BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9710_g2_i1 len=958 path=[2496:0-957]

Length=958
                                                                      Score     E

ref|XP_009619384.1|  PREDICTED: FERM domain-containing protein C        224   1e-65   
ref|XP_009788508.1|  PREDICTED: ESF1 homolog                            220   4e-64   
emb|CDP21813.1|  unnamed protein product                                201   2e-57   
ref|XP_002528638.1|  conserved hypothetical protein                     203   3e-57   Ricinus communis
ref|XP_011012418.1|  PREDICTED: uncharacterized protein LOC105116670    197   5e-55   
gb|KDO61000.1|  hypothetical protein CISIN_1g011207mg                   197   8e-55   
ref|XP_006341187.1|  PREDICTED: nucleomorphin-like                      196   1e-54   
ref|XP_011094441.1|  PREDICTED: uncharacterized protein LOC105174138    193   2e-53   
ref|XP_007027578.1|  Sequence-specific DNA binding transcription ...    191   1e-52   
ref|XP_006481922.1|  PREDICTED: probable serine/threonine-protein...    190   2e-52   
ref|XP_004172887.1|  PREDICTED: uncharacterized LOC101222223            189   2e-52   
ref|XP_006481921.1|  PREDICTED: probable serine/threonine-protein...    190   3e-52   
ref|XP_002277851.3|  PREDICTED: stress response protein NST1            190   3e-52   Vitis vinifera
ref|XP_004138003.1|  PREDICTED: uncharacterized protein LOC101222223    189   3e-52   
ref|XP_007027577.1|  Sequence-specific DNA binding transcription ...    191   3e-52   
dbj|BAO45883.1|  SHOOT2 protein                                         189   4e-52   
ref|XP_008442785.1|  PREDICTED: ESF1 homolog                            189   4e-52   
ref|XP_006430334.1|  hypothetical protein CICLE_v10013486mg             191   6e-52   
ref|XP_011101476.1|  PREDICTED: uncharacterized protein LOC105179522    185   8e-51   
ref|XP_010325945.1|  PREDICTED: putative DNA helicase INO80             186   1e-50   
ref|XP_008241327.1|  PREDICTED: uncharacterized protein LOC103339760    181   6e-49   
ref|XP_007162836.1|  hypothetical protein PHAVU_001G185100g             178   4e-48   
ref|XP_007202030.1|  hypothetical protein PRUPE_ppa005148mg             179   4e-48   
ref|XP_006604609.1|  PREDICTED: uncharacterized protein DDB_G0290...    176   2e-47   
ref|XP_006604608.1|  PREDICTED: uncharacterized protein DDB_G0290...    174   9e-47   
ref|XP_009334880.1|  PREDICTED: uncharacterized protein LOC103927663    174   2e-46   
gb|KHN02271.1|  hypothetical protein glysoja_002295                     173   4e-46   
ref|XP_003542565.1|  PREDICTED: putative mediator of RNA polymera...    172   1e-45   
ref|XP_006594181.1|  PREDICTED: putative mediator of RNA polymera...    172   1e-45   
ref|XP_006407612.1|  hypothetical protein EUTSA_v10020795mg             169   6e-45   
emb|CBI30220.3|  unnamed protein product                                168   1e-44   
ref|XP_009135031.1|  PREDICTED: trihelix transcription factor GT-...    165   2e-43   
ref|XP_010486586.1|  PREDICTED: uncharacterized protein LOC104764701    164   5e-43   
ref|XP_010543479.1|  PREDICTED: trihelix transcription factor GTL...    163   2e-42   
ref|XP_010543481.1|  PREDICTED: trihelix transcription factor GTL...    163   2e-42   
ref|XP_010278270.1|  PREDICTED: putative DNA helicase INO80             162   4e-42   
ref|XP_010480164.1|  PREDICTED: uncharacterized protein LOC104758866    161   7e-42   
ref|XP_010464664.1|  PREDICTED: trihelix transcription factor GTL...    160   2e-41   
gb|AAF04419.1|AC010927_12  unknown protein                              158   8e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187615.2|  sequence-specific DNA binding transcription factor    158   8e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299896.1|  hypothetical protein CARUB_v10016104mg             154   2e-39   
ref|XP_002884773.1|  hypothetical protein ARALYDRAFT_478332             149   1e-37   
gb|KDP29238.1|  hypothetical protein JCGZ_16627                         145   4e-36   
ref|XP_006851780.1|  hypothetical protein AMTR_s00040p00233180          143   3e-35   
ref|XP_009355179.1|  PREDICTED: myb/SANT-like DNA-binding domain-...    140   2e-34   
ref|XP_008367432.1|  PREDICTED: uncharacterized protein LOC103431060    138   2e-33   
ref|XP_008387330.1|  PREDICTED: uncharacterized protein LOC103449787    135   2e-32   
gb|KHN48204.1|  hypothetical protein glysoja_007873                     132   7e-32   
ref|XP_006381332.1|  hypothetical protein POPTR_0006s11870g             131   5e-31   
ref|XP_004486957.1|  PREDICTED: uncharacterized protein LOC101493...    130   5e-31   
ref|XP_011018864.1|  PREDICTED: 46 kDa FK506-binding nuclear prot...    131   6e-31   
ref|XP_004486956.1|  PREDICTED: uncharacterized protein LOC101493...    130   1e-30   
ref|XP_009404390.1|  PREDICTED: uncharacterized protein LOC103987728    130   1e-30   
ref|XP_007145268.1|  hypothetical protein PHAVU_007G224600g             129   2e-30   
ref|XP_004494130.1|  PREDICTED: ABC transporter F family member 4...    129   3e-30   
ref|XP_004303047.1|  PREDICTED: uncharacterized protein LOC101312168    129   4e-30   
ref|XP_004291801.1|  PREDICTED: uncharacterized protein LOC101300312    128   4e-30   
ref|NP_001235465.1|  SHOOT2 protein                                     127   6e-30   
ref|XP_010909118.1|  PREDICTED: putative DNA helicase INO80             129   6e-30   
gb|KEH24098.1|  Myb/SANT-like DNA-binding domain protein                127   7e-30   
ref|XP_010246931.1|  PREDICTED: uncharacterized protein LOC104590097    127   9e-30   
gb|KHN45698.1|  hypothetical protein glysoja_036847                     127   1e-29   
ref|NP_001242801.1|  uncharacterized protein LOC100808934               127   1e-29   
gb|KHN18717.1|  hypothetical protein glysoja_021468                     127   1e-29   
ref|XP_003590397.1|  hypothetical protein MTR_1g061640                  127   2e-29   
ref|XP_010103346.1|  hypothetical protein L484_002280                   126   2e-29   
ref|XP_010243252.1|  PREDICTED: uncharacterized protein LOC104587365    126   3e-29   
ref|XP_009421497.1|  PREDICTED: uncharacterized protein LOC104001043    127   3e-29   
emb|CDY68207.1|  BnaCnng58050D                                          124   3e-29   
ref|XP_009375065.1|  PREDICTED: uncharacterized protein LOC103963911    126   3e-29   
ref|XP_010683922.1|  PREDICTED: AF4/FMR2 family member 4                126   3e-29   
gb|EYU41556.1|  hypothetical protein MIMGU_mgv1a006561mg                123   2e-28   
ref|XP_004497590.1|  PREDICTED: putative mediator of RNA polymera...    123   3e-28   
ref|XP_008777881.1|  PREDICTED: la-related protein CG11505-like         123   6e-28   
ref|XP_009390139.1|  PREDICTED: uncharacterized protein LOC103976598    122   1e-27   
ref|XP_008778516.1|  PREDICTED: uncharacterized protein LOC103698298    120   6e-27   
ref|XP_010912197.1|  PREDICTED: la-related protein CG11505-like         119   8e-27   
ref|XP_009146876.1|  PREDICTED: uncharacterized protein LOC103870494    118   1e-26   
emb|CDY60160.1|  BnaAnng16550D                                          118   1e-26   
ref|XP_006373929.1|  hypothetical protein POPTR_0016s11010g             117   1e-26   
emb|CDY00901.1|  BnaC05g42990D                                          117   2e-26   
ref|XP_010554911.1|  PREDICTED: uncharacterized protein LOC104824502    117   3e-26   
ref|XP_003597439.1|  hypothetical protein MTR_2g098080                  117   4e-26   
gb|KFK38386.1|  hypothetical protein AALP_AA3G106800                    115   8e-26   
ref|XP_004971771.1|  PREDICTED: uncharacterized protein LOC101752474    112   2e-24   
ref|XP_002455555.1|  hypothetical protein SORBIDRAFT_03g013050          111   7e-24   Sorghum bicolor [broomcorn]
gb|AAX95104.1|  expressed protein                                       109   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EAY80056.1|  hypothetical protein OsI_35222                          109   2e-23   Oryza sativa Indica Group [Indian rice]
tpg|DAA54425.1|  TPA: hypothetical protein ZEAMMB73_872770              109   2e-23   
ref|XP_008655870.1|  PREDICTED: uncharacterized protein LOC103635104    109   2e-23   
ref|XP_008673999.1|  PREDICTED: uncharacterized protein LOC103650125    109   3e-23   
ref|XP_006662760.1|  PREDICTED: uncharacterized protein LOC102703623    108   3e-23   
ref|NP_001065831.1|  Os11g0163500                                       108   4e-23   Oryza sativa Japonica Group [Japonica rice]
emb|CDM81776.1|  unnamed protein product                                109   4e-23   
ref|XP_008781414.1|  PREDICTED: uncharacterized protein LOC103701...    106   1e-22   
ref|XP_008781412.1|  PREDICTED: uncharacterized protein LOC103701...    106   2e-22   
ref|XP_002513474.1|  transcription factor, putative                     105   3e-22   Ricinus communis
ref|XP_009420589.1|  PREDICTED: uncharacterized protein LOC104000302    105   4e-22   
ref|XP_010930979.1|  PREDICTED: uncharacterized protein LOC105052003    105   4e-22   
dbj|BAB62605.1|  hypothetical protein                                   106   4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565719.1|  PREDICTED: uncharacterized protein LOC100835008    103   2e-21   
ref|NP_001066231.1|  Os12g0163500                                       103   2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EAY82367.1|  hypothetical protein OsI_37579                          103   2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_009387998.1|  PREDICTED: uncharacterized protein LOC103974835    102   3e-21   
gb|KDP43003.1|  hypothetical protein JCGZ_25189                         102   3e-21   
ref|XP_006663843.1|  PREDICTED: uncharacterized protein LOC102711...    102   3e-21   
gb|EMS64901.1|  hypothetical protein TRIUR3_28119                       102   3e-21   
gb|EMT20023.1|  hypothetical protein F775_31990                         102   3e-21   
dbj|BAJ98139.1|  predicted protein                                      102   5e-21   
ref|XP_003542048.1|  PREDICTED: uncharacterized protein LOC100801014    102   5e-21   
gb|KHN30131.1|  hypothetical protein glysoja_010509                     102   5e-21   
gb|KHN33341.1|  hypothetical protein glysoja_005383                     102   6e-21   
ref|XP_003547125.1|  PREDICTED: uncharacterized protein LOC100798...    102   6e-21   
ref|XP_007150380.1|  hypothetical protein PHAVU_005G148400g             102   6e-21   
ref|XP_011087824.1|  PREDICTED: uncharacterized protein LOC105169181    101   8e-21   
gb|KDP22075.1|  hypothetical protein JCGZ_25906                         101   8e-21   
ref|XP_009419153.1|  PREDICTED: uncharacterized protein LOC103999...    100   1e-20   
ref|XP_010031815.1|  PREDICTED: uncharacterized protein LOC104421532    101   1e-20   
ref|XP_006850180.1|  hypothetical protein AMTR_s00022p00244920          100   1e-20   
ref|XP_009759483.1|  PREDICTED: uncharacterized protein LOC104212...  99.4    2e-20   
ref|XP_009759481.1|  PREDICTED: uncharacterized protein LOC104212...  99.8    2e-20   
ref|XP_004952693.1|  PREDICTED: stress response protein NST1-like...    100   2e-20   
ref|XP_009759482.1|  PREDICTED: uncharacterized protein LOC104212...  99.8    2e-20   
ref|XP_002449041.1|  hypothetical protein SORBIDRAFT_05g003890          100   2e-20   Sorghum bicolor [broomcorn]
gb|ACR35490.1|  unknown                                               99.4    2e-20   Zea mays [maize]
ref|XP_008449727.1|  PREDICTED: uncharacterized protein LOC103491522    100   2e-20   
emb|CDP19340.1|  unnamed protein product                                100   2e-20   
ref|XP_004142119.1|  PREDICTED: uncharacterized protein LOC101205501    100   3e-20   
ref|XP_009628855.1|  PREDICTED: uncharacterized protein LOC104119138    100   3e-20   
ref|XP_009768464.1|  PREDICTED: uncharacterized protein LOC104219473    100   3e-20   
ref|XP_010235511.1|  PREDICTED: uncharacterized protein LOC100828617  99.8    3e-20   
emb|CBI18199.3|  unnamed protein product                              99.0    3e-20   
ref|XP_010241711.1|  PREDICTED: uncharacterized protein LOC104586241    100   3e-20   
ref|XP_004161693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.8    3e-20   
ref|XP_010652952.1|  PREDICTED: stress response protein nst1-like...    100   3e-20   
ref|XP_006365820.1|  PREDICTED: uncharacterized protein LOC102578195    100   3e-20   
ref|XP_002273284.1|  PREDICTED: stress response protein nst1-like...    100   3e-20   Vitis vinifera
ref|XP_004252856.1|  PREDICTED: uncharacterized protein LOC101246904    100   3e-20   
gb|EMT18117.1|  hypothetical protein F775_19888                       99.8    3e-20   
dbj|BAK02398.1|  predicted protein                                    99.8    4e-20   
gb|EMS59212.1|  hypothetical protein TRIUR3_11128                     99.8    4e-20   
gb|EMS60166.1|  hypothetical protein TRIUR3_08128                     99.8    4e-20   
ref|NP_001143969.1|  uncharacterized protein LOC100276786             99.4    4e-20   Zea mays [maize]
ref|XP_008667671.1|  PREDICTED: uncharacterized protein LOC100276...  99.4    4e-20   
gb|EMT09164.1|  hypothetical protein F775_06500                       99.4    5e-20   
ref|XP_007041596.1|  Uncharacterized protein TCM_006441               99.4    5e-20   
ref|XP_010102326.1|  hypothetical protein L484_015274                 99.4    5e-20   
ref|XP_010069064.1|  PREDICTED: uncharacterized protein LOC104456045  99.4    5e-20   
ref|XP_007212531.1|  hypothetical protein PRUPE_ppa019358mg           99.0    5e-20   
ref|XP_002302181.2|  hypothetical protein POPTR_0002s06930g           99.0    5e-20   Populus trichocarpa [western balsam poplar]
ref|XP_002532431.1|  transcription factor, putative                   99.4    6e-20   Ricinus communis
ref|XP_009413538.1|  PREDICTED: uncharacterized protein LOC103994824  99.0    6e-20   
ref|XP_008227154.1|  PREDICTED: uncharacterized protein LOC103326696  99.4    6e-20   
ref|XP_011042849.1|  PREDICTED: uncharacterized protein LOC105138468  99.0    6e-20   
ref|XP_002266272.1|  PREDICTED: uncharacterized protein LOC100259010  99.0    6e-20   Vitis vinifera
ref|XP_010673612.1|  PREDICTED: uncharacterized protein LOC104889964  98.6    9e-20   
ref|NP_001047068.1|  Os02g0542400                                     97.8    1e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EPS69845.1|  hypothetical protein M569_04922                       96.7    1e-19   
gb|EPS68099.1|  hypothetical protein M569_06676                       95.1    1e-19   
ref|XP_008237585.1|  PREDICTED: uncharacterized protein LOC103336322  98.2    1e-19   
ref|XP_008441519.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  98.2    1e-19   
ref|XP_004160309.1|  PREDICTED: uncharacterized protein LOC101232034  98.2    1e-19   
ref|XP_007200864.1|  hypothetical protein PRUPE_ppa1027145mg          97.8    2e-19   
ref|XP_004140967.1|  PREDICTED: uncharacterized protein LOC101203313  97.8    2e-19   
ref|XP_007014993.1|  Sequence-specific DNA binding transcription ...  97.8    2e-19   
ref|XP_004516631.1|  PREDICTED: uncharacterized protein LOC101514780  97.8    2e-19   
ref|XP_010912425.1|  PREDICTED: uncharacterized protein LOC105038...  97.1    2e-19   
ref|XP_002306694.2|  hypothetical protein POPTR_0005s21390g           97.1    2e-19   Populus trichocarpa [western balsam poplar]
emb|CDM81777.1|  unnamed protein product                              97.8    2e-19   
ref|XP_004978760.1|  PREDICTED: uncharacterized protein LOC101780...  97.1    3e-19   
ref|XP_002441874.1|  hypothetical protein SORBIDRAFT_08g003990        97.4    3e-19   Sorghum bicolor [broomcorn]
ref|XP_010912419.1|  PREDICTED: uncharacterized protein LOC105038...  97.1    3e-19   
ref|XP_007152028.1|  hypothetical protein PHAVU_004G095500g           97.1    3e-19   
gb|ACR37608.1|  unknown                                               95.9    3e-19   Zea mays [maize]
emb|CAN65038.1|  hypothetical protein VITISV_021706                   98.2    3e-19   Vitis vinifera
ref|XP_003577819.1|  PREDICTED: uncharacterized protein LOC100846758  96.7    3e-19   
ref|NP_001142484.1|  uncharacterized protein LOC100274707             97.1    3e-19   Zea mays [maize]
ref|XP_011044210.1|  PREDICTED: uncharacterized protein LOC105139468  97.1    3e-19   
ref|XP_006854556.1|  hypothetical protein AMTR_s00030p00089780        96.7    3e-19   
ref|XP_002299233.2|  hypothetical protein POPTR_0001s05670g           96.7    3e-19   Populus trichocarpa [western balsam poplar]
gb|EYU36855.1|  hypothetical protein MIMGU_mgv1a007325mg              96.7    3e-19   
ref|XP_008677662.1|  PREDICTED: hypothetical protein isoform X2       96.7    4e-19   
gb|EMT16151.1|  hypothetical protein F775_16013                       97.4    4e-19   
ref|NP_001170044.1|  hypothetical protein                             96.7    4e-19   Zea mays [maize]
ref|XP_003578873.1|  PREDICTED: uncharacterized protein LOC100835589  96.7    4e-19   
ref|NP_001168394.1|  hypothetical protein                             96.3    4e-19   Zea mays [maize]
ref|XP_010539734.1|  PREDICTED: uncharacterized protein LOC104813711  96.3    5e-19   
ref|XP_003556151.1|  PREDICTED: uncharacterized protein LOC100816474  96.7    5e-19   
ref|XP_010087144.1|  hypothetical protein L484_007394                 97.1    5e-19   
ref|XP_009403682.1|  PREDICTED: uncharacterized protein LOC103987182  95.9    5e-19   
ref|XP_003536428.1|  PREDICTED: uncharacterized protein LOC100812134  96.3    5e-19   
ref|XP_010536037.1|  PREDICTED: pescadillo homolog                    95.1    6e-19   
ref|XP_006473052.1|  PREDICTED: uncharacterized protein LOC102612442  96.3    6e-19   
ref|XP_006434454.1|  hypothetical protein CICLE_v10001142mg           96.3    7e-19   
ref|XP_009799707.1|  PREDICTED: uncharacterized protein LOC104245...  95.5    8e-19   
ref|XP_002303892.2|  hypothetical protein POPTR_0003s20370g           95.9    8e-19   Populus trichocarpa [western balsam poplar]
ref|XP_008661671.1|  PREDICTED: uncharacterized protein LOC100274...  95.9    8e-19   
ref|XP_008645772.1|  PREDICTED: uncharacterized protein LOC103627263  95.5    8e-19   
gb|AIB05441.1|  trihelix transcription factor                         95.5    8e-19   
ref|XP_002532438.1|  transcription factor, putative                   95.9    9e-19   Ricinus communis
ref|XP_008359235.1|  PREDICTED: myb/SANT-like DNA-binding domain-...  95.5    9e-19   
ref|XP_006446099.1|  hypothetical protein CICLE_v10015189mg           95.9    9e-19   
ref|XP_009590354.1|  PREDICTED: uncharacterized protein LOC104087...  95.1    9e-19   
ref|XP_009799706.1|  PREDICTED: uncharacterized protein LOC104245...  95.5    1e-18   
ref|XP_011101525.1|  PREDICTED: uncharacterized protein LOC105179584  95.5    1e-18   
ref|XP_008381817.1|  PREDICTED: uncharacterized protein LOC103444641  95.5    1e-18   
ref|XP_007019480.1|  Sequence-specific DNA binding transcription ...  95.5    1e-18   
ref|XP_009590352.1|  PREDICTED: uncharacterized protein LOC104087...  95.1    1e-18   
ref|XP_004290521.1|  PREDICTED: uncharacterized protein LOC101296534  95.5    1e-18   
gb|KEH25858.1|  transcription factor                                  95.9    1e-18   
emb|CDP10040.1|  unnamed protein product                              95.1    1e-18   
ref|XP_004496474.1|  PREDICTED: uncharacterized protein LOC101496200  95.1    2e-18   
gb|EYU17440.1|  hypothetical protein MIMGU_mgv1a018390mg              94.4    2e-18   
gb|EEC75720.1|  hypothetical protein OsI_12570                        92.8    2e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_011074759.1|  PREDICTED: uncharacterized protein LOC105159405  94.7    2e-18   
ref|XP_007041597.1|  Sequence-specific DNA binding transcription ...  92.8    2e-18   
ref|XP_003637928.1|  hypothetical protein MTR_113s0014                95.5    2e-18   
ref|XP_009798604.1|  PREDICTED: uncharacterized protein LOC104244...  94.0    2e-18   
ref|XP_008798770.1|  PREDICTED: uncharacterized protein LOC103713568  94.4    2e-18   
ref|XP_006647354.1|  PREDICTED: uncharacterized protein LOC102710758  94.4    2e-18   
ref|XP_011037822.1|  PREDICTED: uncharacterized protein LOC105134921  94.7    2e-18   
ref|XP_009619561.1|  PREDICTED: uncharacterized protein LOC104111549  93.6    3e-18   
ref|XP_002452238.1|  hypothetical protein SORBIDRAFT_04g022190        94.0    3e-18   Sorghum bicolor [broomcorn]
ref|XP_009798603.1|  PREDICTED: uncharacterized protein LOC104244...  93.6    3e-18   
ref|XP_010315046.1|  PREDICTED: uncharacterized protein LOC101264265  93.2    4e-18   
ref|XP_002887659.1|  hypothetical protein ARALYDRAFT_895568           93.2    4e-18   
ref|XP_007143533.1|  hypothetical protein PHAVU_007G079600g           94.0    4e-18   
ref|XP_006351819.1|  PREDICTED: uncharacterized protein LOC102593...  93.2    5e-18   
ref|XP_004977312.1|  PREDICTED: uncharacterized protein LOC101777...  93.6    5e-18   
ref|XP_010063872.1|  PREDICTED: uncharacterized protein LOC104450863  93.6    6e-18   
ref|XP_008352771.1|  PREDICTED: uncharacterized protein LOC103416293  93.2    6e-18   
ref|XP_009343631.1|  PREDICTED: uncharacterized protein LOC103935584  93.2    6e-18   
ref|XP_009368513.1|  PREDICTED: uncharacterized protein LOC103958014  93.2    7e-18   
ref|XP_010911980.1|  PREDICTED: uncharacterized protein LOC105038013  92.8    9e-18   
ref|XP_009149597.1|  PREDICTED: uncharacterized protein LOC103872912  92.4    9e-18   
ref|XP_008784156.1|  PREDICTED: uncharacterized protein LOC103703173  92.4    9e-18   
ref|NP_177813.1|  uncharacterized protein                             92.0    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890430.1|  hypothetical protein ARALYDRAFT_472358           92.4    1e-17   
ref|XP_006470590.1|  PREDICTED: uncharacterized protein LOC102621...  92.0    1e-17   
ref|XP_006416324.1|  hypothetical protein EUTSA_v10010018mg           92.4    1e-17   
ref|XP_010498570.1|  PREDICTED: uncharacterized protein LOC104776239  92.4    1e-17   
ref|XP_010459826.1|  PREDICTED: uncharacterized protein LOC104740815  92.4    1e-17   
gb|KDO61296.1|  hypothetical protein CISIN_1g013250mg                 92.4    1e-17   
ref|XP_004952514.1|  PREDICTED: uncharacterized protein LOC101760040  91.7    1e-17   
ref|NP_564136.1|  sequence-specific DNA binding transcription factor  92.4    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KDP42996.1|  hypothetical protein JCGZ_25182                       92.4    1e-17   
ref|XP_006470589.1|  PREDICTED: uncharacterized protein LOC102621...  92.4    1e-17   
ref|XP_006307528.1|  hypothetical protein CARUB_v10009151mg           92.4    1e-17   
ref|XP_010477381.1|  PREDICTED: uncharacterized protein LOC104756477  92.4    1e-17   
gb|KCW89277.1|  hypothetical protein EUGRSUZ_A015722                  90.1    2e-17   
ref|XP_010927385.1|  PREDICTED: uncharacterized protein LOC105049444  92.0    2e-17   
ref|XP_010928865.1|  PREDICTED: uncharacterized protein LOC105050511  91.3    3e-17   
ref|XP_008782906.1|  PREDICTED: uncharacterized protein LOC103702316  90.9    3e-17   
ref|XP_010537278.1|  PREDICTED: uncharacterized protein LOC104812040  90.9    4e-17   
ref|XP_009110193.1|  PREDICTED: uncharacterized protein LOC103835755  90.1    4e-17   
ref|XP_008785828.1|  PREDICTED: uncharacterized protein LOC103704355  90.5    5e-17   
ref|XP_008793938.1|  PREDICTED: uncharacterized protein LOC103710100  90.5    6e-17   
ref|XP_003592116.1|  hypothetical protein MTR_1g098920                89.7    1e-16   
emb|CDY33674.1|  BnaC08g19740D                                        89.0    1e-16   
ref|XP_009104656.1|  PREDICTED: uncharacterized protein LOC103830595  88.2    1e-16   
ref|XP_011087822.1|  PREDICTED: uncharacterized protein LOC105169180  88.6    2e-16   
emb|CDX85976.1|  BnaC06g21580D                                        87.8    2e-16   
ref|XP_010913949.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  89.0    2e-16   
gb|KHN41268.1|  hypothetical protein glysoja_030106                   87.8    5e-16   
ref|XP_003548116.1|  PREDICTED: uncharacterized protein LOC100805861  87.8    5e-16   
ref|XP_006495058.1|  PREDICTED: uncharacterized protein LOC102628040  86.7    7e-16   
gb|KFK42100.1|  hypothetical protein AALP_AA2G210700                  85.9    7e-16   
ref|XP_004955374.1|  PREDICTED: uncharacterized protein LOC101757...  86.3    1e-15   
ref|XP_006432257.1|  hypothetical protein CICLE_v10003451mg           85.9    1e-15   
gb|EYU18523.1|  hypothetical protein MIMGU_mgv1a008487mg              80.5    1e-13   
ref|XP_010236469.1|  PREDICTED: uncharacterized protein LOC104584057  79.0    5e-13   
emb|CBI16400.3|  unnamed protein product                              65.5    3e-09   
ref|XP_009419154.1|  PREDICTED: uncharacterized protein LOC103999...  63.9    4e-08   
gb|ABR16743.1|  unknown                                               61.2    4e-08   Picea sitchensis
emb|CDY22475.1|  BnaC03g22850D                                        58.9    4e-07   
emb|CDY29471.1|  BnaA06g14990D                                        58.2    6e-07   
emb|CDY04607.1|  BnaC05g16450D                                        58.2    6e-07   
emb|CDX96599.1|  BnaA08g21420D                                        59.7    8e-07   
emb|CDX74005.1|  BnaA03g30420D                                        56.6    1e-06   
ref|NP_001042884.1|  Os01g0318400                                     52.8    5e-05   



>ref|XP_009619384.1| PREDICTED: FERM domain-containing protein C [Nicotiana tomentosiformis]
Length=447

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 202/301 (67%), Gaps = 30/301 (10%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LLET+D LS KMKEE KKLLNSKHLFFREM
Sbjct  148  DKFNDLNKRYKRVNDILGKGTACRVVENQNLLETMDHLSSKMKEEVKKLLNSKHLFFREM  207

Query  179  CAYHNs----cahggasgstaadggsDPTSQANNPHQK-CMHSSENVRIGPNL--APAEV  337
            CAYHNS     + GG+ GS      ++   +AN+  QK C+HSSEN RIG +L   P   
Sbjct  208  CAYHNSCGHNTSTGGSGGSGNVQLSTEVAVEANSQAQKRCLHSSENARIGVHLEEGPKMA  267

Query  338  EGLKI---------------------dndddedsdddeeyeedeedssideKSRKKARKT  454
            +G  +                     +        D       E+D  +DE+SRK  RK+
Sbjct  268  KGKSVDDDQEDDEEDEDEDEEEDDDDEVSGARGGHDHHHNHSHEDDDDMDERSRKSQRKS  327

Query  455  ESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVK  634
             S S MV QQLS EL N+ +D  RS VEKR+W+K R +QL+EQ V Y  +A EL+KQR+K
Sbjct  328  GSLSPMV-QQLSTELANVIQDGGRSSVEKRQWLKTRMVQLKEQHVSYLCQAFELQKQRLK  386

Query  635  WekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSDPSSVT  814
            WEKF+SKKEREME+EK++N+RKK+EN+RMVLLL QKELEL +   HQ   NR SDPSSVT
Sbjct  387  WEKFTSKKEREMEKEKLINERKKMENERMVLLLRQKELELLDFHQHQNHNNRNSDPSSVT  446

Query  815  G  817
            G
Sbjct  447  G  447



>ref|XP_009788508.1| PREDICTED: ESF1 homolog [Nicotiana sylvestris]
Length=424

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 201/302 (67%), Gaps = 36/302 (12%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LLET+D L+ KMKEE KKLLNSKHLFFREM
Sbjct  129  DKFNDLNKRYKRVNDILGKGTACRVVENQNLLETMDHLTQKMKEEVKKLLNSKHLFFREM  188

Query  179  CAYHNs-----cahggasgstaadggsDPTSQANNPHQK-CMHSSENVRIGPNLAPAEVE  340
            CAYHNS      + GG S        ++   +AN+  QK C+HSSEN RI  +L     E
Sbjct  189  CAYHNSCGHNNTSTGGGSDIGNVQLSTEMAVEANSQAQKRCLHSSENARIEVHLE----E  244

Query  341  GLKIdnddd-----------------------edsdddeeyeedeedssideKSRKKARK  451
            G K+                              +   + +   E D  +DE+SRK+ RK
Sbjct  245  GTKMAKGKSVDDDQEDDDEDEDEDEEDDEDELSGARGHDNHHSHEYDDDMDERSRKRQRK  304

Query  452  TESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRV  631
            + S S MV QQLS EL N+ +D  RS +EKR+W+K R +QLEEQ V Y  +A EL+KQR+
Sbjct  305  SGSLSPMV-QQLSSELANVIQDGGRSSIEKRQWLKTRMVQLEEQHVGYLCQAFELQKQRL  363

Query  632  KWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSDPSSV  811
            KWEKF+SKKEREME+EK++N+RKKLEN+RMVLLL QKELEL +  H   ++NR SDPSSV
Sbjct  364  KWEKFTSKKEREMEKEKLINERKKLENERMVLLLRQKELELLD-FHQHQNHNRNSDPSSV  422

Query  812  TG  817
            TG
Sbjct  423  TG  424



>emb|CDP21813.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 203/310 (65%), Gaps = 40/310 (13%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ+LL+T+D LS K+KEE KKLL+SKHLFFREM
Sbjct  76   DKFNDLNKRYKRVNDILGKGTACRVVENQSLLDTMDHLSAKIKEEVKKLLSSKHLFFREM  135

Query  179  CAYHNs--------cahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAE  334
            CAYHNS         +  GA+  +   GG +P+SQ     Q+C+H+SEN    PNLA  E
Sbjct  136  CAYHNSCGHGGTGGASSSGAAQQSTEVGGVEPSSQMQQ-QQRCLHTSENASTPPNLARCE  194

Query  335  VEGLKIdndddedsdddeeyeedeedssideK-------------------------SRK  439
            VEG K       + D+DE+ ++D+++   ++                          +RK
Sbjct  195  VEGSKTTKGRSFEEDNDEDDDDDDDEEEYEDDVVEGGGSGCEHGHPEEDDDTPDERCARK  254

Query  440  KARKTESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELE  619
            + RK    S +V QQ+S EL  + +D +++  EKR+WIK R +QLEE+ V ++SEA ELE
Sbjct  255  RRRKGIFLSPLV-QQMSTELVKVLQDESKNSAEKRQWIKNRLLQLEERHVGFQSEAFELE  313

Query  620  KQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL----KNGVHHQASYN  787
            KQR+KW KFSSKKEREMER+K+ N R +LEN+RM+LL+ QKELEL    +     Q   +
Sbjct  314  KQRLKWVKFSSKKEREMERDKLSNDRLRLENERMMLLIRQKELELLDVYQQQQQQQHQSS  373

Query  788  RTSDPSSVTG  817
            R SDPSS+TG
Sbjct  374  RKSDPSSITG  383



>ref|XP_002528638.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33741.1| conserved hypothetical protein [Ricinus communis]
Length=499

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 197/319 (62%), Gaps = 48/319 (15%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTACKVVENQ+LLET+DLSPKMKEE KKLLNSKHLFFREMC
Sbjct  182  DKFNDLNKRYKRVNDILGKGTACKVVENQSLLETMDLSPKMKEEVKKLLNSKHLFFREMC  241

Query  182  AYHNscahggasgstaadggsDPTSQANNP---------HQKCMHSSENVRIGPNLAPAE  334
            AYHNSC HG    ++  +   +  +  ++P          Q+C HS+EN +    ++  E
Sbjct  242  AYHNSCGHGSNGIASGTNHSPEIATDQSHPQHQQASHLQQQRCSHSTENAQFA-TISRTE  300

Query  335  VEGLKIdn---------------------------dddedsdddeeyeedeedssideKS  433
             EG K+                             +  E +   +     E++   +EK 
Sbjct  301  AEGSKMAKRIRNEEDDEEDYDESDEDEDEDEDDEDEAIEGTSRSQNRHGHEDEEDHEEKP  360

Query  434  RKKARKT--ESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEA  607
             +K ++T   S S+ ++QQL+ EL  + +D  +SP EK+ W+K R+MQLEEQ++ Y+ +A
Sbjct  361  AQKRQRTGVHSLSSSLMQQLNSELMGVIQDGAKSPWEKKHWMKLRSMQLEEQQLSYQCQA  420

Query  608  LELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL---------KN  760
             ELEKQR+KW KFSSKKEREME+ K+ N R+ LE++RMVLL+ QKELEL          +
Sbjct  421  FELEKQRLKWVKFSSKKEREMEKAKLDNDRRMLESERMVLLIRQKELELLDLQQQQHHHH  480

Query  761  GVHHQASYNRTSDPSSVTG  817
                Q S N+  DPSS+TG
Sbjct  481  HQQQQLSSNKRGDPSSITG  499



>ref|XP_011012418.1| PREDICTED: uncharacterized protein LOC105116670 [Populus euphratica]
Length=466

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 145/310 (47%), Positives = 199/310 (64%), Gaps = 39/310 (13%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LL+T+DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  158  DKFNDLNKRYKRVNDILGKGTACRVVENQNLLDTMDLSPKMKEEVRKLLNSKHLFFREMC  217

Query  182  AYHNscahgga----sgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLK  349
            AYHNSC H  +      + + +  + P+      HQ+C HS+EN ++  N +  E EG K
Sbjct  218  AYHNSCGHAPSWVAFGSNHSPEMATGPSHAHAQQHQRCSHSTENAQVVTN-SRTETEGSK  276

Query  350  Idndd------------------------------dedsdddeeyeedeedssideKSRK  439
            +                                  + +S     + + +ED+  ++ SRK
Sbjct  277  MAKRAINEEDEVDDDDDDDSDNDEDDYEDDGDEAIEGNSRHQSGHGQGDEDNRDEKSSRK  336

Query  440  KARK-TESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALEL  616
            + RK   S ++ ++QQL+GE+ N+ +D  +S  EK+ W++ R MQLEEQ+V Y+ +A +L
Sbjct  337  RPRKDVFSATSSLMQQLNGEIMNVLQDVAKSSWEKKHWMRLRLMQLEEQQVSYQCQAYDL  396

Query  617  EKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASY---N  787
            EKQR+KW KFSSKKEREMER K+ N+R++LEN+RMVL++ +KELEL +  H Q      N
Sbjct  397  EKQRLKWVKFSSKKEREMERAKLENERRRLENERMVLIVRKKELELLDTQHQQQQQLPSN  456

Query  788  RTSDPSSVTG  817
            + SD SS+ G
Sbjct  457  KRSDTSSIAG  466



>gb|KDO61000.1| hypothetical protein CISIN_1g011207mg [Citrus sinensis]
Length=491

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 146/306 (48%), Positives = 199/306 (65%), Gaps = 37/306 (12%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVN+I+GKGTAC+VVENQ+LLET+DL+PKMKEE KKLLNSKHLFF+EMC
Sbjct  189  DKFNDLNKRYKRVNEILGKGTACRVVENQSLLETMDLTPKMKEEVKKLLNSKHLFFKEMC  248

Query  182  AY-----HNscahggasgstaadggsDPT-SQANNPHQKCMHSSENVRIGPNLAPAEVEG  343
            AY     H S   G    + + +  ++P+  Q      +C+HSSE  ++G N   AE+EG
Sbjct  249  AYHSTCGHGSGTGGTPGANHSPEVATEPSVVQQQQAQHRCLHSSETSQLGANSNRAEMEG  308

Query  344  LKIdndddedsdddeeyeedeedssideK-------------------------SRKKAR  448
             K+     ++ DD EE E D++D   D+                          SRK+ R
Sbjct  309  TKLVKVGSDEEDDVEEDESDDDDYDDDDDEAVGNSRGQQNGHGQEDEDENDEKLSRKRQR  368

Query  449  KTE---SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELE  619
            +       S MVL QL  E+ N+ +D  ++  EK++W+K + +QLEEQ++ Y+ +A ELE
Sbjct  369  QGSLPVPVSPMVL-QLRCEVSNVIQDGAKTSWEKKQWMKMKLLQLEEQQISYQYQAFELE  427

Query  620  KQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSD  799
            KQR+KW KFSSKKEREME+ K++N+R++LEN+RM+L L QK+ EL +    Q S N+ SD
Sbjct  428  KQRLKWVKFSSKKEREMEKAKLVNERRRLENERMLLALRQKDYELLD--QQQHSSNKRSD  485

Query  800  PSSVTG  817
            PSS+TG
Sbjct  486  PSSITG  491



>ref|XP_006341187.1| PREDICTED: nucleomorphin-like [Solanum tuberosum]
Length=482

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 161/304 (53%), Positives = 203/304 (67%), Gaps = 37/304 (12%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGT+C+VVENQ LL+T+D LSPKMKEE KKLLNSKHLFFREM
Sbjct  184  DKFNDLNKRYKRVNDILGKGTSCRVVENQKLLDTMDHLSPKMKEEVKKLLNSKHLFFREM  243

Query  179  CAYHNs-cahggasgstaadggsDPTSQANNP--HQKCMHSSENV--RIGPNLAPAEVEG  343
            CAYHNS   +GG  G  +  G ++P +  N     Q+C+HSSEN   RIG +L    VEG
Sbjct  244  CAYHNSCGHNGGTGGGASGSGVANPQTHQNQSEQQQRCLHSSENTNARIGASL----VEG  299

Query  344  LKIdndd-------------------------dedsdddeeyeedeedssideKSRKKAR  448
             K+                                   D +++   E+    E+SRK+ R
Sbjct  300  PKMPKGASGENDEENEDEEDEDEDEEDDDDEVSGARGHDHDHQSHGEEDDDMERSRKRQR  359

Query  449  KTESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQR  628
            K  + S+ ++QQLS EL N+ +D  RSP+EK +W+K + +QLEEQ V Y  +A EL+KQR
Sbjct  360  KLGA-SSPIVQQLSTELANVVQDRGRSPLEKMQWMKTKMIQLEEQHVSYLCQAFELQKQR  418

Query  629  VKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKN-GVHHQASYNRTSDPS  805
            +KW+KF SKKEREMER+K++N+RKKLEN+RMVLLL QKELEL +   HH  + NR SDPS
Sbjct  419  LKWKKFISKKEREMERDKLINERKKLENERMVLLLKQKELELLDYHQHHPNNNNRNSDPS  478

Query  806  SVTG  817
            SVTG
Sbjct  479  SVTG  482



>ref|XP_011094441.1| PREDICTED: uncharacterized protein LOC105174138 [Sesamum indicum]
Length=482

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 142/309 (46%), Positives = 191/309 (62%), Gaps = 41/309 (13%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKG +C+VVENQ LL+T+D L+PKMKEE KKLLNSKHLFFREM
Sbjct  178  DKFNDLNKRYKRVNDILGKGISCRVVENQRLLDTMDHLTPKMKEEVKKLLNSKHLFFREM  237

Query  179  CAYHNscahggasgstaadggsD------PTSQANNPHQKCMHSSENVRIGPNLAPAEVE  340
            CAYHNSC HG  +  + A G           +Q +   Q+C+HSSEN  +  NL   E E
Sbjct  238  CAYHNSCGHGSGASGSGAAGFPGAAAEAVSQTQLHLQQQRCLHSSENAPVVANLNRGENE  297

Query  341  GLKIdnddd------------------------------edsdddeeyeedeedssideK  430
            G K+                                          ++  ++E +  +++
Sbjct  298  GSKLVKGVSGENDDDQDDDDDQDDQDNDDQDEDGDDEVIGAGSRIHDHGHEDESNDTNDR  357

Query  431  SRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEAL  610
            S  K  +  ++ + ++QQL  E+  + +D  +SP EKR W+K + M LEEQRV  + ++ 
Sbjct  358  SSTKRLRRGTFHSPLIQQLDAEIMTVVQDGAKSPFEKRLWMKKKLMGLEEQRVGIQCQSF  417

Query  611  ELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNR  790
            ELEKQR+KW KF +KKERE+EREK+ N+R +LEN+RM+LL+ QKELEL +  HH  S N+
Sbjct  418  ELEKQRLKWLKFRTKKEREIEREKLRNERLQLENERMMLLIRQKELELLD--HH--SPNK  473

Query  791  TSDPSSVTG  817
             SDPSS+TG
Sbjct  474  KSDPSSITG  482



>ref|XP_007027578.1| Sequence-specific DNA binding transcription factors isoform 2 
[Theobroma cacao]
 gb|EOY08080.1| Sequence-specific DNA binding transcription factors isoform 2 
[Theobroma cacao]
Length=474

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 199/308 (65%), Gaps = 37/308 (12%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+G+GTACKVVENQ+LL+T+DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  168  DKFNDLNKRYKRVNDILGRGTACKVVENQSLLDTMDLSPKMKEEVRKLLNSKHLFFREMC  227

Query  182  AYHNscahggasgstaadggsDPTSQAN------NPHQKCMHSSENVRIGPNLAPAEVEG  343
            AYHNSC HG  +G++ A+   +  ++ +         Q+C+HSS+  +I  N    + E 
Sbjct  228  AYHNSCGHGATAGASGANHSPEVATETSQIQHQQAQQQRCLHSSDTAQIAGNSGGMDPEA  287

Query  344  LKIdn------------------------dddedsdddeeyeedeedssideKSRKKARK  451
            LK+                            D  S     + +++++ + ++ +RK+ RK
Sbjct  288  LKLTKVGSDEEDDDDDDDSDDDEDEDDEEAMDGHSRGHNGHGQEDDEDNDEKSTRKRPRK  347

Query  452  TESWSAM--VLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQ  625
                 ++  ++QQLS E  N+ +D ++S  EK  W+K R MQLEEQ+V Y+ +A ELEKQ
Sbjct  348  GALAMSLSPLMQQLSCEAVNVIQDGSKSVWEK-HWMKMRLMQLEEQQVSYQYQAFELEKQ  406

Query  626  RVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKN----GVHHQASYNRT  793
            R+KW KFS KKEREME+ K+ N+R++LEN+RMVLL+ QKELEL +        Q S ++ 
Sbjct  407  RLKWVKFSGKKEREMEKAKLENERRRLENERMVLLVRQKELELVDLQHQHQPQQHSSSKR  466

Query  794  SDPSSVTG  817
             DPSS+TG
Sbjct  467  GDPSSITG  474



>ref|XP_006481922.1| PREDICTED: probable serine/threonine-protein kinase mps1-like 
isoform X2 [Citrus sinensis]
Length=479

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 199/309 (64%), Gaps = 38/309 (12%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVN+I+GKGTAC+VVENQ+LLET+DL+PKMKEE KKLLNSKHLFF+EMC
Sbjct  172  DKFNDLNKRYKRVNEILGKGTACRVVENQSLLETMDLTPKMKEEVKKLLNSKHLFFKEMC  231

Query  182  AY-----HNscahggasgstaadggsDPT-SQANNPHQKCMHSSENVRIGPNLAPAEVEG  343
            AY     H S   G    + + +  ++P+  Q      +C+HSSE  ++G N   AE+EG
Sbjct  232  AYHSTCGHGSGTGGTPGANHSPEVATEPSVVQQQQAQHRCLHSSETSQLGANSNRAEMEG  291

Query  344  LKIdndddedsdddeeyeedeedssideK-------------------------SRKKAR  448
             K+     ++ DD EE E D++D   D+                          SRK+ R
Sbjct  292  TKLVKVGSDEEDDVEEDESDDDDYDDDDDEAVGNSRGQQNGHGQEDEDENDEKLSRKRQR  351

Query  449  KTE---SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELE  619
            +       S MVL QL  E+ N+ +D  ++  EK++W+K + +QLEEQ++ Y+ +A ELE
Sbjct  352  QGSLPVPVSPMVL-QLRCEVSNVIQDGAKTSWEKKQWMKMKLLQLEEQQISYQYQAFELE  410

Query  620  KQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL---KNGVHHQASYNR  790
            KQR+KW KFSSKKEREME+ K++N+R++LEN+ M+L L QK+ EL   ++    Q S N+
Sbjct  411  KQRLKWVKFSSKKEREMEKAKLVNERRRLENESMLLALRQKDYELLDHQHHHQQQHSSNK  470

Query  791  TSDPSSVTG  817
             SDPSS+TG
Sbjct  471  RSDPSSITG  479



>ref|XP_004172887.1| PREDICTED: uncharacterized LOC101222223 [Cucumis sativus]
Length=439

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 135/284 (48%), Positives = 190/284 (67%), Gaps = 16/284 (6%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTACKVVENQTLL++++L+PK KEE +KLLNSKHLFFREMC
Sbjct  160  DKFNDLNKRYKRVNDILGKGTACKVVENQTLLDSMELTPKTKEEVRKLLNSKHLFFREMC  219

Query  182  AYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLK----  349
            AYHN+C H     S  A        Q     Q C H+++      + + A  EG K    
Sbjct  220  AYHNTCRHSTTHPSPDAATEPSHLPQQQQQQQLCFHATDTTT---SASIAAGEGSKSGDE  276

Query  350  ---IdndddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDS  520
                + +++ + ++++E  E  ++   + +SRK+ARK    +A  +QQLS E+  +  D 
Sbjct  277  EEEEEEEEESEEEEEDEETEGRQEEEEETESRKRARKGGMITA-GMQQLSAEVMGVISDG  335

Query  521  TRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrk  700
             RSP EK++W+K+R +QLEEQ+V ++++A ELEKQR+KW KF SKKER+MER K+ N+++
Sbjct  336  GRSPWEKKQWMKSRLIQLEEQQVSWQTQAFELEKQRLKWVKFRSKKERDMERAKLENEKR  395

Query  701  kLENDRMVLLLHQKELELKN-----GVHHQASYNRTSDPSSVTG  817
             LEN+RM+L++ + EL+L           Q S N+  DPSS+TG
Sbjct  396  MLENERMMLMVKKNELDLMGMQHYQQQQQQHSSNKRGDPSSITG  439



>ref|XP_006481921.1| PREDICTED: probable serine/threonine-protein kinase mps1-like 
isoform X1 [Citrus sinensis]
Length=496

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 199/309 (64%), Gaps = 38/309 (12%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVN+I+GKGTAC+VVENQ+LLET+DL+PKMKEE KKLLNSKHLFF+EMC
Sbjct  189  DKFNDLNKRYKRVNEILGKGTACRVVENQSLLETMDLTPKMKEEVKKLLNSKHLFFKEMC  248

Query  182  AY-----HNscahggasgstaadggsDPT-SQANNPHQKCMHSSENVRIGPNLAPAEVEG  343
            AY     H S   G    + + +  ++P+  Q      +C+HSSE  ++G N   AE+EG
Sbjct  249  AYHSTCGHGSGTGGTPGANHSPEVATEPSVVQQQQAQHRCLHSSETSQLGANSNRAEMEG  308

Query  344  LKIdndddedsdddeeyeedeedssideK-------------------------SRKKAR  448
             K+     ++ DD EE E D++D   D+                          SRK+ R
Sbjct  309  TKLVKVGSDEEDDVEEDESDDDDYDDDDDEAVGNSRGQQNGHGQEDEDENDEKLSRKRQR  368

Query  449  KTE---SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELE  619
            +       S MVL QL  E+ N+ +D  ++  EK++W+K + +QLEEQ++ Y+ +A ELE
Sbjct  369  QGSLPVPVSPMVL-QLRCEVSNVIQDGAKTSWEKKQWMKMKLLQLEEQQISYQYQAFELE  427

Query  620  KQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL---KNGVHHQASYNR  790
            KQR+KW KFSSKKEREME+ K++N+R++LEN+ M+L L QK+ EL   ++    Q S N+
Sbjct  428  KQRLKWVKFSSKKEREMEKAKLVNERRRLENESMLLALRQKDYELLDHQHHHQQQHSSNK  487

Query  791  TSDPSSVTG  817
             SDPSS+TG
Sbjct  488  RSDPSSITG  496



>ref|XP_002277851.3| PREDICTED: stress response protein NST1 [Vitis vinifera]
 ref|XP_010654025.1| PREDICTED: stress response protein NST1 [Vitis vinifera]
Length=492

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 145/295 (49%), Positives = 189/295 (64%), Gaps = 49/295 (17%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ+LL+T+D LSPKMK+E +KLLNSKHLFFREM
Sbjct  178  DKFNDLNKRYKRVNDILGKGTACRVVENQSLLDTMDQLSPKMKDEVRKLLNSKHLFFREM  237

Query  179  CAYHNscahggasgstaadggsDPTSQANNP--------------HQKCMHSS-ENVRIG  313
            CAYHN        G   +     P   A  P               Q+C+HSS E   IG
Sbjct  238  CAYHN-----SCGGGGTSGAHPSPPDTAVEPPQHQQQQQQHQHQHQQRCLHSSTEIATIG  292

Query  314  PNLAPAEVEGLKIdndddedsdddeeyeedeedssideK---------------------  430
            PN + AE E  K+      + D+D++ + ++ D   DE+                     
Sbjct  293  PNASRAETEASKMVKMGSGEEDEDDDEDYEDGDDDDDEEEVVEGGVRSQNEHGHEDDDDN  352

Query  431  ----SRKKARKT---ESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRV  589
                SRK+ARK        + +++QLS E+ ++ +D T+S +EK++W+++R MQLEEQRV
Sbjct  353  EGGYSRKRARKGLFPSPSPSPLMRQLSSEVMSVLQDGTKSTLEKKQWMRSRMMQLEEQRV  412

Query  590  EYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
             Y+ +A ELEKQR+KW KFSSKKEREMEREK++NQRK+LEN+RM LLL QKE+EL
Sbjct  413  SYQCKAFELEKQRLKWVKFSSKKEREMEREKLVNQRKRLENERMALLLRQKEVEL  467



>ref|XP_004138003.1| PREDICTED: uncharacterized protein LOC101222223 [Cucumis sativus]
 gb|KGN59044.1| hypothetical protein Csa_3G748240 [Cucumis sativus]
Length=468

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 135/284 (48%), Positives = 190/284 (67%), Gaps = 16/284 (6%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTACKVVENQTLL++++L+PK KEE +KLLNSKHLFFREMC
Sbjct  189  DKFNDLNKRYKRVNDILGKGTACKVVENQTLLDSMELTPKTKEEVRKLLNSKHLFFREMC  248

Query  182  AYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLK----  349
            AYHN+C H     S  A        Q     Q C H+++      + + A  EG K    
Sbjct  249  AYHNTCRHSTTHPSPDAATEPSHLPQQQQQQQLCFHATDTTT---SASIAAGEGSKSGDE  305

Query  350  ---IdndddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDS  520
                + +++ + ++++E  E  ++   + +SRK+ARK    +A  +QQLS E+  +  D 
Sbjct  306  EEEEEEEEESEEEEEDEETEGRQEEEEETESRKRARKGGMITA-GMQQLSAEVMGVISDG  364

Query  521  TRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrk  700
             RSP EK++W+K+R +QLEEQ+V ++++A ELEKQR+KW KF SKKER+MER K+ N+++
Sbjct  365  GRSPWEKKQWMKSRLIQLEEQQVSWQTQAFELEKQRLKWVKFRSKKERDMERAKLENEKR  424

Query  701  kLENDRMVLLLHQKELELKN-----GVHHQASYNRTSDPSSVTG  817
             LEN+RM+L++ + EL+L           Q S N+  DPSS+TG
Sbjct  425  MLENERMMLMVKKNELDLMGMQHYQQQQQQHSSNKRGDPSSITG  468



>ref|XP_007027577.1| Sequence-specific DNA binding transcription factors isoform 1 
[Theobroma cacao]
 gb|EOY08079.1| Sequence-specific DNA binding transcription factors isoform 1 
[Theobroma cacao]
Length=537

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 199/308 (65%), Gaps = 37/308 (12%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+G+GTACKVVENQ+LL+T+DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  231  DKFNDLNKRYKRVNDILGRGTACKVVENQSLLDTMDLSPKMKEEVRKLLNSKHLFFREMC  290

Query  182  AYHNscahggasgstaadggsDPTSQAN------NPHQKCMHSSENVRIGPNLAPAEVEG  343
            AYHNSC HG  +G++ A+   +  ++ +         Q+C+HSS+  +I  N    + E 
Sbjct  291  AYHNSCGHGATAGASGANHSPEVATETSQIQHQQAQQQRCLHSSDTAQIAGNSGGMDPEA  350

Query  344  LKIdn------------------------dddedsdddeeyeedeedssideKSRKKARK  451
            LK+                            D  S     + +++++ + ++ +RK+ RK
Sbjct  351  LKLTKVGSDEEDDDDDDDSDDDEDEDDEEAMDGHSRGHNGHGQEDDEDNDEKSTRKRPRK  410

Query  452  TESWSAM--VLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQ  625
                 ++  ++QQLS E  N+ +D ++S  EK  W+K R MQLEEQ+V Y+ +A ELEKQ
Sbjct  411  GALAMSLSPLMQQLSCEAVNVIQDGSKSVWEK-HWMKMRLMQLEEQQVSYQYQAFELEKQ  469

Query  626  RVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKN----GVHHQASYNRT  793
            R+KW KFS KKEREME+ K+ N+R++LEN+RMVLL+ QKELEL +        Q S ++ 
Sbjct  470  RLKWVKFSGKKEREMEKAKLENERRRLENERMVLLVRQKELELVDLQHQHQPQQHSSSKR  529

Query  794  SDPSSVTG  817
             DPSS+TG
Sbjct  530  GDPSSITG  537



>dbj|BAO45883.1| SHOOT2 protein [Acacia mangium]
Length=453

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 186/275 (68%), Gaps = 18/275 (7%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+G+GTACKVVENQ+LL+T+DLSPKMKEEA+KLLNSKHLFFREMC
Sbjct  174  DKFNDLNKRYKRVNDILGRGTACKVVENQSLLDTMDLSPKMKEEARKLLNSKHLFFREMC  233

Query  182  AYHNscahggasgstaadggsD------PTSQANNPHQKCMHSSEN-VRI----------  310
            AYHNSC HG ASGS+ A    +      P + A    Q+C H++EN +R+          
Sbjct  234  AYHNSCGHGIASGSSPAQPSPEIGTDHHPATAAAPLRQQCSHTTENGLRVVGSVEDDSDS  293

Query  311  GPNLAPAEVEGLKIdndddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLS  490
                        + D   +  +   E+ EEDE        SRK+ RK  + +A  ++QLS
Sbjct  294  DSESESEAFSDEEEDESVEGQNGGQEQEEEDEMKEGTGRSSRKRKRKLAA-AAQGMKQLS  352

Query  491  GELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkerem  670
            GE+R + ED  +S  EK++WIK R +Q+EEQ+V Y+  A +LEKQR+KW +FSSKKEREM
Sbjct  353  GEVRVVLEDGGKSAWEKKQWIKTRLIQMEEQQVRYKMRAFDLEKQRLKWARFSSKKEREM  412

Query  671  erekmmnqrkkLENDRMVLLLHQKELELKNGVHHQ  775
            ER K+ N+R+ LE +RM+L++ QKELEL +   HQ
Sbjct  413  ERAKLENERRNLETERMLLMIRQKELELFSLHQHQ  447



>ref|XP_008442785.1| PREDICTED: ESF1 homolog [Cucumis melo]
Length=467

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 134/281 (48%), Positives = 188/281 (67%), Gaps = 12/281 (4%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTACKVVENQTLL++++L+PK KEE +KLLNSKHLFFREMC
Sbjct  190  DKFNDLNKRYKRVNDILGKGTACKVVENQTLLDSMELTPKTKEEVRKLLNSKHLFFREMC  249

Query  182  AYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVE-----GL  346
            AYHN+C H     S  A        Q     Q C H+++      ++A  E         
Sbjct  250  AYHNTCRHSTTHPSPDAATEPSHLPQQQQQQQLCFHATDTT-TSASVAAGECSKSGDEED  308

Query  347  KIdndddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDSTR  526
            + + +D+ + ++++E  E  ++   + +SRK+ARK    + M  QQLS E+  +  D  R
Sbjct  309  EEEEEDESEEEEEDEETEGRQEEEEETESRKRARKGGITAGM--QQLSAEVMGVISDGGR  366

Query  527  SPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkL  706
            SP EK++W+K+R +QLEEQ+V ++++A ELEKQR+KW KF SKKER+MER K+ N+++ L
Sbjct  367  SPWEKKQWMKSRLIQLEEQKVSWQTQAFELEKQRLKWVKFRSKKERDMERAKLENEKRML  426

Query  707  ENDRMVLLLHQKELELKN----GVHHQASYNRTSDPSSVTG  817
            EN+RM+L++ + EL+L          Q S N+  DPSS+TG
Sbjct  427  ENERMMLIVKKNELDLMGMQHYQQQQQHSSNKRGDPSSITG  467



>ref|XP_006430334.1| hypothetical protein CICLE_v10013486mg, partial [Citrus clementina]
 gb|ESR43574.1| hypothetical protein CICLE_v10013486mg, partial [Citrus clementina]
Length=592

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 148/306 (48%), Positives = 201/306 (66%), Gaps = 37/306 (12%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVN+I+GKGTAC+VVE Q+LLET+DL+PKMKEE KKLLNSKHLFF+EMC
Sbjct  290  DKFNDLNKRYKRVNEILGKGTACRVVEKQSLLETMDLTPKMKEEVKKLLNSKHLFFKEMC  349

Query  182  AYHNscahggasgstaad-----ggsDPT-SQANNPHQKCMHSSENVRIGPNLAPAEVEG  343
            AYH++CAHG  +G T          ++P+  Q      +C+HS E  ++G N   AE+EG
Sbjct  350  AYHSTCAHGSGTGGTPGANHSPEVATEPSVVQQQQAQHRCLHSPETSQLGANSNRAEMEG  409

Query  344  LKIdndddedsdddeeyeedeedssideK-------------------------SRKKAR  448
             K+     ++ DD EE E DE+D   D+                          SRK+ R
Sbjct  410  TKLVKVGSDEEDDVEEDESDEDDYDDDDDEAVGNSRGQQNGHGQEDEDENDEKLSRKRQR  469

Query  449  KTE---SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELE  619
            +       S MVL QL  E+ N+ +D  ++  EK++W+K + +QLEEQ++ Y+ +A ELE
Sbjct  470  QGSLPVPVSPMVL-QLRCEVSNVIQDGAKTSWEKKQWMKMKLLQLEEQQISYQYQAFELE  528

Query  620  KQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSD  799
            KQR+KW KFSSKKEREME+ K++N+R++LEN+RM+L L QK+ E+ +    Q S N+ SD
Sbjct  529  KQRLKWVKFSSKKEREMEKAKLVNERRRLENERMLLALRQKDYEMLD--QQQHSSNKRSD  586

Query  800  PSSVTG  817
            PSS+TG
Sbjct  587  PSSITG  592



>ref|XP_011101476.1| PREDICTED: uncharacterized protein LOC105179522 [Sesamum indicum]
Length=445

 Score =   185 bits (470),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 184/274 (67%), Gaps = 17/274 (6%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGTAC+VVEN +LL+T+D LSPKMKEE +KLLNSKHLFFREM
Sbjct  173  DKFNDLNKRYKRVNDILGKGTACRVVENPSLLDTMDHLSPKMKEEVRKLLNSKHLFFREM  232

Query  179  CAYHNs-cahggasgstaadggsDPTSQANNP--------HQKCMHSSENVRIGPNLAPA  331
            CAYHNS     GAS S        P   A  P         Q+C+HS+ N     NL   
Sbjct  233  CAYHNSCGHGSGASVSGVGGVDHSPPEAAAEPSQSQLQSRQQRCLHSTGNAPFPTNLNGG  292

Query  332  EVEGLKIdndddedsdddeeyeedeedssideKSRK------KARKTESWSAMVLQQLSG  493
            E E  K+     ++ D+DE+ +E+E++S +  +S +      + RK  S S ++ QQL  
Sbjct  293  ENEASKLAKMMSDEDDEDEDDDEEEDESGVGSESHETDERSLRKRKGTSHSPLI-QQLDA  351

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            EL NM +D  +S  EKR+W+K +  QL+E RV  + + LELEKQR+KW KFS+KKEREME
Sbjct  352  ELVNMLQDRRKSSFEKRQWMKTKLTQLDEDRVGIQYQGLELEKQRLKWLKFSTKKEREME  411

Query  674  rekmmnqrkkLENDRMVLLLHQKELELKNGVHHQ  775
            REK+MN+R KLEN+RMVLL+ Q+EL+L    H Q
Sbjct  412  REKLMNERLKLENERMVLLIRQQELDLLGHDHQQ  445



>ref|XP_010325945.1| PREDICTED: putative DNA helicase INO80 [Solanum lycopersicum]
Length=491

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 158/300 (53%), Positives = 197/300 (66%), Gaps = 31/300 (10%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGT+C+VVENQ LLET+D LSPKMKEE KKLLNSKHL+FREM
Sbjct  195  DKFNDLNKRYKRVNDILGKGTSCRVVENQKLLETMDHLSPKMKEEVKKLLNSKHLYFREM  254

Query  179  CAYHNs-cahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKI-  352
            CAYHNS   +GG+    A        S+     Q+C+HSSEN    P +  + V G K+ 
Sbjct  255  CAYHNSCGHNGGSGSGVANPQAHQNQSEQQQQQQRCLHSSENTN--PRIGASLVVGSKMP  312

Query  353  ------------------------dndddedsdddeeyeedeedssideKSRKKARKTES  460
                                    +        + +    +EED  +DE+SRK+ RK  +
Sbjct  313  KGGENDEENEDEDEEDEDEEDDDDEVSGARGGHEHDHQSHEEEDDDMDERSRKRQRKLGT  372

Query  461  WSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWe  640
             S MV QQLS EL N+ +D  RS +EK +W+K + MQLEEQ V Y  +A EL+KQR+KW+
Sbjct  373  SSPMV-QQLSTELANVVQDRGRSSLEKMQWMKTKMMQLEEQHVSYLCQAFELQKQRLKWK  431

Query  641  kfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKN-GVHHQASYNRTSDPSSVTG  817
            KF SKKEREMER+K++N+RKKLEN+RMVLLL QKELEL +   HH  + +R SDPSSVTG
Sbjct  432  KFISKKEREMERDKLINERKKLENERMVLLLKQKELELLDYHQHHPNNNHRNSDPSSVTG  491



>ref|XP_008241327.1| PREDICTED: uncharacterized protein LOC103339760 [Prunus mume]
Length=483

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 190/321 (59%), Gaps = 50/321 (16%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LLE +DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  164  DKFNDLNKRYKRVNDILGKGTACRVVENQGLLEKMDLSPKMKEEVRKLLNSKHLFFREMC  223

Query  182  AYHNscahggasgstaadggsDPTSQANNPHQ-----------KCMHSSENVRIGPNLAP  328
            AYHNSC HG   G +     S P   A  P +           +C H+SEN  +  N   
Sbjct  224  AYHNSCGHGTVGGVSNGAHNSPPEG-ATEPSEITAHQQQPQQQRCFHASENAHVVANSGR  282

Query  329  AEVEGLKIdndddedsddd-----------------------------eeyeedeedssi  421
            +E E  K+        D+D                                  +++D + 
Sbjct  283  SETEASKMAKGGSGGEDEDEDYEDDDSEDEDEEEEEVVEVGPGSRGLMGHGHHEDDDDND  342

Query  422  deKSRKKARKTESWSA----MVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRV  589
            D  S K+ RK   +S      +  QL  E+R + +D ++SP EK++W+K R +QLEEQ+V
Sbjct  343  DRASLKRPRKEGCFSGPSSSQLTHQLGCEVRGVLQDVSKSPWEKKQWLKTRLIQLEEQQV  402

Query  590  EYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVH  769
             ++ +A ELEKQR+KW KFS KKER+MER K+ N+R++LEN+RM+LL+ +KELEL    H
Sbjct  403  NFQYQAFELEKQRLKWIKFSGKKERDMERAKLENERRRLENERMLLLVRKKELELLELHH  462

Query  770  HQA-----SYNRTSDPSSVTG  817
             Q      S N+  DPSS+TG
Sbjct  463  QQQQQQQNSSNKRGDPSSLTG  483



>ref|XP_007162836.1| hypothetical protein PHAVU_001G185100g [Phaseolus vulgaris]
 ref|XP_007162837.1| hypothetical protein PHAVU_001G185100g [Phaseolus vulgaris]
 gb|ESW34830.1| hypothetical protein PHAVU_001G185100g [Phaseolus vulgaris]
 gb|ESW34831.1| hypothetical protein PHAVU_001G185100g [Phaseolus vulgaris]
Length=450

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 184/268 (69%), Gaps = 17/268 (6%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQTLL+T+DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  167  DKFNDLNKRYKRVNDILGKGTACRVVENQTLLDTMDLSPKMKEEVRKLLNSKHLFFREMC  226

Query  182  AYHNscahggasgstaadggsDP----TSQANNPHQKCMHSSENVRIGPNLAPAEVEGLK  349
             YHNSC H    G++ A   S+       Q  +  Q+C+HSSEN   G  +   + +   
Sbjct  227  TYHNSCGHNNNCGTSNAQQSSEAQPQHQHQHQHQQQRCLHSSENGVGGLRMLKEDEDEDI  286

Query  350  IdndddedsdddeeyeedeedssideKS----RKKARKT---------ESWSAMVLQQLS  490
             + D ++ SD++E+   +     ++E      RK+ARK               +++QQL+
Sbjct  287  EEEDSEDFSDEEEDESGEGGSRGMEEDENDVMRKRARKGGFGVLSSSSSVSCQVMMQQLN  346

Query  491  GELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkerem  670
            GE+  + +D  +S  EK+ W+K R +QLEEQ+V Y  +A ELEKQR+KWE+FSSKKEREM
Sbjct  347  GEVSGVLQDVAKSAWEKKHWMKKRVVQLEEQQVNYHMQAFELEKQRLKWERFSSKKEREM  406

Query  671  erekmmnqrkkLENDRMVLLLHQKELEL  754
            E++K+ N+R++LE +RM+LL+ QKELEL
Sbjct  407  EKDKLQNERRRLEIERMLLLIRQKELEL  434



>ref|XP_007202030.1| hypothetical protein PRUPE_ppa005148mg [Prunus persica]
 gb|EMJ03229.1| hypothetical protein PRUPE_ppa005148mg [Prunus persica]
Length=475

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 134/291 (46%), Positives = 174/291 (60%), Gaps = 45/291 (15%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LLE +DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  164  DKFNDLNKRYKRVNDILGKGTACRVVENQGLLEKMDLSPKMKEEVRKLLNSKHLFFREMC  223

Query  182  AYHNscahggasgstaadggsDPTSQANNPHQ-----------KCMHSSENVRIGPNLAP  328
            AYHNSC HG   G +     S P   A  P +           +C HSSEN  +  N   
Sbjct  224  AYHNSCGHGTVGGVSNGAHNSPPEG-ATEPSEIPAHQQQPQQQRCFHSSENAHVVANSGR  282

Query  329  AEVEGLKIdndddedsddd-----------------------------eeyeedeedssi  421
            +E E  K+        D+D                                  +++D + 
Sbjct  283  SETEASKMVKGGSGGEDEDEDYEDDDSEDEDEEEEEVVEVGPGSRGLMGHGHHEDDDDND  342

Query  422  deKSRKKARKTESWSA----MVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRV  589
            D  S K+ RK   +S      +  QL  E+R + +D ++SP EK++W+K R +QLEEQ+V
Sbjct  343  DRASLKRPRKEGCFSGPSSSQLTHQLGCEVRGVLQDVSKSPWEKKQWLKTRLIQLEEQQV  402

Query  590  EYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQK  742
             Y+ +A ELEKQR+KW KFS KKER+MER K+ N+R++LEN+RM+LL+ +K
Sbjct  403  NYQYQAFELEKQRLKWIKFSGKKERDMERAKLENERRRLENERMLLLVRKK  453



>ref|XP_006604609.1| PREDICTED: uncharacterized protein DDB_G0290301 isoform X2 [Glycine 
max]
Length=403

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 145/218 (67%), Gaps = 7/218 (3%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQTLL+T+DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  133  DKFNDLNKRYKRVNDILGKGTACRVVENQTLLDTMDLSPKMKEEVRKLLNSKHLFFREMC  192

Query  182  AYHNs-cahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGP--NLAPAEVEGLKI  352
            AYHNS   +     ++     ++      +  Q+C+HSSEN  +G    L   E E    
Sbjct  193  AYHNSCGHNNNCGSTSNVQQSTEAQPPHQHQQQQCLHSSEN-GVGSLRMLKEDEDEDDDS  251

Query  353  dndddedsdddeeyeedeedssideKSRKKARKTESW---SAMVLQQLSGELRNMCEDST  523
            +   DED ++  E      +   ++  R++AR    +   S+ ++QQLSGE+  + +D  
Sbjct  252  EEFSDEDEEESGEGGSRGMEEDENDVIRRRARNKGGFGVSSSQMMQQLSGEVSGVLQDGG  311

Query  524  RSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKW  637
            +S  EK++W+K R +QLEEQ+V Y+ +A ELEKQR+KW
Sbjct  312  KSAWEKKQWMKKRVVQLEEQQVSYQIQAFELEKQRLKW  349



>ref|XP_006604608.1| PREDICTED: uncharacterized protein DDB_G0290301 isoform X1 [Glycine 
max]
Length=452

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 145/218 (67%), Gaps = 7/218 (3%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQTLL+T+DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  182  DKFNDLNKRYKRVNDILGKGTACRVVENQTLLDTMDLSPKMKEEVRKLLNSKHLFFREMC  241

Query  182  AYHNs-cahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGP--NLAPAEVEGLKI  352
            AYHNS   +     ++     ++      +  Q+C+HSSEN  +G    L   E E    
Sbjct  242  AYHNSCGHNNNCGSTSNVQQSTEAQPPHQHQQQQCLHSSEN-GVGSLRMLKEDEDEDDDS  300

Query  353  dndddedsdddeeyeedeedssideKSRKKARKTESW---SAMVLQQLSGELRNMCEDST  523
            +   DED ++  E      +   ++  R++AR    +   S+ ++QQLSGE+  + +D  
Sbjct  301  EEFSDEDEEESGEGGSRGMEEDENDVIRRRARNKGGFGVSSSQMMQQLSGEVSGVLQDGG  360

Query  524  RSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKW  637
            +S  EK++W+K R +QLEEQ+V Y+ +A ELEKQR+KW
Sbjct  361  KSAWEKKQWMKKRVVQLEEQQVSYQIQAFELEKQRLKW  398



>ref|XP_009334880.1| PREDICTED: uncharacterized protein LOC103927663 [Pyrus x bretschneideri]
Length=474

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 140/312 (45%), Positives = 183/312 (59%), Gaps = 40/312 (13%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LLE +DL+PKMKEE +KL+NSKHLFF EMC
Sbjct  163  DKFNDLNKRYKRVNDILGKGTACRVVENQGLLEKMDLAPKMKEEVRKLMNSKHLFFTEMC  222

Query  182  AYHNscahggasgstaadggsDPTSQAN--------NPHQ-----KCMHSSENVRIGPNL  322
            AYHNSC HG  SG +     S P              PH+     +C HSSEN +   N 
Sbjct  223  AYHNSCGHGTVSGGSNGAHNSPPEVATEPSEIPVWPQPHEQLQQRRCFHSSENAQAVANS  282

Query  323  APAEVEGLKIdndd-------------------dedsdddeeyeedeedssideKSRKKA  445
              +E EG K+                                   ++ D + +   +K  
Sbjct  283  GRSETEGSKVIKGGSEDEDEDYEDDDSDDEVVRGGSKGHMGHGNHEDNDDNDERAPQKVP  342

Query  446  RK-----TESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEAL  610
            RK       S S  ++QQL+ E+R + +D +++  EK++W+K R +QLEEQ+V Y+  A 
Sbjct  343  RKEGCFSGSSSSTQLMQQLNCEVRVVLQDVSKTAWEKKQWLKTRMIQLEEQQVSYQHRAF  402

Query  611  ELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQA---S  781
            ELEKQR+ W K+S KKER MER K+ N+R++LEN+RM+L++   ELEL    H Q    S
Sbjct  403  ELEKQRLMWIKYSGKKERYMERGKLENERRRLENERMLLVVRGNELELLELHHQQQQQNS  462

Query  782  YNRTSDPSSVTG  817
             N+ SDPSS TG
Sbjct  463  SNKRSDPSSHTG  474



>gb|KHN02271.1| hypothetical protein glysoja_002295 [Glycine soja]
Length=444

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 146/217 (67%), Gaps = 13/217 (6%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQTLL+T+DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  182  DKFNDLNKRYKRVNDILGKGTACRVVENQTLLDTMDLSPKMKEEVRKLLNSKHLFFREMC  241

Query  182  AYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGP--NLAPAEVEGLKId  355
            AYHNSC H    GST+            +  Q+C+HSSEN  +G    L   E E    +
Sbjct  242  AYHNSCGHNNNCGSTS-------QPPHQHQQQQCLHSSEN-GVGSLRMLKEDEDEDDDSE  293

Query  356  ndddedsdddeeyeedeedssideKSRKKARKTESW---SAMVLQQLSGELRNMCEDSTR  526
               DED ++  E      +   ++  R++AR    +   S+ ++QQLSGE+  + +D  +
Sbjct  294  EFSDEDEEESGEGGSRGMEEDENDVIRRRARNKGGFGVSSSQMMQQLSGEVSGVLQDGGK  353

Query  527  SPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKW  637
            S  EK++W+K R +QLEEQ+V Y+ +A ELEKQR+KW
Sbjct  354  SAWEKKQWMKKRVVQLEEQQVSYQIQAFELEKQRLKW  390



>ref|XP_003542565.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26-like isoform X1 [Glycine max]
Length=478

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 134/291 (46%), Positives = 182/291 (63%), Gaps = 44/291 (15%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREM-  178
            DKFNDLNKRYKRVNDI+GKGT+C+VVENQ+LL+++DLSPKMKEE KKLLNSKHLFFREM 
Sbjct  174  DKFNDLNKRYKRVNDILGKGTSCRVVENQSLLDSMDLSPKMKEEVKKLLNSKHLFFREMC  233

Query  179  -----CAYHN----scahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPA  331
                 C + N         G   S           Q   P Q+C HSSE   +G NL  +
Sbjct  234  AYHNSCGHGNNNAPQQGESGGEVSQPQAQPHHHQQQQQQPQQRCFHSSE---VG-NLGGS  289

Query  332  EVEG---LKIdndddedsdddeeyeedeedssideKS-----------------------  433
             VEG   LK+ N ++ D D +++ + +++    ++ S                       
Sbjct  290  GVEGLRMLKVGNGEEGDDDSEDDDDSEDDSDEDEDDSGEGGSRGHVGHGHEDIEDENDGR  349

Query  434  --RKKARKTE--SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYES  601
              RK+ARK    S S  ++QQLS E+  + +D  +S  +K++W+++R MQLEEQ++ Y +
Sbjct  350  SMRKRARKVGGVSMSPQLMQQLSAEVSGVFQDVGKSAWDKKQWMRSRIMQLEEQQISYHT  409

Query  602  EALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            +A ELEKQR+KW +FSSKKEREME  K+ N+R++LEN+RMVLL+ QKE EL
Sbjct  410  QAFELEKQRLKWARFSSKKEREMETAKLENERRRLENERMVLLIRQKEFEL  460



>ref|XP_006594181.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26-like isoform X2 [Glycine max]
Length=469

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 134/291 (46%), Positives = 182/291 (63%), Gaps = 44/291 (15%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREM-  178
            DKFNDLNKRYKRVNDI+GKGT+C+VVENQ+LL+++DLSPKMKEE KKLLNSKHLFFREM 
Sbjct  165  DKFNDLNKRYKRVNDILGKGTSCRVVENQSLLDSMDLSPKMKEEVKKLLNSKHLFFREMC  224

Query  179  -----CAYHN----scahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPA  331
                 C + N         G   S           Q   P Q+C HSSE   +G NL  +
Sbjct  225  AYHNSCGHGNNNAPQQGESGGEVSQPQAQPHHHQQQQQQPQQRCFHSSE---VG-NLGGS  280

Query  332  EVEG---LKIdndddedsdddeeyeedeedssideKS-----------------------  433
             VEG   LK+ N ++ D D +++ + +++    ++ S                       
Sbjct  281  GVEGLRMLKVGNGEEGDDDSEDDDDSEDDSDEDEDDSGEGGSRGHVGHGHEDIEDENDGR  340

Query  434  --RKKARKTE--SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYES  601
              RK+ARK    S S  ++QQLS E+  + +D  +S  +K++W+++R MQLEEQ++ Y +
Sbjct  341  SMRKRARKVGGVSMSPQLMQQLSAEVSGVFQDVGKSAWDKKQWMRSRIMQLEEQQISYHT  400

Query  602  EALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            +A ELEKQR+KW +FSSKKEREME  K+ N+R++LEN+RMVLL+ QKE EL
Sbjct  401  QAFELEKQRLKWARFSSKKEREMETAKLENERRRLENERMVLLIRQKEFEL  451



>ref|XP_006407612.1| hypothetical protein EUTSA_v10020795mg [Eutrema salsugineum]
 gb|ESQ49065.1| hypothetical protein EUTSA_v10020795mg [Eutrema salsugineum]
Length=425

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 120/252 (48%), Positives = 171/252 (68%), Gaps = 14/252 (6%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LL+ +D L+PK+K+E KKLLNSKHLFFREM
Sbjct  177  DKFNDLNKRYKRVNDILGKGTACRVVENQGLLDAMDHLTPKLKDEVKKLLNSKHLFFREM  236

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHNSC H G       +       Q     Q C H++E+          ++  +    
Sbjct  237  CAYHNSCGHLGGHDQPQPNQA---PIQGRPEQQSCFHAAES---------GKMARIAESE  284

Query  359  dddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVE  538
            +++E    ++   E E+    +E++RKK RK E  S  V +++  E   + ED+ +S +E
Sbjct  285  EEEESDMAEDSESEMEDTEEEEEETRKKRRKGEGVSPAV-KRMREEATRVLEDAGKSALE  343

Query  539  KRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDR  718
            K+ W++ +T++LEE++V YE EA+E+EKQRVKW ++ SKKEREME+  + NQR++LE +R
Sbjct  344  KKEWMRTKTLELEERKVGYEWEAVEMEKQRVKWLRYRSKKEREMEKANLENQRRRLETER  403

Query  719  MVLLLHQKELEL  754
            MVL+L ++E+EL
Sbjct  404  MVLILRRREIEL  415



>emb|CBI30220.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 157/249 (63%), Gaps = 52/249 (21%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ+LL+T+D LSPKMK+E +KLLNSKHLFFREM
Sbjct  161  DKFNDLNKRYKRVNDILGKGTACRVVENQSLLDTMDQLSPKMKDEVRKLLNSKHLFFREM  220

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAY                            H  C     +   G + +P +        
Sbjct  221  CAY----------------------------HNSCGGGGTS---GAHPSPPDT-------  242

Query  359  dddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVE  538
                          +       +++RK    + S S + ++QLS E+ ++ +D T+S +E
Sbjct  243  ------------ATEASKMRRLKRARKGLFPSPSPSPL-MRQLSSEVMSVLQDGTKSTLE  289

Query  539  KRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDR  718
            K++W+++R MQLEEQRV Y+ +A ELEKQR+KW KFSSKKEREMEREK++NQRK+LEN+R
Sbjct  290  KKQWMRSRMMQLEEQRVSYQCKAFELEKQRLKWVKFSSKKEREMEREKLVNQRKRLENER  349

Query  719  MVLLLHQKE  745
            M LLL QKE
Sbjct  350  MALLLRQKE  358



>ref|XP_009135031.1| PREDICTED: trihelix transcription factor GT-3a-like [Brassica 
rapa]
Length=416

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 172/273 (63%), Gaps = 37/273 (14%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LLET+D L+PK+K+E KKLLNSKHLFF+EM
Sbjct  180  DKFNDLNKRYKRVNDILGKGTACRVVENQALLETMDHLTPKLKDEVKKLLNSKHLFFKEM  239

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHNSC H     ++ A     P  Q+      C H++E                    
Sbjct  240  CAYHNSCGHLDQPQASQAPSHHRPEQQS------CFHAAE--------------------  273

Query  359  dddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVE  538
                   ++ E  ED E    +E++ KK R+ E  S  V +++  E     ++  +S  E
Sbjct  274  -----VAEESETAEDSESEMEEEETSKKRRRGEGVSGAV-KRMREETARALDEPGKSAWE  327

Query  539  KRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDR  718
            KR W++ + ++LEE++V YE EA+E+EK+RVKW ++ SKKEREME+ K+ NQR+ LE +R
Sbjct  328  KREWMRRKALELEERKVGYEWEAVEMEKERVKWMRYRSKKEREMEKAKLENQRRMLETER  387

Query  719  MVLLLHQKELELKNGVHHQASYNRTSDPSSVTG  817
            MVL+L ++E+EL   V  Q S  +  DPSS TG
Sbjct  388  MVLILRRREIEL---VELQ-SLGKRVDPSSATG  416



>ref|XP_010486586.1| PREDICTED: uncharacterized protein LOC104764701 [Camelina sativa]
Length=439

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 174/272 (64%), Gaps = 16/272 (6%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKG AC+VVENQ LLE++D L+PK+K+E KKLLNSKHLFFREM
Sbjct  181  DKFNDLNKRYKRVNDILGKGIACRVVENQGLLESMDHLTPKLKDEVKKLLNSKHLFFREM  240

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHNSC H G          +  + Q N     C H++E  ++       EVE      
Sbjct  241  CAYHNSCGHLGGHDQQPPPQQNPVSVQQN-----CFHAAEAGKMARIAERGEVE----VE  291

Query  359  dddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVE  538
             D  +  + E   E+ E+   +E ++KK RK  +   M +++L  E   + ED  +S  E
Sbjct  292  SDMAEDSESESEMEESEEEEEEETTKKKRRKVLT---MAVKRLREEAARVMEDVGKSVWE  348

Query  539  KRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDR  718
            K+ W++ + +++EE+++ YE E +E+EKQRVKW ++ SKKEREME+ K+ NQR++LE +R
Sbjct  349  KKEWMRRKMLEVEEKKIGYEWEGVEMEKQRVKWLRYRSKKEREMEKAKLDNQRRRLETER  408

Query  719  MVLLLHQKELELKNGVHHQASYNRTSDPSSVT  814
            MVL+L + E+EL      Q S  +  DPSS  
Sbjct  409  MVLMLRRSEIELN---ELQQSSGKRVDPSSAA  437



>ref|XP_010543479.1| PREDICTED: trihelix transcription factor GTL1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543480.1| PREDICTED: trihelix transcription factor GTL1 isoform X2 [Tarenaya 
hassleriana]
Length=451

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 173/269 (64%), Gaps = 18/269 (7%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ+LLE++DL PK+KEEAKKLLNSKHLFFREMC
Sbjct  190  DKFNDLNKRYKRVNDILGKGTACRVVENQSLLESMDLPPKLKEEAKKLLNSKHLFFREMC  249

Query  182  AYHNscahggasgstaadggsDPTSQANN---PHQKCMH------SSENVRIGPNLAPAE  334
            AYHNSC H   + + A      P +Q  +   P Q C H      SS+  RI  N     
Sbjct  250  AYHNSCGHLTHTNANAIAAADQPQTQTQSHPQPQQSCFHSAAAGDSSKMTRIAEN-----  304

Query  335  VEGLKIdndddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCE  514
              G + + + D   D D E + DEE    +  + K+ RK     A  ++ L  E+  +  
Sbjct  305  --GEEEEEESDTAEDSDTEDDSDEEGEEEEVVAGKRQRKMSETGA--VRGLMEEVGRVAM  360

Query  515  DSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnq  694
            D  +   EK+ W+K + ++LEE+RV +E EALE+EKQ +KW +F SKKEREME+ ++ NQ
Sbjct  361  DMAKGAREKKEWMKKKMVELEERRVGFEWEALEMEKQSLKWMRFKSKKEREMEKARLDNQ  420

Query  695  rkkLENDRMVLLLHQKELELKNGVHHQAS  781
            R++LEN+RM+LLL +KE+E        AS
Sbjct  421  RRRLENERMLLLLRRKEMEFDTSASASAS  449



>ref|XP_010543481.1| PREDICTED: trihelix transcription factor GTL1 isoform X3 [Tarenaya 
hassleriana]
Length=454

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 173/269 (64%), Gaps = 18/269 (7%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ+LLE++DL PK+KEEAKKLLNSKHLFFREMC
Sbjct  193  DKFNDLNKRYKRVNDILGKGTACRVVENQSLLESMDLPPKLKEEAKKLLNSKHLFFREMC  252

Query  182  AYHNscahggasgstaadggsDPTSQANN---PHQKCMH------SSENVRIGPNLAPAE  334
            AYHNSC H   + + A      P +Q  +   P Q C H      SS+  RI  N     
Sbjct  253  AYHNSCGHLTHTNANAIAAADQPQTQTQSHPQPQQSCFHSAAAGDSSKMTRIAEN-----  307

Query  335  VEGLKIdndddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCE  514
              G + + + D   D D E + DEE    +  + K+ RK     A  ++ L  E+  +  
Sbjct  308  --GEEEEEESDTAEDSDTEDDSDEEGEEEEVVAGKRQRKMSETGA--VRGLMEEVGRVAM  363

Query  515  DSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnq  694
            D  +   EK+ W+K + ++LEE+RV +E EALE+EKQ +KW +F SKKEREME+ ++ NQ
Sbjct  364  DMAKGAREKKEWMKKKMVELEERRVGFEWEALEMEKQSLKWMRFKSKKEREMEKARLDNQ  423

Query  695  rkkLENDRMVLLLHQKELELKNGVHHQAS  781
            R++LEN+RM+LLL +KE+E        AS
Sbjct  424  RRRLENERMLLLLRRKEMEFDTSASASAS  452



>ref|XP_010278270.1| PREDICTED: putative DNA helicase INO80 [Nelumbo nucifera]
Length=494

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 126/283 (45%), Positives = 168/283 (59%), Gaps = 45/283 (16%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGTACKVVENQ+LLET+D LSPKMKEE +KLLNSKHLFFREM
Sbjct  180  DKFNDLNKRYKRVNDILGKGTACKVVENQSLLETMDQLSPKMKEEVRKLLNSKHLFFREM  239

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPN----LAPAEVEG-  343
            CAYHNSC  G      A++   +  S+ +   Q C HS E           L+ +E EG 
Sbjct  240  CAYHNSCGGGVGGAHHASEAALE--SENHQQQQHCFHSPEGTAAAAGNPRSLSRSECEGL  297

Query  344  ---------------------------------LKIdndddedsdddeeyeedeedssid  424
                                             ++I      +        E+E+D+ + 
Sbjct  298  KLRSREEEEDDDGEDDDDDDDDGDEDEDDEDESMEIGGRSRNNEHGGGGGHEEEDDNELK  357

Query  425  eKSRKKARKTESWSAMV----LQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVE  592
              SRKK RK    +++     +Q L+ E+  + +D T+S  ++R+W++ +++QLEEQRV 
Sbjct  358  LASRKKLRKGMPAASLSPSPSIQHLNSEMMGVLQDGTKSSWDQRQWMRNKSLQLEEQRVS  417

Query  593  YESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDRM  721
            Y+ +A  LEKQR+KW KFS KKEREMER K+ N+R +LEN+RM
Sbjct  418  YQCQAFGLEKQRLKWIKFSGKKEREMERMKLKNERMRLENERM  460



>ref|XP_010480164.1| PREDICTED: uncharacterized protein LOC104758866 [Camelina sativa]
Length=439

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 173/272 (64%), Gaps = 14/272 (5%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKG AC+VVENQ LLE++D L+PK+K+E KKLLNSKHLFFREM
Sbjct  179  DKFNDLNKRYKRVNDILGKGIACRVVENQGLLESMDHLTPKLKDEVKKLLNSKHLFFREM  238

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHN                 +P S +    Q C HS+E  ++       EVE      
Sbjct  239  CAYHN-SCGHLGGHDQQQPPQQNPVSVSVPVQQNCFHSAEAGKMARIAERGEVE-----V  292

Query  359  dddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVE  538
            + D   D + E E +E D   +E+++KK R+  +     +++L  E   + ED  +S  E
Sbjct  293  ESDMAEDSESESEMEESDEEEEEETKKKRRRVLT---TAVKRLREEAARVMEDVGKSVWE  349

Query  539  KRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDR  718
            K+ W++ + +++EE+++ YE E +E+EKQRVKW ++ SKKEREME+ K+ NQR++LE +R
Sbjct  350  KKEWMRRKMLEVEEKKIGYEWEGVEMEKQRVKWLRYRSKKEREMEKAKLDNQRRRLEAER  409

Query  719  MVLLLHQKELELKNGVHHQASYNRTSDPSSVT  814
            MVL+L + E+EL      Q+S  R  DPSS  
Sbjct  410  MVLMLRRSEIELN---ELQSSAKRV-DPSSTA  437



>ref|XP_010464664.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Camelina sativa]
 ref|XP_010464665.1| PREDICTED: trihelix transcription factor GTL1-like isoform X2 
[Camelina sativa]
Length=447

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 121/272 (44%), Positives = 170/272 (63%), Gaps = 13/272 (5%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKG AC+VVENQ LLE++D L+PK+K+E KKLLNSKHLFFREM
Sbjct  186  DKFNDLNKRYKRVNDILGKGIACRVVENQGLLESMDHLTPKLKDEVKKLLNSKHLFFREM  245

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHN                 +P S        C H++E  ++       EVE      
Sbjct  246  CAYHN-SCGHLGGHDQQQPPQQNPVSVPVPVQLNCFHAAEAGKMARTAERGEVE-----V  299

Query  359  dddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVE  538
            + D   D + E E +E +   +E+++KK RK  +     +++L  E   + ED  +S  E
Sbjct  300  ESDMAEDSESESEMEETEEEEEEETKKKRRKVLT---TAVKRLREEAVRVMEDVGKSVWE  356

Query  539  KRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDR  718
            K+ W++ + +++EE+++ YE E +E+EKQRVKW ++ SKKEREME+ K+ NQR++LE +R
Sbjct  357  KKEWMRRKMLEVEEKKIGYEWEGVEMEKQRVKWLRYRSKKEREMEKAKLDNQRRRLETER  416

Query  719  MVLLLHQKELELKNGVHHQASYNRTSDPSSVT  814
            MVL+L + E+EL      Q S  +  DPSS  
Sbjct  417  MVLMLRRSEIELN---ELQQSSAKRVDPSSTA  445



>gb|AAF04419.1|AC010927_12 unknown protein [Arabidopsis thaliana]
Length=418

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 178/274 (65%), Gaps = 21/274 (8%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKG AC+VVENQ LLE++D L+PK+K+E KKLLNSKHLFFREM
Sbjct  164  DKFNDLNKRYKRVNDILGKGIACRVVENQGLLESMDHLTPKLKDEVKKLLNSKHLFFREM  223

Query  179  CAYHNscahggasgstaadggsDPTS-QANNPHQKCMHSSENVRIGPNLAPAEVEGLKId  355
            CAYHN  + G   G        +P S    +  Q C H++E  ++      A +   +  
Sbjct  224  CAYHN--SCGHLGGHDQQPPQQNPISIPIPSQQQNCFHAAEAGKM------ARI--AERV  273

Query  356  ndddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPV  535
              ++E   D  E  E E + S +E++RKK R + +     +++L  E  ++ ED  +S  
Sbjct  274  EVEEEVESDMAEDSESEMEESEEEETRKKRRISTA-----VKRLREEAASVVEDVGKSVW  328

Query  536  EKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLEND  715
            EK+ WI+ + +++EE+++ YE E +E+EKQRVKW ++ SKKEREME+ K+ NQR++LE +
Sbjct  329  EKKEWIRRKMLEIEEKKIGYEWEGVEMEKQRVKWMRYRSKKEREMEKAKLDNQRRRLETE  388

Query  716  RMVLLLHQKELELKNGVHHQASYNRTSDPSSVTG  817
            RM+L+L + E+EL      Q+S  R  DPSS  G
Sbjct  389  RMILMLRRSEIELN---ELQSSGTRV-DPSSAKG  418



>ref|NP_187615.2| sequence-specific DNA binding transcription factor [Arabidopsis 
thaliana]
 gb|AAM13849.2| unknown protein [Arabidopsis thaliana]
 gb|AEE74853.1| sequence-specific DNA binding transcription factor [Arabidopsis 
thaliana]
Length=431

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 178/274 (65%), Gaps = 21/274 (8%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKG AC+VVENQ LLE++D L+PK+K+E KKLLNSKHLFFREM
Sbjct  177  DKFNDLNKRYKRVNDILGKGIACRVVENQGLLESMDHLTPKLKDEVKKLLNSKHLFFREM  236

Query  179  CAYHNscahggasgstaadggsDPTS-QANNPHQKCMHSSENVRIGPNLAPAEVEGLKId  355
            CAYHN  + G   G        +P S    +  Q C H++E  ++      A +   +  
Sbjct  237  CAYHN--SCGHLGGHDQQPPQQNPISIPIPSQQQNCFHAAEAGKM------ARI--AERV  286

Query  356  ndddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPV  535
              ++E   D  E  E E + S +E++RKK R + +     +++L  E  ++ ED  +S  
Sbjct  287  EVEEEVESDMAEDSESEMEESEEEETRKKRRISTA-----VKRLREEAASVVEDVGKSVW  341

Query  536  EKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLEND  715
            EK+ WI+ + +++EE+++ YE E +E+EKQRVKW ++ SKKEREME+ K+ NQR++LE +
Sbjct  342  EKKEWIRRKMLEIEEKKIGYEWEGVEMEKQRVKWMRYRSKKEREMEKAKLDNQRRRLETE  401

Query  716  RMVLLLHQKELELKNGVHHQASYNRTSDPSSVTG  817
            RM+L+L + E+EL      Q+S  R  DPSS  G
Sbjct  402  RMILMLRRSEIELN---ELQSSGTRV-DPSSAKG  431



>ref|XP_006299896.1| hypothetical protein CARUB_v10016104mg [Capsella rubella]
 gb|EOA32794.1| hypothetical protein CARUB_v10016104mg [Capsella rubella]
Length=435

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 130/273 (48%), Positives = 175/273 (64%), Gaps = 16/273 (6%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKG AC+VVENQ LLE++D L+PK+K+E KKLLNSKHLFFREM
Sbjct  178  DKFNDLNKRYKRVNDILGKGIACRVVENQGLLESMDHLTPKLKDEVKKLLNSKHLFFREM  237

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHNSC H G               Q N     C H++E    G     AE E  + D 
Sbjct  238  CAYHNSCGHLGGHDQPPQQSPVTIPVQQN-----CFHAAE---AGKMARIAEREEAEEDV  289

Query  359  dddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVE  538
            + D   D + E EE EE+    E++ KK R+  +     +++L  E   + ED  +S  E
Sbjct  290  ESDMAEDSESEMEESEEEEEEVEETTKKKRRVLT---TAVKRLREEAARVVEDVGKSVWE  346

Query  539  KRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDR  718
            K+ W++ + +++EE+++ YE E +E+EKQRVKW ++ SKKEREME+ K+ NQR++LE +R
Sbjct  347  KKEWMRRKMLEIEEKKIGYEWEGVEMEKQRVKWMRYRSKKEREMEKAKLDNQRRRLETER  406

Query  719  MVLLLHQKELELKNGVHHQASYNRTSDPSSVTG  817
            MVL+L + E+EL      Q+S  R  DP S TG
Sbjct  407  MVLMLRRSEIELN---ELQSSGKRV-DPCSATG  435



>ref|XP_002884773.1| hypothetical protein ARALYDRAFT_478332 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61032.1| hypothetical protein ARALYDRAFT_478332 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 115/252 (46%), Positives = 161/252 (64%), Gaps = 16/252 (6%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKG AC+VVENQ LLE++D L+ K+K+E KKLLNSKHLFFREM
Sbjct  151  DKFNDLNKRYKRVNDILGKGIACRVVENQGLLESMDHLTVKLKDEVKKLLNSKHLFFREM  210

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHNSC H G              SQ N     C H++E  ++      A +       
Sbjct  211  CAYHNSCGHLGGHDQPPQQNPISIPSQQN-----CFHAAEAGKM------ARIVERVEVE  259

Query  359  dddedsdddeeyeedeedssideKSRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVE  538
            ++ E    ++   E EE     E+  +K ++  +     +++L  E   + ED  +S  E
Sbjct  260  EEVESDMAEDSESEMEESEEEVEEDTRKKQRIST----AVKRLREEATRVVEDVGKSVWE  315

Query  539  KRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDR  718
            K+ W+K + +++EE+++ YE EA+E+EKQRVKW ++ SKKEREME+ K+ NQR++LE +R
Sbjct  316  KKEWMKRKMLEIEEKKIGYEWEAVEMEKQRVKWMRYRSKKEREMEKAKLDNQRRRLETER  375

Query  719  MVLLLHQKELEL  754
            MVL L + E+EL
Sbjct  376  MVLNLRRTEIEL  387



>gb|KDP29238.1| hypothetical protein JCGZ_16627 [Jatropha curcas]
Length=483

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 92/127 (72%), Gaps = 11/127 (9%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTACKVVENQ+LLET+DLSPKMKEE KKLLNSKHLFFREMC
Sbjct  168  DKFNDLNKRYKRVNDILGKGTACKVVENQSLLETMDLSPKMKEEVKKLLNSKHLFFREMC  227

Query  182  AYHNs----cahggasgstaadggsDPTSQANNPH------QKCMHSSENVRIGPNLAPA  331
            AYHNS     +   +  +  +   +   S A +PH      Q+C HSSEN ++  N + +
Sbjct  228  AYHNSCGHGSSGVASGTTNHSPEVATDQSHAQHPHASHVQQQRCSHSSENAQLATN-SRS  286

Query  332  EVEGLKI  352
            E EG K+
Sbjct  287  ETEGSKM  293


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 85/112 (76%), Gaps = 4/112 (4%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            EL ++ +D  +SP EK+ W+K R M+LEEQ+V Y+ +ALELEKQR+KW KFSSKKEREME
Sbjct  372  ELVSVIQDGAKSPWEKKHWMKVRLMELEEQQVSYQRQALELEKQRLKWVKFSSKKEREME  431

Query  674  rekmmnqrkkLENDRMVLLLHQKELE----LKNGVHHQASYNRTSDPSSVTG  817
            R K+ N+R++LE++RMVLL+ QKELE      +    Q S N+ SDPSS+TG
Sbjct  432  RAKLENERRRLESERMVLLVRQKELELLDLHHHQQQQQLSSNKRSDPSSITG  483



>ref|XP_006851780.1| hypothetical protein AMTR_s00040p00233180 [Amborella trichopoda]
 gb|ERN13247.1| hypothetical protein AMTR_s00040p00233180 [Amborella trichopoda]
Length=443

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 165/262 (63%), Gaps = 33/262 (13%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKGTACKVV+NQ+LLET+D LS KMKEE +KLLNSKHLFFREM
Sbjct  183  DKFNDLNKRYKRVNDILGKGTACKVVQNQSLLETMDHLSSKMKEEVRKLLNSKHLFFREM  242

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYH+SCA      +T          Q     Q+C HS+E  +   ++     +GL+++ 
Sbjct  243  CAYHSSCAGQQPCDTTDTP-----HHQMPQQQQRCFHSAETTK---HIEMEASKGLRMNG  294

Query  359  dddedsdddeeyeedeedssid----------eKSRKKARKTESWSAMVLQQLSGELRNM  508
             D++   D EE +++E++   +            S K+ RK    + M    +SGE    
Sbjct  295  GDEQQHQDTEEEDDEEDEEDEEDDEEEEEEEWGSSNKRQRKPMG-TTMSRLMMSGE----  349

Query  509  CEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmm  688
                     E R  I+ + ++++E+RV +++EALELEKQR KW KFS KKERE+ER K+ 
Sbjct  350  ---------EGRECIRRKLVEVKEERVRFQAEALELEKQRFKWAKFSGKKERELERLKLE  400

Query  689  nqrkkLENDRMVLLLHQKELEL  754
            N+R KLEN+RM LLL  KE EL
Sbjct  401  NERNKLENERMSLLLRHKEAEL  422



>ref|XP_009355179.1| PREDICTED: myb/SANT-like DNA-binding domain-containing protein 
4 [Pyrus x bretschneideri]
Length=449

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 110/258 (43%), Positives = 161/258 (62%), Gaps = 25/258 (10%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT+C+VVEN  L++ +  LS K K++ +K+L+SKHLF++EM
Sbjct  184  DKFNDLNKRYKRLNDILGRGTSCRVVENPALMDAMPHLSAKAKDDVRKILSSKHLFYKEM  243

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCM---HSSENVRIGPNLAPAEVEGLK  349
            CAYHN                  P  Q  NPH   +     S+++    N +  E     
Sbjct  244  CAYHNGQRI--------------PDCQELNPHGYSLPLGRCSKDI----NGSEEEEAEEN  285

Query  350  IdndddedsdddeeyeedeedssideKSRKKARKTES--WSAMV-LQQLSGELRNMCEDS  520
             D++DD+  ++D    +++ +       RKKAR+ +   W   V L     E+ +  +D+
Sbjct  286  HDSEDDKLDNEDHNNADNDRERMRRMSERKKAREEDGHMWPQHVPLDSFEVEVGDCFQDA  345

Query  521  TRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrk  700
            T+S  E+R WIK + +QLEEQRV + +EALE+EKQR KW ++ SKK+RE+ER ++ N+R 
Sbjct  346  TKSLWERRDWIKKQKLQLEEQRVSFHAEALEIEKQRYKWLRYCSKKDRELERLRLENERM  405

Query  701  kLENDRMVLLLHQKELEL  754
            KLEN+R VL L QKE+EL
Sbjct  406  KLENERRVLQLRQKEVEL  423



>ref|XP_008367432.1| PREDICTED: uncharacterized protein LOC103431060 [Malus domestica]
Length=475

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 88/124 (71%), Gaps = 8/124 (6%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LLE +DL+PKMKEE +KLLNSKHLFFREMC
Sbjct  160  DKFNDLNKRYKRVNDILGKGTACRVVENQGLLEKMDLAPKMKEEVRKLLNSKHLFFREMC  219

Query  182  AYHNscahggasgstaadggsDPTSQANNP-------HQKCMHSSENVRIGPNLAPAEVE  340
            AYHNSC HG   G++     S P + A  P        Q C HSSEN +   N   +E E
Sbjct  220  AYHNSCGHGTVGGASNGAHNSPPEA-ATEPSEIPAQQQQXCFHSSENAQAVANSGRSETE  278

Query  341  GLKI  352
            G K+
Sbjct  279  GSKM  282


 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 83/112 (74%), Gaps = 4/112 (4%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+R + +D T++P EK++W+K R +QLEEQ+V Y+ +A ELEKQR+KW K+S KKER+ME
Sbjct  364  EMRVVMQDVTKTPWEKQQWLKTRLIQLEEQQVSYQYQAFELEKQRLKWIKYSGKKERDME  423

Query  674  rekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYN----RTSDPSSVTG  817
            R K+ N+R++LEN+RM+LL+ +KELEL      Q   N    R+  PSS+TG
Sbjct  424  RAKLENERRRLENERMLLLVRRKELELHQQQQQQQQQNSSNKRSDPPSSLTG  475



>ref|XP_008387330.1| PREDICTED: uncharacterized protein LOC103449787 [Malus domestica]
Length=479

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 86/130 (66%), Gaps = 13/130 (10%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LLE +DL+PKMKEE +KLLNSKHLFFREMC
Sbjct  160  DKFNDLNKRYKRVNDILGKGTACRVVENQGLLEKMDLAPKMKEEVRKLLNSKHLFFREMC  219

Query  182  AYHNscahggasgstaadggsDPTSQAN--------NPH-----QKCMHSSENVRIGPNL  322
            AYHNSC H    G +     S P              PH     Q+C HSSEN +   N 
Sbjct  220  AYHNSCGHETVGGRSNGAHNSPPQVATEPSEIQVWPQPHEQLQQQRCFHSSENAQAVANS  279

Query  323  APAEVEGLKI  352
              +E +G K+
Sbjct  280  GRSETKGSKV  289


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = +2

Query  458  SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKW  637
            S S  ++QQL  E+R + +D +++P EK++W+K R ++L+EQ+V Y+  A ELEKQR+KW
Sbjct  357  SSSTHLMQQLGCEVRVVLQDVSKTPWEKKQWLKTRIIKLQEQQVSYQHRAFELEKQRLKW  416

Query  638  ekfsskkeremerekmmnqrkkLENDRMVLLLHQKE---LELKNGVHHQASYNRTSDPSS  808
             K+S KKER MER K+ N+R++LEN+RM+L++  KE   LEL +    Q S N+ SDPSS
Sbjct  417  IKYSGKKERYMERRKLENERRRLENERMLLVVRGKEFDLLELHHQQQQQNSSNKRSDPSS  476

Query  809  VTG  817
            +TG
Sbjct  477  LTG  479



>gb|KHN48204.1| hypothetical protein glysoja_007873 [Glycine soja]
Length=367

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 92/127 (72%), Gaps = 14/127 (11%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGT+C+VVENQ+LL+++DLSPKMKEE KKLLNSKHLFFREMC
Sbjct  63   DKFNDLNKRYKRVNDILGKGTSCRVVENQSLLDSMDLSPKMKEEVKKLLNSKHLFFREMC  122

Query  182  AYHNscahggasgstaadggsDPT----------SQANNPHQKCMHSSENVRIGPNLAPA  331
            AYHNSC HG  +     + G + +           Q   P Q+C HSSE   +G NL  +
Sbjct  123  AYHNSCGHGNNNAPQQGESGGEVSQPQAQPHHHQQQQQQPQQRCFHSSE---VG-NLGGS  178

Query  332  EVEGLKI  352
             VEGL++
Sbjct  179  GVEGLRM  185


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 84/109 (77%), Gaps = 2/109 (2%)
 Frame = +2

Query  434  RKKARKTE--SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEA  607
            RK+ARK    S S  ++QQLS E+  + +D  +S  +K++W+++R MQLEEQ++ Y ++A
Sbjct  241  RKRARKVGGVSMSPQLMQQLSAEVSGVFQDVGKSAWDKKQWMRSRIMQLEEQQISYHTQA  300

Query  608  LELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
             ELEKQR+KW +FSSKKEREME  K+ N+R++LEN+RMVLL+ QKE EL
Sbjct  301  FELEKQRLKWARFSSKKEREMETAKLENERRRLENERMVLLIRQKEFEL  349



>ref|XP_006381332.1| hypothetical protein POPTR_0006s11870g [Populus trichocarpa]
 gb|ERP59129.1| hypothetical protein POPTR_0006s11870g [Populus trichocarpa]
Length=496

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (74%), Gaps = 10/126 (8%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ+LL+T+DLSPKMK+E +KLLNSKHLFFREMC
Sbjct  169  DKFNDLNKRYKRVNDILGKGTACRVVENQSLLDTMDLSPKMKDEVRKLLNSKHLFFREMC  228

Query  182  AYHNs--cahggasgstaadggsDPT-------SQANNPHQKCMHSSENVRIGPNLAPAE  334
            AYHNS   A   +  + + +  +DP+       +Q    +Q+C HS+EN ++  N +  E
Sbjct  229  AYHNSCGHAGVASGINNSPEMATDPSHAQHQQATQQQQQYQRCSHSTENAQVVTN-SRTE  287

Query  335  VEGLKI  352
             EG K+
Sbjct  288  TEGSKM  293


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = +2

Query  431  SRKKARK-TESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEA  607
            SRK+ RK   S ++ ++QQL+GE+ N+  D  +S  EK +W+K + MQLEEQ+V Y+ +A
Sbjct  365  SRKRPRKEVFSATSSLMQQLNGEIMNVLRDGAKSSWEKNQWMKLKLMQLEEQQVNYQCQA  424

Query  608  LELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASY-  784
             ELEKQR+KW +FSSKKEREMER K+ N+RK+LEN+RMVL + +KELEL +  H Q    
Sbjct  425  FELEKQRLKWVRFSSKKEREMERAKLENERKRLENERMVLTVRKKELELLDTTHQQQQLP  484

Query  785  -NRTSDPSSVTG  817
             N+ SDPSS+ G
Sbjct  485  SNKRSDPSSIAG  496



>ref|XP_004486957.1| PREDICTED: uncharacterized protein LOC101493778 isoform X2 [Cicer 
arietinum]
Length=401

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 160/275 (58%), Gaps = 27/275 (10%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT C+VVEN  L++++ +L+ K K++ +K+L+SKHLF++EM
Sbjct  132  DKFNDLNKRYKRLNEILGRGTCCQVVENPALMDSMPNLTAKSKDDVRKILSSKHLFYKEM  191

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHN                  P S   + H   +   ++ R        + +  + ++
Sbjct  192  CAYHNGQRI--------------PNSHDLDLHSYSLEHGKDSRDNDGSEDEDEDNNESED  237

Query  359  dddedsdddeeyeedeedssideKSRKKARKTESWS-AMVLQQLSGELRNMCEDSTRSPV  535
            D+ ++  +   +        + ++++        W  ++ +++L  E+  + +D   SP 
Sbjct  238  DELDNEININAHGHGGRMEEVYDRNKLSEEDGHFWPRSVAMEKLEVEMARVFQDPAMSPW  297

Query  536  EKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLEND  715
            E+R WIK + +QL+EQ V Y+  ALEL+KQR KW ++ SKK+RE+E+ +M N+R KLEN+
Sbjct  298  ERREWIKVQLLQLQEQNVGYQVRALELQKQRFKWLRYCSKKDRELEKLRMENKRMKLENE  357

Query  716  RMVLLLHQKELELKNGVHHQASYNRTS---DPSSV  811
            R +L L Q+ELE        A  +R     DPSS+
Sbjct  358  RRILKLKQRELE--------ADVSRAEVSLDPSSI  384



>ref|XP_011018864.1| PREDICTED: 46 kDa FK506-binding nuclear protein-like [Populus 
euphratica]
Length=486

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 93/128 (73%), Gaps = 12/128 (9%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ+LL+T+DLSPKMK+E +KLLNSKHLFFREMC
Sbjct  157  DKFNDLNKRYKRVNDILGKGTACRVVENQSLLDTMDLSPKMKDEVRKLLNSKHLFFREMC  216

Query  182  AYHNs----cahggasgstaadggsDPT-------SQANNPHQKCMHSSENVRIGPNLAP  328
            AYHNS     +   +  S + +  +DP+       +Q    +Q+C HS+EN ++  N + 
Sbjct  217  AYHNSCGHAPSGVASGISNSPEMAADPSHAQHQQATQQQQQYQRCSHSTENTQVVTN-SM  275

Query  329  AEVEGLKI  352
             E EG K+
Sbjct  276  TETEGSKM  283


 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = +2

Query  431  SRKKARK-TESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEA  607
            SRK+ RK   S ++ ++QQL+GE+ N+  D  +S  EK +W+K + +QLEEQ+V Y+ +A
Sbjct  355  SRKRPRKEVFSTTSSLMQQLNGEITNVLRDGAKSSWEKNQWMKLKLVQLEEQQVNYQCQA  414

Query  608  LELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASY-  784
             ELEKQR+KW KFSSKKEREMER K+ N+R++LEN+RMVL++ +KELEL +  H Q    
Sbjct  415  FELEKQRLKWVKFSSKKEREMERAKLENERRRLENERMVLIVRKKELELLDTTHQQQQLP  474

Query  785  -NRTSDPSSVTG  817
             N+ SDPSS+ G
Sbjct  475  SNKRSDPSSIAG  486



>ref|XP_004486956.1| PREDICTED: uncharacterized protein LOC101493778 isoform X1 [Cicer 
arietinum]
Length=444

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 160/275 (58%), Gaps = 27/275 (10%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT C+VVEN  L++++ +L+ K K++ +K+L+SKHLF++EM
Sbjct  175  DKFNDLNKRYKRLNEILGRGTCCQVVENPALMDSMPNLTAKSKDDVRKILSSKHLFYKEM  234

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHN                  P S   + H   +   ++ R        + +  + ++
Sbjct  235  CAYHNGQRI--------------PNSHDLDLHSYSLEHGKDSRDNDGSEDEDEDNNESED  280

Query  359  dddedsdddeeyeedeedssideKSRKKARKTESWS-AMVLQQLSGELRNMCEDSTRSPV  535
            D+ ++  +   +        + ++++        W  ++ +++L  E+  + +D   SP 
Sbjct  281  DELDNEININAHGHGGRMEEVYDRNKLSEEDGHFWPRSVAMEKLEVEMARVFQDPAMSPW  340

Query  536  EKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLEND  715
            E+R WIK + +QL+EQ V Y+  ALEL+KQR KW ++ SKK+RE+E+ +M N+R KLEN+
Sbjct  341  ERREWIKVQLLQLQEQNVGYQVRALELQKQRFKWLRYCSKKDRELEKLRMENKRMKLENE  400

Query  716  RMVLLLHQKELELKNGVHHQASYNRTS---DPSSV  811
            R +L L Q+ELE        A  +R     DPSS+
Sbjct  401  RRILKLKQRELE--------ADVSRAEVSLDPSSI  427



>ref|XP_009404390.1| PREDICTED: uncharacterized protein LOC103987728 [Musa acuminata 
subsp. malaccensis]
Length=547

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVND++GKGTAC+VVENQ LLET+DLSPK KEEA+KLLNSKHLFFREMC
Sbjct  218  DKFNDLNKRYKRVNDLLGKGTACRVVENQALLETMDLSPKAKEEARKLLNSKHLFFREMC  277

Query  182  AYHN  193
            AYHN
Sbjct  278  AYHN  281



>ref|XP_007145268.1| hypothetical protein PHAVU_007G224600g [Phaseolus vulgaris]
 gb|ESW17262.1| hypothetical protein PHAVU_007G224600g [Phaseolus vulgaris]
Length=473

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LLET++LSPKMKEE KKLLNSKHLFFREMC
Sbjct  165  DKFNDLNKRYKRVNDILGKGTACRVVENQNLLETMELSPKMKEEVKKLLNSKHLFFREMC  224

Query  182  AYHN  193
            AYHN
Sbjct  225  AYHN  228


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 86/109 (79%), Gaps = 2/109 (2%)
 Frame = +2

Query  434  RKKARKTE--SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEA  607
            RK+ARK      S +++QQLS E+  + +D  RS  +K++W+++R +QLEEQ++ Y+S++
Sbjct  348  RKRARKVREVPVSPLMMQQLSAEVSGVFQDGGRSAWDKKQWMRSRILQLEEQQISYQSQS  407

Query  608  LELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
             ELEKQR+KW +FSSKKEREM+R K+ N+R++LEN+RMVLL+ QKE EL
Sbjct  408  FELEKQRLKWARFSSKKEREMKRAKLENERRRLENERMVLLIRQKEFEL  456



>ref|XP_004494130.1| PREDICTED: ABC transporter F family member 4-like [Cicer arietinum]
Length=451

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKR+KRVNDI+GKGTAC+VVENQ+LL+T+DL+PKMKEEA+KLLNSKHLFFREMC
Sbjct  172  DKFNDLNKRFKRVNDILGKGTACRVVENQSLLDTMDLTPKMKEEARKLLNSKHLFFREMC  231

Query  182  AYHN  193
            AYHN
Sbjct  232  AYHN  235


 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 81/109 (74%), Gaps = 3/109 (3%)
 Frame = +2

Query  434  RKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALE  613
            RKK RK    S+ ++QQLS E+ N+ +D  +S  EK++W+K R +QL EQ++ Y  EA E
Sbjct  335  RKKTRKV---SSHLMQQLSSEVMNVLQDGVKSNWEKKQWMKKREVQLAEQQINYHVEAFE  391

Query  614  LEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKN  760
            +EKQR+KW KFS  KERE+ER K+ N+ K+LE DRMVL+L QKE+EL+N
Sbjct  392  IEKQRLKWAKFSGNKEREIERHKLENEGKRLEIDRMVLVLRQKEIELQN  440



>ref|XP_004303047.1| PREDICTED: uncharacterized protein LOC101312168 [Fragaria vesca 
subsp. vesca]
Length=489

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 85/127 (67%), Gaps = 10/127 (8%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTACKVVENQ LLE ++LS KMKEE KKLLNSKHLFFREMC
Sbjct  174  DKFNDLNKRYKRVNDILGKGTACKVVENQGLLEKMELSSKMKEEVKKLLNSKHLFFREMC  233

Query  182  AYHNscahggasgstaadggsDPTSQANN----------PHQKCMHSSENVRIGPNLAPA  331
            AYHNSC HG    + A+   +     A +            Q+C H SEN  +  N   +
Sbjct  234  AYHNSCGHGTVGAAGASGAHNSSPEMATDQSQVQLQRQSQQQRCFHVSENAHVVANSGRS  293

Query  332  EVEGLKI  352
            E EG K+
Sbjct  294  ETEGSKM  300


 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 101/135 (75%), Gaps = 9/135 (7%)
 Frame = +2

Query  437  KKARKTESWSA----MVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESE  604
            K+ RK   +S     M++QQL+ E+  + +D++++P EK++W+K R +QLEEQ+V Y  +
Sbjct  356  KRPRKGSCFSGPSMKMLMQQLTSEVNGVIQDASKTPWEKKQWMKRRLIQLEEQQVSYRYQ  415

Query  605  ALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQA--  778
            + ELEKQR+KW K+SSKKER+MER K+ N+ ++LEN+RM+LL+ QKELEL + +HHQ   
Sbjct  416  SFELEKQRLKWVKYSSKKERDMERAKLENEGRRLENERMLLLVRQKELELLD-LHHQHPQ  474

Query  779  --SYNRTSDPSSVTG  817
              S N+ SDPSS+TG
Sbjct  475  QNSSNKRSDPSSLTG  489



>ref|XP_004291801.1| PREDICTED: uncharacterized protein LOC101300312 [Fragaria vesca 
subsp. vesca]
Length=451

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 102/256 (40%), Positives = 156/256 (61%), Gaps = 22/256 (9%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT+C+VVEN +L++++  LS K K++ +K+L+SK LF++EM
Sbjct  184  DKFNDLNKRYKRLNDILGRGTSCRVVENPSLMDSMPHLSAKAKDDVRKILSSKQLFYKEM  243

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHN     G            P         +C  +  NV        +E EG++  +
Sbjct  244  CAYHNGQWIPGCHDLDLQGDPLRPG--------RC-STDNNV--------SEEEGVEEHH  286

Query  359  dddedsdddeeyeedeedssideKSRKKARKTES----WSAMVLQQLSGELRNMCEDSTR  526
            D ++D  D+E+   D  D     ++  + R +E     W  + L     E+  + +D T+
Sbjct  287  DTEDDGSDNEDNNADGSDRDRMGRTGDRKRSSEEDDHFWQHVSLDTFEVEMAEVLQDPTK  346

Query  527  SPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkL  706
            S  E+R WI  + ++L++QRV  E+E LELEKQR +W ++ SKK+RE+ER ++ N+R KL
Sbjct  347  SLWERREWINKQKLRLQQQRVNCEAEDLELEKQRYRWLRYRSKKDRELERLRLENERMKL  406

Query  707  ENDRMVLLLHQKELEL  754
            EN++ VL L QKELE+
Sbjct  407  ENEKRVLQLRQKELEI  422



>ref|NP_001235465.1| SHOOT2 protein [Glycine max]
 gb|AAK69274.1| unknown [Glycine max]
Length=408

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGT+C+VVENQ+LL+++DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  126  DKFNDLNKRYKRVNDILGKGTSCRVVENQSLLDSMDLSPKMKEEVRKLLNSKHLFFREMC  185

Query  182  AYHN  193
            AYHN
Sbjct  186  AYHN  189


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 86/112 (77%), Gaps = 3/112 (3%)
 Frame = +2

Query  434  RKKARKTESW---SAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESE  604
            R++AR    +   S+ ++QQLSGE+  + +D  +S  EK++W+K R +QLEEQ+V Y+ +
Sbjct  272  RRRARNKGGFGVSSSQMMQQLSGEVSGVLQDGGKSAWEKKQWMKKRVVQLEEQQVSYQMQ  331

Query  605  ALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKN  760
            A ELEKQR+KW +FSSKKEREME++K+ N+R++LE +RMVLLL  KELEL N
Sbjct  332  AFELEKQRLKWARFSSKKEREMEKDKLQNERRRLEIERMVLLLRHKELELVN  383



>ref|XP_010909118.1| PREDICTED: putative DNA helicase INO80 [Elaeis guineensis]
Length=571

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVND++GKGTAC+VVENQ LL+T+DLSPK KEEA+KLLNSKHLFFREMC
Sbjct  210  DKFNDLNKRYKRVNDLLGKGTACRVVENQALLDTMDLSPKAKEEARKLLNSKHLFFREMC  269

Query  182  AYHN  193
            AYHN
Sbjct  270  AYHN  273


 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +2

Query  476  LQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfssk  655
            +QQL  EL  M     +   ++R+W+K R ++LEEQRV YES AL+LE+QR KW +FS+ 
Sbjct  432  MQQLKSELMGMAGGGEQ---QQRQWLKRRVVELEEQRVGYESRALQLERQRFKWLRFSTN  488

Query  656  keremerekmmnqrkkLENDRMVLLLHQKELEL  754
            KEREMER K+ N R +LEN+RM+LLL QKE EL
Sbjct  489  KEREMERMKLENDRLRLENERMLLLLRQKEFEL  521



>gb|KEH24098.1| Myb/SANT-like DNA-binding domain protein [Medicago truncatula]
Length=455

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQTLL+T+DLS K+KEEA+KLLNSKHLFFREMC
Sbjct  166  DKFNDLNKRYKRVNDILGKGTACRVVENQTLLDTMDLSAKLKEEARKLLNSKHLFFREMC  225

Query  182  AYHN  193
            AYHN
Sbjct  226  AYHN  229


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  434  RKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALE  613
            RKK+RK  S  + V+QQLS E+ ++ +D  +S  EK++W+K + +QL E++V Y  EA E
Sbjct  335  RKKSRKVSSLPSQVMQQLSSEVMSVLQDGVKSCWEKKQWMKKKVVQLGEEQVNYHVEAFE  394

Query  614  LEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKE  745
            +EKQR+KW KFSS KEREMER+K+ N+RK LE DRMVLLL QKE
Sbjct  395  IEKQRLKWVKFSSNKEREMERQKLENERKSLEIDRMVLLLRQKE  438



>ref|XP_010246931.1| PREDICTED: uncharacterized protein LOC104590097 [Nelumbo nucifera]
 ref|XP_010246932.1| PREDICTED: uncharacterized protein LOC104590097 [Nelumbo nucifera]
 ref|XP_010246933.1| PREDICTED: uncharacterized protein LOC104590097 [Nelumbo nucifera]
Length=457

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 100/255 (39%), Positives = 150/255 (59%), Gaps = 23/255 (9%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT C+VVEN  LL+T+ +++ KMK++ +K+L+SKHLF++EM
Sbjct  190  DKFNDLNKRYKRLNEILGRGTTCRVVENPALLDTMTNITAKMKDDVRKILSSKHLFYKEM  249

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRI--GPNLAPAEVEGLKI  352
            CAYHN                     +  N H   +HS    R   G      E    + 
Sbjct  250  CAYHN-------------------GQRIPNTHDFDLHSLPATRCSEGNGFEGEEDVENED  290

Query  353  dndddedsdddeeyeedeedssideKSRKKARKTESW-SAMVLQQLSGELRNMCEDSTRS  529
             +D D D +DD   EED E      K R+       W  + +    + E+  + +D T+S
Sbjct  291  CDDGDSDDEDDNNAEEDAERMGEFGKRRENEEDGNLWLQSGIYNSFAAEIAGVLQDPTKS  350

Query  530  PVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLE  709
              E+R WI+ + +QL+ +RV  ++EA ELEK+ +KW +F +KK+RE+E  ++ N+R +LE
Sbjct  351  TWERREWIRNQLLQLQVKRVNLQAEAFELEKRHLKWLRFCNKKDRELELLRLNNERMRLE  410

Query  710  NDRMVLLLHQKELEL  754
            N+RM L + Q ELEL
Sbjct  411  NERMTLQVKQIELEL  425



>gb|KHN45698.1| hypothetical protein glysoja_036847 [Glycine soja]
Length=477

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 86/126 (68%), Gaps = 13/126 (10%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKF+DLNKRYKRVNDI+GKGTAC+VVENQ LL+++DLSPKMKEE KKLLNS+HLFFREMC
Sbjct  169  DKFSDLNKRYKRVNDILGKGTACRVVENQNLLDSMDLSPKMKEEVKKLLNSRHLFFREMC  228

Query  182  AYHNscahggasgstaadggsD---------PTSQANNPHQKCMHSSENVRIGPNLAPAE  334
            AYHNSC +G  +     + G +                  Q+C HSSE      NL  + 
Sbjct  229  AYHNSCGNGNNNAPQQGESGGEVSQPQSQSQAQPHHQQQQQRCFHSSEVA----NLGGSG  284

Query  335  VEGLKI  352
            VEGL++
Sbjct  285  VEGLRV  290


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 84/112 (75%), Gaps = 5/112 (4%)
 Frame = +2

Query  434  RKKARK-----TESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYE  598
            RK+ARK     + S S   +QQLS E+  M +D  +S  +K++W++ R  QLEEQR+ Y 
Sbjct  347  RKRARKVGGGVSNSLSPQTMQQLSAEVTGMFQDVGKSAWDKKQWMRNRMKQLEEQRISYH  406

Query  599  SEALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            ++A ELEKQR+KW +FSSKKEREMER K+ N+R+KLEN+RMVLL+ QKELEL
Sbjct  407  TQAFELEKQRLKWARFSSKKEREMERAKLENERRKLENERMVLLIRQKELEL  458



>ref|NP_001242801.1| uncharacterized protein LOC100808934 [Glycine max]
 gb|ACU21542.1| unknown [Glycine max]
Length=455

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQTLL+T+DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  177  DKFNDLNKRYKRVNDILGKGTACRVVENQTLLDTMDLSPKMKEEVRKLLNSKHLFFREMC  236

Query  182  AY  187
            AY
Sbjct  237  AY  238


 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = +2

Query  434  RKKAR-----KTESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYE  598
            RK+AR        S S+ ++QQL+GE+  + +D  +S  EK++W+K + +QLEEQ+V Y+
Sbjct  330  RKRARNKGGFGVSSISSQMMQQLNGEVSGVLQDGGKSAWEKKQWMKKKVVQLEEQQVSYQ  389

Query  599  SEALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKN  760
             +A E+EKQR+KW +FSSKKEREME++K+ N+RK+LE +RMVLLL  KELEL N
Sbjct  390  MQAFEMEKQRLKWARFSSKKEREMEKDKLQNERKRLEIERMVLLLRHKELELVN  443



>gb|KHN18717.1| hypothetical protein glysoja_021468, partial [Glycine soja]
Length=456

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQTLL+T+DLSPKMKEE +KLLNSKHLFFREMC
Sbjct  178  DKFNDLNKRYKRVNDILGKGTACRVVENQTLLDTMDLSPKMKEEVRKLLNSKHLFFREMC  237

Query  182  AY  187
            AY
Sbjct  238  AY  239


 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = +2

Query  434  RKKARK-----TESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYE  598
            RK+AR        S S+ ++QQL+GE+  + +D  +S  EK++W+K + +QLEEQ+V Y+
Sbjct  331  RKRARNKGGFGVSSISSQMMQQLNGEVSGVLQDGGKSAWEKKQWMKKKVVQLEEQQVSYQ  390

Query  599  SEALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKN  760
             +A E+EKQR+KW +FSSKKEREME++K+ N+RK+LE +RMVLLL  KELEL N
Sbjct  391  MQAFEMEKQRLKWARFSSKKEREMEKDKLQNERKRLEIERMVLLLRHKELELVN  444



>ref|XP_003590397.1| hypothetical protein MTR_1g061640 [Medicago truncatula]
 gb|ABE80120.2| Homeodomain-like [Medicago truncatula]
 gb|AES60648.1| Myb/SANT-like DNA-binding domain protein [Medicago truncatula]
Length=496

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LL+++DLSPKMK+E +KLLNSKHLFFREMC
Sbjct  186  DKFNDLNKRYKRVNDILGKGTACRVVENQGLLDSMDLSPKMKDEVRKLLNSKHLFFREMC  245

Query  182  AYHN  193
            AYHN
Sbjct  246  AYHN  249


 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 86/114 (75%), Gaps = 6/114 (5%)
 Frame = +2

Query  431  SRKKARKT------ESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVE  592
            SRK+ARK        S S  ++ Q++ E+  + +D  +S  EK++WI+ R MQLEEQ++ 
Sbjct  369  SRKRARKGGFSFPRSSSSTQLVNQMNNEISGVFQDGGKSTWEKKQWIRNRIMQLEEQKIG  428

Query  593  YESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            YES+A +LEKQR+KW ++SSKKEREMER K+ N+R++LEN+RMVLL+ +KELEL
Sbjct  429  YESQAFQLEKQRLKWARYSSKKEREMERAKLENERRRLENERMVLLIRKKELEL  482



>ref|XP_010103346.1| hypothetical protein L484_002280 [Morus notabilis]
 gb|EXB95450.1| hypothetical protein L484_002280 [Morus notabilis]
Length=473

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGT+C+VVENQ+LL+++DL+PKMKEE +KLLNSKHLFFREMC
Sbjct  172  DKFNDLNKRYKRVNDILGKGTSCRVVENQSLLDSMDLTPKMKEEVRKLLNSKHLFFREMC  231

Query  182  AYHN  193
            AYHN
Sbjct  232  AYHN  235


 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  458  SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKW  637
            S +  ++Q    E+  + +D  RSP EK++W+K R +QLEEQ+V Y+ EA ELEKQR+KW
Sbjct  347  SGTTQLIQHFRSEILGVVQDGLRSPWEKKQWLKVRMLQLEEQQVSYQCEAFELEKQRLKW  406

Query  638  ekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
             KFSSKKEREME+ K  N+R+KLEN+RMVL++ QKELEL
Sbjct  407  IKFSSKKEREMEKAKFENERRKLENERMVLIIRQKELEL  445



>ref|XP_010243252.1| PREDICTED: uncharacterized protein LOC104587365 [Nelumbo nucifera]
Length=496

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 86/124 (69%), Gaps = 7/124 (6%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRV DI+G+GTACKVVENQ+LL+T++ LSPK K+E +KLLNSKHLFFREM
Sbjct  176  DKFNDLNKRYKRVTDILGRGTACKVVENQSLLDTMEQLSPKTKDEVRKLLNSKHLFFREM  235

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQK---CMHSSENVRIGPN---LAPAEVE  340
            CAYHNSC  GG  G           +  +  HQ+   C HSSE   +  N   L+  E E
Sbjct  236  CAYHNSCGGGGLGGGAGGGHHPSEVAAESANHQQQQHCFHSSEGPSVISNSKGLSRGETE  295

Query  341  GLKI  352
            GLK+
Sbjct  296  GLKM  299


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +2

Query  473  VLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfss  652
            ++QQL+ E+ N+ +D  +SP E+R W++ +++QLEEQRV Y+ +A+ELEKQR KW KFS 
Sbjct  379  LIQQLNSEMMNVLQDGAKSPWEQREWMRTKSVQLEEQRVSYQCQAVELEKQRFKWIKFSG  438

Query  653  kkeremerekmmnqrkkLENDRMVLLLHQKELELKN  760
            KKEREMER K+ N+R +LEN+RMVLLL QKELEL N
Sbjct  439  KKEREMERLKLDNERMRLENERMVLLLRQKELELIN  474



>ref|XP_009421497.1| PREDICTED: uncharacterized protein LOC104001043 [Musa acuminata 
subsp. malaccensis]
Length=554

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVND++GKGTAC+VVENQ LL+T+DLSPK K+EA+KLLNSKHLFFREMC
Sbjct  195  DKFNDLNKRYKRVNDLLGKGTACRVVENQALLDTMDLSPKAKDEARKLLNSKHLFFREMC  254

Query  182  AYHN  193
            AYHN
Sbjct  255  AYHN  258


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  548  WIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVL  727
            W+K +  +LEEQRV Y+  A +LE+Q  KW +FS+ KEREMER K+ N+R  LENDRM+L
Sbjct  437  WLKRKAAELEEQRVAYQCRAFQLERQHFKWLRFSTSKEREMERMKLDNERLCLENDRMLL  496

Query  728  LLHQKELELKN  760
            LL QKELEL +
Sbjct  497  LLRQKELELTH  507



>emb|CDY68207.1| BnaCnng58050D [Brassica napus]
Length=316

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 73/101 (72%), Gaps = 7/101 (7%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD--LSPKMKEEAKKLLNSKHLFFRE  175
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LLET+D  L+PK+K+E KKLLNSKHLFF+E
Sbjct  166  DKFNDLNKRYKRVNDILGKGTACRVVENQALLETMDHRLTPKLKDEVKKLLNSKHLFFKE  225

Query  176  MCAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSE  298
            MCAYHN                 DP SQ     Q C+H++E
Sbjct  226  MCAYHN----SCGHLDQPQQPSQDP-SQHRPEQQSCIHAAE  261



>ref|XP_009375065.1| PREDICTED: uncharacterized protein LOC103963911 [Pyrus x bretschneideri]
Length=446

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 109/255 (43%), Positives = 156/255 (61%), Gaps = 19/255 (7%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT+C+VVEN  L++ +  LS K+K++ +K+L+SKHLF++EM
Sbjct  181  DKFNDLNKRYKRLNDILGRGTSCRVVENPALMDAMPHLSAKVKDDVRKILSSKHLFYKEM  240

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHN                  P  Q  +PH   +      +     A  E E      
Sbjct  241  CAYHNGQRI--------------PDCQDLDPHGYSLPLGRCSKDNNGSAEEEAEENHDSE  286

Query  359  dddedsdddeeyeedeedssideKSRKKARKTES--WSAMV-LQQLSGELRNMCEDSTRS  529
            DD+ D++DD + E D E      +  K+ R+ +   W   V L     E+  + +D T+S
Sbjct  287  DDELDNEDDNDAENDRERMRRMGEG-KRVREEDGHLWPQYVLLDSFQVEMGEIFQDPTKS  345

Query  530  PVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLE  709
              E+R WIK +  QL+EQRV +++EALE+EKQR KW ++ SKK+RE+ER ++ N+R KLE
Sbjct  346  LWERRDWIKKQKQQLQEQRVSFQAEALEIEKQRYKWLRYCSKKDRELERLRLENERMKLE  405

Query  710  NDRMVLLLHQKELEL  754
            N+R VL L QKELE+
Sbjct  406  NERRVLQLRQKELEI  420



>ref|XP_010683922.1| PREDICTED: AF4/FMR2 family member 4 [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQTLL+++D++PK+KEE +KLLNSKHLFFREMC
Sbjct  224  DKFNDLNKRYKRVNDILGKGTACRVVENQTLLDSMDVTPKLKEEVRKLLNSKHLFFREMC  283

Query  182  AYHN  193
            AYHN
Sbjct  284  AYHN  287


 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = +2

Query  434  RKKARKTESWSA----MVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYES  601
            RKKA+     S+      LQ+L+GE+  M +D ++S  EK++W+  + +QLEEQ ++++ 
Sbjct  401  RKKAKTVVGDSSNNNSHALQKLNGEIMGMLQDGSKSSREKKQWMMTQLVQLEEQGLKFQF  460

Query  602  EALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            +ALELEKQR +W KFSSKKEREME+ K+ N+RK+LE +RM+LLL QKE+E+
Sbjct  461  QALELEKQRWRWIKFSSKKEREMEKMKIDNERKRLETERMMLLLRQKEMEV  511



>gb|EYU41556.1| hypothetical protein MIMGU_mgv1a006561mg [Erythranthe guttata]
Length=439

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 129/290 (44%), Positives = 168/290 (58%), Gaps = 62/290 (21%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR                              EE KKLLNSKHLFFREMC
Sbjct  194  DKFNDLNKRYKR------------------------------EEVKKLLNSKHLFFREMC  223

Query  182  AYHNscahggasgstaadggsDPTSQANNPHQKCMHSS-ENVRIGPNLAPAEVEGLKIdn  358
            AYHNSCAHGG S          P        + C HSS EN       AP   +G K+DN
Sbjct  224  AYHNSCAHGGGSSGGGGGFHHPPIET-----EPCFHSSTENAN-----APVINKGSKLDN  273

Query  359  dddedsdddeeyeedeedssideK---------------SRKKARKTES--WSAMVLQQL  487
            DDD+D DD+   ++  +D   D                 ++K+ RK +S   ++ ++Q+L
Sbjct  274  DDDDDDDDESNDDDSNDDVDDDVDDDVDDDGGGSRDDDVAKKRVRKGDSELTNSGLIQEL  333

Query  488  SGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkere  667
              EL  + +D T+  +EKRRW+K R M+LEE+ V  +S++ E+EKQR+KW KFSSKKERE
Sbjct  334  DAELARVLQDPTKGAMEKRRWMKTRLMRLEEESVGIQSQSFEIEKQRLKWLKFSSKKERE  393

Query  668  merekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSDPSSVTG  817
            ME+EK+ N+R+KLEN+RMVLL+ QKE +L   + H  S N+ SDPSS+TG
Sbjct  394  MEKEKLTNERRKLENERMVLLIRQKEFDL---LQHYYS-NKKSDPSSITG  439



>ref|XP_004497590.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26-like [Cicer arietinum]
Length=507

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LL+++DL+ KMKEE +KLLNSKHLFFREMC
Sbjct  193  DKFNDLNKRYKRVNDILGKGTACRVVENQNLLDSMDLTTKMKEEVRKLLNSKHLFFREMC  252

Query  182  AYHN  193
            AYHN
Sbjct  253  AYHN  256


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 85/121 (70%), Gaps = 13/121 (11%)
 Frame = +2

Query  431  SRKKARKTESWS-------------AMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQ  571
            SRK+ARK   ++             + ++ Q+  E+  + +D  +SP EK++WI+++ M 
Sbjct  371  SRKRARKEGGFAFSMSSLSSSTALTSTLMHQMKSEISGVFQDGGKSPWEKKQWIRSKIMM  430

Query  572  LEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELE  751
            LEE++V Y S+  ELEKQR+KW +FSSKKEREMER K+ N+R++LEN+RMVL++ QKE+E
Sbjct  431  LEEEKVRYLSQEFELEKQRLKWARFSSKKEREMERAKVENERRRLENERMVLIIRQKEIE  490

Query  752  L  754
            L
Sbjct  491  L  491



>ref|XP_008777881.1| PREDICTED: la-related protein CG11505-like [Phoenix dactylifera]
Length=554

 Score =   123 bits (308),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVND++GKGTAC+VVENQ LL+TLD LSPK KEEA+KLLNSKHLFFREM
Sbjct  224  DKFNDLNKRYKRVNDLLGKGTACRVVENQALLDTLDQLSPKAKEEARKLLNSKHLFFREM  283

Query  179  CAYH  190
            CAYH
Sbjct  284  CAYH  287


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +2

Query  476  LQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfssk  655
            +QQL  EL  M     +   ++R+W+K R  +LEEQRV Y+S AL+LE+QR KW +FS+ 
Sbjct  448  IQQLKSELMGMAGGGEQ---QQRQWLKRRVAELEEQRVGYDSRALQLERQRFKWLRFSTN  504

Query  656  keremerekmmnqrkkLENDRMVLLLHQKELEL  754
            KEREMER K+ N   +LEN+RM+LLL QKELEL
Sbjct  505  KEREMERMKLENDSLRLENERMLLLLRQKELEL  537



>ref|XP_009390139.1| PREDICTED: uncharacterized protein LOC103976598 [Musa acuminata 
subsp. malaccensis]
Length=535

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 62/65 (95%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVND++GKGTAC+VVENQTLL+T+D L PK KEEA+KLLNSKHLFFREM
Sbjct  204  DKFNDLNKRYKRVNDLLGKGTACRVVENQTLLDTMDNLYPKAKEEARKLLNSKHLFFREM  263

Query  179  CAYHN  193
            CAYH+
Sbjct  264  CAYHH  268


 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  548  WIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVL  727
            W++ +  +LEEQRV Y+  A +LE+QR KW +FSS KEREMER K+ N+R +LENDRM+L
Sbjct  437  WLRRKATELEEQRVAYQGRAFQLERQRFKWLRFSSNKEREMERMKLDNERLRLENDRMLL  496

Query  728  LLHQKELELKNG  763
            LL QKELEL +G
Sbjct  497  LLRQKELELVHG  508



>ref|XP_008778516.1| PREDICTED: uncharacterized protein LOC103698298, partial [Phoenix 
dactylifera]
Length=536

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVND++GKGTAC+VVENQ LL+T+D LSPK KEEA+KLLNSKHLFFREM
Sbjct  207  DKFNDLNKRYKRVNDLLGKGTACRVVENQALLDTMDHLSPKAKEEARKLLNSKHLFFREM  266

Query  179  CAYHN  193
            C YH+
Sbjct  267  CTYHH  271


 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = +2

Query  476  LQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfssk  655
            +Q+L  EL  M         ++R+W+K R  +LEEQRV Y S AL+LE+QR KW +FS+K
Sbjct  434  MQKLKSELMGMAAGGGEP--QQRQWLKRRAAELEEQRVGYRSRALQLERQRFKWLRFSTK  491

Query  656  keremerekmmnqrkkLENDRMVLLLHQKELELKNG  763
            KEREMER K+ N R +LEN+RM+LLL QKELEL  G
Sbjct  492  KEREMERMKLHNDRLRLENERMLLLLRQKELELIGG  527



>ref|XP_010912197.1| PREDICTED: la-related protein CG11505-like [Elaeis guineensis]
Length=541

 Score =   119 bits (299),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVND++GKGTAC+VVENQ LL+T++ LSPK KEEA+KLLNSKHLFFREM
Sbjct  212  DKFNDLNKRYKRVNDLLGKGTACRVVENQALLDTMEHLSPKAKEEARKLLNSKHLFFREM  271

Query  179  CAYHN  193
            CAYH+
Sbjct  272  CAYHH  276


 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 4/97 (4%)
 Frame = +2

Query  479  QQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskk  658
            Q+L  EL  M  D  +   ++R+W+K R  +LEEQRV Y+S AL+LE+QR KW +FS+KK
Sbjct  438  QRLKSELMGMAGDGEQ---QQRQWLKGRAAELEEQRVGYQSRALQLERQRFKWLRFSTKK  494

Query  659  eremerekmmnqrkkLENDRMVLLLHQKELE-LKNGV  766
            ER+MER K+ N R +LEN+RM+LLL QKELE L+ GV
Sbjct  495  ERDMERLKLHNDRLRLENERMLLLLRQKELEFLRCGV  531



>ref|XP_009146876.1| PREDICTED: uncharacterized protein LOC103870494 [Brassica rapa]
Length=419

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+G+GTAC VVENQ LLE +D L+PK++EE KKLLNSKHLFF+EM
Sbjct  179  DKFNDLNKRYKRVNDILGRGTACHVVENQGLLEGMDHLTPKLREEVKKLLNSKHLFFKEM  238

Query  179  CAYHN  193
            CAYHN
Sbjct  239  CAYHN  243


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 81/117 (69%), Gaps = 4/117 (3%)
 Frame = +2

Query  467  AMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekf  646
            +  ++++  E   + +D  +S  EK+ W++ + +++EE++V YE EA+E+EKQRVKW ++
Sbjct  307  SAAVKRMREETARVLDDPGKSAWEKKEWMRRKALEIEERKVGYEWEAVEMEKQRVKWVRY  366

Query  647  sskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSDPSSVTG  817
             SKKEREME+ K+ NQR+ LE +RMVL+L ++E+EL      Q +  R  DPSS TG
Sbjct  367  RSKKEREMEKAKLENQRRSLETERMVLVLRRREIEL---TELQLAGKRV-DPSSATG  419



>emb|CDY60160.1| BnaAnng16550D [Brassica napus]
Length=423

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+G+GTAC VVENQ LLE +D L+PK++EE KKLLNSKHLFF+EM
Sbjct  179  DKFNDLNKRYKRVNDILGRGTACHVVENQGLLEGMDHLTPKLREEVKKLLNSKHLFFKEM  238

Query  179  CAYHN  193
            CAYHN
Sbjct  239  CAYHN  243


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 81/117 (69%), Gaps = 4/117 (3%)
 Frame = +2

Query  467  AMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekf  646
            +  ++++  E   + +D  +S  EK+ W++ + +++EE++V YE EA+E+EKQRVKW ++
Sbjct  311  SAAVKRMREETARVLDDPGKSAWEKKEWMRRKALEIEERKVGYEWEAVEMEKQRVKWVRY  370

Query  647  sskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSDPSSVTG  817
             SKKEREME+ K+ NQR+ LE +R+VL+L ++E+EL      Q +  R  DPSS TG
Sbjct  371  RSKKEREMEKAKLENQRRSLETERLVLVLRRREIEL---TELQLAGKRV-DPSSATG  423



>ref|XP_006373929.1| hypothetical protein POPTR_0016s11010g [Populus trichocarpa]
 gb|ERP51726.1| hypothetical protein POPTR_0016s11010g [Populus trichocarpa]
Length=355

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVNDI+GKGTAC+VVENQ LL+T+DLSPKMKEE +KLLNSKHLFFR+M 
Sbjct  135  DKFNDLNKRYKRVNDILGKGTACRVVENQNLLDTMDLSPKMKEEVRKLLNSKHLFFRDMW  194

Query  182  AY  187
            A+
Sbjct  195  AF  196


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 97/137 (71%), Gaps = 8/137 (6%)
 Frame = +2

Query  431  SRKKARK-TESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEA  607
            SRK+ RK   S ++ ++QQL+GE+ N+ +D  +S  EK+ W++ R MQLEEQ+V Y+ +A
Sbjct  219  SRKRPRKDVFSATSPLMQQLNGEIMNVLQDVAKSSWEKKHWMRLRLMQLEEQQVSYQCQA  278

Query  608  LELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASY-  784
             ELEKQR+KW KFSSKKEREME  K+ N+R++LEN+RMVL++ +KELEL +  H Q    
Sbjct  279  YELEKQRLKWVKFSSKKEREMEGVKLENERRRLENERMVLIVRKKELELLDTQHQQQQQQ  338

Query  785  ------NRTSDPSSVTG  817
                  N+ SD SS+ G
Sbjct  339  QQQLPSNKRSDTSSIAG  355



>emb|CDY00901.1| BnaC05g42990D [Brassica napus]
Length=420

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 61/65 (94%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+G+GTAC+VVENQ LLE +D L+PK+++E KKLLNSKHLFF+EM
Sbjct  175  DKFNDLNKRYKRVNDILGRGTACRVVENQGLLEGMDHLTPKLRDEVKKLLNSKHLFFKEM  234

Query  179  CAYHN  193
            CAYHN
Sbjct  235  CAYHN  239


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 81/117 (69%), Gaps = 4/117 (3%)
 Frame = +2

Query  467  AMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekf  646
            +  ++++  E   + +D  +S  EK+ W++ + +++EE++V YE EA+E+EKQRVKW ++
Sbjct  306  SAAVKRMREETARVLDDPGKSAWEKKEWMRRKALEIEERKVGYEWEAVEMEKQRVKWIRY  365

Query  647  sskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSDPSSVTG  817
             SKKEREME+ K+ NQR+ LE +RMVL+L ++++EL      Q +  R  DPSS TG
Sbjct  366  RSKKEREMEKAKLENQRRSLETERMVLILRRRDIEL---TELQLAGKRV-DPSSATG  418



>ref|XP_010554911.1| PREDICTED: uncharacterized protein LOC104824502 [Tarenaya hassleriana]
Length=380

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKRVND++GKGTAC+VVENQ LL+ +D+  K+KEE KKLL+SKHLFFREMC
Sbjct  168  DKFNDLNKRYKRVNDMLGKGTACRVVENQGLLDAMDIPLKLKEEVKKLLHSKHLFFREMC  227

Query  182  AYHN  193
            AYHN
Sbjct  228  AYHN  231



>ref|XP_003597439.1| hypothetical protein MTR_2g098080 [Medicago truncatula]
 gb|AES67690.1| transcription factor [Medicago truncatula]
Length=445

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 159/275 (58%), Gaps = 27/275 (10%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT C+VVEN  L++++ +LS K K++ +K+L+SKHLF++EM
Sbjct  176  DKFNDLNKRYKRLNEILGRGTCCQVVENPALMDSMVNLSAKAKDDVRKILSSKHLFYKEM  235

Query  179  CAYHNscahggasgstaadggsDPTSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKIdn  358
            CAYHN                  P S   + H   +   ++ R        + +  + ++
Sbjct  236  CAYHNGQRI--------------PNSHDLDLHSYSLEHGKDSRDHDGSDDEDEDNNESED  281

Query  359  dddedsdddeeyeedeedssideKSRKKARKTESWSAMV-LQQLSGELRNMCEDSTRSPV  535
            D+ ++  +     +        ++++        W   + +++L  E+  + +D  +SP 
Sbjct  282  DELDNGININARGDGGRMEGFCDRNKLSEEDGHFWPQSIGMKKLESEMARVFQDPVKSPW  341

Query  536  EKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrkkLEND  715
            EKR WIK + +QL+EQ V+++++A EL+KQ+ KW ++ SKK+RE+E+  M N+R K EN+
Sbjct  342  EKREWIKQQLLQLQEQNVDFQAKAFELQKQQFKWLRYRSKKDRELEKLAMENKRMKFENE  401

Query  716  RMVLLLHQKELELKNGVHHQASYNRTS---DPSSV  811
              +L L Q+E E        A ++R+    DP+S+
Sbjct  402  HRILKLKQREQE--------AEFSRSEMSLDPTSI  428



>gb|KFK38386.1| hypothetical protein AALP_AA3G106800 [Arabis alpina]
Length=406

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 60/65 (92%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRVNDI+GKG AC+VVENQ LLET+ +++PK+K E +KLLNSKHLFFREM
Sbjct  162  DKFNDLNKRYKRVNDILGKGIACRVVENQGLLETMVNVTPKLKNEVRKLLNSKHLFFREM  221

Query  179  CAYHN  193
            CAYHN
Sbjct  222  CAYHN  226


 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 72/104 (69%), Gaps = 4/104 (4%)
 Frame = +2

Query  506  MCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekm  685
            + ED  +S  EK+ W++ R +++EE+RV YE +A+E+EKQRVKW ++ SKKEREME+ K+
Sbjct  307  VVEDVGKSVWEKKEWLRKRALEIEEKRVGYEWKAVEMEKQRVKWMRYRSKKEREMEKAKL  366

Query  686  mnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSDPSSVTG  817
             N R++LE +RMVL+L + E+EL  G        +  DPS  TG
Sbjct  367  ENTRRRLETERMVLMLRRSEIELTEG----DVLGKRVDPSLATG  406



>ref|XP_004971771.1| PREDICTED: uncharacterized protein LOC101752474 [Setaria italica]
Length=456

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRV D++G+G AC+VVEN  LL+ + DLSPK K+EA+KLL+SKHLFFREM
Sbjct  133  DKFNDLNKRYKRVVDLLGRGRACRVVENPALLDAIDDLSPKAKDEARKLLSSKHLFFREM  192

Query  179  CAYHN  193
            CAYHN
Sbjct  193  CAYHN  197



>ref|XP_002455555.1| hypothetical protein SORBIDRAFT_03g013050 [Sorghum bicolor]
 gb|EES00675.1| hypothetical protein SORBIDRAFT_03g013050 [Sorghum bicolor]
Length=541

 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRV D++G+G AC+VVEN  LL+TL D++PK K+EA+KLL+SKHLFFREM
Sbjct  184  DKFNDLNKRYKRVVDLLGRGRACRVVENHALLDTLDDMTPKAKDEARKLLSSKHLFFREM  243

Query  179  CAYHN  193
            CAYHN
Sbjct  244  CAYHN  248



>gb|AAX95104.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABA91672.1| expressed protein [Oryza sativa Japonica Group]
 gb|EEE51699.1| hypothetical protein OsJ_33071 [Oryza sativa Japonica Group]
Length=435

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ DI+G+GTAC VVEN +LL+ +D+S KMKE+A+K+LNSKHLF+ EMC
Sbjct  175  DKFNDLNKRYKRLTDILGRGTACNVVENHSLLDHMDISEKMKEDARKILNSKHLFYEEMC  234

Query  182  AYHN  193
            +YHN
Sbjct  235  SYHN  238



>gb|EAY80056.1| hypothetical protein OsI_35222 [Oryza sativa Indica Group]
Length=435

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ DI+G+GTAC VVEN +LL+ +D+S KMKE+A+K+LNSKHLF+ EMC
Sbjct  175  DKFNDLNKRYKRLTDILGRGTACNVVENHSLLDHMDISEKMKEDARKILNSKHLFYEEMC  234

Query  182  AYHN  193
            +YHN
Sbjct  235  SYHN  238



>tpg|DAA54425.1| TPA: hypothetical protein ZEAMMB73_872770 [Zea mays]
Length=528

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRV D++G+G AC+VVEN  LL+ +D L+PK K EA+KLL+SKHLFFREM
Sbjct  191  DKFNDLNKRYKRVVDLLGRGRACRVVENHALLDAIDELTPKAKNEARKLLSSKHLFFREM  250

Query  179  CAYHN  193
            CAYHN
Sbjct  251  CAYHN  255



>ref|XP_008655870.1| PREDICTED: uncharacterized protein LOC103635104 [Zea mays]
 gb|AFW80662.1| hypothetical protein ZEAMMB73_350135 [Zea mays]
Length=533

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRV D++G+G AC+VVEN  LL+ +D L+PK K+EA+KLL+SKHLFFREM
Sbjct  198  DKFNDLNKRYKRVVDLLGRGRACRVVENHALLDAIDELTPKAKDEARKLLSSKHLFFREM  257

Query  179  CAYHN  193
            CAYHN
Sbjct  258  CAYHN  262



>ref|XP_008673999.1| PREDICTED: uncharacterized protein LOC103650125 [Zea mays]
Length=537

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRV D++G+G AC+VVEN  LL+ +D L+PK K EA+KLL+SKHLFFREM
Sbjct  200  DKFNDLNKRYKRVVDLLGRGRACRVVENHALLDAIDELTPKAKNEARKLLSSKHLFFREM  259

Query  179  CAYHN  193
            CAYHN
Sbjct  260  CAYHN  264



>ref|XP_006662760.1| PREDICTED: uncharacterized protein LOC102703623 [Oryza brachyantha]
Length=433

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ DI+G+GTAC VVEN TLL+ +D+S KMKE+A+K+L+SKHLF+ EMC
Sbjct  175  DKFNDLNKRYKRLTDILGRGTACDVVENHTLLDHMDISEKMKEDARKILSSKHLFYEEMC  234

Query  182  AYHN  193
            +YHN
Sbjct  235  SYHN  238



>ref|NP_001065831.1| Os11g0163500 [Oryza sativa Japonica Group]
 gb|AAX95102.1| expressed protein [Oryza sativa Japonica Group]
 gb|AAX95103.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABA91670.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABA91671.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27676.1| Os11g0163500 [Oryza sativa Japonica Group]
 dbj|BAG94929.1| unnamed protein product [Oryza sativa Japonica Group]
Length=483

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ DI+G+GTAC VVEN +LL+ +D+S KMKE+A+K+LNSKHLF+ EMC
Sbjct  223  DKFNDLNKRYKRLTDILGRGTACNVVENHSLLDHMDISEKMKEDARKILNSKHLFYEEMC  282

Query  182  AYHN  193
            +YHN
Sbjct  283  SYHN  286



>emb|CDM81776.1| unnamed protein product [Triticum aestivum]
Length=542

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRV D++G+GTACKVVEN TLL+ + +L+ K KEEA+KLL+SKHLFFREM
Sbjct  210  DKFNDLNKRYKRVVDLLGRGTACKVVENPTLLDAMGELTAKAKEEARKLLSSKHLFFREM  269

Query  179  CAYHN  193
            C YHN
Sbjct  270  CTYHN  274



>ref|XP_008781414.1| PREDICTED: uncharacterized protein LOC103701210 isoform X2 [Phoenix 
dactylifera]
Length=436

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ DI+G+GT+CKVVEN  LL+ +D+S K+KE+A+K+L+SKHLF+ EMC
Sbjct  176  DKFNDLNKRYKRLTDILGRGTSCKVVENPVLLDQMDISDKLKEDARKILSSKHLFYEEMC  235

Query  182  AYHN  193
            +YHN
Sbjct  236  SYHN  239



>ref|XP_008781412.1| PREDICTED: uncharacterized protein LOC103701210 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008781413.1| PREDICTED: uncharacterized protein LOC103701210 isoform X1 [Phoenix 
dactylifera]
Length=444

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ DI+G+GT+CKVVEN  LL+ +D+S K+KE+A+K+L+SKHLF+ EMC
Sbjct  184  DKFNDLNKRYKRLTDILGRGTSCKVVENPVLLDQMDISDKLKEDARKILSSKHLFYEEMC  243

Query  182  AYHN  193
            +YHN
Sbjct  244  SYHN  247



>ref|XP_002513474.1| transcription factor, putative [Ricinus communis]
 gb|EEF48877.1| transcription factor, putative [Ricinus communis]
Length=454

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+NDI+G+GT+C+VVEN  L++++ LS K KE+ +K+L+SKHLF++EMC
Sbjct  185  DKFNDLNKRYKRLNDILGRGTSCRVVENPALMDSMPLSAKAKEDVRKILSSKHLFYKEMC  244

Query  182  AYHN  193
            AYHN
Sbjct  245  AYHN  248


 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D + S  EK+ WI  + +QL EQRV  +++A ELEKQR KW ++ SKK++E E
Sbjct  337  EMAGIFQDPSVSLWEKKEWINKQKLQLLEQRVSIQAQAFELEKQRFKWLRYCSKKDKEFE  396

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
            + ++ N+R +LEN++ VL L QK+LE+
Sbjct  397  KLRLENERMRLENEQSVLQLRQKQLEM  423



>ref|XP_009420589.1| PREDICTED: uncharacterized protein LOC104000302 [Musa acuminata 
subsp. malaccensis]
Length=428

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ DI+G+GT+CKVVEN  LLE +++S K+KE+A+K+L+SKHLF+ EMC
Sbjct  174  DKFNDLNKRYKRLTDILGRGTSCKVVENPALLEHMNISEKLKEDARKILSSKHLFYEEMC  233

Query  182  AYHN  193
            +YHN
Sbjct  234  SYHN  237



>ref|XP_010930979.1| PREDICTED: uncharacterized protein LOC105052003 [Elaeis guineensis]
Length=441

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ DI+G+GT+C+VVEN  LL+ +D+S K+KE+A+K+L+SKHLF+ EMC
Sbjct  181  DKFNDLNKRYKRLTDILGRGTSCRVVENPALLDQMDISDKLKEDARKILSSKHLFYEEMC  240

Query  182  AYHN  193
            +YHN
Sbjct  241  SYHN  244



>dbj|BAB62605.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAB93442.1| hypothetical protein [Oryza sativa Japonica Group]
Length=547

 Score =   106 bits (265),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRV D++G+G ACKVVEN  LL+ +D L+ K K+EA+KLL+SKHLFFREM
Sbjct  190  DKFNDLNKRYKRVVDLLGRGKACKVVENHALLDAMDELTHKAKDEARKLLSSKHLFFREM  249

Query  179  CAYHN  193
            CAYHN
Sbjct  250  CAYHN  254


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +2

Query  473  VLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfss  652
             +QQL  EL          P + R+W++ RT+++EEQ+V +E  A  LE+QR+KWE+F +
Sbjct  412  AVQQLQSELAAAVAGGG-DPQQVRQWVRRRTVEVEEQQVAHEVRAYHLERQRLKWERFRA  470

Query  653  kkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
             KER+MER ++ N R +++  RM+LLL QK+L+ 
Sbjct  471  NKERDMERARLRNDRLRIDGRRMLLLLRQKDLDF  504



>ref|XP_003565719.1| PREDICTED: uncharacterized protein LOC100835008 [Brachypodium 
distachyon]
Length=480

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRV D++G+G AC VVE+  LL+ +D L P+ KEEA+KLL+SKHLFFREM
Sbjct  158  DKFNDLNKRYKRVVDLLGRGKACAVVESPALLDAMDELPPRAKEEARKLLSSKHLFFREM  217

Query  179  CAYHN  193
            C YHN
Sbjct  218  CNYHN  222



>ref|NP_001066231.1| Os12g0163500 [Oryza sativa Japonica Group]
 gb|ABA95865.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29250.1| Os12g0163500 [Oryza sativa Japonica Group]
 gb|EAZ19746.1| hypothetical protein OsJ_35324 [Oryza sativa Japonica Group]
 dbj|BAG95902.1| unnamed protein product [Oryza sativa Japonica Group]
Length=432

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTACK+VEN  LL+ + +LS KMK++A+K+L+SKHLF+ EM
Sbjct  169  DKFNDLNKRYKRLTDILGRGTACKIVENHALLDCMSNLSDKMKDDARKILSSKHLFYEEM  228

Query  179  CAYHN  193
            C+YHN
Sbjct  229  CSYHN  233



>gb|EAY82367.1| hypothetical protein OsI_37579 [Oryza sativa Indica Group]
Length=432

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTACK+VEN  LL+ + +LS KMK++A+K+L+SKHLF+ EM
Sbjct  169  DKFNDLNKRYKRLTDILGRGTACKIVENHALLDCMSNLSDKMKDDARKILSSKHLFYEEM  228

Query  179  CAYHN  193
            C+YHN
Sbjct  229  CSYHN  233



>ref|XP_009387998.1| PREDICTED: uncharacterized protein LOC103974835 [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN  LL+++  +SPK KE+ +K+L+SKHLF+REM
Sbjct  177  DKFNDLNKRYKRLNEILGRGTSCQVVENPHLLDSMSHISPKAKEDVRKILSSKHLFYREM  236

Query  179  CAYHN  193
            CAYHN
Sbjct  237  CAYHN  241



>gb|KDP43003.1| hypothetical protein JCGZ_25189 [Jatropha curcas]
Length=445

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LLE +DLS K KE+ +K+L+SKHLF+ EMC
Sbjct  183  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLEYIDLSEKEKEDVRKILSSKHLFYEEMC  242

Query  182  AYHN  193
            +YHN
Sbjct  243  SYHN  246


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  458  SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKW  637
            S+S + + Q+  ++  +  +S+R+   +++W+++R++QLEEQ+V+ + E LELEKQR KW
Sbjct  346  SYSHVQIPQV--DMNQISPESSRAAWLQKQWMESRSLQLEEQKVQIQLEMLELEKQRFKW  403

Query  638  ekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            ++FS K++ E+E+ +M N+R KLEN+RM L L +KE+ L
Sbjct  404  KRFSRKRDHELEKLRMENERMKLENERMALELKRKEMGL  442



>ref|XP_006663843.1| PREDICTED: uncharacterized protein LOC102711209 isoform X1 [Oryza 
brachyantha]
 ref|XP_006663844.1| PREDICTED: uncharacterized protein LOC102711209 isoform X2 [Oryza 
brachyantha]
 ref|XP_006663845.1| PREDICTED: uncharacterized protein LOC102711209 isoform X3 [Oryza 
brachyantha]
Length=446

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTACK+VEN  LL+ + +LS KMK++A+K+L+SKHLF+ EM
Sbjct  183  DKFNDLNKRYKRLTDILGRGTACKIVENHALLDCMSNLSDKMKDDARKILSSKHLFYEEM  242

Query  179  CAYHN  193
            C+YHN
Sbjct  243  CSYHN  247



>gb|EMS64901.1| hypothetical protein TRIUR3_28119 [Triticum urartu]
Length=439

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VVEN  LL+++  LS KMKE+A+K+LNSKHLF+ +M
Sbjct  180  DKFNDLNKRYKRLTDILGRGTACSVVENPALLDSMHHLSDKMKEDARKILNSKHLFYEQM  239

Query  179  CAYHN  193
            C+YHN
Sbjct  240  CSYHN  244



>gb|EMT20023.1| hypothetical protein F775_31990 [Aegilops tauschii]
Length=440

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VVEN  LL+++  LS KMKE+A+K+LNSKHLF+ +M
Sbjct  181  DKFNDLNKRYKRLTDILGRGTACSVVENPALLDSMHHLSDKMKEDARKILNSKHLFYEQM  240

Query  179  CAYHN  193
            C+YHN
Sbjct  241  CSYHN  245



>dbj|BAJ98139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VVEN  LL+++ +LS KMKE+A+K+LNSKHLF+ +M
Sbjct  177  DKFNDLNKRYKRLTDILGRGTACCVVENPALLDSMHNLSDKMKEDARKILNSKHLFYEQM  236

Query  179  CAYHN  193
            C+YHN
Sbjct  237  CSYHN  241



>ref|XP_003542048.1| PREDICTED: uncharacterized protein LOC100801014 [Glycine max]
Length=439

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT C+VVEN  L++++ +LS KMK++ +K+L+SKHLF++EM
Sbjct  170  DKFNDLNKRYKRLNDILGRGTCCQVVENPVLMDSMPNLSAKMKDDVRKILSSKHLFYKEM  229

Query  179  CAYHN  193
            CAYHN
Sbjct  230  CAYHN  234


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D T+   E+R WIK + +QL+EQ + Y+++ALELEKQR+KW ++ SKK+RE+ 
Sbjct  322  EMARVFQDPTKLLREQREWIKIQMLQLQEQNISYQAQALELEKQRLKWLRYCSKKDRELG  381

Query  674  rekmmnqrkkLENDRMVLLLHQKELE  751
            + ++ N+R KLEN+  +L L QKELE
Sbjct  382  KLRLENKRMKLENEHRILKLKQKELE  407



>gb|KHN30131.1| hypothetical protein glysoja_010509 [Glycine soja]
Length=439

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT C+VVEN  L++++ +LS KMK++ +K+L+SKHLF++EM
Sbjct  170  DKFNDLNKRYKRLNDILGRGTCCQVVENPVLMDSMPNLSAKMKDDVRKILSSKHLFYKEM  229

Query  179  CAYHN  193
            CAYHN
Sbjct  230  CAYHN  234


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D T+   E+R WIK + +QL+EQ + Y+++ALELEKQR+KW ++ SKK+RE+ 
Sbjct  322  EMARVFQDPTKLLREQREWIKIQMLQLQEQNISYQAQALELEKQRLKWLRYCSKKDRELG  381

Query  674  rekmmnqrkkLENDRMVLLLHQKELE  751
            + ++ N+R KLEN+  +L L QKELE
Sbjct  382  KLRLENKRMKLENEHRILKLKQKELE  407



>gb|KHN33341.1| hypothetical protein glysoja_005383 [Glycine soja]
Length=447

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT C+VVEN  L++++ +LS KMK++ +K+L+SKHLF++EM
Sbjct  178  DKFNDLNKRYKRLNDILGRGTCCQVVENPVLMDSMPNLSAKMKDDVRKILSSKHLFYKEM  237

Query  179  CAYHN  193
            CAYHN
Sbjct  238  CAYHN  242


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D T+S  E+R WIK + +QL+EQ + Y+++ALELEKQR+KW ++ SKK+RE+E
Sbjct  330  EMARVFQDPTKSLHEQREWIKIQMLQLQEQNISYQAQALELEKQRLKWLRYCSKKDRELE  389

Query  674  rekmmnqrkkLENDRMVLLLHQKELE  751
            + ++ N+R KLEN+R +L L QKELE
Sbjct  390  KLRLENKRMKLENERRILKLKQKELE  415



>ref|XP_003547125.1| PREDICTED: uncharacterized protein LOC100798932 isoform X1 [Glycine 
max]
 ref|XP_006597254.1| PREDICTED: uncharacterized protein LOC100798932 isoform X2 [Glycine 
max]
Length=447

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT C+VVEN  L++++ +LS KMK++ +K+L+SKHLF++EM
Sbjct  178  DKFNDLNKRYKRLNDILGRGTCCQVVENPVLMDSMPNLSAKMKDDVRKILSSKHLFYKEM  237

Query  179  CAYHN  193
            CAYHN
Sbjct  238  CAYHN  242


 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D T+S  E+R WIK + +QL+EQ + Y+++ALELEKQR+KW ++ SKK+RE+E
Sbjct  330  EMARVFQDPTKSLHEQREWIKIQMLQLQEQNISYQAQALELEKQRLKWLRYCSKKDRELE  389

Query  674  rekmmnqrkkLENDRMVLLLHQKELE  751
            + ++ N+R KLEN+R +L L QKELE
Sbjct  390  KLRLENKRMKLENERRILKLKQKELE  415



>ref|XP_007150380.1| hypothetical protein PHAVU_005G148400g [Phaseolus vulgaris]
 gb|ESW22374.1| hypothetical protein PHAVU_005G148400g [Phaseolus vulgaris]
Length=448

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT C+VVEN  L++++ +LS KMK++ +K+L+SKHLF++EM
Sbjct  178  DKFNDLNKRYKRLNDILGRGTCCQVVENPALMDSIPNLSAKMKDDVRKILSSKHLFYKEM  237

Query  179  CAYHN  193
            CAYHN
Sbjct  238  CAYHN  242


 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 74/106 (70%), Gaps = 5/106 (5%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D T+S  E+R WIK + +QL+EQ + Y+++ LELEKQR+KW ++ SKK+RE+E
Sbjct  331  EMARVFQDPTKSLREQREWIKIQMLQLQEQNISYQAQTLELEKQRLKWLRYCSKKDRELE  390

Query  674  rekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSDPSSV  811
            R ++ N+R KLEN+  +L L QKELE+       ++   + DP+S+
Sbjct  391  RLRLENKRMKLENEHRILKLKQKELEVDF-----STSEMSLDPASI  431



>ref|XP_011087824.1| PREDICTED: uncharacterized protein LOC105169181 [Sesamum indicum]
Length=431

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYK++NDI+G+GT+C+VVEN TLL+ +D+S K KE  +K+L+SK LF++EMC
Sbjct  175  DKFNDLNKRYKKLNDILGRGTSCEVVENPTLLDLMDISAKSKESVRKILSSKQLFYQEMC  234

Query  182  AYHN  193
            +YHN
Sbjct  235  SYHN  238



>gb|KDP22075.1| hypothetical protein JCGZ_25906 [Jatropha curcas]
Length=455

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN  L++++ LS K K++ +K+L+SKHLF++EMC
Sbjct  185  DKFNDLNKRYKRLNEILGRGTSCRVVENPALMDSMPLSDKAKDDVRKILSSKHLFYKEMC  244

Query  182  AYHN  193
            AYHN
Sbjct  245  AYHN  248


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D   S  EK+ WIK + +QL EQRV  +S+A ELEKQR KW ++ SKK+RE E
Sbjct  339  EMAAIFQDPAVSLWEKKEWIKKQKLQLLEQRVSIQSQAFELEKQRFKWLRYCSKKDREFE  398

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
              ++ N+R +LEN++ +L L QK+L +
Sbjct  399  TSRLENERLRLENEQSILQLRQKQLGM  425



>ref|XP_009419153.1| PREDICTED: uncharacterized protein LOC103999204 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT C+VVEN  LL+++  +SPK K++ +K+L+SKHLF+REM
Sbjct  169  DKFNDLNKRYKRLNEILGRGTTCQVVENPLLLDSMHHISPKAKDDVRKILSSKHLFYREM  228

Query  179  CAYHN  193
            CAYHN
Sbjct  229  CAYHN  233


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  +  D+T+SP E+  W K R +QLEE+RV+ E+EALELEK+  KW++F SKK+ E+E
Sbjct  294  EIDGVLRDTTKSPWEQWEWFKRRALQLEEERVDVEAEALELEKRHFKWQRFRSKKDWELE  353

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
            R ++ N R +LEN+ M+L + QKELEL
Sbjct  354  RLRLENDRLRLENECMILQVRQKELEL  380



>ref|XP_010031815.1| PREDICTED: uncharacterized protein LOC104421532 [Eucalyptus grandis]
 gb|KCW51199.1| hypothetical protein EUGRSUZ_J00785 [Eucalyptus grandis]
Length=450

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT+CKVVEN +L++++  LS K KE+ +K+L+S+HLF++EM
Sbjct  178  DKFNDLNKRYKRLNDILGRGTSCKVVENPSLMDSMPHLSAKAKEDVRKILSSRHLFYKEM  237

Query  179  CAYHN  193
            CAYHN
Sbjct  238  CAYHN  242


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+ ++ +D +++P E++ W+K + +QL+EQR   ++++ ELEKQR KW ++ SKK RE+E
Sbjct  333  EMADIFQDPSKTPWERKEWMKRQMLQLQEQRANIQAQSFELEKQRFKWLRYCSKKNRELE  392

Query  674  rekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTS  796
            R ++ N+R KLEN+R  L L  ++LE+ N    +AS++ TS
Sbjct  393  RLRLENERMKLENERGFLELKHRDLEI-NSRRSEASFDPTS  432



>ref|XP_006850180.1| hypothetical protein AMTR_s00022p00244920 [Amborella trichopoda]
 gb|ERN11761.1| hypothetical protein AMTR_s00022p00244920 [Amborella trichopoda]
Length=441

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT C+VVEN +LL++++ LS K K++ +K+L+SKHLF++EM
Sbjct  179  DKFNDLNKRYKRLNDILGRGTTCRVVENPSLLDSMNHLSAKTKDDVRKILSSKHLFYKEM  238

Query  179  CAYHN  193
            CAYHN
Sbjct  239  CAYHN  243


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +2

Query  452  TESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRV  631
            +E     V +    E+  M  D+ +SP E+R  IK+R +QL+EQRV  +++A ELEK+R 
Sbjct  340  SECGKTGVAENFGVEMAGMLPDNAKSPWEQRELIKSRVLQLQEQRVGLQAQAFELEKRRF  399

Query  632  KWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            +W+KF SKK+RE+ER K+ N+R +L+N+RM L + QKEL++
Sbjct  400  RWQKFCSKKDRELERLKLENERMRLDNERMSLQMRQKELDM  440



>ref|XP_009759483.1| PREDICTED: uncharacterized protein LOC104212013 isoform X3 [Nicotiana 
sylvestris]
Length=319

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFND+NK++KR+NDI+G+GTAC VVEN  LLE +DLS  +KEE KKLL SK LF++EMC
Sbjct  120  DKFNDMNKKFKRLNDILGRGTACHVVENPALLEMMDLSDNLKEEMKKLLGSKQLFYQEMC  179

Query  182  AYHN  193
            +Y+N
Sbjct  180  SYNN  183



>ref|XP_009759481.1| PREDICTED: uncharacterized protein LOC104212013 isoform X1 [Nicotiana 
sylvestris]
Length=366

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFND+NK++KR+NDI+G+GTAC VVEN  LLE +DLS  +KEE KKLL SK LF++EMC
Sbjct  167  DKFNDMNKKFKRLNDILGRGTACHVVENPALLEMMDLSDNLKEEMKKLLGSKQLFYQEMC  226

Query  182  AYHN  193
            +Y+N
Sbjct  227  SYNN  230



>ref|XP_004952693.1| PREDICTED: stress response protein NST1-like isoform X1 [Setaria 
italica]
 ref|XP_004952694.1| PREDICTED: stress response protein NST1-like isoform X2 [Setaria 
italica]
Length=402

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ +I+G+GTAC++VE   LLE + LS K+KEEAKK LNSKHL + EMC
Sbjct  150  DKFNDLNKRYKRLTEILGRGTACQIVEKPALLEQVSLSAKLKEEAKKHLNSKHLHYEEMC  209

Query  182  AYHN  193
            +YHN
Sbjct  210  SYHN  213



>ref|XP_009759482.1| PREDICTED: uncharacterized protein LOC104212013 isoform X2 [Nicotiana 
sylvestris]
Length=364

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFND+NK++KR+NDI+G+GTAC VVEN  LLE +DLS  +KEE KKLL SK LF++EMC
Sbjct  165  DKFNDMNKKFKRLNDILGRGTACHVVENPALLEMMDLSDNLKEEMKKLLGSKQLFYQEMC  224

Query  182  AYHN  193
            +Y+N
Sbjct  225  SYNN  228



>ref|XP_002449041.1| hypothetical protein SORBIDRAFT_05g003890 [Sorghum bicolor]
 gb|EES08029.1| hypothetical protein SORBIDRAFT_05g003890 [Sorghum bicolor]
Length=431

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VV N  LL++++ LS KMK++AKK+L+SKHLF+ EM
Sbjct  179  DKFNDLNKRYKRLTDILGRGTACNVVANPALLDSMNHLSDKMKDDAKKILSSKHLFYEEM  238

Query  179  CAYHN  193
            C+YHN
Sbjct  239  CSYHN  243



>gb|ACR35490.1| unknown [Zea mays]
Length=360

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VV N  LL+++  LS KMK++AKK+L+SKHLF+ EM
Sbjct  103  DKFNDLNKRYKRLTDILGRGTACNVVANPALLDSMTHLSDKMKDDAKKILSSKHLFYEEM  162

Query  179  CAYHN  193
            C+YHN
Sbjct  163  CSYHN  167



>ref|XP_008449727.1| PREDICTED: uncharacterized protein LOC103491522 [Cucumis melo]
Length=446

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+GKGT+C+VVEN  L++++  LS K K++ +K+L+SKHLF++EM
Sbjct  179  DKFNDLNKRYKRLNDILGKGTSCRVVENPALMDSMPHLSSKAKDDVRKILSSKHLFYKEM  238

Query  179  CAYHN  193
            CAYHN
Sbjct  239  CAYHN  243


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 71/101 (70%), Gaps = 1/101 (1%)
 Frame = +2

Query  461  WSAMVLQ-QLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKW  637
            WS  V + +  G++     D T+S  E++ WIK + +QL+EQ   ++++++ELEKQR KW
Sbjct  319  WSNSVGKNEFEGQIDVFLSDPTKSQWERKVWIKKQMLQLQEQCNSFQAQSVELEKQRFKW  378

Query  638  ekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKN  760
             ++ SKK R++ER ++ N+R KL+N++ VL L +KE+EL++
Sbjct  379  LRYCSKKNRDLERARLENERMKLDNEQRVLQLKRKEMELES  419



>emb|CDP19340.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++NDI+G+GT+C+VVEN  LL  ++ LS K KE+ +KLL SKHLF++EM
Sbjct  193  DKFNDLNKRYKKLNDILGRGTSCRVVENPALLNNMEHLSDKAKEDVRKLLGSKHLFYKEM  252

Query  179  CAYHN  193
            CAYHN
Sbjct  253  CAYHN  257


 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 71/111 (64%), Gaps = 1/111 (1%)
 Frame = +2

Query  485  LSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskker  664
               E+  M  D T+S  E+R WI+ R +QL E+R+  ++EA ELEKQR+KW++F +KKE 
Sbjct  348  FQAEIAEMFSDPTKSQWERREWIRKRMLQLHEERIGIQAEAFELEKQRLKWQRFCNKKEL  407

Query  665  emerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSDPSSVTG  817
            E+E  ++  +R  +EN+R  L L QKE+E++     ++++N TS    + G
Sbjct  408  ELETARLEKERLIIENERKALQLKQKEVEVEF-RRPESTFNLTSFSIDIMG  457



>ref|XP_004142119.1| PREDICTED: uncharacterized protein LOC101205501 [Cucumis sativus]
 gb|KGN54170.1| hypothetical protein Csa_4G290850 [Cucumis sativus]
Length=443

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+GKGT+C+VVEN  L++++  LS K K++ +K+L+SKHLF++EM
Sbjct  179  DKFNDLNKRYKRLNDILGKGTSCRVVENPALMDSMPHLSSKAKDDVRKILSSKHLFYKEM  238

Query  179  CAYHN  193
            CAYHN
Sbjct  239  CAYHN  243


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 69/99 (70%), Gaps = 1/99 (1%)
 Frame = +2

Query  461  WSAMVLQ-QLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKW  637
            WS  V + +  G++     D T+S  E++ WIK + +QL+EQ   ++++++ELEKQR KW
Sbjct  316  WSNSVGKNEFEGQIDVFLSDPTKSHWERKVWIKKQMLQLQEQCNSFQAQSVELEKQRFKW  375

Query  638  ekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
             ++ SKK R++ER ++ N+R KL+N++ VL L +KE+EL
Sbjct  376  LRYCSKKNRDLERARLENERMKLDNEQRVLQLKRKEMEL  414



>ref|XP_009628855.1| PREDICTED: uncharacterized protein LOC104119138 [Nicotiana tomentosiformis]
Length=451

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++NDI+G+GT+C VVEN  L++++  LS K K+  KK+LNSKHLF+REM
Sbjct  188  DKFNDLNKRYKKLNDILGRGTSCAVVENPVLMDSMPQLSAKAKDTVKKILNSKHLFYREM  247

Query  179  CAYHN  193
            CAYHN
Sbjct  248  CAYHN  252


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 66/103 (64%), Gaps = 6/103 (6%)
 Frame = +2

Query  464  SAMVLQQLSG------ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQ  625
            S   L   SG      E+    +D T+S  E++ WIK R +QLEE+ +  ++EALELEK+
Sbjct  318  SGSFLPHTSGNDNFVAEINEFFQDPTKSKWEQKMWIKKRMLQLEEENIGIQAEALELEKR  377

Query  626  RVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            + KW++F  KK+RE+E E++ N++  LEN+ M L L  KELE+
Sbjct  378  QFKWQRFCRKKDRELEIERLENEKLILENEHMSLQLKHKELEI  420



>ref|XP_009768464.1| PREDICTED: uncharacterized protein LOC104219473 [Nicotiana sylvestris]
Length=453

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++NDI+G+GT+C VVEN  L++++  LS K K+  KK+LNSKHLF+REM
Sbjct  189  DKFNDLNKRYKKLNDILGRGTSCAVVENPALMDSMPQLSAKAKDTVKKILNSKHLFYREM  248

Query  179  CAYHN  193
            CAYHN
Sbjct  249  CAYHN  253


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+    +D T+S  E++ WIK R +QLEE+++  ++EALELEK++ KW++F  KK+RE+E
Sbjct  336  EINEFFQDPTKSRWEQKMWIKKRMLQLEEEKIGIQAEALELEKRQFKWQRFCRKKDRELE  395

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
             E++ N++  LEN+ M L L +KELE+
Sbjct  396  IERLENEKLILENEHMSLQLKRKELEI  422



>ref|XP_010235511.1| PREDICTED: uncharacterized protein LOC100828617 [Brachypodium 
distachyon]
 ref|XP_010235512.1| PREDICTED: uncharacterized protein LOC100828617 [Brachypodium 
distachyon]
 ref|XP_010235513.1| PREDICTED: uncharacterized protein LOC100828617 [Brachypodium 
distachyon]
Length=417

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ +I+G+GT C++VEN  LLE + LS K+KEEA+KLL+SKHL + EMC
Sbjct  144  DKFNDLNKRYKRLTEILGRGTTCQIVENPQLLEGVSLSGKLKEEARKLLSSKHLHYEEMC  203

Query  182  AYHN  193
            +YHN
Sbjct  204  SYHN  207



>emb|CBI18199.3| unnamed protein product [Vitis vinifera]
Length=361

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ND++G+GT+C+VVEN  LL+ +D L+ K KE+ +K+L+SKHLF+ EM
Sbjct  138  DKFNDLNKRYKRLNDVLGRGTSCQVVENPALLDMMDHLTEKTKEDVRKILSSKHLFYEEM  197

Query  179  CAYHN  193
            C+YHN
Sbjct  198  CSYHN  202



>ref|XP_010241711.1| PREDICTED: uncharacterized protein LOC104586241 [Nelumbo nucifera]
Length=452

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ D++G+GT+C+VVEN  LL+ +D+S K K++ +K+L+SKHLF+ EMC
Sbjct  186  DKFNDLNKRYKRLTDLLGRGTSCRVVENPALLDMMDISEKAKDDVRKILSSKHLFYEEMC  245

Query  182  AYHN  193
            +YHN
Sbjct  246  SYHN  249


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 73/104 (70%), Gaps = 8/104 (8%)
 Frame = +2

Query  479  QQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskk  658
            Q +  ++  +  + T++   +++W+K+R++QLEEQ+++ E++ LELE++R KW++FS KK
Sbjct  355  QTIPVDMNQVFPEGTKAAWSQKQWMKSRSLQLEEQKIQIEAQMLELERERFKWQRFSRKK  414

Query  659  eremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNR  790
            +RE+++ +M N+R KLEN+RM L L  +ELE        A +NR
Sbjct  415  DRELDKMRMENERMKLENERMALELKHRELE--------ADFNR  450



>ref|XP_004161693.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101205501 
[Cucumis sativus]
Length=443

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+GKGT+C+VVEN  L++++  LS K K++ +K+L+SKHLF++EM
Sbjct  179  DKFNDLNKRYKRLNDILGKGTSCRVVENPALMDSMPHLSSKAKDDVRKILSSKHLFYKEM  238

Query  179  CAYHN  193
            CAYHN
Sbjct  239  CAYHN  243


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 69/99 (70%), Gaps = 1/99 (1%)
 Frame = +2

Query  461  WSAMVLQ-QLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKW  637
            WS  V + +  G++     D T+S  E++ WIK + +QL+EQ   ++++++ELEKQR KW
Sbjct  316  WSNSVGKNEFEGQIDVFLSDPTKSHWERKVWIKKQMLQLQEQCNSFQAQSVELEKQRFKW  375

Query  638  ekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
             ++ SKK R++ER ++ N+R KL+N++ VL L +KE+EL
Sbjct  376  LRYCSKKNRDLERARLENERMKLDNEQRVLQLKRKEMEL  414



>ref|XP_010652952.1| PREDICTED: stress response protein nst1-like isoform X1 [Vitis 
vinifera]
Length=454

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT C+VVEN  L++++  LS KMK++ KK+L+SKHLF++EM
Sbjct  184  DKFNDLNKRYKRLNEILGRGTTCRVVENPALMDSMPQLSAKMKDDVKKILSSKHLFYQEM  243

Query  179  CAYHN  193
            CAYHN
Sbjct  244  CAYHN  248


 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + ED T+S  E++ WIK R +QL+EQRV   ++  ELEKQR KW ++SSKK R++E
Sbjct  337  EMAGIFEDPTKSLWEQKEWIKNRMLQLQEQRVTIMAQGFELEKQRFKWLRYSSKKGRDLE  396

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
              ++ N+R  LEN+RMVL L QKELEL
Sbjct  397  NSRLENERLGLENERMVLELKQKELEL  423



>ref|XP_006365820.1| PREDICTED: uncharacterized protein LOC102578195 [Solanum tuberosum]
Length=459

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++NDI+G+GT+C VVEN  L++++  LS K K+  KK+LNSKHLF+REM
Sbjct  189  DKFNDLNKRYKKLNDILGRGTSCAVVENPVLMDSMPQLSAKAKDTVKKILNSKHLFYREM  248

Query  179  CAYHN  193
            CAYHN
Sbjct  249  CAYHN  253


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 67/103 (65%), Gaps = 6/103 (6%)
 Frame = +2

Query  464  SAMVLQQLSG------ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQ  625
            +   L Q++G      E+    +D T+S  +++ WIK R +QLEE+++  ++EA ELEK+
Sbjct  326  NGSFLPQINGNDNFLAEINEFFQDPTKSQWDQKMWIKKRMLQLEEEKIGIQAEAFELEKR  385

Query  626  RVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            +VKW++F  KK+RE E E++ N++  LEN+ M L L  K+ EL
Sbjct  386  QVKWQRFCRKKDREFEIERLENKKLMLENEHMALQLKHKQHEL  428



>ref|XP_002273284.1| PREDICTED: stress response protein nst1-like isoform X2 [Vitis 
vinifera]
Length=451

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT C+VVEN  L++++  LS KMK++ KK+L+SKHLF++EM
Sbjct  181  DKFNDLNKRYKRLNEILGRGTTCRVVENPALMDSMPQLSAKMKDDVKKILSSKHLFYQEM  240

Query  179  CAYHN  193
            CAYHN
Sbjct  241  CAYHN  245


 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + ED T+S  E++ WIK R +QL+EQRV   ++  ELEKQR KW ++SSKK R++E
Sbjct  334  EMAGIFEDPTKSLWEQKEWIKNRMLQLQEQRVTIMAQGFELEKQRFKWLRYSSKKGRDLE  393

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
              ++ N+R  LEN+RMVL L QKELEL
Sbjct  394  NSRLENERLGLENERMVLELKQKELEL  420



>ref|XP_004252856.1| PREDICTED: uncharacterized protein LOC101246904 [Solanum lycopersicum]
Length=460

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++NDI+G+GT+C VVEN  L++++  LS K K+  KK+LNSKHLF+REM
Sbjct  190  DKFNDLNKRYKKLNDILGRGTSCAVVENPVLMDSMPQLSAKAKDTVKKILNSKHLFYREM  249

Query  179  CAYHN  193
            CAYHN
Sbjct  250  CAYHN  254


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 66/103 (64%), Gaps = 6/103 (6%)
 Frame = +2

Query  464  SAMVLQQLSG------ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQ  625
            +   L Q++G      E+     D T+S  +K+ WIK R +QLEE+++  ++EA ELEK+
Sbjct  327  NGYFLPQINGNDNFLAEINEFFHDPTKSQWDKKMWIKKRMLQLEEEKIGIQAEAFELEKR  386

Query  626  RVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            +VKW++F  KK+RE E E++ N++  LEN+ M L L  K+ EL
Sbjct  387  QVKWQRFCRKKDREFEIERLENKKLMLENEHMALQLKHKQHEL  429



>gb|EMT18117.1| hypothetical protein F775_19888 [Aegilops tauschii]
Length=444

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VV+N  LL+ + +LS KMKE+A+K+LNSKHLF+  M
Sbjct  183  DKFNDLNKRYKRLTDILGRGTACNVVDNPALLDCMNNLSDKMKEDARKILNSKHLFYEMM  242

Query  179  CAYHN  193
            C+YHN
Sbjct  243  CSYHN  247



>dbj|BAK02398.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VV+N  LL+ + +LS KMKE+A+K+LNSKHLF+  M
Sbjct  180  DKFNDLNKRYKRLTDILGRGTACTVVDNPALLDCMSNLSDKMKEDARKILNSKHLFYEMM  239

Query  179  CAYHN  193
            C+YHN
Sbjct  240  CSYHN  244



>gb|EMS59212.1| hypothetical protein TRIUR3_11128 [Triticum urartu]
Length=436

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GT CKVVEN  LL+ +D LS K+K++A+K+L+S+HLF+ EM
Sbjct  179  DKFNDLNKRYKRLTDILGRGTTCKVVENPALLDRMDNLSDKLKDDARKILSSRHLFYEEM  238

Query  179  CAYHN  193
            C+YHN
Sbjct  239  CSYHN  243



>gb|EMS60166.1| hypothetical protein TRIUR3_08128 [Triticum urartu]
Length=442

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VV+N  LL+ + +LS KMKE+A+K+LNSKHLF+  M
Sbjct  181  DKFNDLNKRYKRLTDILGRGTACNVVDNPALLDCMNNLSDKMKEDARKILNSKHLFYEMM  240

Query  179  CAYHN  193
            C+YHN
Sbjct  241  CSYHN  245



>ref|NP_001143969.1| uncharacterized protein LOC100276786 [Zea mays]
 gb|ACG36810.1| hypothetical protein [Zea mays]
Length=436

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VV N  LL+++  LS KMK++AKK+L+SKHLF+ EM
Sbjct  179  DKFNDLNKRYKRLTDILGRGTACNVVANPALLDSMTHLSDKMKDDAKKILSSKHLFYEEM  238

Query  179  CAYHN  193
            C+YHN
Sbjct  239  CSYHN  243



>ref|XP_008667671.1| PREDICTED: uncharacterized protein LOC100276786 isoform X1 [Zea 
mays]
Length=436

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VV N  LL+++  LS KMK++AKK+L+SKHLF+ EM
Sbjct  179  DKFNDLNKRYKRLTDILGRGTACNVVANPALLDSMTHLSDKMKDDAKKILSSKHLFYEEM  238

Query  179  CAYHN  193
            C+YHN
Sbjct  239  CSYHN  243



>gb|EMT09164.1| hypothetical protein F775_06500 [Aegilops tauschii]
Length=442

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GT CKVVEN  LL+ +D LS K+K++A+K+L+S+HLF+ EM
Sbjct  179  DKFNDLNKRYKRLTDILGRGTTCKVVENPALLDRMDNLSDKLKDDARKILSSRHLFYEEM  238

Query  179  CAYHN  193
            C+YHN
Sbjct  239  CSYHN  243



>ref|XP_007041596.1| Uncharacterized protein TCM_006441 [Theobroma cacao]
 gb|EOX97427.1| Uncharacterized protein TCM_006441 [Theobroma cacao]
Length=447

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFN+LNK Y+R+ND++G+GT+CKVVEN  LL+ +DLS K KE+ +K+L SKHLFF EMC
Sbjct  149  DKFNNLNKTYRRLNDLLGRGTSCKVVENPKLLDIIDLSEKGKEDVRKILTSKHLFFEEMC  208

Query  182  AYHN  193
            +YHN
Sbjct  209  SYHN  212



>ref|XP_010102326.1| hypothetical protein L484_015274 [Morus notabilis]
 gb|EXB93287.1| hypothetical protein L484_015274 [Morus notabilis]
Length=452

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT+C+VVEN  L++++  LS K K++ +K+L+SKHLF++EM
Sbjct  184  DKFNDLNKRYKRLNDILGRGTSCRVVENPALMDSMPHLSAKAKDDVRKILSSKHLFYKEM  243

Query  179  CAYHN  193
            CAYHN
Sbjct  244  CAYHN  248


 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +2

Query  485  LSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskker  664
              GE+    +D T+S  E+R W+K + MQLE QRV  ++EALELEKQR +W ++ SKK+R
Sbjct  332  FEGEMARFFQDPTKSLWERREWVKKQMMQLEVQRVNVQAEALELEKQRFRWLRYCSKKDR  391

Query  665  emerekmmnqrkkLENDRMVLLLHQKELEL  754
            E+ER ++ N+R KLEN+R VL L QKELEL
Sbjct  392  ELERLRLENERMKLENERKVLQLRQKELEL  421



>ref|XP_010069064.1| PREDICTED: uncharacterized protein LOC104456045 [Eucalyptus grandis]
Length=461

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  41   NDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMCAYHN  193
            NDI+GKGTAC+VVENQ+LLE +DLS KMKEE KKLLNSKHLFFREMCAYHN
Sbjct  165  NDILGKGTACRVVENQSLLEVMDLSTKMKEEVKKLLNSKHLFFREMCAYHN  215


 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +2

Query  470  MVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfs  649
            M +QQLSGE   + +D  RSP EK++W+K + +QLEEQRV Y+ +A ELEKQR+KW KFS
Sbjct  345  MFVQQLSGEATGVMQDGNRSPWEKKQWMKVKLVQLEEQRVSYQLQAYELEKQRLKWLKFS  404

Query  650  skkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQA-SYNRTSDPSSVTG  817
             KKER+MER K+ N+R++LEN+RMVLLL QKELEL +    Q  S N+ S+PSS+TG
Sbjct  405  GKKERDMERAKLENERRRLENERMVLLLRQKELELLDLQQQQQHSSNKRSEPSSITG  461



>ref|XP_007212531.1| hypothetical protein PRUPE_ppa019358mg, partial [Prunus persica]
 gb|EMJ13730.1| hypothetical protein PRUPE_ppa019358mg, partial [Prunus persica]
Length=402

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT+C+VVEN  L++++  LS K K++ +K+L+SKHLF++EM
Sbjct  160  DKFNDLNKRYKRLNDILGRGTSCRVVENPALMDSMPHLSAKAKDDVRKILSSKHLFYKEM  219

Query  179  CAYHN  193
            CAYHN
Sbjct  220  CAYHN  224


 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 3/110 (3%)
 Frame = +2

Query  434  RKKARKTES--WSAMVL-QQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESE  604
            RKKA + +   W   VL      E+  + +D T+S  E+R WIK + +QLEEQRV +++E
Sbjct  290  RKKASEEDGHFWPQYVLLDSFEVEMGEIFQDPTKSLWERRDWIKKQKLQLEEQRVGFQAE  349

Query  605  ALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            ALELEKQR KW ++ SKK+RE+ER ++ N+R KLEN+R VL L QKELE+
Sbjct  350  ALELEKQRYKWLRYCSKKDRELERLRLENERMKLENERKVLQLRQKELEI  399



>ref|XP_002302181.2| hypothetical protein POPTR_0002s06930g [Populus trichocarpa]
 gb|EEE81454.2| hypothetical protein POPTR_0002s06930g [Populus trichocarpa]
Length=420

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ND++G+GT+C+VVEN  LL+ +D L+ K K++ +K+LNSKHLF+ EM
Sbjct  183  DKFNDLNKRYKRLNDMLGRGTSCQVVENPALLDVIDYLTEKEKDDVRKILNSKHLFYEEM  242

Query  179  CAYHN  193
            C+YHN
Sbjct  243  CSYHN  247



>ref|XP_002532431.1| transcription factor, putative [Ricinus communis]
 gb|EEF29946.1| transcription factor, putative [Ricinus communis]
Length=445

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT+C+VVEN  LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  182  DKFNDLNKRYKRLNDILGRGTSCQVVENPALLDVIDFLTEKAKDDVRKILSSKHLFYEEM  241

Query  179  CAYHN  193
            C+YHN
Sbjct  242  CSYHN  246


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +2

Query  458  SWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKW  637
            S+S + + Q+  ++  M  +STR+ + +++W+++ T+QLEEQ+++ + E LELEKQR KW
Sbjct  346  SYSHLQIPQV--DINQMSSESTRAALLQKQWMESCTLQLEEQKLQIQLEMLELEKQRFKW  403

Query  638  ekfsskkeremerekmmnqrkkLENDRMVLLLHQKEL  748
            ++FS K++ E+E+ ++ N+R KLEN+RM L L +KE+
Sbjct  404  KRFSRKRDHELEKLRLENERMKLENERMALELKRKEM  440



>ref|XP_009413538.1| PREDICTED: uncharacterized protein LOC103994824 [Musa acuminata 
subsp. malaccensis]
Length=424

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GT+CKVVEN  LL+ + +LS KMK++ +K+L+SKHLF+ EM
Sbjct  165  DKFNDLNKRYKRLTDILGRGTSCKVVENPALLDRMSNLSEKMKDDVRKILSSKHLFYEEM  224

Query  179  CAYHN  193
            C+YHN
Sbjct  225  CSYHN  229



>ref|XP_008227154.1| PREDICTED: uncharacterized protein LOC103326696 [Prunus mume]
Length=449

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT+C+VVEN  L++++  LS K K++ +K+L+SKHLF++EM
Sbjct  184  DKFNDLNKRYKRLNDILGRGTSCRVVENPALMDSMPHLSAKAKDDVRKILSSKHLFYKEM  243

Query  179  CAYHN  193
            CAYHN
Sbjct  244  CAYHN  248


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = +2

Query  434  RKKARKTES--WSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEA  607
            RKKA + +   W   VL     E+  + +D T+S  E+R WIK + +QL+EQRV +++EA
Sbjct  314  RKKASEEDVHFWPQYVLDSFEVEMGEIFQDPTKSLWERRDWIKKQKLQLQEQRVGFQAEA  373

Query  608  LELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            LELEKQR KW ++ SKK+RE+ER ++ N+R KLEN+R +L L QKELE+
Sbjct  374  LELEKQRYKWLRYCSKKDRELERLRLENERMKLENERKLLHLRQKELEI  422



>ref|XP_011042849.1| PREDICTED: uncharacterized protein LOC105138468 [Populus euphratica]
Length=447

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ND++G+GT+C+VVEN  LL+ +D L+ K K++ +K+LNSKHLF+ EM
Sbjct  183  DKFNDLNKRYKRLNDMLGRGTSCQVVENPALLDVIDYLTEKEKDDVRKILNSKHLFYEEM  242

Query  179  CAYHN  193
            C+YHN
Sbjct  243  CSYHN  247


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 75/106 (71%), Gaps = 3/106 (3%)
 Frame = +2

Query  431  SRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEAL  610
            SR+  + + S+  +  Q    ++  +  +S R+   +++W+++RT+QLEE++++ + E L
Sbjct  340  SREPNKGSSSYHPLAAQV---DVNQVSSESARAVWLQKQWMESRTLQLEERKLQIQQEML  396

Query  611  ELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKEL  748
            ELEKQR KW++FS K++RE+E+ +M N+R KLEND+M L L +KE+
Sbjct  397  ELEKQRFKWQRFSKKRDRELEKLRMENERMKLENDQMALELKRKEM  442



>ref|XP_002266272.1| PREDICTED: uncharacterized protein LOC100259010 [Vitis vinifera]
Length=440

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ND++G+GT+C+VVEN  LL+ +D L+ K KE+ +K+L+SKHLF+ EM
Sbjct  180  DKFNDLNKRYKRLNDVLGRGTSCQVVENPALLDMMDHLTEKTKEDVRKILSSKHLFYEEM  239

Query  179  CAYHN  193
            C+YHN
Sbjct  240  CSYHN  244



>ref|XP_010673612.1| PREDICTED: uncharacterized protein LOC104889964 [Beta vulgaris 
subsp. vulgaris]
Length=458

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++NDI+G+GT+C+VVEN +L++ +  L+ K K+E KK+L+SKHLF+REM
Sbjct  188  DKFNDLNKRYKKLNDILGRGTSCQVVENPSLMDAMPHLTEKAKDEVKKILSSKHLFYREM  247

Query  179  CAYHN  193
            CA+HN
Sbjct  248  CAFHN  252


 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 69/93 (74%), Gaps = 3/93 (3%)
 Frame = +2

Query  521  TRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrk  700
            T+SP E+R  I+ R +QLE Q+V  ++EAL++EKQR+KW +F SKK+RE+E+ ++ N R 
Sbjct  350  TKSPTEQRAQIQHRMLQLEMQKVRLQAEALDIEKQRLKWLRFRSKKDRELEKLRLENDRM  409

Query  701  kLENDRMVLLLHQKELELKNGVH-HQASYNRTS  796
            KLENDRMVLLL QKE+ L  G+   + S  RTS
Sbjct  410  KLENDRMVLLLKQKEMVL--GMQKSETSLERTS  440



>ref|NP_001047068.1| Os02g0542400 [Oryza sativa Japonica Group]
 dbj|BAD28229.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08982.1| Os02g0542400 [Oryza sativa Japonica Group]
 gb|EAY86202.1| hypothetical protein OsI_07578 [Oryza sativa Indica Group]
 gb|EAZ23363.1| hypothetical protein OsJ_07059 [Oryza sativa Japonica Group]
Length=410

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ +I+G+GTAC+VVE+  LLE + LS K+KEEA+K LNSKHL + EMC
Sbjct  160  DKFNDLNKRYKRMTEILGRGTACQVVEHPELLEGMRLSGKLKEEARKHLNSKHLHYEEMC  219

Query  182  AYHN  193
            +YHN
Sbjct  220  SYHN  223



>gb|EPS69845.1| hypothetical protein M569_04922, partial [Genlisea aurea]
Length=295

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN +LL+ +D +S K KEE +K+L+SKHL++ EM
Sbjct  70   DKFNDLNKRYKRLNEILGRGTSCEVVENPSLLDMMDHVSNKEKEEVRKILSSKHLYYEEM  129

Query  179  CAYHN  193
            C+YHN
Sbjct  130  CSYHN  134



>gb|EPS68099.1| hypothetical protein M569_06676, partial [Genlisea aurea]
Length=207

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT C+VVEN +LL+ +D +S K+K+E KK+L+SKHL + EM
Sbjct  96   DKFNDLNKRYKRLNEILGRGTCCEVVENPSLLDLMDHVSEKLKDEVKKILSSKHLHYEEM  155

Query  179  CAYHN  193
            C+YHN
Sbjct  156  CSYHN  160



>ref|XP_008237585.1| PREDICTED: uncharacterized protein LOC103336322 [Prunus mume]
Length=445

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVENQ LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  182  DKFNDLNKRYKKLNDMLGRGTSCQVVENQALLDVIDYLTEKEKDDVRKILSSKHLFYEEM  241

Query  179  CAYHN  193
            C+YHN
Sbjct  242  CSYHN  246


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            ++  +  D T++   +++WI++R++QLEEQ+++ + E LELEKQ  KW++FS K++RE+E
Sbjct  356  DMNQVLPDGTKAAWLQKQWIESRSLQLEEQKLQIQVEMLELEKQHFKWQRFSKKRDRELE  415

Query  674  rekmmnqrkkLENDRMVLLLHQKEL  748
            + +M N+R KLEN+RM L L +KE+
Sbjct  416  KLRMENERMKLENERMALELKRKEM  440



>ref|XP_008441519.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103485620 
[Cucumis melo]
Length=449

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDIIG+GT+C+VVEN  LL+ +D L+ K K++ +K+LNSK LF+ EM
Sbjct  182  DKFNDLNKRYKRLNDIIGRGTSCQVVENPALLDVIDYLTEKDKDDVRKILNSKQLFYEEM  241

Query  179  CAYHN  193
            C+YHN
Sbjct  242  CSYHN  246



>ref|XP_004160309.1| PREDICTED: uncharacterized protein LOC101232034 [Cucumis sativus]
Length=449

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDIIG+GT+C+VVEN  LL+ +D L+ K K++ +K+LNSK LF+ EM
Sbjct  182  DKFNDLNKRYKRLNDIIGRGTSCQVVENPALLDVIDYLTEKDKDDVRKILNSKQLFYEEM  241

Query  179  CAYHN  193
            C+YHN
Sbjct  242  CSYHN  246



>ref|XP_007200864.1| hypothetical protein PRUPE_ppa1027145mg [Prunus persica]
 gb|EMJ02063.1| hypothetical protein PRUPE_ppa1027145mg [Prunus persica]
Length=445

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVENQ LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  182  DKFNDLNKRYKKLNDMLGRGTSCQVVENQALLDVIDYLTEKEKDDVRKILSSKHLFYEEM  241

Query  179  CAYHN  193
            C+YHN
Sbjct  242  CSYHN  246


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            ++  +  D T++   +++WI++R++QLEEQ+++ + E LELEKQR KW++FS K++RE+E
Sbjct  356  DMNQVLPDGTKAAWLQKQWIESRSLQLEEQKLQIQVEMLELEKQRFKWQRFSKKRDRELE  415

Query  674  rekmmnqrkkLENDRMVLLLHQKEL  748
            + +M N+R KLEN+RM L L +KE+
Sbjct  416  KLRMENERMKLENERMALELKRKEM  440



>ref|XP_004140967.1| PREDICTED: uncharacterized protein LOC101203313 [Cucumis sativus]
 gb|KGN46144.1| hypothetical protein Csa_6G057100 [Cucumis sativus]
Length=449

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDIIG+GT+C+VVEN  LL+ +D L+ K K++ +K+LNSK LF+ EM
Sbjct  182  DKFNDLNKRYKRLNDIIGRGTSCQVVENPALLDVIDYLTEKDKDDVRKILNSKQLFYEEM  241

Query  179  CAYHN  193
            C+YHN
Sbjct  242  CSYHN  246



>ref|XP_007014993.1| Sequence-specific DNA binding transcription factors [Theobroma 
cacao]
 gb|EOY32612.1| Sequence-specific DNA binding transcription factors [Theobroma 
cacao]
Length=454

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++NDI+G+GT+C+VVEN +L++++  LS K K++ KK+L+SKHLF+ EM
Sbjct  183  DKFNDLNKRYKKLNDILGRGTSCRVVENPSLMDSMPHLSAKAKDDVKKILSSKHLFYPEM  242

Query  179  CAYHN  193
            CAYHN
Sbjct  243  CAYHN  247


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 81/129 (63%), Gaps = 8/129 (6%)
 Frame = +2

Query  434  RKKARKTES--WSAMVLQQ-LSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESE  604
            RKKA   E   WS    Q  L  E+  +  D TRS +E++ WIK + +QL+E+RV  + E
Sbjct  314  RKKASAEEGHFWSQSAEQDSLKVEMAGIFHDPTRSSLERKEWIKRQILQLQEERVNLQVE  373

Query  605  ALELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASY  784
              ELEKQR KW ++ +KK RE+ER ++ N+R +LEN+R +L L QKELE+  G     S 
Sbjct  374  GFELEKQRFKWLRYCNKKGRELERLRLENERMRLENERSLLQLRQKELEV--GFR---SS  428

Query  785  NRTSDPSSV  811
            + + DP+S+
Sbjct  429  DASLDPTSL  437



>ref|XP_004516631.1| PREDICTED: uncharacterized protein LOC101514780 [Cicer arietinum]
Length=447

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ND++G+GT+C+VVEN  LL+ ++ LS K K++ +K+LNSKHLF+ EM
Sbjct  182  DKFNDLNKRYKRLNDMLGRGTSCQVVENPALLDVINYLSEKEKDDVRKILNSKHLFYEEM  241

Query  179  CAYHN  193
            C+YHN
Sbjct  242  CSYHN  246



>ref|XP_010912425.1| PREDICTED: uncharacterized protein LOC105038344 isoform X2 [Elaeis 
guineensis]
Length=404

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTACKVVEN  LL+ +  +S K+K++ KK+L+SKHLF+ EM
Sbjct  145  DKFNDLNKRYKRLVDILGRGTACKVVENPALLDQMKHISDKLKDDVKKILSSKHLFYEEM  204

Query  179  CAYHN  193
            C+YHN
Sbjct  205  CSYHN  209



>ref|XP_002306694.2| hypothetical protein POPTR_0005s21390g [Populus trichocarpa]
 gb|EEE93690.2| hypothetical protein POPTR_0005s21390g [Populus trichocarpa]
Length=412

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ND++G+GT+C+VVEN  LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  183  DKFNDLNKRYKRLNDMLGRGTSCQVVENPALLDVIDYLTEKDKDDVRKILSSKHLFYEEM  242

Query  179  CAYHN  193
            C+YHN
Sbjct  243  CSYHN  247


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            ++  +  +S+R+   +++W+++RT++LEEQ ++ + E LELEKQR KW++FS K++RE+E
Sbjct  323  DMNQVSPESSRASWLQKQWMESRTLELEEQNLKIQQEMLELEKQRFKWQRFSKKRDRELE  382

Query  674  rekmmnqrkkLENDRMVLLLHQKEL  748
            + +M N+R KLEN+RM L L +KE+
Sbjct  383  KLRMENERMKLENERMTLELKRKEM  407



>emb|CDM81777.1| unnamed protein product [Triticum aestivum]
Length=496

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKRV +++G+GTAC VV N  LL+T+ +L+ K KEEA+KLL SK LFFREM
Sbjct  187  DKFNDLNKRYKRVVELLGRGTACNVVANPALLDTMGELTAKAKEEARKLLRSKRLFFREM  246

Query  179  CAYHN  193
            C YHN
Sbjct  247  CHYHN  251



>ref|XP_004978760.1| PREDICTED: uncharacterized protein LOC101780231 isoform X1 [Setaria 
italica]
 ref|XP_004978761.1| PREDICTED: uncharacterized protein LOC101780231 isoform X2 [Setaria 
italica]
Length=434

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VVE   LL++++ LS KMK++ KKLLNSK LFF EM
Sbjct  176  DKFNDLNKRYKRLIDILGRGTACDVVEKPELLDSMNHLSDKMKDDVKKLLNSKQLFFEEM  235

Query  179  CAYHN  193
            C+YHN
Sbjct  236  CSYHN  240



>ref|XP_002441874.1| hypothetical protein SORBIDRAFT_08g003990 [Sorghum bicolor]
 gb|EES15712.1| hypothetical protein SORBIDRAFT_08g003990 [Sorghum bicolor]
Length=447

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GT C+VV N  LL+ + +LS KMK++A+K+L+SKHLF+ EM
Sbjct  181  DKFNDLNKRYKRLTDILGRGTTCRVVANPELLDGMTNLSDKMKDDARKILSSKHLFYEEM  240

Query  179  CAYHN  193
            C+YHN
Sbjct  241  CSYHN  245



>ref|XP_010912419.1| PREDICTED: uncharacterized protein LOC105038344 isoform X1 [Elaeis 
guineensis]
 ref|XP_010912421.1| PREDICTED: uncharacterized protein LOC105038344 isoform X1 [Elaeis 
guineensis]
 ref|XP_010912422.1| PREDICTED: uncharacterized protein LOC105038344 isoform X1 [Elaeis 
guineensis]
 ref|XP_010912423.1| PREDICTED: uncharacterized protein LOC105038344 isoform X1 [Elaeis 
guineensis]
 ref|XP_010912424.1| PREDICTED: uncharacterized protein LOC105038344 isoform X1 [Elaeis 
guineensis]
Length=429

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTACKVVEN  LL+ +  +S K+K++ KK+L+SKHLF+ EM
Sbjct  170  DKFNDLNKRYKRLVDILGRGTACKVVENPALLDQMKHISDKLKDDVKKILSSKHLFYEEM  229

Query  179  CAYHN  193
            C+YHN
Sbjct  230  CSYHN  234



>ref|XP_007152028.1| hypothetical protein PHAVU_004G095500g [Phaseolus vulgaris]
 gb|ESW24022.1| hypothetical protein PHAVU_004G095500g [Phaseolus vulgaris]
Length=442

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVE+ +LL+ +D LS K KEE +K+L+SKHLF+ EM
Sbjct  178  DKFNDLNKRYKKLNDMLGRGTSCQVVESPSLLDVIDYLSEKEKEEVRKILSSKHLFYEEM  237

Query  179  CAYHN  193
            C+YHN
Sbjct  238  CSYHN  242



>gb|ACR37608.1| unknown [Zea mays]
Length=328

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 55/65 (85%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GT C+VV N  LL+ + +LS KMK+ A+K+L+SKHLF+ EM
Sbjct  63   DKFNDLNKRYKRLTDILGRGTTCRVVANPELLDGMANLSDKMKDAARKILSSKHLFYEEM  122

Query  179  CAYHN  193
            C+YHN
Sbjct  123  CSYHN  127



>emb|CAN65038.1| hypothetical protein VITISV_021706 [Vitis vinifera]
Length=601

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ND++G+GT+C+VVEN  LL+ +D L+ K KE+ +K+L+SKHLF+ EM
Sbjct  180  DKFNDLNKRYKRLNDVLGRGTSCQVVENPALLDMMDHLTEKTKEDVRKILSSKHLFYEEM  239

Query  179  CAYHN  193
            C+YHN
Sbjct  240  CSYHN  244



>ref|XP_003577819.1| PREDICTED: uncharacterized protein LOC100846758 [Brachypodium 
distachyon]
Length=422

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G G AC VV N  LL+ +D LS KMKE+A+K+L+SKHLF+ EM
Sbjct  172  DKFNDLNKRYKRLTDILGCGIACDVVGNPALLDGMDNLSDKMKEDARKILSSKHLFYEEM  231

Query  179  CAYHN  193
            C+YHN
Sbjct  232  CSYHN  236



>ref|NP_001142484.1| uncharacterized protein LOC100274707 [Zea mays]
 gb|ACG24316.1| hypothetical protein [Zea mays]
Length=446

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GT C+VV N  LL+ + +LS KMK++A+K+L+SKHLF+ EM
Sbjct  181  DKFNDLNKRYKRLTDILGRGTTCRVVANPELLDGMANLSDKMKDDARKILSSKHLFYEEM  240

Query  179  CAYHN  193
            C+YHN
Sbjct  241  CSYHN  245



>ref|XP_011044210.1| PREDICTED: uncharacterized protein LOC105139468 [Populus euphratica]
Length=447

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ND++G+GT+C+VVEN  LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  183  DKFNDLNKRYKRLNDMLGRGTSCQVVENPALLDVIDYLTEKDKDDVRKILSSKHLFYEEM  242

Query  179  CAYHN  193
            C+YHN
Sbjct  243  CSYHN  247


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 73/106 (69%), Gaps = 2/106 (2%)
 Frame = +2

Query  431  SRKKARKTESWSAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEAL  610
            S +   K  S+S   + Q+  ++  +  +S+R+   +++W+++RT+QLEEQ ++ + E L
Sbjct  339  SSQDPNKVSSYSHPQIAQV--DMNQVSPESSRASWLQKQWMESRTLQLEEQNLKIQQEML  396

Query  611  ELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKEL  748
            ELEKQR KW++FS K++ E+E+ +M N+R KLEN+RM L L  KE+
Sbjct  397  ELEKQRFKWQRFSKKRDHELEKLRMENERMKLENERMALELKHKEM  442



>ref|XP_006854556.1| hypothetical protein AMTR_s00030p00089780 [Amborella trichopoda]
 gb|ERN16023.1| hypothetical protein AMTR_s00030p00089780 [Amborella trichopoda]
Length=429

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ D++G+GT+CKVVE+  LL+ +D LS K KE+ +K+L+SKHLF+ EM
Sbjct  158  DKFNDLNKRYKRLTDVLGRGTSCKVVEHPALLDLMDHLSEKTKEDVRKILSSKHLFYEEM  217

Query  179  CAYHN  193
            C+YHN
Sbjct  218  CSYHN  222


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  485  LSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskker  664
             + E+  + +D T++   +R+WI+ RT+QLEEQ +  +++ LELEKQR KW+KFS KK+R
Sbjct  337  FASEMNQIMQDGTKAAWAQRQWIRNRTLQLEEQSLSIQAQMLELEKQRFKWQKFSRKKDR  396

Query  665  emerekmmnqrkkLENDRMVLLLHQKELE  751
            E+ + +M N+R KL N+R+ L L +KELE
Sbjct  397  ELSKMRMENERMKLANERLTLELKRKELE  425



>ref|XP_002299233.2| hypothetical protein POPTR_0001s05670g, partial [Populus trichocarpa]
 gb|EEE84038.2| hypothetical protein POPTR_0001s05670g, partial [Populus trichocarpa]
Length=417

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT C+VVEN  L++++  LS K K++ +K+L SKHLF++EM
Sbjct  156  DKFNDLNKRYKRLNEILGRGTTCRVVENPVLMDSMPHLSAKAKDDVRKILGSKHLFYKEM  215

Query  179  CAYHN  193
            CAYHN
Sbjct  216  CAYHN  220


 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 9/104 (9%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D   SP E++ WIK + +QL EQRV  +++  ELEKQR KW ++ SKK++E E
Sbjct  313  EMAAIFQDPAVSPWERKEWIKKQRLQLLEQRVSIQAQTFELEKQRFKWLRYCSKKDKEFE  372

Query  674  rekmmnqrkkLENDRMVLLLHQKELELKNGVHHQASYNRTSDPS  805
            R ++ N+ +KLEN++  L L QK+LE+           R+S+PS
Sbjct  373  RLRLENEWRKLENEQSALQLRQKQLEMD---------FRSSEPS  407



>gb|EYU36855.1| hypothetical protein MIMGU_mgv1a007325mg [Erythranthe guttata]
Length=411

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN +LLE +D +S K K+E +K+L+SKHL + EM
Sbjct  178  DKFNDLNKRYKRLNEILGRGTSCEVVENPSLLEVMDHISTKAKDEVRKILSSKHLHYEEM  237

Query  179  CAYHN  193
            C+YHN
Sbjct  238  CSYHN  242



>ref|XP_008677662.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=426

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G GTAC VV N  LL++++ LS KMK+ AKK+L+SKHLF+ EM
Sbjct  170  DKFNDLNKRYKRLIDILGMGTACNVVANPALLDSMNHLSDKMKDNAKKILSSKHLFYEEM  229

Query  179  CAYHN  193
            C+YHN
Sbjct  230  CSYHN  234



>gb|EMT16151.1| hypothetical protein F775_16013 [Aegilops tauschii]
Length=485

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK V D++G+GTAC VV N  LL+T+ +L+ K KEEA+K+L SK LFFREM
Sbjct  197  DKFNDLNKRYKGVVDLLGRGTACDVVANPALLDTMGELTAKSKEEARKMLRSKRLFFREM  256

Query  179  CAYHN  193
            C YHN
Sbjct  257  CNYHN  261



>ref|NP_001170044.1| hypothetical protein [Zea mays]
 ref|XP_008677660.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008677661.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN35616.1| unknown [Zea mays]
 gb|AFW65617.1| hypothetical protein ZEAMMB73_122216 [Zea mays]
 gb|AFW65618.1| hypothetical protein ZEAMMB73_122216 [Zea mays]
 gb|AFW65619.1| hypothetical protein ZEAMMB73_122216 [Zea mays]
 gb|AIB05439.1| trihelix transcription factor [Zea mays]
Length=436

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G GTAC VV N  LL++++ LS KMK+ AKK+L+SKHLF+ EM
Sbjct  180  DKFNDLNKRYKRLIDILGMGTACNVVANPALLDSMNHLSDKMKDNAKKILSSKHLFYEEM  239

Query  179  CAYHN  193
            C+YHN
Sbjct  240  CSYHN  244



>ref|XP_003578873.1| PREDICTED: uncharacterized protein LOC100835589 [Brachypodium 
distachyon]
 ref|XP_010238688.1| PREDICTED: uncharacterized protein LOC100835589 [Brachypodium 
distachyon]
Length=429

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GT C+VV N  LL+ +D LS K+K++A+K+L+S+HLF+ EM
Sbjct  167  DKFNDLNKRYKRLTDILGRGTTCRVVANPALLDHMDNLSDKLKDDARKILSSRHLFYEEM  226

Query  179  CAYHN  193
            C+YHN
Sbjct  227  CSYHN  231



>ref|NP_001168394.1| hypothetical protein [Zea mays]
 ref|XP_008677548.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28071.1| unknown [Zea mays]
 gb|AFW62567.1| hypothetical protein ZEAMMB73_488031 [Zea mays]
 gb|AFW62568.1| hypothetical protein ZEAMMB73_488031 [Zea mays]
Length=398

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ +I+G+G AC++VE   LLE L LS K++EEAKK LNSKHL + EMC
Sbjct  147  DKFNDLNKRYKRLTEILGRGRACQIVEKPELLEQLSLSGKLREEAKKHLNSKHLHYEEMC  206

Query  182  AYHN  193
            +YHN
Sbjct  207  SYHN  210



>ref|XP_010539734.1| PREDICTED: uncharacterized protein LOC104813711 [Tarenaya hassleriana]
Length=434

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ +D LS K K++ +K+L+SKHLF+ EM
Sbjct  182  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDVIDYLSEKEKDDVRKILSSKHLFYEEM  241

Query  179  CAYHN  193
            C+YHN
Sbjct  242  CSYHN  246


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  515  DSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnq  694
            +S R+   +++WI++R++QLEEQ+++ ++E LELEKQR KW++FS K+++E+E+ +M NQ
Sbjct  353  ESGRAAWLQKQWIESRSLQLEEQKLQIQAELLELEKQRFKWQRFSKKRDQELEKMRMENQ  412

Query  695  rkkLENDRMVLLLHQKEL  748
            R KLEN+RM L L ++E+
Sbjct  413  RMKLENERMALELKRREM  430



>ref|XP_003556151.1| PREDICTED: uncharacterized protein LOC100816474 [Glycine max]
 gb|KHN46420.1| hypothetical protein glysoja_031738 [Glycine soja]
Length=445

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ +D LS K K++ +K+L+SKHLF+ EM
Sbjct  180  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDVIDFLSEKEKDDVRKILSSKHLFYEEM  239

Query  179  CAYHN  193
            C+YHN
Sbjct  240  CSYHN  244



>ref|XP_010087144.1| hypothetical protein L484_007394 [Morus notabilis]
 gb|EXB27049.1| hypothetical protein L484_007394 [Morus notabilis]
Length=511

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ND++G+GT+C+VVEN  LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  181  DKFNDLNKRYKRLNDMLGRGTSCQVVENPALLDVIDYLTEKEKDDVRKILSSKHLFYEEM  240

Query  179  CAYHN  193
            C+YHN
Sbjct  241  CSYHN  245


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +2

Query  461  WSAMVLQQLS-GELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKW  637
            +S   +QQL   ++ +   D TR    +++WI++R++QLEE++++ + E LELE+QR+KW
Sbjct  353  YSQPQVQQLGQTDMNHAPPDGTRVAWLQKQWIESRSLQLEERKLQIQVEMLELERQRLKW  412

Query  638  ekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            ++F+ K++RE+E+ +M N R KLEN+RM L L ++E+ L
Sbjct  413  QRFTKKRDRELEKLRMENVRMKLENERMALELKREEIGL  451



>ref|XP_009403682.1| PREDICTED: uncharacterized protein LOC103987182 [Musa acuminata 
subsp. malaccensis]
Length=418

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GT+CKVVEN +LL+ + +LS K K++ +K+L+SKHLF+ EM
Sbjct  158  DKFNDLNKRYKRLTDILGRGTSCKVVENPSLLDHMNNLSEKSKDDVRKILSSKHLFYEEM  217

Query  179  CAYHN  193
            C+YHN
Sbjct  218  CSYHN  222



>ref|XP_003536428.1| PREDICTED: uncharacterized protein LOC100812134 [Glycine max]
 gb|KHN17008.1| hypothetical protein glysoja_011482 [Glycine soja]
Length=444

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ +D LS K K++ +K+L+SKHLF+ EM
Sbjct  182  DKFNDLNKRYKKLNDMLGRGTSCQVVENPVLLDVIDFLSEKEKDDVRKILSSKHLFYEEM  241

Query  179  CAYHN  193
            C+YHN
Sbjct  242  CSYHN  246



>ref|XP_010536037.1| PREDICTED: pescadillo homolog [Tarenaya hassleriana]
Length=363

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++NDI+G+  +C VVEN +L++++  LS K K+E +K+LNSKHLF++EM
Sbjct  114  DKFNDLNKRYKKLNDILGRNISCSVVENPSLMDSMSHLSAKAKDEVRKILNSKHLFYKEM  173

Query  179  CAYHN  193
            CAYHN
Sbjct  174  CAYHN  178



>ref|XP_006473052.1| PREDICTED: uncharacterized protein LOC102612442 [Citrus sinensis]
Length=447

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN +LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  184  DKFNDLNKRYKKLNDMLGRGTSCQVVENPSLLDVIDFLTEKEKDDVRKILSSKHLFYEEM  243

Query  179  CAYHN  193
            C+YHN
Sbjct  244  CSYHN  248


 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +2

Query  464  SAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWek  643
            S+   Q    ++     +S +S   +++WI++R++QLEEQ+++ + E LELEKQR KW++
Sbjct  348  SSYPPQVAQADMNQALPESMKSSWLQKQWIESRSLQLEEQKLQIQVEMLELEKQRFKWQR  407

Query  644  fsskkeremerekmmnqrkkLENDRMVLLLHQKEL  748
            FS K++RE+E+ +M N+R KLEN+RM L L QKE+
Sbjct  408  FSKKRDRELEKLRMENERMKLENERMALELKQKEM  442



>ref|XP_006434454.1| hypothetical protein CICLE_v10001142mg [Citrus clementina]
 gb|ESR47694.1| hypothetical protein CICLE_v10001142mg [Citrus clementina]
 gb|KDO83724.1| hypothetical protein CISIN_1g013261mg [Citrus sinensis]
 gb|KDO83725.1| hypothetical protein CISIN_1g013261mg [Citrus sinensis]
Length=447

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN +LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  184  DKFNDLNKRYKKLNDMLGRGTSCQVVENPSLLDVIDFLTEKEKDDVRKILSSKHLFYEEM  243

Query  179  CAYHN  193
            C+YHN
Sbjct  244  CSYHN  248


 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +2

Query  464  SAMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWek  643
            S+   Q    ++     +S +S   +++WI++R++QLEEQ+++ + E LELEKQR KW++
Sbjct  348  SSYPPQVAQADMNQALPESMKSSWLQKQWIESRSLQLEEQKLQIQVEMLELEKQRFKWQR  407

Query  644  fsskkeremerekmmnqrkkLENDRMVLLLHQKEL  748
            FS K++RE+E+ +M N+R KLEN+RM L L QKE+
Sbjct  408  FSKKRDRELEKLRMENERMKLENERMALELKQKEM  442



>ref|XP_009799707.1| PREDICTED: uncharacterized protein LOC104245746 isoform X2 [Nicotiana 
sylvestris]
Length=405

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN  LL+ LD +S K KEE +K+L+SKHL + EM
Sbjct  140  DKFNDLNKRYKRLNEILGRGTSCEVVENPALLDVLDHVSEKGKEEVRKILSSKHLHYEEM  199

Query  179  CAYHN  193
            C+YHN
Sbjct  200  CSYHN  204



>ref|XP_002303892.2| hypothetical protein POPTR_0003s20370g [Populus trichocarpa]
 gb|EEE78871.2| hypothetical protein POPTR_0003s20370g [Populus trichocarpa]
Length=425

 Score = 95.9 bits (237),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN  L++++  LS K K++ +K+L+SKHLF++E+
Sbjct  156  DKFNDLNKRYKRLNEILGRGTSCRVVENPALMDSMPHLSAKAKDDVRKILSSKHLFYKEI  215

Query  179  CAYHN  193
            CAYHN
Sbjct  216  CAYHN  220


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D+  SP E++ WIK + +QL EQRV  +++A ELEKQ+ KW ++ SKK++E E
Sbjct  308  EMTAIFQDTNVSPWERKEWIKKQRLQLLEQRVNIKAQAFELEKQQFKWLRYCSKKDKEFE  367

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
            R ++ N+  +LEN +    L QK+LE+
Sbjct  368  RLRLENEMMRLENRQSAFQLRQKQLEM  394



>ref|XP_008661671.1| PREDICTED: uncharacterized protein LOC100274707 isoform X1 [Zea 
mays]
 ref|XP_008661672.1| PREDICTED: uncharacterized protein LOC100274707 isoform X1 [Zea 
mays]
 gb|AFW56163.1| hypothetical protein ZEAMMB73_082916 [Zea mays]
 gb|AIB05440.1| trihelix transcription factor [Zea mays]
Length=446

 Score = 95.9 bits (237),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 55/65 (85%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GT C+VV N  LL+ + +LS KMK+ A+K+L+SKHLF+ EM
Sbjct  181  DKFNDLNKRYKRLTDILGRGTTCRVVANPELLDGMANLSDKMKDAARKILSSKHLFYEEM  240

Query  179  CAYHN  193
            C+YHN
Sbjct  241  CSYHN  245



>ref|XP_008645772.1| PREDICTED: uncharacterized protein LOC103627263 [Zea mays]
 ref|XP_008645773.1| PREDICTED: uncharacterized protein LOC103627263 [Zea mays]
 gb|AFW71728.1| hypothetical protein ZEAMMB73_992910 [Zea mays]
Length=405

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ +I+G+G AC++VE   LLE + LS K++EEAKK LNSKHL + EMC
Sbjct  150  DKFNDLNKRYKRLTEILGRGRACQIVEKPELLEQVSLSAKLREEAKKHLNSKHLHYEEMC  209

Query  182  AYHN  193
            +YHN
Sbjct  210  SYHN  213



>gb|AIB05441.1| trihelix transcription factor [Zea mays]
Length=405

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ +I+G+G AC++VE   LLE + LS K++EEAKK LNSKHL + EMC
Sbjct  150  DKFNDLNKRYKRLTEILGRGRACQIVEKPELLEQVSLSAKLREEAKKHLNSKHLHYEEMC  209

Query  182  AYHN  193
            +YHN
Sbjct  210  SYHN  213



>ref|XP_002532438.1| transcription factor, putative [Ricinus communis]
 gb|EEF29953.1| transcription factor, putative [Ricinus communis]
Length=441

 Score = 95.9 bits (237),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  178  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDVIDYLTEKEKDDVRKILSSKHLFYEEM  237

Query  179  CAYHN  193
            C+YHN
Sbjct  238  CSYHN  242


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  521  TRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnqrk  700
            T++   +++W+++R +QLEEQ+++ + E LELEKQR KW++FS K++RE+E+ +M N+R 
Sbjct  361  TKAAWLQKQWMESRALQLEEQKLQIQIETLELEKQRFKWQRFSRKRDRELEKLRMENERM  420

Query  701  kLENDRMVLLLHQKELEL  754
            KLEN+RM L L QKE+ +
Sbjct  421  KLENERMALELKQKEISV  438



>ref|XP_008359235.1| PREDICTED: myb/SANT-like DNA-binding domain-containing protein 
4 [Malus domestica]
Length=440

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 55/65 (85%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+NDI+G+GT C+VVEN  L++ +  LS K  ++ +K+L+SKHLF++EM
Sbjct  175  DKFNDLNKRYKRLNDILGRGTTCRVVENPALMDAMPHLSAKAMDDVRKILSSKHLFYKEM  234

Query  179  CAYHN  193
            CAYHN
Sbjct  235  CAYHN  239


 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 77/109 (71%), Gaps = 3/109 (3%)
 Frame = +2

Query  437  KKARKTES--WSAMV-LQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEA  607
            KKAR+ +   W   V L     E+ +  +D+T+S  E+R WIK + +QLEEQRV + +EA
Sbjct  306  KKAREEDGHLWPQHVPLDSFEVEVGDCFQDTTKSLWERRDWIKKQKLQLEEQRVSFHAEA  365

Query  608  LELEKQRVKWekfsskkeremerekmmnqrkkLENDRMVLLLHQKELEL  754
            LE+EKQR KW ++ SKK+RE+ER ++ N+R KLEN+R VL L QKE+EL
Sbjct  366  LEIEKQRYKWLRYCSKKDRELERLRLENERMKLENERRVLQLRQKEVEL  414



>ref|XP_006446099.1| hypothetical protein CICLE_v10015189mg [Citrus clementina]
 gb|ESR59339.1| hypothetical protein CICLE_v10015189mg [Citrus clementina]
Length=458

 Score = 95.9 bits (237),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD---LSPKMKEEAKKLLNSKHLFFR  172
            DKFNDLNKRYK++NDI+GKG  C+VVEN  L++T+    LSPK K++ +K+L SKHLF++
Sbjct  186  DKFNDLNKRYKKLNDILGKGLTCQVVENPALIDTMSCSHLSPKAKDDVRKILGSKHLFYK  245

Query  173  EMCAYHN  193
            EM AYHN
Sbjct  246  EMFAYHN  252


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D ++S  E+R WIK + + L+ QRV  +++A ELEKQ +KW ++ SKK+RE+E
Sbjct  341  EMARIFQDPSKSMWERREWIKKQKLALQNQRVSIQAQAFELEKQHLKWLRYCSKKDRELE  400

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
            R ++ N+R +L+N++M+L L QK+ EL
Sbjct  401  RSRLENERIRLDNEQMILHLKQKQFEL  427



>ref|XP_009590354.1| PREDICTED: uncharacterized protein LOC104087550 isoform X2 [Nicotiana 
tomentosiformis]
Length=407

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN  LL+ LD +S K KEE +K+L+SKHL + EM
Sbjct  142  DKFNDLNKRYKRLNEILGRGTSCEVVENPVLLDMLDHVSEKGKEEVRKILSSKHLHYEEM  201

Query  179  CAYHN  193
            C+YHN
Sbjct  202  CSYHN  206



>ref|XP_009799706.1| PREDICTED: uncharacterized protein LOC104245746 isoform X1 [Nicotiana 
sylvestris]
Length=418

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN  LL+ LD +S K KEE +K+L+SKHL + EM
Sbjct  153  DKFNDLNKRYKRLNEILGRGTSCEVVENPALLDVLDHVSEKGKEEVRKILSSKHLHYEEM  212

Query  179  CAYHN  193
            C+YHN
Sbjct  213  CSYHN  217



>ref|XP_011101525.1| PREDICTED: uncharacterized protein LOC105179584 [Sesamum indicum]
Length=437

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN  LL+ +D +S K KEE +K+L+SKHL + EM
Sbjct  177  DKFNDLNKRYKRLNEILGRGTSCEVVENPALLDVMDHISEKAKEEVRKILSSKHLHYEEM  236

Query  179  CAYHN  193
            C+YHN
Sbjct  237  CSYHN  241



>ref|XP_008381817.1| PREDICTED: uncharacterized protein LOC103444641 [Malus domestica]
 ref|XP_008348746.1| PREDICTED: uncharacterized protein LOC103411910 [Malus domestica]
Length=447

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  184  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDVIDYLTEKEKDDVRKILSSKHLFYEEM  243

Query  179  CAYHN  193
            C+YHN
Sbjct  244  CSYHN  248


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            ++  +  D T++   +++W+++R+ QLEEQ+++ + E LELEKQR+KW++FS K++RE+E
Sbjct  358  DMNQVLPDGTKAAWLQKQWVESRSFQLEEQKLQIQVEMLELEKQRLKWQRFSKKRDRELE  417

Query  674  rekmmnqrkkLENDRMVLLLHQKEL  748
            + +M N R KLEN+RM L L QKE+
Sbjct  418  KMRMENDRMKLENERMALELKQKEM  442



>ref|XP_007019480.1| Sequence-specific DNA binding transcription factors [Theobroma 
cacao]
 gb|EOY16705.1| Sequence-specific DNA binding transcription factors [Theobroma 
cacao]
Length=446

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  183  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDVIDYLTEKEKDDVRKILSSKHLFYEEM  242

Query  179  CAYHN  193
            C+YHN
Sbjct  243  CSYHN  247


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            ++  +  D+TR+   +++WI++R++QLEEQ+++ + E LELEKQR KW++FS K++RE+E
Sbjct  359  DMNQVLPDNTRAAWLQKQWIESRSLQLEEQKLQIQVEMLELEKQRFKWQRFSKKRDRELE  418

Query  674  rekmmnqrkkLENDRMVLLLHQKEL  748
            + +M N+R KLEN+RM L L +KE 
Sbjct  419  KMRMENERMKLENERMALELKRKEF  443



>ref|XP_009590352.1| PREDICTED: uncharacterized protein LOC104087550 isoform X1 [Nicotiana 
tomentosiformis]
Length=420

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN  LL+ LD +S K KEE +K+L+SKHL + EM
Sbjct  155  DKFNDLNKRYKRLNEILGRGTSCEVVENPVLLDMLDHVSEKGKEEVRKILSSKHLHYEEM  214

Query  179  CAYHN  193
            C+YHN
Sbjct  215  CSYHN  219



>ref|XP_004290521.1| PREDICTED: uncharacterized protein LOC101296534 [Fragaria vesca 
subsp. vesca]
Length=451

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  186  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDVIDYLTEKEKDDVRKILSSKHLFYEEM  245

Query  179  CAYHN  193
            C+YHN
Sbjct  246  CSYHN  250


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  491  GELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkerem  670
            G++     DST++   +++WI++R++QLEEQR++ + E LELEKQR+KW+KFS K++RE+
Sbjct  361  GDINQALPDSTKAAWLQKQWIESRSVQLEEQRLQIQVEMLELEKQRLKWQKFSKKRDREL  420

Query  671  erekmmnqrkkLENDRMVLLLHQKEL  748
            E+ KM N+R KLEN+RM L L +KE+
Sbjct  421  EKLKMENERMKLENERMALELKRKEM  446



>gb|KEH25858.1| transcription factor [Medicago truncatula]
Length=526

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ND++G+GT+C+VVEN  LL+ ++ L+ K K++ +K+LNSKHLF+ EM
Sbjct  181  DKFNDLNKRYKRLNDMLGRGTSCQVVENPALLDVIEYLNEKEKDDVRKILNSKHLFYEEM  240

Query  179  CAYHN  193
            C+YHN
Sbjct  241  CSYHN  245



>emb|CDP10040.1| unnamed protein product [Coffea canephora]
Length=445

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN  LL+ +D +S K KEE +K+L+SKHL + EM
Sbjct  181  DKFNDLNKRYKRLNEILGRGTSCEVVENPALLDMMDHVSEKAKEEVRKILSSKHLHYEEM  240

Query  179  CAYHN  193
            C+YHN
Sbjct  241  CSYHN  245



>ref|XP_004496474.1| PREDICTED: uncharacterized protein LOC101496200 [Cicer arietinum]
Length=449

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ +D LS K K++ +K+L+SKHLF+ EM
Sbjct  183  DKFNDLNKRYKKLNDMLGRGTSCQVVENPGLLDLIDYLSEKEKDDVRKILSSKHLFYEEM  242

Query  179  CAYHN  193
            C+YHN
Sbjct  243  CSYHN  247


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +2

Query  479  QQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskk  658
            Q +  ++     +STR+   +++W+ +R  QLEEQ+++ + E LELEKQR KW++FS KK
Sbjct  355  QMVHSDVNQALPESTRTAWLQKQWLDSRQFQLEEQKLQIQVEMLELEKQRFKWQRFSKKK  414

Query  659  eremerekmmnqrkkLENDRMVLLLHQKELEL  754
            +RE+E+  + N+R K+EN+RM L L +KE+ +
Sbjct  415  DRELEKLSLENERMKIENERMALELKRKEMNI  446



>gb|EYU17440.1| hypothetical protein MIMGU_mgv1a018390mg [Erythranthe guttata]
Length=384

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN  LL+ +D +S K KEE +K+L+SKHL + EM
Sbjct  149  DKFNDLNKRYKRLNEILGRGTSCEVVENPELLDVMDRISEKNKEEVRKILSSKHLHYEEM  208

Query  179  CAYHN  193
            C+YHN
Sbjct  209  CSYHN  213



>gb|EEC75720.1| hypothetical protein OsI_12570 [Oryza sativa Indica Group]
Length=254

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DK NDLNK YKRV D++G+G ACKVVEN  LL+ +D L+ K K+EA KLL+SKHLFFREM
Sbjct  95   DKLNDLNKWYKRVVDLLGRGKACKVVENHALLDAMDELTQKSKDEACKLLSSKHLFFREM  154

Query  179  CAYHN  193
            C  HN
Sbjct  155  CGKHN  159



>ref|XP_011074759.1| PREDICTED: uncharacterized protein LOC105159405 [Sesamum indicum]
Length=437

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT+C+VVEN  LL+ +D +S K KEE +K+L+SKHL + EM
Sbjct  172  DKFNDLNKRYKRLNEILGRGTSCEVVENPALLDMMDHISEKAKEEVRKILSSKHLHYEEM  231

Query  179  CAYHN  193
            C+YHN
Sbjct  232  CSYHN  236



>ref|XP_007041597.1| Sequence-specific DNA binding transcription factors, putative 
[Theobroma cacao]
 gb|EOX97428.1| Sequence-specific DNA binding transcription factors, putative 
[Theobroma cacao]
Length=271

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR ND +G+GT+CKV EN  LL+T  LS K KEE KK+L+SK+LF  EMC
Sbjct  58   DKFNDLNKRYKRCNDFLGRGTSCKVAENSELLDTKYLSDKAKEEVKKILSSKNLFNEEMC  117

Query  182  AYH  190
            +YH
Sbjct  118  SYH  120



>ref|XP_003637928.1| hypothetical protein MTR_113s0014 [Medicago truncatula]
Length=563

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ND++G+GT+C+VVEN  LL+ ++ L+ K K++ +K+LNSKHLF+ EM
Sbjct  181  DKFNDLNKRYKRLNDMLGRGTSCQVVENPALLDVIEYLNEKEKDDVRKILNSKHLFYEEM  240

Query  179  CAYHN  193
            C+YHN
Sbjct  241  CSYHN  245



>ref|XP_009798604.1| PREDICTED: uncharacterized protein LOC104244809 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009798605.1| PREDICTED: uncharacterized protein LOC104244809 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009798606.1| PREDICTED: uncharacterized protein LOC104244809 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009798607.1| PREDICTED: uncharacterized protein LOC104244809 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009798608.1| PREDICTED: uncharacterized protein LOC104244809 isoform X2 [Nicotiana 
sylvestris]
Length=372

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNK++KR+NDI+G+GTAC VVEN  L+E +DL+   +EE KKLL+SK LF++E+C
Sbjct  152  DKFNDLNKKFKRLNDILGRGTACCVVENPGLMEMMDLTHDAQEEVKKLLSSKQLFYQELC  211

Query  182  AYHN  193
            +Y+N
Sbjct  212  SYNN  215



>ref|XP_008798770.1| PREDICTED: uncharacterized protein LOC103713568 [Phoenix dactylifera]
Length=417

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+NDI+G GT+C VV +   LE++ +S K K + +K+L+SKHLF++EMC
Sbjct  171  DKFNDLNKRYKRLNDILGPGTSCIVVNDPASLESMPISQKAKSDVRKILSSKHLFYKEMC  230

Query  182  AYHN  193
            AYH+
Sbjct  231  AYHS  234


 Score = 69.3 bits (168),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +2

Query  476  LQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfssk  655
             +    E+  + +D TRSP+E+R W++ R +QLEE+R++ E+EAL +E+QR KW++FSSK
Sbjct  294  FESFLAEMDAVLQDPTRSPLERREWLRMRALQLEEERLDIETEALAIERQRFKWQRFSSK  353

Query  656  keremerekmmnqrkkLENDRMVLLLHQKELEL  754
            K+RE+ER ++ N+R  LEN+RM +   QKELEL
Sbjct  354  KDREIERSRLENERLMLENERMRMQARQKELEL  386



>ref|XP_006647354.1| PREDICTED: uncharacterized protein LOC102710758 [Oryza brachyantha]
Length=411

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ +I+G+GTAC++VE+  LLE + LS K+KEEAKK L SKHL + EMC
Sbjct  161  DKFNDLNKRYKRLTEILGRGTACQIVEHPELLERMRLSGKLKEEAKKHLISKHLHYEEMC  220

Query  182  AYHN  193
            +YHN
Sbjct  221  SYHN  224



>ref|XP_011037822.1| PREDICTED: uncharacterized protein LOC105134921 [Populus euphratica]
 ref|XP_011037823.1| PREDICTED: uncharacterized protein LOC105134921 [Populus euphratica]
 ref|XP_011037824.1| PREDICTED: uncharacterized protein LOC105134921 [Populus euphratica]
Length=459

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+N+I+G+GT C VVEN  L++ +  LS K K++ +K+L SKHLF++EM
Sbjct  185  DKFNDLNKRYKRLNEILGRGTTCTVVENPVLMDQMPHLSAKAKDDVRKILGSKHLFYKEM  244

Query  179  CAYHN  193
            CAYHN
Sbjct  245  CAYHN  249


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D   SP E++ WIK + +QL EQRV  +++  ELEKQR KW ++ SKK++E E
Sbjct  342  EMAAIFQDPAVSPWERKEWIKKQRLQLLEQRVSIQAQTFELEKQRFKWLRYCSKKDKEFE  401

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
            R ++ N+ K+LEN++  L L QK+LE+
Sbjct  402  RLRLENEWKRLENEQSALQLRQKQLEM  428



>ref|XP_009619561.1| PREDICTED: uncharacterized protein LOC104111549 [Nicotiana tomentosiformis]
 ref|XP_009619562.1| PREDICTED: uncharacterized protein LOC104111549 [Nicotiana tomentosiformis]
 ref|XP_009619563.1| PREDICTED: uncharacterized protein LOC104111549 [Nicotiana tomentosiformis]
 ref|XP_009619564.1| PREDICTED: uncharacterized protein LOC104111549 [Nicotiana tomentosiformis]
 ref|XP_009619565.1| PREDICTED: uncharacterized protein LOC104111549 [Nicotiana tomentosiformis]
Length=371

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNK++KR+NDI+G+GTAC VVEN  L+E + L+  ++EE KKLL+SK LF++EMC
Sbjct  152  DKFNDLNKKFKRLNDILGRGTACCVVENPGLMEMMGLTHDVQEEVKKLLSSKQLFYQEMC  211

Query  182  AYHN  193
            +Y+N
Sbjct  212  SYNN  215



>ref|XP_002452238.1| hypothetical protein SORBIDRAFT_04g022190 [Sorghum bicolor]
 gb|EES05214.1| hypothetical protein SORBIDRAFT_04g022190 [Sorghum bicolor]
Length=409

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNKRYKR+ +I+G+G AC++VE   LL+ + LS K++EEAKK LNSKHL + EMC
Sbjct  157  DKFNDLNKRYKRLTEILGRGRACQIVEKHELLDQVSLSGKLREEAKKHLNSKHLHYEEMC  216

Query  182  AYHN  193
            +YHN
Sbjct  217  SYHN  220



>ref|XP_009798603.1| PREDICTED: uncharacterized protein LOC104244809 isoform X1 [Nicotiana 
sylvestris]
Length=390

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNK++KR+NDI+G+GTAC VVEN  L+E +DL+   +EE KKLL+SK LF++E+C
Sbjct  170  DKFNDLNKKFKRLNDILGRGTACCVVENPGLMEMMDLTHDAQEEVKKLLSSKQLFYQELC  229

Query  182  AYHN  193
            +Y+N
Sbjct  230  SYNN  233



>ref|XP_010315046.1| PREDICTED: uncharacterized protein LOC101264265 [Solanum lycopersicum]
Length=384

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNK+++R+ND++G+GTAC VVEN  LLE +DL   +KEE  K+L S+ LF+ EMC
Sbjct  135  DKFNDLNKKFRRLNDVLGRGTACNVVENPVLLEIMDLPNDLKEEMNKILGSRQLFYEEMC  194

Query  182  AYHN  193
            +Y+N
Sbjct  195  SYNN  198



>ref|XP_002887659.1| hypothetical protein ARALYDRAFT_895568 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63918.1| hypothetical protein ARALYDRAFT_895568 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++N+++G+GT+C+VVEN  LL+ +D L+ K KEE +K+++SKHLF+ EM
Sbjct  156  DKFNDLNKRYKKLNEMLGRGTSCEVVENPALLDKIDYLNEKEKEEVRKIMSSKHLFYEEM  215

Query  179  CAYHN  193
            C+YHN
Sbjct  216  CSYHN  220



>ref|XP_007143533.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
 ref|XP_007143534.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
 gb|ESW15527.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
 gb|ESW15528.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
Length=450

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVE   LL+ +D LS K K++ +K+L+SKHLF+ EM
Sbjct  184  DKFNDLNKRYKKLNDMLGRGTSCQVVEKPALLDVIDFLSDKEKDDVRKILSSKHLFYEEM  243

Query  179  CAYHN  193
            C+YHN
Sbjct  244  CSYHN  248


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +2

Query  479  QQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskk  658
            Q +  ++     +S RS   +++W+++R +QLEEQ+++ + E LELEKQR KW++FS KK
Sbjct  356  QMVQSDVNQGLPESMRSAWLQKQWVESRFLQLEEQKLQIQVEMLELEKQRFKWQRFSKKK  415

Query  659  eremerekmmnqrkkLENDRMVLLLHQKEL  748
            +RE+E+  + N+R KLEN+R+ L L +KEL
Sbjct  416  DRELEKLSLENERLKLENERLALELKRKEL  445



>ref|XP_006351819.1| PREDICTED: uncharacterized protein LOC102593487 isoform X1 [Solanum 
tuberosum]
 ref|XP_006351820.1| PREDICTED: uncharacterized protein LOC102593487 isoform X2 [Solanum 
tuberosum]
 ref|XP_006351821.1| PREDICTED: uncharacterized protein LOC102593487 isoform X3 [Solanum 
tuberosum]
Length=392

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKFNDLNK+++R+NDI+G+GTAC VVEN  LLE +DL   +KEE  K+L S+ LF+ EMC
Sbjct  135  DKFNDLNKKFRRLNDILGRGTACNVVENPVLLERMDLPYDLKEEMNKILGSRQLFYEEMC  194

Query  182  AYHN  193
            +Y+N
Sbjct  195  SYNN  198



>ref|XP_004977312.1| PREDICTED: uncharacterized protein LOC101777650 isoform X1 [Setaria 
italica]
 ref|XP_004977313.1| PREDICTED: uncharacterized protein LOC101777650 isoform X2 [Setaria 
italica]
 ref|XP_004977314.1| PREDICTED: uncharacterized protein LOC101777650 isoform X3 [Setaria 
italica]
Length=446

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ D++G+GT C++V N  LL+++ +LS K K++A+K+L+SKHLF+ EM
Sbjct  178  DKFNDLNKRYKRLTDLLGRGTTCRIVANPELLDSMANLSDKTKDDARKILSSKHLFYEEM  237

Query  179  CAYHN  193
            C+YHN
Sbjct  238  CSYHN  242



>ref|XP_010063872.1| PREDICTED: uncharacterized protein LOC104450863 [Eucalyptus grandis]
 gb|KCW71142.1| hypothetical protein EUGRSUZ_F04240 [Eucalyptus grandis]
Length=446

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ ++ LS K K++ +K+L+SKHLF+ EM
Sbjct  183  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDMIEFLSEKEKDDVRKILSSKHLFYEEM  242

Query  179  CAYHN  193
            C+YHN
Sbjct  243  CSYHN  247



>ref|XP_008352771.1| PREDICTED: uncharacterized protein LOC103416293 [Malus domestica]
 ref|XP_008352772.1| PREDICTED: uncharacterized protein LOC103416293 [Malus domestica]
Length=448

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ ++ L+ K K++ +K+L+SKHLF+ EM
Sbjct  184  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDVIEYLTEKEKDDVRKILSSKHLFYEEM  243

Query  179  CAYHN  193
            C+YHN
Sbjct  244  CSYHN  248


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            ++  +  D T++   +++W+++R+ QLEEQ+++ + E LELEKQR+KW++FS K++ E+E
Sbjct  359  DMNQVLPDGTKAVWLQKQWVESRSFQLEEQKLQIQVEMLELEKQRLKWQRFSKKRDHELE  418

Query  674  rekmmnqrkkLENDRMVLLLHQKEL  748
            + ++ N+R KLEN+RM+L L QKE+
Sbjct  419  KLRLENERMKLENERMILELKQKEM  443



>ref|XP_009343631.1| PREDICTED: uncharacterized protein LOC103935584 [Pyrus x bretschneideri]
Length=447

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ ++ L+ K K++ +K+L+SKHLF+ EM
Sbjct  184  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDVIEYLTEKEKDDVRKILSSKHLFYEEM  243

Query  179  CAYHN  193
            C+YHN
Sbjct  244  CSYHN  248


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            ++  +  D T++   +++W+++R+ QLEEQ+++ + E LELEKQR+KW++FS K++RE+E
Sbjct  358  DMNQVLPDGTKAAWLQKQWVESRSFQLEEQKLQIQVEMLELEKQRLKWQRFSKKRDRELE  417

Query  674  rekmmnqrkkLENDRMVLLLHQKEL  748
            + +M N+R KLEN+RM L L QKE+
Sbjct  418  KMRMENERMKLENERMALELKQKEM  442



>ref|XP_009368513.1| PREDICTED: uncharacterized protein LOC103958014 [Pyrus x bretschneideri]
Length=448

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+ ++ L+ K K++ +K+L+SKHLF+ EM
Sbjct  184  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDVIEYLTEKEKDDVRKILSSKHLFYEEM  243

Query  179  CAYHN  193
            C+YHN
Sbjct  244  CSYHN  248


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            ++  +  D T++   +++W+++R+ QLEEQ+++ + E LELEKQR+KW++FS K++ E+E
Sbjct  359  DMNQVLPDGTKAVWLQKQWVESRSFQLEEQKLQIQVEMLELEKQRLKWQRFSKKRDHELE  418

Query  674  rekmmnqrkkLENDRMVLLLHQKEL  748
            + ++ N+R KLEN+RM+L L QKE+
Sbjct  419  KLRLENERMKLENERMILELKQKEM  443



>ref|XP_010911980.1| PREDICTED: uncharacterized protein LOC105038013 [Elaeis guineensis]
 ref|XP_010911981.1| PREDICTED: uncharacterized protein LOC105038013 [Elaeis guineensis]
Length=431

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETL-DLSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ +I+G+GT+CK+VEN  LL+ +  +S K+K++A+K+L SKHL++ EM
Sbjct  176  DKFNDLNKRYKRLTEILGRGTSCKIVENPALLDYMPSISEKVKDDARKILRSKHLYYEEM  235

Query  179  CAYHN  193
            C+YHN
Sbjct  236  CSYHN  240



>ref|XP_009149597.1| PREDICTED: uncharacterized protein LOC103872912 [Brassica rapa]
Length=401

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+++  L+ K K++ +K+++SKHLF+ EM
Sbjct  149  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDSIGYLNDKEKDDVRKIMSSKHLFYEEM  208

Query  179  CAYHN  193
            C+YHN
Sbjct  209  CSYHN  213


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  512  EDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmn  691
            E+S RS + +++WI++RT+QLEEQ+++ + E LELEKQR +WE+FS K+++E+ER +M N
Sbjct  319  EESERSALMQKQWIESRTLQLEEQKLQIQVELLELEKQRFRWERFSKKRDQELERMRMEN  378

Query  692  qrkkLENDRMVLLLHQKEL  748
            +R KLENDRM L L Q+EL
Sbjct  379  ERMKLENDRMGLELKQREL  397



>ref|XP_008784156.1| PREDICTED: uncharacterized protein LOC103703173 [Phoenix dactylifera]
 ref|XP_008784157.1| PREDICTED: uncharacterized protein LOC103703173 [Phoenix dactylifera]
 ref|XP_008784158.1| PREDICTED: uncharacterized protein LOC103703173 [Phoenix dactylifera]
Length=417

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYKR+ DI+G+GTAC VVEN  LL  ++ +S K+K+E KK+L+SK LF+ EM
Sbjct  170  DKFNDLNKRYKRLIDILGRGTACMVVENPALLGQMEHISDKLKDEVKKILSSKQLFYEEM  229

Query  179  CAYHN  193
            C+YHN
Sbjct  230  CSYHN  234



>ref|NP_177813.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51150.1|AC079283_7 hypothetical protein [Arabidopsis thaliana]
 dbj|BAH30377.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35897.1| uncharacterized protein AT1G76870 [Arabidopsis thaliana]
Length=385

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++N+++G+GT+C+VVEN +LL+ +D L+ K K+E +++++SKHLF+ EM
Sbjct  143  DKFNDLNKRYKKLNEMLGRGTSCEVVENPSLLDKIDYLNEKEKDEVRRIMSSKHLFYEEM  202

Query  179  CAYHN  193
            C+YHN
Sbjct  203  CSYHN  207



>ref|XP_002890430.1| hypothetical protein ARALYDRAFT_472358 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66689.1| hypothetical protein ARALYDRAFT_472358 [Arabidopsis lyrata subsp. 
lyrata]
Length=440

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+++  L+ K K++ +K+++SKHLF+ EM
Sbjct  175  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDSIGYLNDKEKDDVRKIMSSKHLFYEEM  234

Query  179  CAYHN  193
            C+YHN
Sbjct  235  CSYHN  239


 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  515  DSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnq  694
            +S R+   +++WI++RT+QLEEQ+++ + E LELEKQR +W++FS K+++E+ER +M N+
Sbjct  359  ESARAASVQKQWIESRTLQLEEQKLQIQVELLELEKQRFRWQRFSKKRDQELERMRMENE  418

Query  695  rkkLENDRMVLLLHQKEL  748
            R KLENDRM L L Q+EL
Sbjct  419  RMKLENDRMGLELKQREL  436



>ref|XP_006470590.1| PREDICTED: uncharacterized protein LOC102621074 isoform X2 [Citrus 
sinensis]
Length=414

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD---LSPKMKEEAKKLLNSKHLFFR  172
            DKFNDLNKRYK++NDI+GKG  C+VVEN  L++T+    LS K K++ +K+L SKHLF++
Sbjct  142  DKFNDLNKRYKKLNDILGKGLTCQVVENPALIDTMSCSHLSAKAKDDVRKILGSKHLFYK  201

Query  173  EMCAYHN  193
            EM AYHN
Sbjct  202  EMFAYHN  208


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D ++S  E+R WIK + + L+ QRV  +++A ELEKQ +KW ++ SKK+RE+E
Sbjct  297  EMARIFQDPSKSMWERREWIKKQKLALQNQRVSIQAQAFELEKQHLKWLRYCSKKDRELE  356

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
            R ++ N+R +L+N++M+L L QK+ EL
Sbjct  357  RSRLENERIRLDNEQMILHLKQKQFEL  383



>ref|XP_006416324.1| hypothetical protein EUTSA_v10010018mg [Eutrema salsugineum]
 gb|ESQ34677.1| hypothetical protein EUTSA_v10010018mg [Eutrema salsugineum]
Length=438

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+++  L+ K K++ +K+++SKHLF+ EM
Sbjct  173  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDSIGYLNDKEKDDVRKIMSSKHLFYEEM  232

Query  179  CAYHN  193
            C+YHN
Sbjct  233  CSYHN  237


 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  515  DSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnq  694
            +S R+   +++WI++RT+QLEEQ+++ + E LELEKQR +WE+FS K+++E+ER +M N+
Sbjct  357  ESGRAASVQKQWIESRTLQLEEQKLQIQVELLELEKQRFRWERFSKKRDQELERMRMENE  416

Query  695  rkkLENDRMVLLLHQKEL  748
            R KLENDRM L L Q+EL
Sbjct  417  RMKLENDRMGLELKQREL  434



>ref|XP_010498570.1| PREDICTED: uncharacterized protein LOC104776239 [Camelina sativa]
Length=447

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+++  L+ K K++ +K+++SKHLF+ EM
Sbjct  181  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDSIGYLNDKEKDDVRKIMSSKHLFYEEM  240

Query  179  CAYHN  193
            C+YHN
Sbjct  241  CSYHN  245


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  491  GELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkerem  670
            G++     +S R+   +++W+++RT+QLEEQ+++ + E LELEKQR +W++FS K+++E+
Sbjct  358  GDVNQGGAESGRAASMQKQWMESRTLQLEEQKLQIQVELLELEKQRFRWQRFSKKRDQEL  417

Query  671  erekmmnqrkkLENDRMVLLLHQKEL  748
            ER +M N+R KLENDRM L L Q+EL
Sbjct  418  ERMRMENERMKLENDRMGLELKQREL  443



>ref|XP_010459826.1| PREDICTED: uncharacterized protein LOC104740815 [Camelina sativa]
Length=447

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+++  L+ K K++ +K+++SKHLF+ EM
Sbjct  181  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDSIGYLNDKEKDDVRKIMSSKHLFYEEM  240

Query  179  CAYHN  193
            C+YHN
Sbjct  241  CSYHN  245


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  491  GELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkerem  670
            G++     +S R+   +++W+++RT+QLEEQ+++ + E LELEKQR +W++ S K+++E+
Sbjct  358  GDVNQGGVESGRAASMQKQWMESRTLQLEEQKLQIQVELLELEKQRFRWQRISKKRDQEL  417

Query  671  erekmmnqrkkLENDRMVLLLHQKEL  748
            ER +M N+R KLENDRM L L Q+EL
Sbjct  418  ERMRMENERMKLENDRMGLELKQREL  443



>gb|KDO61296.1| hypothetical protein CISIN_1g013250mg [Citrus sinensis]
Length=447

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD---LSPKMKEEAKKLLNSKHLFFR  172
            DKFNDLNKRYK++NDI+GKG  C+VVEN  L++T+    LS K K++ +K+L SKHLF++
Sbjct  186  DKFNDLNKRYKKLNDILGKGLTCQVVENPALIDTMSCSHLSAKAKDDVRKILGSKHLFYK  245

Query  173  EMCAYHN  193
            EM AYHN
Sbjct  246  EMFAYHN  252


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D ++S  E+R WIK + + L+ QRV  +++A ELEKQ +KW ++ SKK+RE+E
Sbjct  330  EMARIFQDPSKSMWERREWIKKQKLALQNQRVSIQAQAFELEKQHLKWLRYCSKKDRELE  389

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
            R ++ N+R +L+N++M+L L QK+ EL
Sbjct  390  RSRLENERIRLDNEQMILHLKQKQFEL  416



>ref|XP_004952514.1| PREDICTED: uncharacterized protein LOC101760040 [Setaria italica]
Length=369

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMC  181
            DKF+DLNKRYKRV +I+G GTACK+VE   LLE +++S K+KEEA+K L+SK+L + +MC
Sbjct  138  DKFHDLNKRYKRVTEILGWGTACKIVEKPALLEQMNISEKLKEEARKHLSSKNLHYEQMC  197

Query  182  AYHN  193
            +YHN
Sbjct  198  SYHN  201



>ref|NP_564136.1| sequence-specific DNA binding transcription factor [Arabidopsis 
thaliana]
 gb|AAF81362.1|AC036104_11 Contains weak similarity to DNA-binding protein (GT-1a) from 
Nicotiana tabacum gb|M93436 [Arabidopsis thaliana]
 gb|AAK76524.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14317.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30074.1| sequence-specific DNA binding transcription factor [Arabidopsis 
thaliana]
Length=443

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+++  L+ K K++ +K+++SKHLF+ EM
Sbjct  178  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDSIGYLNDKEKDDVRKIMSSKHLFYEEM  237

Query  179  CAYHN  193
            C+YHN
Sbjct  238  CSYHN  242


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  515  DSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnq  694
            +S R+   +++W+++RT+QLEEQ+++ + E LELEKQR +W++FS K+++E+ER +M N+
Sbjct  362  ESGRAGSVQKQWMESRTLQLEEQKLQIQVELLELEKQRFRWQRFSKKRDQELERMRMENE  421

Query  695  rkkLENDRMVLLLHQKEL  748
            R KLENDRM L L Q+EL
Sbjct  422  RMKLENDRMGLELKQREL  439



>gb|KDP42996.1| hypothetical protein JCGZ_25182 [Jatropha curcas]
Length=443

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL  +D L+ K K++ +K+L+SKHLF+ EM
Sbjct  180  DKFNDLNKRYKKLNDMLGRGTSCEVVENPALLVHIDYLTEKEKDDVRKILSSKHLFYEEM  239

Query  179  CAYHN  193
            C+YHN
Sbjct  240  CSYHN  244


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +2

Query  476  LQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfssk  655
            LQ    ++  M  +ST++    ++W++++T+QLEEQ+++ + E +ELEKQR KW++FS K
Sbjct  348  LQIAQVDMNQMSTESTKAAWLHKQWMESQTLQLEEQKLQIQLEMMELEKQRFKWKRFSRK  407

Query  656  keremerekmmnqrkkLENDRMVLLLHQKELEL  754
            ++ E+E+ ++ N+R KLEN+R+ L L +KE+ +
Sbjct  408  RDHELEKLRVENERMKLENERIALELKRKEMGI  440



>ref|XP_006470589.1| PREDICTED: uncharacterized protein LOC102621074 isoform X1 [Citrus 
sinensis]
Length=458

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD---LSPKMKEEAKKLLNSKHLFFR  172
            DKFNDLNKRYK++NDI+GKG  C+VVEN  L++T+    LS K K++ +K+L SKHLF++
Sbjct  186  DKFNDLNKRYKKLNDILGKGLTCQVVENPALIDTMSCSHLSAKAKDDVRKILGSKHLFYK  245

Query  173  EMCAYHN  193
            EM AYHN
Sbjct  246  EMFAYHN  252


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  494  ELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkereme  673
            E+  + +D ++S  E+R WIK + + L+ QRV  +++A ELEKQ +KW ++ SKK+RE+E
Sbjct  341  EMARIFQDPSKSMWERREWIKKQKLALQNQRVSIQAQAFELEKQHLKWLRYCSKKDRELE  400

Query  674  rekmmnqrkkLENDRMVLLLHQKELEL  754
            R ++ N+R +L+N++M+L L QK+ EL
Sbjct  401  RSRLENERIRLDNEQMILHLKQKQFEL  427



>ref|XP_006307528.1| hypothetical protein CARUB_v10009151mg [Capsella rubella]
 ref|XP_006307529.1| hypothetical protein CARUB_v10009151mg [Capsella rubella]
 gb|EOA40426.1| hypothetical protein CARUB_v10009151mg [Capsella rubella]
 gb|EOA40427.1| hypothetical protein CARUB_v10009151mg [Capsella rubella]
Length=442

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+++  L+ K K++ +K+++SKHLF+ EM
Sbjct  174  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDSIGYLNEKEKDDVRKIMSSKHLFYEEM  233

Query  179  CAYHN  193
            C+YHN
Sbjct  234  CSYHN  238


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  515  DSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkeremerekmmnq  694
            +S RS   +++W+++RT+QLEEQ+++ + E LELEKQR +W++FS K+++E+ER +M N+
Sbjct  361  ESGRSASMQKQWMESRTLQLEEQKLQIQVELLELEKQRFRWQRFSKKRDQELERMRMENE  420

Query  695  rkkLENDRMVLLLHQKEL  748
            R KLENDRM L L Q+EL
Sbjct  421  RMKLENDRMGLELKQREL  438



>ref|XP_010477381.1| PREDICTED: uncharacterized protein LOC104756477 [Camelina sativa]
Length=452

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    DKFNDLNKRYKRVNDIIGKGTACKVVENQTLLETLD-LSPKMKEEAKKLLNSKHLFFREM  178
            DKFNDLNKRYK++ND++G+GT+C+VVEN  LL+++  L+ K K++ +K+++SKHLF+ EM
Sbjct  184  DKFNDLNKRYKKLNDMLGRGTSCQVVENPALLDSIGYLNDKEKDDVRKIMSSKHLFYEEM  243

Query  179  CAYHN  193
            C+YHN
Sbjct  244  CSYHN  248


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  491  GELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekfsskkerem  670
            G++     +S R+   +++W+++RT+QLEEQ+++ + E LELEKQR +W++FS K+++E+
Sbjct  363  GDVNQGGVESGRAASMQKQWMESRTLQLEEQKLQIQVELLELEKQRFRWQRFSKKRDQEL  422

Query  671  erekmmnqrkkLENDRMVLLLHQKEL  748
            ER +M N+R KLENDRM L L Q+EL
Sbjct  423  ERMRMENERMKLENDRMGLELKQREL  448



>gb|KCW89277.1| hypothetical protein EUGRSUZ_A015722, partial [Eucalyptus grandis]
Length=291

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +2

Query  467  AMVLQQLSGELRNMCEDSTRSPVEKRRWIKARTMQLEEQRVEYESEALELEKQRVKWekf  646
             M +QQLSGE   + +D  RSP EK++W+K + +QLEEQRV Y+ +A ELEKQR+KW KF
Sbjct  174  TMFVQQLSGEATGVMQDGNRSPWEKKQWMKVKLVQLEEQRVSYQLQAYELEKQRLKWLKF  233

Query  647  sskkeremerekmmnqrkkLENDRMVLLLHQKELELKNGVHHQA-SYNRTSDPSSVTG  817
            S KKER+MER K+ N+R++LEN+RMVLLL QKELEL +    Q  S N+ S+PSS+TG
Sbjct  234  SGKKERDMERAKLENERRRLENERMVLLLRQKELELLDLQQQQQHSSNKRSEPSSITG  291


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 64/107 (60%), Gaps = 10/107 (9%)
 Frame = +2

Query  59   GTACKVVENQTLLETLDLSPKMKEEAKKLLNSKHLFFREMCAYHNscahggasgstaadg  238
            GTAC+VVENQ+LLE +DLS KMKEE KKLLNSKHLFFREMCAYHNSC HG      A   
Sbjct  1    GTACRVVENQSLLEVMDLSTKMKEEVKKLLNSKHLFFREMCAYHNSCGHGPGGSGGAGGA  60

Query  239  gsDP---------TSQANNPHQKCMHSSENVRIGPNLAPAEVEGLKI  352
               P           Q   P + C H++++   G +L   E E  K+
Sbjct  61   HHSPEVAVEPSHIQQQQQVPQRGCFHAADSA-AGDHLGKTETEASKM  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2109012510310