BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9710_g1_i1 len=803 path=[1:0-802]

Length=803
                                                                      Score     E

ref|XP_010325945.1|  PREDICTED: putative DNA helicase INO80             158   3e-41   
ref|XP_006341187.1|  PREDICTED: nucleomorphin-like                      157   7e-41   
ref|XP_011094441.1|  PREDICTED: uncharacterized protein LOC105174138    141   5e-35   
ref|XP_011101476.1|  PREDICTED: uncharacterized protein LOC105179522    137   1e-33   
ref|XP_002528638.1|  conserved hypothetical protein                     135   7e-33   Ricinus communis
ref|XP_009619384.1|  PREDICTED: FERM domain-containing protein C        134   1e-32   
gb|KDP29238.1|  hypothetical protein JCGZ_16627                         134   2e-32   
ref|XP_007202030.1|  hypothetical protein PRUPE_ppa005148mg             134   2e-32   
ref|XP_008241327.1|  PREDICTED: uncharacterized protein LOC103339760    133   3e-32   
ref|XP_002277851.3|  PREDICTED: stress response protein NST1            131   1e-31   Vitis vinifera
ref|XP_009788508.1|  PREDICTED: ESF1 homolog                            130   3e-31   
ref|XP_011012418.1|  PREDICTED: uncharacterized protein LOC105116670    126   6e-30   
ref|XP_006373929.1|  hypothetical protein POPTR_0016s11010g             125   9e-30   
ref|XP_004497590.1|  PREDICTED: putative mediator of RNA polymera...    125   3e-29   
ref|XP_011018864.1|  PREDICTED: 46 kDa FK506-binding nuclear prot...    124   5e-29   
ref|XP_006381332.1|  hypothetical protein POPTR_0006s11870g             123   8e-29   
ref|XP_010243252.1|  PREDICTED: uncharacterized protein LOC104587365    123   1e-28   
ref|XP_007027578.1|  Sequence-specific DNA binding transcription ...    122   2e-28   
ref|XP_004303047.1|  PREDICTED: uncharacterized protein LOC101312168    122   2e-28   
emb|CBI30220.3|  unnamed protein product                                122   2e-28   
ref|XP_010103346.1|  hypothetical protein L484_002280                   122   2e-28   
ref|XP_007027577.1|  Sequence-specific DNA binding transcription ...    122   3e-28   
ref|XP_006594181.1|  PREDICTED: putative mediator of RNA polymera...    120   9e-28   
gb|EYU41556.1|  hypothetical protein MIMGU_mgv1a006561mg                120   1e-27   
ref|NP_001235465.1|  SHOOT2 protein                                     119   1e-27   
ref|XP_003542565.1|  PREDICTED: putative mediator of RNA polymera...    120   1e-27   
ref|XP_003590397.1|  hypothetical protein MTR_1g061640                  119   2e-27   
ref|XP_004172887.1|  PREDICTED: uncharacterized LOC101222223            116   2e-26   
ref|XP_004138003.1|  PREDICTED: uncharacterized protein LOC101222223    116   2e-26   
ref|XP_008442785.1|  PREDICTED: ESF1 homolog                            116   2e-26   
ref|XP_007162836.1|  hypothetical protein PHAVU_001G185100g             115   4e-26   
ref|XP_009334880.1|  PREDICTED: uncharacterized protein LOC103927663    115   4e-26   
emb|CDP21813.1|  unnamed protein product                                115   5e-26   
ref|XP_008387330.1|  PREDICTED: uncharacterized protein LOC103449787    115   5e-26   
gb|KHN45698.1|  hypothetical protein glysoja_036847                     114   9e-26   
ref|XP_004494130.1|  PREDICTED: ABC transporter F family member 4...    114   1e-25   
ref|XP_010278270.1|  PREDICTED: putative DNA helicase INO80             114   1e-25   
ref|NP_001242801.1|  uncharacterized protein LOC100808934               114   1e-25   
gb|KHN18717.1|  hypothetical protein glysoja_021468                     114   1e-25   
ref|XP_010554911.1|  PREDICTED: uncharacterized protein LOC104824502    113   2e-25   
ref|XP_006604609.1|  PREDICTED: uncharacterized protein DDB_G0290...    112   3e-25   
gb|KHN02271.1|  hypothetical protein glysoja_002295                     112   5e-25   
ref|XP_006604608.1|  PREDICTED: uncharacterized protein DDB_G0290...    112   6e-25   
gb|KEH24098.1|  Myb/SANT-like DNA-binding domain protein                112   7e-25   
ref|XP_006407612.1|  hypothetical protein EUTSA_v10020795mg             110   2e-24   
ref|XP_010683922.1|  PREDICTED: AF4/FMR2 family member 4                112   2e-24   
ref|XP_006430334.1|  hypothetical protein CICLE_v10013486mg             112   2e-24   
gb|KDO61000.1|  hypothetical protein CISIN_1g011207mg                   111   2e-24   
ref|XP_006481921.1|  PREDICTED: probable serine/threonine-protein...    110   2e-24   
dbj|BAO45883.1|  SHOOT2 protein                                         110   3e-24   
ref|XP_006481922.1|  PREDICTED: probable serine/threonine-protein...    110   3e-24   
ref|XP_002884773.1|  hypothetical protein ARALYDRAFT_478332             109   4e-24   
ref|XP_008367432.1|  PREDICTED: uncharacterized protein LOC103431060    108   1e-23   
ref|XP_010486586.1|  PREDICTED: uncharacterized protein LOC104764701    104   3e-22   
ref|XP_006299896.1|  hypothetical protein CARUB_v10016104mg             104   4e-22   
gb|AAF04419.1|AC010927_12  unknown protein                              103   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480164.1|  PREDICTED: uncharacterized protein LOC104758866    103   5e-22   
ref|NP_187615.2|  sequence-specific DNA binding transcription factor    103   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135031.1|  PREDICTED: trihelix transcription factor GT-...    103   5e-22   
gb|EPS63933.1|  hypothetical protein M569_10850                       98.2    7e-22   
emb|CDY68207.1|  BnaCnng58050D                                          100   4e-21   
ref|XP_010464664.1|  PREDICTED: trihelix transcription factor GTL...    100   5e-21   
ref|XP_007145268.1|  hypothetical protein PHAVU_007G224600g             100   7e-21   
emb|CDY60160.1|  BnaAnng16550D                                          100   8e-21   
ref|XP_009146876.1|  PREDICTED: uncharacterized protein LOC103870494    100   8e-21   
emb|CDY00901.1|  BnaC05g42990D                                        99.8    1e-20   
ref|XP_006851780.1|  hypothetical protein AMTR_s00040p00233180        96.7    2e-19   
gb|KHN48204.1|  hypothetical protein glysoja_007873                   93.2    1e-18   
ref|XP_010543479.1|  PREDICTED: trihelix transcription factor GTL...  89.4    7e-17   
ref|XP_009590354.1|  PREDICTED: uncharacterized protein LOC104087...  88.2    1e-16   
ref|XP_009590352.1|  PREDICTED: uncharacterized protein LOC104087...  88.2    2e-16   
ref|XP_010543481.1|  PREDICTED: trihelix transcription factor GTL...  87.8    2e-16   
gb|KCW89278.1|  hypothetical protein EUGRSUZ_A015721                  82.4    6e-16   
ref|XP_010912425.1|  PREDICTED: uncharacterized protein LOC105038...  85.5    9e-16   
gb|KFK38386.1|  hypothetical protein AALP_AA3G106800                  85.5    1e-15   
ref|XP_002266272.1|  PREDICTED: uncharacterized protein LOC100259010  85.9    1e-15   Vitis vinifera
ref|XP_008784156.1|  PREDICTED: uncharacterized protein LOC103703173  85.5    1e-15   
ref|XP_010912419.1|  PREDICTED: uncharacterized protein LOC105038...  85.5    1e-15   
ref|XP_009419154.1|  PREDICTED: uncharacterized protein LOC103999...  84.7    1e-15   
gb|KDP42996.1|  hypothetical protein JCGZ_25182                       85.5    1e-15   
ref|XP_009419153.1|  PREDICTED: uncharacterized protein LOC103999...  84.7    2e-15   
ref|XP_004290521.1|  PREDICTED: uncharacterized protein LOC101296534  85.1    2e-15   
tpg|DAA54425.1|  TPA: hypothetical protein ZEAMMB73_872770            85.1    3e-15   
ref|XP_008673999.1|  PREDICTED: uncharacterized protein LOC103650125  85.1    3e-15   
ref|XP_002532431.1|  transcription factor, putative                   84.7    3e-15   Ricinus communis
emb|CAN65038.1|  hypothetical protein VITISV_021706                   85.1    3e-15   Vitis vinifera
emb|CDM81777.1|  unnamed protein product                              84.7    4e-15   
ref|XP_009420589.1|  PREDICTED: uncharacterized protein LOC104000302  83.2    9e-15   
ref|XP_003556151.1|  PREDICTED: uncharacterized protein LOC100816474  83.2    9e-15   
ref|XP_011087824.1|  PREDICTED: uncharacterized protein LOC105169181  82.8    1e-14   
ref|XP_010246931.1|  PREDICTED: uncharacterized protein LOC104590097  82.8    1e-14   
emb|CDP10040.1|  unnamed protein product                              82.4    2e-14   
ref|XP_010069064.1|  PREDICTED: uncharacterized protein LOC104456045  82.4    2e-14   
ref|XP_009799707.1|  PREDICTED: uncharacterized protein LOC104245...  82.0    2e-14   
ref|XP_010459826.1|  PREDICTED: uncharacterized protein LOC104740815  82.4    2e-14   
ref|XP_008781414.1|  PREDICTED: uncharacterized protein LOC103701...  82.0    2e-14   
ref|XP_009799706.1|  PREDICTED: uncharacterized protein LOC104245...  81.6    2e-14   
ref|XP_008781412.1|  PREDICTED: uncharacterized protein LOC103701...  81.6    3e-14   
gb|KDP43003.1|  hypothetical protein JCGZ_25189                       81.6    3e-14   
emb|CDX96599.1|  BnaA08g21420D                                        80.1    3e-14   
ref|XP_003536428.1|  PREDICTED: uncharacterized protein LOC100812134  81.6    3e-14   
ref|XP_007200864.1|  hypothetical protein PRUPE_ppa1027145mg          81.3    4e-14   
ref|XP_007019480.1|  Sequence-specific DNA binding transcription ...  81.3    4e-14   
emb|CDM81776.1|  unnamed protein product                              81.3    4e-14   
ref|XP_008237585.1|  PREDICTED: uncharacterized protein LOC103336322  80.9    5e-14   
emb|CDY33674.1|  BnaC08g19740D                                        80.1    6e-14   
ref|XP_010087144.1|  hypothetical protein L484_007394                 80.9    6e-14   
ref|XP_010241711.1|  PREDICTED: uncharacterized protein LOC104586241  80.5    7e-14   
ref|XP_009413538.1|  PREDICTED: uncharacterized protein LOC103994824  80.1    8e-14   
ref|XP_009110193.1|  PREDICTED: uncharacterized protein LOC103835755  79.7    8e-14   
gb|EYU17440.1|  hypothetical protein MIMGU_mgv1a018390mg              79.7    9e-14   
ref|XP_004516631.1|  PREDICTED: uncharacterized protein LOC101514780  80.1    9e-14   
ref|XP_002306694.2|  hypothetical protein POPTR_0005s21390g           79.7    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006473052.1|  PREDICTED: uncharacterized protein LOC102612442  80.1    1e-13   
ref|XP_006434454.1|  hypothetical protein CICLE_v10001142mg           80.1    1e-13   
ref|XP_010498570.1|  PREDICTED: uncharacterized protein LOC104776239  79.7    1e-13   
ref|XP_011044210.1|  PREDICTED: uncharacterized protein LOC105139468  79.7    1e-13   
gb|EMT16151.1|  hypothetical protein F775_16013                       80.1    1e-13   
ref|XP_002455555.1|  hypothetical protein SORBIDRAFT_03g013050        80.1    1e-13   Sorghum bicolor [broomcorn]
ref|XP_002302181.2|  hypothetical protein POPTR_0002s06930g           79.3    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009149597.1|  PREDICTED: uncharacterized protein LOC103872912  79.3    1e-13   
ref|XP_010930979.1|  PREDICTED: uncharacterized protein LOC105052003  79.7    1e-13   
gb|EPS69845.1|  hypothetical protein M569_04922                       77.8    2e-13   
ref|XP_007150380.1|  hypothetical protein PHAVU_005G148400g           79.3    2e-13   
ref|XP_010537278.1|  PREDICTED: uncharacterized protein LOC104812040  79.3    2e-13   
ref|XP_009628855.1|  PREDICTED: uncharacterized protein LOC104119138  79.3    2e-13   
ref|XP_006416324.1|  hypothetical protein EUTSA_v10010018mg           79.3    2e-13   
ref|XP_002890430.1|  hypothetical protein ARALYDRAFT_472358           79.0    2e-13   
ref|XP_011101525.1|  PREDICTED: uncharacterized protein LOC105179584  79.0    2e-13   
ref|XP_009375065.1|  PREDICTED: uncharacterized protein LOC103963911  79.0    2e-13   
ref|XP_011042849.1|  PREDICTED: uncharacterized protein LOC105138468  79.0    2e-13   
ref|XP_002532438.1|  transcription factor, putative                   79.0    2e-13   Ricinus communis
ref|XP_010063872.1|  PREDICTED: uncharacterized protein LOC104450863  79.0    3e-13   
ref|XP_010652952.1|  PREDICTED: stress response protein nst1-like...  78.6    3e-13   
ref|XP_002273284.1|  PREDICTED: stress response protein nst1-like...  78.6    3e-13   Vitis vinifera
ref|XP_009368513.1|  PREDICTED: uncharacterized protein LOC103958014  78.6    3e-13   
ref|XP_009387998.1|  PREDICTED: uncharacterized protein LOC103974835  78.2    3e-13   
ref|XP_011074759.1|  PREDICTED: uncharacterized protein LOC105159405  78.2    4e-13   
ref|XP_010477381.1|  PREDICTED: uncharacterized protein LOC104756477  78.2    4e-13   
ref|XP_003547125.1|  PREDICTED: uncharacterized protein LOC100798...  78.2    4e-13   
gb|KHN33341.1|  hypothetical protein glysoja_005383                   78.2    4e-13   
gb|EPS68099.1|  hypothetical protein M569_06676                       75.5    5e-13   
ref|XP_006307528.1|  hypothetical protein CARUB_v10009151mg           77.8    5e-13   
gb|KHN41268.1|  hypothetical protein glysoja_030106                   77.8    6e-13   
ref|XP_008655870.1|  PREDICTED: uncharacterized protein LOC103635104  77.8    8e-13   
ref|XP_004496474.1|  PREDICTED: uncharacterized protein LOC101496200  77.4    8e-13   
ref|XP_007143533.1|  hypothetical protein PHAVU_007G079600g           77.4    8e-13   
ref|XP_009768464.1|  PREDICTED: uncharacterized protein LOC104219473  77.4    9e-13   
ref|XP_009403682.1|  PREDICTED: uncharacterized protein LOC103987182  77.0    1e-12   
ref|XP_003565719.1|  PREDICTED: uncharacterized protein LOC100835008  77.0    1e-12   
ref|XP_009421497.1|  PREDICTED: uncharacterized protein LOC104001043  77.0    1e-12   
ref|XP_007014993.1|  Sequence-specific DNA binding transcription ...  76.6    1e-12   
ref|XP_010912197.1|  PREDICTED: la-related protein CG11505-like       76.6    2e-12   
ref|XP_003592116.1|  hypothetical protein MTR_1g098920                76.3    2e-12   
ref|XP_010539734.1|  PREDICTED: uncharacterized protein LOC104813711  76.3    2e-12   
ref|XP_006365820.1|  PREDICTED: uncharacterized protein LOC102578195  75.9    3e-12   
ref|XP_004252856.1|  PREDICTED: uncharacterized protein LOC101246904  75.9    3e-12   
ref|XP_008798770.1|  PREDICTED: uncharacterized protein LOC103713568  75.5    3e-12   
ref|XP_007152028.1|  hypothetical protein PHAVU_004G095500g           75.9    3e-12   
ref|XP_009390139.1|  PREDICTED: uncharacterized protein LOC103976598  75.9    3e-12   
ref|XP_008352771.1|  PREDICTED: uncharacterized protein LOC103416293  75.5    4e-12   
ref|XP_008359235.1|  PREDICTED: myb/SANT-like DNA-binding domain-...  75.5    4e-12   
gb|EYU36855.1|  hypothetical protein MIMGU_mgv1a007325mg              75.1    4e-12   
ref|XP_003548116.1|  PREDICTED: uncharacterized protein LOC100805861  75.1    4e-12   
ref|XP_006850180.1|  hypothetical protein AMTR_s00022p00244920        75.1    4e-12   
ref|XP_008381817.1|  PREDICTED: uncharacterized protein LOC103444641  75.1    4e-12   
ref|XP_002452238.1|  hypothetical protein SORBIDRAFT_04g022190        74.7    5e-12   Sorghum bicolor [broomcorn]
ref|XP_009404390.1|  PREDICTED: uncharacterized protein LOC103987728  75.1    5e-12   
ref|XP_008782906.1|  PREDICTED: uncharacterized protein LOC103702316  74.7    6e-12   
ref|XP_008227154.1|  PREDICTED: uncharacterized protein LOC103326696  74.7    6e-12   
ref|XP_007212531.1|  hypothetical protein PRUPE_ppa019358mg           74.3    7e-12   
ref|XP_009355179.1|  PREDICTED: myb/SANT-like DNA-binding domain-...  74.3    8e-12   
gb|EAY82367.1|  hypothetical protein OsI_37579                        74.3    9e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_177813.1|  uncharacterized protein                             73.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486956.1|  PREDICTED: uncharacterized protein LOC101493...  73.9    1e-11   
ref|NP_564136.1|  sequence-specific DNA binding transcription factor  73.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001066231.1|  Os12g0163500                                     73.9    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004486957.1|  PREDICTED: uncharacterized protein LOC101493...  73.6    1e-11   
emb|CDP19340.1|  unnamed protein product                              73.6    1e-11   
gb|KHN30131.1|  hypothetical protein glysoja_010509                   73.6    2e-11   
ref|XP_002299233.2|  hypothetical protein POPTR_0001s05670g           73.2    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011037822.1|  PREDICTED: uncharacterized protein LOC105134921  73.2    2e-11   
gb|AAX95104.1|  expressed protein                                     73.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663843.1|  PREDICTED: uncharacterized protein LOC102711...  73.2    2e-11   
ref|XP_009343631.1|  PREDICTED: uncharacterized protein LOC103935584  73.2    2e-11   
gb|EAY80056.1|  hypothetical protein OsI_35222                        73.2    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_010102326.1|  hypothetical protein L484_015274                 72.8    2e-11   
ref|XP_010913949.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  72.8    3e-11   
ref|NP_001065831.1|  Os11g0163500                                     72.8    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001170044.1|  hypothetical protein                             72.4    4e-11   Zea mays [maize]
ref|XP_008677662.1|  PREDICTED: hypothetical protein isoform X2       72.4    4e-11   
ref|XP_002449041.1|  hypothetical protein SORBIDRAFT_05g003890        72.0    5e-11   Sorghum bicolor [broomcorn]
gb|ACR35490.1|  unknown                                               71.6    6e-11   Zea mays [maize]
ref|XP_011087822.1|  PREDICTED: uncharacterized protein LOC105169180  71.6    6e-11   
ref|XP_003542048.1|  PREDICTED: uncharacterized protein LOC100801014  71.6    6e-11   
ref|XP_008785828.1|  PREDICTED: uncharacterized protein LOC103704355  71.6    6e-11   
ref|XP_008667671.1|  PREDICTED: uncharacterized protein LOC100276...  71.6    6e-11   
ref|XP_002303892.2|  hypothetical protein POPTR_0003s20370g           71.6    6e-11   Populus trichocarpa [western balsam poplar]
ref|NP_001143969.1|  uncharacterized protein LOC100276786             71.6    7e-11   Zea mays [maize]
ref|XP_007041596.1|  Uncharacterized protein TCM_006441               71.2    8e-11   
ref|XP_010236469.1|  PREDICTED: uncharacterized protein LOC104584057  71.2    8e-11   
ref|XP_010928865.1|  PREDICTED: uncharacterized protein LOC105050511  71.2    9e-11   
ref|XP_010031815.1|  PREDICTED: uncharacterized protein LOC104421532  71.2    9e-11   
ref|XP_004161693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  71.2    9e-11   
ref|XP_002441874.1|  hypothetical protein SORBIDRAFT_08g003990        71.2    1e-10   Sorghum bicolor [broomcorn]
ref|XP_002513474.1|  transcription factor, putative                   70.9    1e-10   Ricinus communis
gb|EMS59212.1|  hypothetical protein TRIUR3_11128                     70.5    1e-10   
ref|NP_001142484.1|  uncharacterized protein LOC100274707             70.5    2e-10   Zea mays [maize]
gb|EMT09164.1|  hypothetical protein F775_06500                       70.5    2e-10   
ref|XP_008661671.1|  PREDICTED: uncharacterized protein LOC100274...  70.1    2e-10   
ref|XP_008441519.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.1    2e-10   
emb|CDX74006.1|  BnaA03g30410D                                        66.6    3e-10   
gb|KDP22075.1|  hypothetical protein JCGZ_25906                       69.7    3e-10   
ref|XP_004160309.1|  PREDICTED: uncharacterized protein LOC101232034  69.7    3e-10   
ref|XP_003597439.1|  hypothetical protein MTR_2g098080                69.7    3e-10   
gb|KEH25858.1|  transcription factor                                  69.7    3e-10   
ref|XP_004140967.1|  PREDICTED: uncharacterized protein LOC101203313  69.7    3e-10   
ref|XP_004142119.1|  PREDICTED: uncharacterized protein LOC101205501  69.3    4e-10   
ref|XP_008449727.1|  PREDICTED: uncharacterized protein LOC103491522  69.3    4e-10   
ref|XP_010927385.1|  PREDICTED: uncharacterized protein LOC105049444  68.9    5e-10   
ref|XP_003637928.1|  hypothetical protein MTR_113s0014                69.3    5e-10   
ref|XP_004978760.1|  PREDICTED: uncharacterized protein LOC101780...  68.9    5e-10   
ref|XP_010911980.1|  PREDICTED: uncharacterized protein LOC105038013  68.9    5e-10   
ref|XP_004977312.1|  PREDICTED: uncharacterized protein LOC101777...  68.9    6e-10   
ref|XP_009798604.1|  PREDICTED: uncharacterized protein LOC104244...  68.6    6e-10   
gb|EAY73746.1|  hypothetical protein OsI_01620                        67.8    7e-10   Oryza sativa Indica Group [Indian rice]
gb|EEE54438.1|  hypothetical protein OsJ_01511                        67.4    7e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662760.1|  PREDICTED: uncharacterized protein LOC102703623  68.6    8e-10   
ref|XP_009798603.1|  PREDICTED: uncharacterized protein LOC104244...  68.2    8e-10   
ref|XP_002887659.1|  hypothetical protein ARALYDRAFT_895568           67.8    1e-09   
ref|XP_010247986.1|  PREDICTED: uncharacterized protein LOC104590914  66.2    1e-09   
ref|XP_010673612.1|  PREDICTED: uncharacterized protein LOC104889964  67.8    1e-09   
ref|NP_001168394.1|  hypothetical protein                             67.8    1e-09   Zea mays [maize]
dbj|BAB62605.1|  hypothetical protein                                 67.8    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006854556.1|  hypothetical protein AMTR_s00030p00089780        67.4    2e-09   
ref|XP_009759483.1|  PREDICTED: uncharacterized protein LOC104212...  66.6    2e-09   
ref|XP_008793938.1|  PREDICTED: uncharacterized protein LOC103710100  67.0    2e-09   
ref|XP_004952693.1|  PREDICTED: stress response protein NST1-like...  67.0    2e-09   
ref|XP_009759481.1|  PREDICTED: uncharacterized protein LOC104212...  67.0    2e-09   
ref|XP_009759482.1|  PREDICTED: uncharacterized protein LOC104212...  67.0    2e-09   
ref|XP_006446099.1|  hypothetical protein CICLE_v10015189mg           66.2    5e-09   
ref|XP_006470589.1|  PREDICTED: uncharacterized protein LOC102621...  66.2    5e-09   
gb|KDO61296.1|  hypothetical protein CISIN_1g013250mg                 65.9    5e-09   
ref|XP_006470590.1|  PREDICTED: uncharacterized protein LOC102621...  65.9    5e-09   
ref|XP_006432257.1|  hypothetical protein CICLE_v10003451mg           65.9    6e-09   
ref|XP_006495058.1|  PREDICTED: uncharacterized protein LOC102628040  65.9    6e-09   
ref|XP_009619561.1|  PREDICTED: uncharacterized protein LOC104111549  65.5    6e-09   
gb|EMS64901.1|  hypothetical protein TRIUR3_28119                     65.5    7e-09   
dbj|BAK02398.1|  predicted protein                                    65.1    9e-09   
ref|XP_003578873.1|  PREDICTED: uncharacterized protein LOC100835589  65.1    1e-08   
gb|EMT18117.1|  hypothetical protein F775_19888                       65.1    1e-08   
gb|EMS60166.1|  hypothetical protein TRIUR3_08128                     65.1    1e-08   
dbj|BAJ98139.1|  predicted protein                                    64.7    1e-08   
gb|EMT20023.1|  hypothetical protein F775_31990                       64.3    2e-08   
ref|XP_006351819.1|  PREDICTED: uncharacterized protein LOC102593...  63.9    2e-08   
ref|XP_010536037.1|  PREDICTED: pescadillo homolog                    63.9    2e-08   
ref|XP_010315046.1|  PREDICTED: uncharacterized protein LOC101264265  63.9    3e-08   
ref|XP_010909118.1|  PREDICTED: putative DNA helicase INO80           63.9    3e-08   
gb|AIB05441.1|  trihelix transcription factor                         63.5    3e-08   
ref|XP_008645772.1|  PREDICTED: uncharacterized protein LOC103627263  63.5    4e-08   
gb|EYU18523.1|  hypothetical protein MIMGU_mgv1a008487mg              62.8    6e-08   
ref|XP_006647354.1|  PREDICTED: uncharacterized protein LOC102710758  61.6    1e-07   
ref|XP_010235511.1|  PREDICTED: uncharacterized protein LOC100828617  60.8    2e-07   
ref|NP_001047068.1|  Os02g0542400                                     60.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004955374.1|  PREDICTED: uncharacterized protein LOC101757...  60.5    4e-07   
gb|ACR37608.1|  unknown                                               59.7    6e-07   Zea mays [maize]
ref|XP_003577819.1|  PREDICTED: uncharacterized protein LOC100846758  59.7    7e-07   
emb|CDX85976.1|  BnaC06g21580D                                        58.9    9e-07   
ref|XP_008778516.1|  PREDICTED: uncharacterized protein LOC103698298  58.5    2e-06   
ref|XP_008777881.1|  PREDICTED: la-related protein CG11505-like       58.5    2e-06   
ref|XP_004291801.1|  PREDICTED: uncharacterized protein LOC101300312  58.2    3e-06   
ref|XP_009104656.1|  PREDICTED: uncharacterized protein LOC103830595  55.8    1e-05   
emb|CBI18199.3|  unnamed protein product                              51.2    4e-04   
ref|XP_004971771.1|  PREDICTED: uncharacterized protein LOC101752474  50.4    8e-04   



>ref|XP_010325945.1| PREDICTED: putative DNA helicase INO80 [Solanum lycopersicum]
Length=491

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 125/201 (62%), Gaps = 27/201 (13%)
 Frame = -3

Query  522  MESNGMYSNMGSGMLGLEMSLhhv----------ppqqnphpmqhqshpPMVSWPggg--  379
            M+S  +YSNMG GMLGLEMSLHH             Q  PHP     H PMVS+      
Sbjct  1    MDSGSLYSNMGPGMLGLEMSLHHQIPPQNTHHHLHQQPPPHPQPQPHHHPMVSFAHQENN  60

Query  378  -------gGTYPSGNKPKPTPGLTLSDDNDPG-GPTADQNSVDDGKR---KMCPWQRMKW  232
                      +P G+       L  SDD++P  G +AD NS DDGKR   K CPWQRMKW
Sbjct  61   DNQQQTLRQVFPFGSNKAKNQSLNFSDDDEPVPGVSADNNSTDDGKRNGNKTCPWQRMKW  120

Query  231  TDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwK----SVSRA  64
            TDNMVRLLIMVVYYIGDEVGSEGNIN+ +  KKK   GGGGG      + K    SVSRA
Sbjct  121  TDNMVRLLIMVVYYIGDEVGSEGNINNDSSGKKKGGSGGGGGGGVGVLQKKGKWKSVSRA  180

Query  63   MMERGFYVSPQQCEDKFNDLN  1
            MMERGFYVSPQQCEDKFNDLN
Sbjct  181  MMERGFYVSPQQCEDKFNDLN  201



>ref|XP_006341187.1| PREDICTED: nucleomorphin-like [Solanum tuberosum]
Length=482

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 125/196 (64%), Gaps = 28/196 (14%)
 Frame = -3

Query  522  MESNGMYSNMGSGMLGLEMSLhhv---------ppqqnphpmqhqshpPMVSWPggg---  379
            M+S  +YSN G GMLGLEMSLHH            QQ     Q   H PMVS+       
Sbjct  1    MDSGSLYSNRGPGMLGLEMSLHHQIPQQNTHHHLHQQPLPHPQPPPHHPMVSFAHQENAD  60

Query  378  ------gGTYPSGNKPKPTPGLTLSDDNDPG-GPTADQNSVDDGKR---KMCPWQRMKWT  229
                     +P GN       L  SDD++P  G +AD NS DDGKR   K CPWQRMKWT
Sbjct  61   NQQQTLRQVFPFGNNKAKNQSLNFSDDDEPVPGVSADNNSTDDGKRNGNKTCPWQRMKWT  120

Query  228  DNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERG  49
            DNMVRLLIMVVYYIGDEVGSEGN N+       ++G   GGV+QKKGKWKSVSRAMMERG
Sbjct  121  DNMVRLLIMVVYYIGDEVGSEGNNNND------SSGKKKGGVLQKKGKWKSVSRAMMERG  174

Query  48   FYVSPQQCEDKFNDLN  1
            FYVSPQQCEDKFNDLN
Sbjct  175  FYVSPQQCEDKFNDLN  190



>ref|XP_011094441.1| PREDICTED: uncharacterized protein LOC105174138 [Sesamum indicum]
Length=482

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 118/194 (61%), Gaps = 30/194 (15%)
 Frame = -3

Query  522  MESNGM----YSNMGSGMLGLEMSLhhvppqqnphpmq----------------hqshpP  403
            MESN M    YSN+  GMLGLEMSL+H  P Q                      H     
Sbjct  1    MESNAMPGGRYSNVQPGMLGLEMSLNHHIPPQQNPHQMPQQQPHPNQPMVPSYGHHEADY  60

Query  402  MVSWPggggGTYPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDN  223
                       YP   K K    LTLSDD++PG     +NS DDGKRKM  WQRMKWTDN
Sbjct  61   HSQAQQSAKQGYPFSAKSK-NQTLTLSDDDEPG--FLAENSTDDGKRKMPSWQRMKWTDN  117

Query  222  MVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFY  43
            MVRLLIMVVYYIGDEVGS+   NDP      AA   GGGV+QKKGKWKSVSRAMMERGFY
Sbjct  118  MVRLLIMVVYYIGDEVGSDQG-NDP------AAKKKGGGVLQKKGKWKSVSRAMMERGFY  170

Query  42   VSPQQCEDKFNDLN  1
            VSPQQCEDKFNDLN
Sbjct  171  VSPQQCEDKFNDLN  184



>ref|XP_011101476.1| PREDICTED: uncharacterized protein LOC105179522 [Sesamum indicum]
Length=445

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 118/189 (62%), Gaps = 25/189 (13%)
 Frame = -3

Query  522  MESNGMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVS---------------WP  388
            ME NG+Y +M  GMLGLEMSL H  P QNP   QH       +               +P
Sbjct  1    MEPNGIYPSMQPGMLGLEMSLRHPVPAQNPQNSQHIQQQQQQNSPHPVVGYGRHDGDCYP  60

Query  387  ggggGTYPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLL  208
                  YP   K K    LTLSDD++PG     + S DDGKRKM PWQRMKWTDNM+RLL
Sbjct  61   QTQQQGYPFAAKSK-NQSLTLSDDDEPG--VTAETSADDGKRKMSPWQRMKWTDNMIRLL  117

Query  207  IMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQ  28
            IMVVYY+GDEV SEG  NDP      +   GGGG +QKKGKWKSVS+ M E+GF VSPQQ
Sbjct  118  IMVVYYVGDEVVSEG--NDP-----ASKKKGGGGALQKKGKWKSVSKVMTEKGFNVSPQQ  170

Query  27   CEDKFNDLN  1
            CEDKFNDLN
Sbjct  171  CEDKFNDLN  179



>ref|XP_002528638.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33741.1| conserved hypothetical protein [Ricinus communis]
Length=499

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 115/187 (61%), Gaps = 24/187 (13%)
 Frame = -3

Query  510  GMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpP-----MVSWPggg-----------  379
            G++S MGSG+LGLEM LH    QQ  +P   Q+        MV++               
Sbjct  9    GIFSGMGSGLLGLEMPLHQQQQQQQQNPQNPQNTHQIHHPQMVAYAHNHESDHNPQSQQS  68

Query  378  -gGTYPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIM  202
                Y   +   P P   LSD+++PG    D  S  DGKRK+ PWQRMKWTD+MVRLLIM
Sbjct  69   VKHAYNPYSSLNPKPQSPLSDEDEPGFTGDD--STGDGKRKVSPWQRMKWTDSMVRLLIM  126

Query  201  VVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCE  22
             V+YIGDE GSEGN NDP           GGG+ QKKGKWKSVSRAMME+GFYVSPQQCE
Sbjct  127  AVFYIGDEAGSEGN-NDP----STGKKKAGGGLSQKKGKWKSVSRAMMEKGFYVSPQQCE  181

Query  21   DKFNDLN  1
            DKFNDLN
Sbjct  182  DKFNDLN  188



>ref|XP_009619384.1| PREDICTED: FERM domain-containing protein C [Nicotiana tomentosiformis]
Length=447

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 94/123 (76%), Gaps = 9/123 (7%)
 Frame = -3

Query  366  PSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKR-KMCPWQRMKWTDNMVRLLIMVVYY  190
            P GNK K    LT SD++D        NSV+DGKR K CPWQRMKWTDNMVRLLIMVVYY
Sbjct  40   PFGNKAK-NQSLTFSDEDDN-------NSVEDGKRSKTCPWQRMKWTDNMVRLLIMVVYY  91

Query  189  IGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFN  10
            IGDEVGSE N N+      K  GGG  GV+QKKGKWKSVSRAMMERGFYVSPQQCEDKFN
Sbjct  92   IGDEVGSELNNNNNDTTNGKKKGGGSVGVLQKKGKWKSVSRAMMERGFYVSPQQCEDKFN  151

Query  9    DLN  1
            DLN
Sbjct  152  DLN  154



>gb|KDP29238.1| hypothetical protein JCGZ_16627 [Jatropha curcas]
Length=483

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 113/185 (61%), Gaps = 22/185 (12%)
 Frame = -3

Query  522  MESNGM----YSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSWPggggGTYPSGN  355
            ME NG+    +S MGSG+LGLEM LH     QNPH + H     +V++       +P   
Sbjct  1    MEHNGLAGGIFSGMGSGVLGLEMPLHQEQNPQNPHHLHHPQ---IVAYAHHESDHHPQTQ  57

Query  354  KPKPTPGLTLSDDNDPGGPTADQNS-------VDDGKRKMCPWQRMKWTDNMVRLLIMVV  196
            +    P    S    P  P +D++          DGKRKM PWQRMKWTD+MVRLLIM V
Sbjct  58   QSMKHPYPYASAKPKPQSPPSDEDEHFIGDDVTSDGKRKMSPWQRMKWTDSMVRLLIMAV  117

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
            +YIGDE GSE  +NDP            GG+ QKKGKWKSVSRAMME+GFYVSPQQCEDK
Sbjct  118  FYIGDEAGSE--VNDP------TGKKKAGGLSQKKGKWKSVSRAMMEKGFYVSPQQCEDK  169

Query  15   FNDLN  1
            FNDLN
Sbjct  170  FNDLN  174



>ref|XP_007202030.1| hypothetical protein PRUPE_ppa005148mg [Prunus persica]
 gb|EMJ03229.1| hypothetical protein PRUPE_ppa005148mg [Prunus persica]
Length=475

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 114/185 (62%), Gaps = 26/185 (14%)
 Frame = -3

Query  522  MESNGMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSWPg-----------ggg  376
            MESNG++S    G+LGLEM LH     QNP    H   P MV++                
Sbjct  1    MESNGLFS----GILGLEMPLHQTQNPQNPQNTHHMHQPQMVAYAHHDPDHHQHPHQSVK  56

Query  375  GTYPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVV  196
              YP   K K    + LSDD++PG   AD NS  D KRK+ PWQRMKWTD MVRLLIM V
Sbjct  57   QGYPFATKSKQ---IALSDDDEPG-FGADDNSNGDNKRKISPWQRMKWTDTMVRLLIMAV  112

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
            +YIGDE GSEG   DP            GG++QKKGKWKSVSRAMME+GFYVSPQQCEDK
Sbjct  113  FYIGDEGGSEG--TDP-----TGKKKSVGGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDK  165

Query  15   FNDLN  1
            FNDLN
Sbjct  166  FNDLN  170



>ref|XP_008241327.1| PREDICTED: uncharacterized protein LOC103339760 [Prunus mume]
Length=483

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 114/185 (62%), Gaps = 26/185 (14%)
 Frame = -3

Query  522  MESNGMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSWPgg-----------gg  376
            MESNG++S    G+LGLEM LH     QNP    H   P MV++                
Sbjct  1    MESNGLFS----GILGLEMPLHQTQNPQNPQNPHHMHQPQMVAYAHHDPDHPQHPHQSVK  56

Query  375  GTYPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVV  196
              YP   K K    + LSDD++PG   AD NS  D KRK+ PWQRMKWTD MVRLLIM V
Sbjct  57   QGYPFATKSKQ---IALSDDDEPGF-GADDNSNGDNKRKISPWQRMKWTDTMVRLLIMAV  112

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
            +YIGDE GSEG   DP            GG++QKKGKWKSVSRAMME+GFYVSPQQCEDK
Sbjct  113  FYIGDEGGSEG--TDP-----TGKKKSVGGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDK  165

Query  15   FNDLN  1
            FNDLN
Sbjct  166  FNDLN  170



>ref|XP_002277851.3| PREDICTED: stress response protein NST1 [Vitis vinifera]
 ref|XP_010654025.1| PREDICTED: stress response protein NST1 [Vitis vinifera]
Length=492

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 118/186 (63%), Gaps = 26/186 (14%)
 Frame = -3

Query  510  GMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpP-------MVSWPggggGTYPSGNK  352
            GM+S+MG+GMLGLEM L     QQNP    H  H         MV++       +    +
Sbjct  9    GMFSSMGTGMLGLEMPLQQPQQQQNPQNPHHTHHHTHLQQHPQMVAFAHPDPDHHSQSQQ  68

Query  351  P---------KPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMV  199
            P         K    LTLSD+++PG  T D +S  DGKRK+ PW RMKWTDNMVRLLIM 
Sbjct  69   PVKHGYPYVTKAKQQLTLSDEDEPG-LTGD-DSTADGKRKVSPWHRMKWTDNMVRLLIMA  126

Query  198  VYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCED  19
            V+YIGDE GSE   +DP      +A    GG++QKKGKWKSVSRAMME+GFYVSPQQCED
Sbjct  127  VFYIGDEGGSE--CSDP------SAKKKTGGLLQKKGKWKSVSRAMMEKGFYVSPQQCED  178

Query  18   KFNDLN  1
            KFNDLN
Sbjct  179  KFNDLN  184



>ref|XP_009788508.1| PREDICTED: ESF1 homolog [Nicotiana sylvestris]
Length=424

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 92/120 (77%), Gaps = 9/120 (8%)
 Frame = -3

Query  357  NKPKPTPGLTLSDDNDPGGPTADQNSVDDGKR-KMCPWQRMKWTDNMVRLLIMVVYYIGD  181
            NK K    LT SDD+D        NSV+DGK+ K CPWQRMKWTDNMVRLLIMVVYYIGD
Sbjct  24   NKAK-NQSLTFSDDDDN-------NSVEDGKKSKTCPWQRMKWTDNMVRLLIMVVYYIGD  75

Query  180  EVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            EVGSE N N+      K  GGG  GV+QKKGKWKSVSRAMMERGFYVSPQQCEDKFNDLN
Sbjct  76   EVGSEVNNNNNDTYNSKKKGGGSVGVLQKKGKWKSVSRAMMERGFYVSPQQCEDKFNDLN  135



>ref|XP_011012418.1| PREDICTED: uncharacterized protein LOC105116670 [Populus euphratica]
Length=466

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 103/174 (59%), Gaps = 19/174 (11%)
 Frame = -3

Query  495  MGSGMLGLEMSLhh--------vppqqnphpmqhqshpPMVSWPggggGTYPSGNKPKPT  340
            MGSGMLGLE+ LH                    H                YP  +  KP 
Sbjct  1    MGSGMLGLELPLHQPENPQNPNHMNHPQVVAYTHHESDHRQHSQQSVKQAYPYASSTKPK  60

Query  339  PGLT-LSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEG  163
              L+ LSD+++P     D  S  +GKRKM PWQRMKWTD+MVRLLIM V+YIGD+VGSEG
Sbjct  61   QLLSPLSDEDEPSFTGDD--STTEGKRKMSPWQRMKWTDHMVRLLIMAVFYIGDDVGSEG  118

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
              +DP            GG+ QKKGKWKSVSRAMME+GFYVSPQQCEDKFNDLN
Sbjct  119  --SDP------IGKKKPGGLAQKKGKWKSVSRAMMEKGFYVSPQQCEDKFNDLN  164



>ref|XP_006373929.1| hypothetical protein POPTR_0016s11010g [Populus trichocarpa]
 gb|ERP51726.1| hypothetical protein POPTR_0016s11010g [Populus trichocarpa]
Length=355

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 92/125 (74%), Gaps = 11/125 (9%)
 Frame = -3

Query  372  TYPSGNKPKPTPGLT-LSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVV  196
             YP  +  KP   L+ LSD+++P   T D N+ D GKRKM PWQRMKWTD+MVRLLIM V
Sbjct  27   AYPYASSTKPKQLLSPLSDEDEPSF-TGDDNTTD-GKRKMSPWQRMKWTDHMVRLLIMAV  84

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
            +YIGD+VGSEG  +DP            GG+ QKKGKWKSVSRAMME+GFYVSPQQCEDK
Sbjct  85   FYIGDDVGSEG--SDP------IGKKKPGGLAQKKGKWKSVSRAMMEKGFYVSPQQCEDK  136

Query  15   FNDLN  1
            FNDLN
Sbjct  137  FNDLN  141



>ref|XP_004497590.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26-like [Cicer arietinum]
Length=507

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 7/107 (7%)
 Frame = -3

Query  321  DDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPag  142
            D+++P  P A+++S  D KRK+ PWQRMKWTD MVRLLIM VYYIGDE GSEGN NDP  
Sbjct  100  DEDEPNFP-AEESSGGDPKRKISPWQRMKWTDTMVRLLIMAVYYIGDEAGSEGNNNDP--  156

Query  141  nkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                 +     G++QKKGKWKSVSRAMME+GFYVSPQQCEDKFNDLN
Sbjct  157  ----MSKKKPSGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFNDLN  199



>ref|XP_011018864.1| PREDICTED: 46 kDa FK506-binding nuclear protein-like [Populus 
euphratica]
Length=486

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 103/174 (59%), Gaps = 20/174 (11%)
 Frame = -3

Query  495  MGSGMLGLEMSLhhvp--------pqqnphpmqhqshpPMVSWPggggGTYPSGNKPKPT  340
            MGSGMLGLE+ LH                    H                YP  +  KP 
Sbjct  1    MGSGMLGLELPLHQQQNPQNPHHLQHPQIVAYTHHESDHHQHSQQSAKHAYPFAS-TKPK  59

Query  339  PGLT-LSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEG  163
              L+ LS++++P     D  S  DGKRK+ PWQRMKWTDNMVRLLIM V+YIGDEVGSE 
Sbjct  60   QLLSPLSNEDEPSFTGDD--STTDGKRKISPWQRMKWTDNMVRLLIMAVFYIGDEVGSE-  116

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
             ++DP            GG+ QKKGKWKSVSRAMME+GFYVSPQQCEDKFNDLN
Sbjct  117  -VSDP------IGKKKPGGLAQKKGKWKSVSRAMMEKGFYVSPQQCEDKFNDLN  163



>ref|XP_006381332.1| hypothetical protein POPTR_0006s11870g [Populus trichocarpa]
 gb|ERP59129.1| hypothetical protein POPTR_0006s11870g [Populus trichocarpa]
Length=496

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 106/186 (57%), Gaps = 23/186 (12%)
 Frame = -3

Query  522  MESN----GMYSNMGSGMLGLEMSLhhvp--------pqqnphpmqhqshpPMVSWPggg  379
            ME N    G++  MGSG+LGLE+ LH                    H             
Sbjct  1    MEHNDLGGGIFPGMGSGILGLELPLHQQQNPQNPHHLQHPQIVAYAHHESDHHQHSQQSA  60

Query  378  gGTYPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMV  199
               YP  +  KP     LS++++P     D  S  DG RK+ PWQRMKWTDNMVRLLIM 
Sbjct  61   KHAYPFAS-TKPKQLSPLSNEDEPSFTGDD--STTDGNRKISPWQRMKWTDNMVRLLIMA  117

Query  198  VYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCED  19
            V+YIGDEVGSE  ++DP            GG+ QKKGKWKSVSRAMME+GFYVSPQQCED
Sbjct  118  VFYIGDEVGSE--VSDP------IGKKKPGGLAQKKGKWKSVSRAMMEKGFYVSPQQCED  169

Query  18   KFNDLN  1
            KFNDLN
Sbjct  170  KFNDLN  175



>ref|XP_010243252.1| PREDICTED: uncharacterized protein LOC104587365 [Nelumbo nucifera]
Length=496

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 117/185 (63%), Gaps = 22/185 (12%)
 Frame = -3

Query  516  SNGMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpP-MVSWPggggGTY---------  367
            + GM S +  GMLGLEM LH    Q +PH   HQ   P MVS+ G     +         
Sbjct  7    AGGMISGLSPGMLGLEMPLHQAQQQHHPHQHHHQQQHPQMVSFAGQDADHHSQSQSVKQH  66

Query  366  ---PSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVV  196
               P   K KP    +LSD+ + G   A ++   DGK++M PWQRMKWTDNMVRLLIMVV
Sbjct  67   VYPPYATKAKPQQP-SLSDEEEQG--FAGEDGGADGKKRMSPWQRMKWTDNMVRLLIMVV  123

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
            +YIGD+ GSEG  NDP      A     GG++QKKGKWKSVSRAMME+GFYVSPQQCEDK
Sbjct  124  FYIGDDGGSEG--NDP----SGAGKKKPGGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDK  177

Query  15   FNDLN  1
            FNDLN
Sbjct  178  FNDLN  182



>ref|XP_007027578.1| Sequence-specific DNA binding transcription factors isoform 2 
[Theobroma cacao]
 gb|EOY08080.1| Sequence-specific DNA binding transcription factors isoform 2 
[Theobroma cacao]
Length=474

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 88/123 (72%), Gaps = 12/123 (10%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYY  190
            YP  +K K      LSD+++PG    D     D KRK+ PWQRMKWTD+MVRLLIM VYY
Sbjct  64   YPFASKTKQLS--PLSDEDEPGFTPDD--GAADAKRKISPWQRMKWTDSMVRLLIMAVYY  119

Query  189  IGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFN  10
            IGDE GSEG  NDP      A     GG++QKKGKWKSVSRAMME+GFYVSPQQCEDKFN
Sbjct  120  IGDEAGSEG--NDP------AGKKKAGGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFN  171

Query  9    DLN  1
            DLN
Sbjct  172  DLN  174



>ref|XP_004303047.1| PREDICTED: uncharacterized protein LOC101312168 [Fragaria vesca 
subsp. vesca]
Length=489

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 110/184 (60%), Gaps = 26/184 (14%)
 Frame = -3

Query  510  GMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshp-PMVSWPgggg-------------G  373
            G++  M SGMLGLEM LH     QNP    H  H   MVS+                   
Sbjct  9    GLFPEMRSGMLGLEMPLHQTQNPQNPQNPHHHMHQPQMVSYAHHEADLNHHPQAQQSVKH  68

Query  372  TYPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVY  193
             YP   KPK    +TLSD+++PG    D  S  D KRK+ PWQRMKWTD MVRLLIM V+
Sbjct  69   GYPYAAKPKQ---ITLSDEDEPGFGADD--SAGDNKRKISPWQRMKWTDTMVRLLIMAVF  123

Query  192  YIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKF  13
            YIGDE  SE    DP           GGG++QKKGKWKSVSRAMME+GFYVSPQQCEDKF
Sbjct  124  YIGDEGVSE--CPDP-----TGKKKNGGGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKF  176

Query  12   NDLN  1
            NDLN
Sbjct  177  NDLN  180



>emb|CBI30220.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 92/123 (75%), Gaps = 12/123 (10%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYY  190
            YP   K K    LTLSD+++PG  T D +S  DGKRK+ PW RMKWTDNMVRLLIM V+Y
Sbjct  57   YPYVTKAKQQ--LTLSDEDEPG-LTGD-DSTADGKRKVSPWHRMKWTDNMVRLLIMAVFY  112

Query  189  IGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFN  10
            IGDE GSE   +DP      +A    GG++QKKGKWKSVSRAMME+GFYVSPQQCEDKFN
Sbjct  113  IGDEGGSE--CSDP------SAKKKTGGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFN  164

Query  9    DLN  1
            DLN
Sbjct  165  DLN  167



>ref|XP_010103346.1| hypothetical protein L484_002280 [Morus notabilis]
 gb|EXB95450.1| hypothetical protein L484_002280 [Morus notabilis]
Length=473

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 108/194 (56%), Gaps = 36/194 (19%)
 Frame = -3

Query  522  MESNGM-----YSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSWPggggGTYPSG  358
            ME+NG+     +S MGSGMLGLEM L                   MV +        P+ 
Sbjct  1    MEANGLGGGGLFSAMGSGMLGLEMPLQPQQQNPRHLQHPQ-----MVGYAHHD----PAD  51

Query  357  NKPKPTPGL---------------TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDN  223
              P+  P L                LSD+++ G       +  DGKRKM PWQRMKWTD+
Sbjct  52   QHPQTQPSLKHGYTYGPTSKSKQVALSDEDEAGFGADHDGTNGDGKRKMSPWQRMKWTDS  111

Query  222  MVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFY  43
            MVR LIM VYYIGD+ G EG   DP      A     GG++QKKGKWK+VSRAMME+GF+
Sbjct  112  MVRYLIMAVYYIGDDGGLEG--TDP-----AAKKKPSGGLLQKKGKWKTVSRAMMEKGFH  164

Query  42   VSPQQCEDKFNDLN  1
            VSPQQCEDKFNDLN
Sbjct  165  VSPQQCEDKFNDLN  178



>ref|XP_007027577.1| Sequence-specific DNA binding transcription factors isoform 1 
[Theobroma cacao]
 gb|EOY08079.1| Sequence-specific DNA binding transcription factors isoform 1 
[Theobroma cacao]
Length=537

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 88/123 (72%), Gaps = 12/123 (10%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYY  190
            YP  +K K      LSD+++PG    D     D KRK+ PWQRMKWTD+MVRLLIM VYY
Sbjct  127  YPFASKTKQLS--PLSDEDEPGFTPDD--GAADAKRKISPWQRMKWTDSMVRLLIMAVYY  182

Query  189  IGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFN  10
            IGDE GSEG  NDP      A     GG++QKKGKWKSVSRAMME+GFYVSPQQCEDKFN
Sbjct  183  IGDEAGSEG--NDP------AGKKKAGGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFN  234

Query  9    DLN  1
            DLN
Sbjct  235  DLN  237



>ref|XP_006594181.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26-like isoform X2 [Glycine max]
Length=469

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 86/123 (70%), Gaps = 19/123 (15%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYY  190
            + S  K + +P   LSDD++PG P AD    +D KRK+ PWQRMKWTD MVRLLIM VYY
Sbjct  68   FSSQTKQQQSP---LSDDDEPGFP-AD----EDPKRKVSPWQRMKWTDTMVRLLIMAVYY  119

Query  189  IGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFN  10
            IGDE GSEG                  G+MQKKGKWKSVSRAMME+GFYVSPQQCEDKFN
Sbjct  120  IGDEAGSEGT-----------DKKKSSGLMQKKGKWKSVSRAMMEKGFYVSPQQCEDKFN  168

Query  9    DLN  1
            DLN
Sbjct  169  DLN  171



>gb|EYU41556.1| hypothetical protein MIMGU_mgv1a006561mg [Erythranthe guttata]
Length=439

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 93/125 (74%), Gaps = 7/125 (6%)
 Frame = -3

Query  372  TYPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMC-PWQRMKWTDNMVRLLIMVV  196
            TYPS  K K  P LTLSDD++PG   A  NS DDGKRKM  PWQRMKWTDNMV+LLIMVV
Sbjct  82   TYPSAPKSKTQP-LTLSDDDEPG--FAADNSADDGKRKMTSPWQRMKWTDNMVKLLIMVV  138

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
            +YIGDEV   G        +      GGGG +QKKGKWKSVSRAMMERGFYVSPQQCEDK
Sbjct  139  FYIGDEVVVGGGGAA---AEGVDKKKGGGGALQKKGKWKSVSRAMMERGFYVSPQQCEDK  195

Query  15   FNDLN  1
            FNDLN
Sbjct  196  FNDLN  200



>ref|NP_001235465.1| SHOOT2 protein [Glycine max]
 gb|AAK69274.1| unknown [Glycine max]
Length=408

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 85/123 (69%), Gaps = 19/123 (15%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYY  190
            +    K + +P   LSDD++PG P AD    +D KRK+ PWQRMKWTD MVRLLIM VYY
Sbjct  29   FSHQTKQQQSP---LSDDDEPGFP-AD----EDPKRKVSPWQRMKWTDTMVRLLIMAVYY  80

Query  189  IGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFN  10
            IGDE GSEG                  G++QKKGKWKSVSRAMME+GFYVSPQQCEDKFN
Sbjct  81   IGDEAGSEGT-----------DKKKSSGLIQKKGKWKSVSRAMMEKGFYVSPQQCEDKFN  129

Query  9    DLN  1
            DLN
Sbjct  130  DLN  132



>ref|XP_003542565.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26-like isoform X1 [Glycine max]
Length=478

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 86/123 (70%), Gaps = 19/123 (15%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYY  190
            + S  K + +P   LSDD++PG P AD    +D KRK+ PWQRMKWTD MVRLLIM VYY
Sbjct  77   FSSQTKQQQSP---LSDDDEPGFP-AD----EDPKRKVSPWQRMKWTDTMVRLLIMAVYY  128

Query  189  IGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFN  10
            IGDE GSEG                  G+MQKKGKWKSVSRAMME+GFYVSPQQCEDKFN
Sbjct  129  IGDEAGSEGT-----------DKKKSSGLMQKKGKWKSVSRAMMEKGFYVSPQQCEDKFN  177

Query  9    DLN  1
            DLN
Sbjct  178  DLN  180



>ref|XP_003590397.1| hypothetical protein MTR_1g061640 [Medicago truncatula]
 gb|ABE80120.2| Homeodomain-like [Medicago truncatula]
 gb|AES60648.1| Myb/SANT-like DNA-binding domain protein [Medicago truncatula]
Length=496

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 83/109 (76%), Gaps = 10/109 (9%)
 Frame = -3

Query  327  LSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDP  148
            +SD+++P  P A+++S  D KRK+ PWQRMKWTD MVRLLIM VYYIGDE GSEG   DP
Sbjct  94   MSDEDEPNFP-AEESSGGDPKRKISPWQRMKWTDTMVRLLIMAVYYIGDEAGSEG--TDP  150

Query  147  agnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                         G++QKKGKWKSVSRAMME+GFYVSPQQCEDKFNDLN
Sbjct  151  -------NKKKSSGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFNDLN  192



>ref|XP_004172887.1| PREDICTED: uncharacterized LOC101222223 [Cucumis sativus]
Length=439

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 100/179 (56%), Gaps = 23/179 (13%)
 Frame = -3

Query  507  MYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSW----------PggggGTYPSG  358
            M+S M S MLGLE+ LH  P         H     MVS+          P      YP  
Sbjct  1    MFSGMNSSMLGLELPLHQNPTNPTNPHQLHHPP--MVSYVQHDPHHHQQPPSVSVKYPFP  58

Query  357  NKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDE  178
             K KP     LSDD + G    D N   DGK+K+ PWQRMKWTD MVRLLI  V+YIGDE
Sbjct  59   TKAKPQQS-NLSDDEEQGFAADDSNG--DGKKKISPWQRMKWTDMMVRLLITAVFYIGDE  115

Query  177  VGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
             GSE                   G++QKKGKWKSVSRAMME+GFYVSPQQCEDKFNDLN
Sbjct  116  GGSE--------PVDHVGKKKPVGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFNDLN  166



>ref|XP_004138003.1| PREDICTED: uncharacterized protein LOC101222223 [Cucumis sativus]
 gb|KGN59044.1| hypothetical protein Csa_3G748240 [Cucumis sativus]
Length=468

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 100/179 (56%), Gaps = 23/179 (13%)
 Frame = -3

Query  507  MYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSW----------PggggGTYPSG  358
            M+S M S MLGLE+ LH  P         H     MVS+          P      YP  
Sbjct  30   MFSGMNSSMLGLELPLHQNPTNPTNPHQLHHPP--MVSYVQHDPHHHQQPPSVSVKYPFP  87

Query  357  NKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDE  178
             K KP     LSDD + G    D N   DGK+K+ PWQRMKWTD MVRLLI  V+YIGDE
Sbjct  88   TKAKPQQS-NLSDDEEQGFAADDSNG--DGKKKISPWQRMKWTDMMVRLLITAVFYIGDE  144

Query  177  VGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
             GSE                   G++QKKGKWKSVSRAMME+GFYVSPQQCEDKFNDLN
Sbjct  145  GGSE--------PVDHVGKKKPVGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFNDLN  195



>ref|XP_008442785.1| PREDICTED: ESF1 homolog [Cucumis melo]
Length=467

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 100/179 (56%), Gaps = 23/179 (13%)
 Frame = -3

Query  507  MYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSW----------PggggGTYPSG  358
            M+S M S MLGLE+ LH  P         H     MVS+          P      YP  
Sbjct  31   MFSGMNSSMLGLELPLHQNPTNPTNPHQLHHPP--MVSYVQHDPHHHQQPPSVSVKYPFP  88

Query  357  NKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDE  178
             K KP     LSDD + G    D N   DGK+K+ PWQRMKWTD MVRLLI  V+YIGDE
Sbjct  89   TKAKPQQS-NLSDDEEQGFAADDSNG--DGKKKISPWQRMKWTDMMVRLLITAVFYIGDE  145

Query  177  VGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
             GSE                   G++QKKGKWKSVSRAMME+GFYVSPQQCEDKFNDLN
Sbjct  146  GGSE--------PVDHVGKKKPVGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFNDLN  196



>ref|XP_007162836.1| hypothetical protein PHAVU_001G185100g [Phaseolus vulgaris]
 ref|XP_007162837.1| hypothetical protein PHAVU_001G185100g [Phaseolus vulgaris]
 gb|ESW34830.1| hypothetical protein PHAVU_001G185100g [Phaseolus vulgaris]
 gb|ESW34831.1| hypothetical protein PHAVU_001G185100g [Phaseolus vulgaris]
Length=450

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 79/111 (71%), Gaps = 12/111 (11%)
 Frame = -3

Query  333  LTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIN  154
            +TLSD+++ G    D     D KRKM PW RMKWTD MVRLLIM VYYIGDE GSEG  +
Sbjct  75   ITLSDEDEAGFTAEDSG---DPKRKMSPWHRMKWTDTMVRLLIMAVYYIGDEAGSEG--S  129

Query  153  DPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            DP             G++QKKGKWKSVSR MME+G+YVSPQQCEDKFNDLN
Sbjct  130  DP-------TKKKATGLLQKKGKWKSVSRGMMEKGYYVSPQQCEDKFNDLN  173



>ref|XP_009334880.1| PREDICTED: uncharacterized protein LOC103927663 [Pyrus x bretschneideri]
Length=474

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 110/183 (60%), Gaps = 23/183 (13%)
 Frame = -3

Query  522  MESNGMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSW-----PggggGTYPSG  358
            ME+NG++S    GMLGLEM LH                  MV++     P      + S 
Sbjct  1    MEANGLFS----GMLGLEMPLHQNTQNPQNPHHHMHQPQ-MVAYAPHHDPDNHQNPHQSV  55

Query  357  NKPKP----TPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYY  190
             +  P    +  + LSDD++PG   AD NS  D K+K+ PWQRMKWTD MVRLLIM V+Y
Sbjct  56   KQGHPFAPKSKQIALSDDDEPGF-GADDNSNGDNKKKISPWQRMKWTDTMVRLLIMAVFY  114

Query  189  IGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFN  10
            IGD+  S+G   DP            GG++QKKGKWKSVSRAM+E+GFYVSPQQCEDKFN
Sbjct  115  IGDDA-SDG--PDP-----TGKKKPAGGLLQKKGKWKSVSRAMIEKGFYVSPQQCEDKFN  166

Query  9    DLN  1
            DLN
Sbjct  167  DLN  169



>emb|CDP21813.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 74/88 (84%), Gaps = 7/88 (8%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            RK+ PWQRMKWTDNMVRLLIMVV+YIGDEVGSEG  NDP          G GGV+QKKGK
Sbjct  2    RKISPWQRMKWTDNMVRLLIMVVFYIGDEVGSEG--NDP-----AGKKKGAGGVLQKKGK  54

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WKSVSRAMMERGF+VSPQQCEDKFNDLN
Sbjct  55   WKSVSRAMMERGFFVSPQQCEDKFNDLN  82



>ref|XP_008387330.1| PREDICTED: uncharacterized protein LOC103449787 [Malus domestica]
Length=479

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 113/183 (62%), Gaps = 26/183 (14%)
 Frame = -3

Query  522  MESNGMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSW-----PggggGTYPSG  358
            ME+NG++S    GMLGLEM LH  P   +    Q Q    MV++     P      + S 
Sbjct  1    MEANGLFS----GMLGLEMPLHQNPQNPHHLMHQPQ----MVAYAPHHDPDNHQNPHQSV  52

Query  357  NKPKP----TPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYY  190
             +  P    +  + LSDD++PG   AD NS  D K+K+ PWQRMKWTD MV LLIM V+Y
Sbjct  53   KQRHPFAPKSKQIALSDDDEPGF-GADDNSNGDNKKKISPWQRMKWTDTMVSLLIMAVFY  111

Query  189  IGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFN  10
            IGDE  S+G   DP            GG++QKKGKWKSVSRAMME+GFYVSPQQCEDKFN
Sbjct  112  IGDEA-SDG--PDP-----TGKKKPAGGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFN  163

Query  9    DLN  1
            DLN
Sbjct  164  DLN  166



>gb|KHN45698.1| hypothetical protein glysoja_036847 [Glycine soja]
Length=477

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 80/110 (73%), Gaps = 17/110 (15%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            + SDD++PG  +AD    DD K+K+ PWQRMKWTD MVRLLIM VYYIGDE GSEG    
Sbjct  83   SFSDDDEPG--SAD----DDPKKKVSPWQRMKWTDTMVRLLIMAVYYIGDEAGSEGT---  133

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                          G+MQKKGKWKSVSRAMME+GFYVSPQQCEDKF+DLN
Sbjct  134  --------DKKKASGLMQKKGKWKSVSRAMMEKGFYVSPQQCEDKFSDLN  175



>ref|XP_004494130.1| PREDICTED: ABC transporter F family member 4-like [Cicer arietinum]
Length=451

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 108/181 (60%), Gaps = 18/181 (10%)
 Frame = -3

Query  516  SNGMYSNMGSGMLGLEMSLhhvppqqnphpmqhq-shpPMVSWPggg------gGTYPSG  358
            S+G++  + +G LGLE  L     QQ     QH   H  MVS+             YP  
Sbjct  7    SSGIFPTINNGFLGLENPLKQQQQQQQNLQNQHTLHHHQMVSYTNHHDNDQPIKQNYPYS  66

Query  357  NKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDE  178
            +K      +TLSD+++P    A++ +  D KRK  PW RMKWTD+MVRLLIM VYYIGDE
Sbjct  67   SKTNKPQQITLSDEDEPCFG-AEETTSSDPKRKGSPWHRMKWTDSMVRLLIMAVYYIGDE  125

Query  177  V-GSEG-NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDL  4
              GSEG  IND              G++QKKGKWKSVS+ MME+G+YVSPQQCEDKFNDL
Sbjct  126  AGGSEGIIINDK--------KKSTTGLLQKKGKWKSVSKGMMEKGYYVSPQQCEDKFNDL  177

Query  3    N  1
            N
Sbjct  178  N  178



>ref|XP_010278270.1| PREDICTED: putative DNA helicase INO80 [Nelumbo nucifera]
Length=494

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 85/124 (69%), Gaps = 11/124 (9%)
 Frame = -3

Query  369  YPSGNKPKPT-PGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVY  193
            Y    K KP  P L+   D +  G   D    D  KR M PWQRMKWTDNMVRLLIMVV+
Sbjct  73   YAYATKGKPQQPALS---DEEEQGLVGDDGGADARKR-MSPWQRMKWTDNMVRLLIMVVF  128

Query  192  YIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKF  13
            YIGD+ GSEG  NDP      A     GG++QKKGKWKSVSRAMME+GFYVSPQQCEDKF
Sbjct  129  YIGDDGGSEG--NDP----SGAGKKKPGGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKF  182

Query  12   NDLN  1
            NDLN
Sbjct  183  NDLN  186



>ref|NP_001242801.1| uncharacterized protein LOC100808934 [Glycine max]
 gb|ACU21542.1| unknown [Glycine max]
Length=455

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 105/186 (56%), Gaps = 27/186 (15%)
 Frame = -3

Query  510  GMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSWPggggGTYPSGNKPKPTPGL  331
            G++ N+ SG+LG+E  L   P  QN        H  MVS+      T     +P P   +
Sbjct  9    GIFPNISSGLLGVENPLQQQPNLQNQQNPHPLHHLQMVSYTTNHD-TDTHHQQPPPQQSI  67

Query  330  ----------------TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMV  199
                            TLSD+++P   TA+ NS  D KRK+ PW RMKWTD MV+ LIM 
Sbjct  68   KHGYNFSATKSNKSQITLSDEDEPV-FTAEDNSSGDPKRKVSPWHRMKWTDTMVKFLIMA  126

Query  198  VYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCED  19
            VYYIGDE GSEG   DP             G++QKKGKWKSVS  MME+G+YVSPQQCED
Sbjct  127  VYYIGDEAGSEG--TDP-------TKKKASGLLQKKGKWKSVSGGMMEKGYYVSPQQCED  177

Query  18   KFNDLN  1
            KFNDLN
Sbjct  178  KFNDLN  183



>gb|KHN18717.1| hypothetical protein glysoja_021468, partial [Glycine soja]
Length=456

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 105/186 (56%), Gaps = 27/186 (15%)
 Frame = -3

Query  510  GMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSWPggggGTYPSGNKPKPTPGL  331
            G++ N+ SG+LG+E  L   P  QN        H  MVS+      T     +P P   +
Sbjct  10   GIFPNISSGLLGVENPLQQQPNLQNQQNPHPLHHLQMVSYTTNHD-TDTHHQQPPPQQSI  68

Query  330  ----------------TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMV  199
                            TLSD+++P   TA+ NS  D KRK+ PW RMKWTD MV+ LIM 
Sbjct  69   KHGYNFSATKSNKSQITLSDEDEPV-FTAEDNSSGDPKRKVSPWHRMKWTDTMVKFLIMA  127

Query  198  VYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCED  19
            VYYIGDE GSEG   DP             G++QKKGKWKSVS  MME+G+YVSPQQCED
Sbjct  128  VYYIGDEAGSEG--TDP-------TKKKASGLLQKKGKWKSVSGGMMEKGYYVSPQQCED  178

Query  18   KFNDLN  1
            KFNDLN
Sbjct  179  KFNDLN  184



>ref|XP_010554911.1| PREDICTED: uncharacterized protein LOC104824502 [Tarenaya hassleriana]
Length=380

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 88/121 (73%), Gaps = 5/121 (4%)
 Frame = -3

Query  348  KPTPGLTLSDDNDPG-GPTADQNSVD----DGKRKMCPWQRMKWTDNMVRLLIMVVYYIG  184
            KP    +LSD+++ G GP +  N  D    +GKRK   WQR+KWTD MV+LLIM V+Y+G
Sbjct  54   KPKQSSSLSDEDEHGSGPGSGYNPEDGAGANGKRKFSQWQRVKWTDTMVKLLIMAVFYMG  113

Query  183  DEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDL  4
            DE GS     DPA  +  ++   GGG++QKKGKWKSVSRAMME+GFYVSPQQCEDKFNDL
Sbjct  114  DEAGSSEPTADPAKKRLSSSSPAGGGMVQKKGKWKSVSRAMMEKGFYVSPQQCEDKFNDL  173

Query  3    N  1
            N
Sbjct  174  N  174



>ref|XP_006604609.1| PREDICTED: uncharacterized protein DDB_G0290301 isoform X2 [Glycine 
max]
Length=403

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 80/110 (73%), Gaps = 10/110 (9%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            TLSD+++P   TA+ NS  D KRK+ PW RMKWTD MV+LLIM VYYIGDE GSE    D
Sbjct  40   TLSDEDEPV-FTAEDNSSGDPKRKVSPWHRMKWTDTMVKLLIMAVYYIGDEAGSE--CTD  96

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            P             G++QKKGKWKSVS+ MME+G+YVSPQQCEDKFNDLN
Sbjct  97   P-------TKKKASGLLQKKGKWKSVSKGMMEKGYYVSPQQCEDKFNDLN  139



>gb|KHN02271.1| hypothetical protein glysoja_002295 [Glycine soja]
Length=444

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 80/110 (73%), Gaps = 10/110 (9%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            TLSD+++P   TA+ NS  D KRK+ PW RMKWTD MV+LLIM VYYIGDE GSE    D
Sbjct  89   TLSDEDEPV-FTAEDNSSGDPKRKVSPWHRMKWTDTMVKLLIMAVYYIGDEAGSE--CTD  145

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            P             G++QKKGKWKSVS+ MME+G+YVSPQQCEDKFNDLN
Sbjct  146  P-------TKKKASGLLQKKGKWKSVSKGMMEKGYYVSPQQCEDKFNDLN  188



>ref|XP_006604608.1| PREDICTED: uncharacterized protein DDB_G0290301 isoform X1 [Glycine 
max]
Length=452

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 80/110 (73%), Gaps = 10/110 (9%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            TLSD+++P   TA+ NS  D KRK+ PW RMKWTD MV+LLIM VYYIGDE GSE    D
Sbjct  89   TLSDEDEPV-FTAEDNSSGDPKRKVSPWHRMKWTDTMVKLLIMAVYYIGDEAGSE--CTD  145

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            P             G++QKKGKWKSVS+ MME+G+YVSPQQCEDKFNDLN
Sbjct  146  P-------TKKKASGLLQKKGKWKSVSKGMMEKGYYVSPQQCEDKFNDLN  188



>gb|KEH24098.1| Myb/SANT-like DNA-binding domain protein [Medicago truncatula]
Length=455

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 108/186 (58%), Gaps = 26/186 (14%)
 Frame = -3

Query  522  MESNGM----YSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSWPggggGT-----  370
            MESNG+    + N+ +G LG+E   +    QQN        H  MVS+            
Sbjct  1    MESNGLGGGIFPNINNGFLGVE---NPSKQQQNHQNPHTLHHHQMVSYDQPHQSIKQGYP  57

Query  369  YPS---GNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMV  199
            YPS    NKP+    + LSD+++P    AD+ SV D KRK  PW RMKWTD MVRLLIM 
Sbjct  58   YPSKTNNNKPQQI-NINLSDEDEPC-FGADETSVGDPKRKGSPWHRMKWTDTMVRLLIMA  115

Query  198  VYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCED  19
            VYYIGDE G+     D              G++QKKGKWKSVS+ MME+G+YVSPQQCED
Sbjct  116  VYYIGDEAGTSELSADK---------KKANGLLQKKGKWKSVSKGMMEKGYYVSPQQCED  166

Query  18   KFNDLN  1
            KFNDLN
Sbjct  167  KFNDLN  172



>ref|XP_006407612.1| hypothetical protein EUTSA_v10020795mg [Eutrema salsugineum]
 gb|ESQ49065.1| hypothetical protein EUTSA_v10020795mg [Eutrema salsugineum]
Length=425

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 89/128 (70%), Gaps = 9/128 (7%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPG-----GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLI  205
            YP  +KPK     ++ DD D G     G   + ++  DGKRK+  W RMKWTD MVRLLI
Sbjct  60   YPYASKPKQLSPASVGDDEDRGSGSGSGCHPEDSAGTDGKRKISQWHRMKWTDTMVRLLI  119

Query  204  MVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQC  25
            M V+YIGDE G    ++D    KKK AGGGGG + QKKGKWKSVSRAM+E+GF VSPQQC
Sbjct  120  MAVFYIGDEAG----LSDQIDAKKKIAGGGGGMLQQKKGKWKSVSRAMVEKGFSVSPQQC  175

Query  24   EDKFNDLN  1
            EDKFNDLN
Sbjct  176  EDKFNDLN  183



>ref|XP_010683922.1| PREDICTED: AF4/FMR2 family member 4 [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 84/117 (72%), Gaps = 6/117 (5%)
 Frame = -3

Query  333  LTLSDDNDPGGPTADQNSVDDGKRK----MCPWQRMKWTDNMVRLLIMVVYYIGDEVGSE  166
            LT SD+++PG     +NS  D K K    + PW RMKWTDNMVRLLIM VYYIGDE G+E
Sbjct  114  LTNSDEDEPGCANDHENSSVDDKSKGGTNVSPWHRMKWTDNMVRLLIMAVYYIGDEGGAE  173

Query  165  --GNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
               +   P        GGGG G++QKKGKWKSVSRAMME+GFYVSPQQCEDKFNDLN
Sbjct  174  IGSDKKKPGSGGGGGGGGGGAGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFNDLN  230



>ref|XP_006430334.1| hypothetical protein CICLE_v10013486mg, partial [Citrus clementina]
 gb|ESR43574.1| hypothetical protein CICLE_v10013486mg, partial [Citrus clementina]
Length=592

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 104/256 (41%), Positives = 129/256 (50%), Gaps = 59/256 (23%)
 Frame = -3

Query  633  THLFE-----VKRRVVADQTFLKSW-FLIFLVLCMVLIV*GVT---MESNGM----YSNM  493
            THLF      +K + +    F + W F     L +++ + G+    ME NG+    +S +
Sbjct  55   THLFNSILWFLKEKFLRLH-FSRIWCFGQLYFLGLIIKITGINISLMEPNGLQGGLFSGI  113

Query  492  GSGMLGLEMSLhhvppqqnphpmqh------------qshpPMVSWPggggGT-------  370
             SGMLGLEM LH     Q     Q               +  MV++      T       
Sbjct  114  ASGMLGLEMPLHPQSQPQPQPQPQTQQQNPQTNPQNPHHYSQMVAFSHHPHDTELHHTQT  173

Query  369  -----------YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMC--PWQRMKWT  229
                       Y   +K K      LSD+ D  G T D +S  DGKRK    PWQRMKWT
Sbjct  174  QSQQSVKQQHGYLFSSKQKQQQLSPLSDE-DELGLTPD-DSAGDGKRKASSSPWQRMKWT  231

Query  228  DNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERG  49
            D+MV+LLI+ V YIGDEVGS+GN                G ++QKKGKWKSVSRAM+ERG
Sbjct  232  DSMVKLLILAVLYIGDEVGSDGN-----------DKKKTGALLQKKGKWKSVSRAMLERG  280

Query  48   FYVSPQQCEDKFNDLN  1
            FYVSPQQCEDKFNDLN
Sbjct  281  FYVSPQQCEDKFNDLN  296



>gb|KDO61000.1| hypothetical protein CISIN_1g011207mg [Citrus sinensis]
Length=491

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 108/200 (54%), Gaps = 43/200 (22%)
 Frame = -3

Query  510  GMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshp----------PMVSWPggggGT---  370
            G++S + SGMLGLEM LH     Q     Q Q+             MV++      T   
Sbjct  9    GLFSGIASGMLGLEMPLHPQSQPQPQPQPQQQNPQTNPQNPHHYPQMVAFSHHPHDTELH  68

Query  369  ---------------YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMC--PWQR  241
                           Y   +K K      LSD+ D  G T D +S  DGKRK    PWQR
Sbjct  69   HTQTQSQQSVKQQHGYLFSSKQKQQQLSPLSDE-DELGLTPD-DSAGDGKRKASSSPWQR  126

Query  240  MKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAM  61
            MKWTD+MV+LLI+ V YIGDEVGS+GN                G ++QKKGKWKSVSRAM
Sbjct  127  MKWTDSMVKLLILAVLYIGDEVGSDGN-----------DKKKTGALLQKKGKWKSVSRAM  175

Query  60   MERGFYVSPQQCEDKFNDLN  1
            +ERGFYVSPQQCEDKFNDLN
Sbjct  176  LERGFYVSPQQCEDKFNDLN  195



>ref|XP_006481921.1| PREDICTED: probable serine/threonine-protein kinase mps1-like 
isoform X1 [Citrus sinensis]
Length=496

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 108/200 (54%), Gaps = 43/200 (22%)
 Frame = -3

Query  510  GMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshp----------PMVSWPggggGT---  370
            G++S + SGMLGLEM LH     Q     Q Q+             MV++      T   
Sbjct  9    GLFSGIASGMLGLEMPLHPQSQPQPQPQPQQQNPQTNPQNPHHYPQMVAFSHHPHDTELH  68

Query  369  ---------------YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMC--PWQR  241
                           Y   +K K      LSD+ D  G T D +S  DGKRK    PWQR
Sbjct  69   HTQTQSQQSVKQQHGYLFSSKQKQQQLSPLSDE-DELGLTPD-DSAGDGKRKASSSPWQR  126

Query  240  MKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAM  61
            MKWTD+MV+LLI+ V YIGDEVGS+GN                G ++QKKGKWKSVSRAM
Sbjct  127  MKWTDSMVKLLILAVLYIGDEVGSDGN-----------DKKKTGALLQKKGKWKSVSRAM  175

Query  60   MERGFYVSPQQCEDKFNDLN  1
            +ERGFYVSPQQCEDKFNDLN
Sbjct  176  LERGFYVSPQQCEDKFNDLN  195



>dbj|BAO45883.1| SHOOT2 protein [Acacia mangium]
Length=453

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 83/123 (67%), Gaps = 11/123 (9%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYY  190
            Y + N  +  P   LSD+ +P    AD +S D   +   PWQRMKWTD MVRLLIM VYY
Sbjct  69   YSTKNTQQTAP---LSDEEEPEF-AADDSSGDPKSKNTSPWQRMKWTDTMVRLLIMAVYY  124

Query  189  IGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFN  10
            IGDEV SEG   DP      +      G++QKKGKWKSVSRAMME+GFYVSPQQCEDKFN
Sbjct  125  IGDEVVSEG--TDP-----NSGKKKPAGLLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFN  177

Query  9    DLN  1
            DLN
Sbjct  178  DLN  180



>ref|XP_006481922.1| PREDICTED: probable serine/threonine-protein kinase mps1-like 
isoform X2 [Citrus sinensis]
Length=479

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 77/108 (71%), Gaps = 14/108 (13%)
 Frame = -3

Query  318  DNDPGGPTADQNSVDDGKRKMC--PWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPa  145
            D D  G T D +S  DGKRK    PWQRMKWTD+MV+LLI+ V YIGDEVGS+GN     
Sbjct  83   DEDELGLTPD-DSAGDGKRKASSSPWQRMKWTDSMVKLLILAVLYIGDEVGSDGN-----  136

Query  144  gnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                       G ++QKKGKWKSVSRAM+ERGFYVSPQQCEDKFNDLN
Sbjct  137  ------DKKKTGALLQKKGKWKSVSRAMLERGFYVSPQQCEDKFNDLN  178



>ref|XP_002884773.1| hypothetical protein ARALYDRAFT_478332 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61032.1| hypothetical protein ARALYDRAFT_478332 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 91/129 (71%), Gaps = 10/129 (8%)
 Frame = -3

Query  369  YPSGNKPKP-TPGLTLSDDNDPG-----GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLL  208
            YP  +KPK  +P     DD D G     G   + ++  DGKRK+  W RMKWTD MVRLL
Sbjct  33   YPYASKPKQLSPISGAGDDEDRGSGSGSGCNPEDSAGTDGKRKLSQWHRMKWTDTMVRLL  92

Query  207  IMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQ  28
            IM V+YIGDE G    +NDP   KKK  GGGGGG++QKKGKWKSVSRAM+E+GF VSPQQ
Sbjct  93   IMAVFYIGDEAG----LNDPIDPKKKTGGGGGGGMLQKKGKWKSVSRAMVEKGFSVSPQQ  148

Query  27   CEDKFNDLN  1
            CEDKFNDLN
Sbjct  149  CEDKFNDLN  157



>ref|XP_008367432.1| PREDICTED: uncharacterized protein LOC103431060 [Malus domestica]
Length=475

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 105/188 (56%), Gaps = 36/188 (19%)
 Frame = -3

Query  522  MESNGMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpP--MVSWP------------g  385
            ME+NG++S    GMLGLEM LH  P         H       MV +              
Sbjct  1    MEANGLFS----GMLGLEMPLHQNPQNPPNPQNPHNPMHQPQMVPYAPHHDPDPHQNPHQ  56

Query  384  gggGTYPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLI  205
                 YP   K K    + LSDD++PG          D KRK+ PWQRMKWTD MVRLLI
Sbjct  57   SVKQGYPFAPKSKQ---IALSDDDEPGFGA-------DDKRKISPWQRMKWTDTMVRLLI  106

Query  204  MVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQC  25
            M V+YIGDE  S+G   DP            GG++QKKGKWKSVSRAMME+GFYVSPQQC
Sbjct  107  MAVFYIGDEA-SDG--PDP-----TGKKKPAGGLLQKKGKWKSVSRAMMEKGFYVSPQQC  158

Query  24   EDKFNDLN  1
            EDKFNDLN
Sbjct  159  EDKFNDLN  166



>ref|XP_010486586.1| PREDICTED: uncharacterized protein LOC104764701 [Camelina sativa]
Length=439

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 104/191 (54%), Gaps = 21/191 (11%)
 Frame = -3

Query  522  MESNGMYSNMGSGMLGLEMSLhhvppqqnphpmq---hqshpPMVSWPggggGTYPSGNK  352
            MESN M+S     ML LEM  +   P+          + +     + P      YPS   
Sbjct  1    MESNVMFSGFSPRMLSLEMPQNPQNPKTVHQFQHPHPYTNSNDQQTQPPIKQPLYPSYAS  60

Query  351  PKPTPGLTLS--------DDNDPG-----GPTADQNSVDDGKRKMCPWQRMKWTDNMVRL  211
              P+    LS        DD D G     G   + ++  DGKRK+  W RMKWTD MVRL
Sbjct  61   AAPSKLKQLSPISGGCNGDDEDRGSGSGSGCNPEDSAGTDGKRKLSQWHRMKWTDTMVRL  120

Query  210  LIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkw-KSVSRAMMERGFYVSP  34
            LIM V+YIGDE G    +NDP   KKK  GGGGGG M +K    KSVSRAM+E+GF VSP
Sbjct  121  LIMAVFYIGDEAG----LNDPIDVKKKGGGGGGGGGMLQKKGKWKSVSRAMVEKGFSVSP  176

Query  33   QQCEDKFNDLN  1
            QQCEDKFNDLN
Sbjct  177  QQCEDKFNDLN  187



>ref|XP_006299896.1| hypothetical protein CARUB_v10016104mg [Capsella rubella]
 gb|EOA32794.1| hypothetical protein CARUB_v10016104mg [Capsella rubella]
Length=435

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 111/190 (58%), Gaps = 22/190 (12%)
 Frame = -3

Query  522  MESNGMYSNMGSGMLGLEMSLhhvppqqnphpmq----hqshpPMVSWPggggGTYPSGN  355
            MESN M+S     ML LEM  +   PQ +           +     + P      YP  +
Sbjct  1    MESNVMFSGFSPRMLSLEMPQNPQNPQNSVQFQHPHPYTSTSADQQTQPPMIKPLYPYAS  60

Query  354  KPKPTPGLTLS-------DDNDPG-----GPTADQNSVDDGKRKMCPWQRMKWTDNMVRL  211
             P P+    LS       DD D G     G   D ++  DGKRK+  W RMKWTD MVRL
Sbjct  61   AP-PSKPKQLSPMSGCNGDDEDRGSGSGSGCNPDDSAGTDGKRKLSQWHRMKWTDTMVRL  119

Query  210  LIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQ  31
            LIM V+YIGDE G    +NDP  + KK +GGGGGG++QKKGKWKSVSRAM+E+GF VSPQ
Sbjct  120  LIMAVFYIGDEAG----LNDP-IDVKKKSGGGGGGMLQKKGKWKSVSRAMVEKGFSVSPQ  174

Query  30   QCEDKFNDLN  1
            QCEDKFNDLN
Sbjct  175  QCEDKFNDLN  184



>gb|AAF04419.1|AC010927_12 unknown protein [Arabidopsis thaliana]
Length=418

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 83/134 (62%), Gaps = 15/134 (11%)
 Frame = -3

Query  369  YPSGNKPK---PTPGLTLSDDNDPGGPTADQNSVD----DGKRKMCPWQRMKWTDNMVRL  211
            YP  +KPK   P  G    D++   G  +  N  D    DGKRK+  W RMKWTD MVRL
Sbjct  41   YPYASKPKQMSPISGGGCDDEDRGSGSGSGCNPEDSAGTDGKRKLSQWHRMKWTDTMVRL  100

Query  210  LIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkw----KSVSRAMMERGFY  43
            LIM V+YIGDE G    +NDP   KKK  GGGGGG      +     KSVSRAM+E+GF 
Sbjct  101  LIMAVFYIGDEAG----LNDPVDAKKKTGGGGGGGGGGGMLQKKGKWKSVSRAMVEKGFS  156

Query  42   VSPQQCEDKFNDLN  1
            VSPQQCEDKFNDLN
Sbjct  157  VSPQQCEDKFNDLN  170



>ref|XP_010480164.1| PREDICTED: uncharacterized protein LOC104758866 [Camelina sativa]
Length=439

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 108/189 (57%), Gaps = 19/189 (10%)
 Frame = -3

Query  522  MESNGMYSNMGSGMLGLEMSLhhvppqqnphpmqh--qshpPMVSWPggggGTYP----S  361
            MESN M+S     ML LEM  +   P  +     H   +     + P      YP    +
Sbjct  1    MESNVMFSGFSPRMLSLEMPQNQQNPTVHQFQHPHPYTNSGDQQTQPPIKQPLYPPYASA  60

Query  360  GNKPK---PTPGLTLSDDNDPG-----GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLI  205
             +KPK   P  G    DD D G     G   + ++  DGKRK+  W RMKWTD MVRLLI
Sbjct  61   PSKPKQLSPISGGCNGDDEDRGSGSGSGCNPEDSAGTDGKRKLSQWHRMKWTDTMVRLLI  120

Query  204  MVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkw-KSVSRAMMERGFYVSPQQ  28
            M V+YIGDE G    +NDP   KKK++GGGGGG M +K    KSVS+AM+E+GF VSPQQ
Sbjct  121  MAVFYIGDEAG----LNDPIDVKKKSSGGGGGGGMLQKKGKWKSVSKAMVEKGFSVSPQQ  176

Query  27   CEDKFNDLN  1
            CEDKFNDLN
Sbjct  177  CEDKFNDLN  185



>ref|NP_187615.2| sequence-specific DNA binding transcription factor [Arabidopsis 
thaliana]
 gb|AAM13849.2| unknown protein [Arabidopsis thaliana]
 gb|AEE74853.1| sequence-specific DNA binding transcription factor [Arabidopsis 
thaliana]
Length=431

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 83/134 (62%), Gaps = 15/134 (11%)
 Frame = -3

Query  369  YPSGNKPK---PTPGLTLSDDNDPGGPTADQNSVD----DGKRKMCPWQRMKWTDNMVRL  211
            YP  +KPK   P  G    D++   G  +  N  D    DGKRK+  W RMKWTD MVRL
Sbjct  54   YPYASKPKQMSPISGGGCDDEDRGSGSGSGCNPEDSAGTDGKRKLSQWHRMKWTDTMVRL  113

Query  210  LIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkw----KSVSRAMMERGFY  43
            LIM V+YIGDE G    +NDP   KKK  GGGGGG      +     KSVSRAM+E+GF 
Sbjct  114  LIMAVFYIGDEAG----LNDPVDAKKKTGGGGGGGGGGGMLQKKGKWKSVSRAMVEKGFS  169

Query  42   VSPQQCEDKFNDLN  1
            VSPQQCEDKFNDLN
Sbjct  170  VSPQQCEDKFNDLN  183



>ref|XP_009135031.1| PREDICTED: trihelix transcription factor GT-3a-like [Brassica 
rapa]
Length=416

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 87/135 (64%), Gaps = 12/135 (9%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTAD----QNSV-DDGKRKMCPWQRMKWTDNMVRLLI  205
            YP  +K      L+  DD D G  +      ++SV  DGKR+  PW RMKWTD MVRLLI
Sbjct  52   YPRSSKAMQLSPLSGGDDEDRGSGSGSGCHPEDSVGTDGKRRASPWHRMKWTDTMVRLLI  111

Query  204  MVVYYIGDEVGSEGN-------INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGF  46
            M VYYIGDE G  G+       I+   G      GGGGG V+QKKGKWKSVSRAM+E+GF
Sbjct  112  MAVYYIGDEGGLVGDQTEAKKKISGGGGGGGGGGGGGGGAVLQKKGKWKSVSRAMVEKGF  171

Query  45   YVSPQQCEDKFNDLN  1
             VSPQQCEDKFNDLN
Sbjct  172  SVSPQQCEDKFNDLN  186



>gb|EPS63933.1| hypothetical protein M569_10850, partial [Genlisea aurea]
Length=116

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 69/84 (82%), Gaps = 4/84 (5%)
 Frame = -3

Query  252  PWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSV  73
            PWQRMKWTDNMVRLLIMVVYY+GDEV +EG+            GGGGG  MQKKGKWKSV
Sbjct  35   PWQRMKWTDNMVRLLIMVVYYVGDEV-AEGS---DRRKGGGGGGGGGGSAMQKKGKWKSV  90

Query  72   SRAMMERGFYVSPQQCEDKFNDLN  1
            S+AMMERGF+VSPQQCEDKFNDLN
Sbjct  91   SKAMMERGFFVSPQQCEDKFNDLN  114



>emb|CDY68207.1| BnaCnng58050D [Brassica napus]
Length=316

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 84/128 (66%), Gaps = 12/128 (9%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTAD----QNSV-DDGKRKMCPWQRMKWTDNMVRLLI  205
            YP  +K      L++ D+ D G  +      ++SV  DGKR++  W RMKWTD MVRLLI
Sbjct  52   YPRSSKAMQLSPLSVGDEEDRGSGSGSGCHPEDSVGTDGKRRVSQWHRMKWTDTMVRLLI  111

Query  204  MVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQC  25
            M VYYIGD    EG + D     +      GGGV+QKKGKWKSVSRAM+E+GF VSPQQC
Sbjct  112  MAVYYIGD----EGGVGD---QTEAKKKISGGGVLQKKGKWKSVSRAMVEKGFSVSPQQC  164

Query  24   EDKFNDLN  1
            EDKFNDLN
Sbjct  165  EDKFNDLN  172



>ref|XP_010464664.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Camelina sativa]
 ref|XP_010464665.1| PREDICTED: trihelix transcription factor GTL1-like isoform X2 
[Camelina sativa]
Length=447

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = -3

Query  345  PTPGLTLSDDNDPG-----GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGD  181
            P  G    DD D G     G   + ++  DGKRK+  W RMKWTD MVRLLIM V+YIGD
Sbjct  71   PISGGCNGDDEDRGSGSGSGCNPEDSAGTDGKRKLSQWHRMKWTDTMVRLLIMAVFYIGD  130

Query  180  EVGSEGNINDPagnkkkaaggggggvmqkkgkwK------SVSRAMMERGFYVSPQQCED  19
            E G    +NDP   KKK++GGGGGG     G  +      SVSRAM+E+GF VSPQQCED
Sbjct  131  EAG----LNDPIDVKKKSSGGGGGGGGGGGGMLQKKGKWKSVSRAMVEKGFSVSPQQCED  186

Query  18   KFNDLN  1
            KFNDLN
Sbjct  187  KFNDLN  192



>ref|XP_007145268.1| hypothetical protein PHAVU_007G224600g [Phaseolus vulgaris]
 gb|ESW17262.1| hypothetical protein PHAVU_007G224600g [Phaseolus vulgaris]
Length=473

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 77/125 (62%), Gaps = 22/125 (18%)
 Frame = -3

Query  369  YP--SGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVV  196
            YP  S  K K      LSD++D            D K+K+  WQRMKWTD MVRLLIM V
Sbjct  67   YPPYSSAKTKQQQHSGLSDEDD---------DTSDPKKKVSLWQRMKWTDTMVRLLIMAV  117

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
            YYIGDE GSEG                  G++QKKGKWKSVSRAMME+G YVSPQQCEDK
Sbjct  118  YYIGDEGGSEGT-----------DKKKSLGMLQKKGKWKSVSRAMMEKGSYVSPQQCEDK  166

Query  15   FNDLN  1
            FNDLN
Sbjct  167  FNDLN  171



>emb|CDY60160.1| BnaAnng16550D [Brassica napus]
Length=423

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = -3

Query  291  DQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSE--GNINDPagnkkkaagg  118
            D     DGKRK+ PW RMKWTD MVRLLIM V+YIGDE G    G+  D           
Sbjct  92   DSAGTTDGKRKISPWHRMKWTDTMVRLLIMAVFYIGDEAGGALGGDQTDAKKKIITGGMM  151

Query  117  ggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                   K     SVSRAM+E+GF VSPQQCEDKFNDLN
Sbjct  152  LQKKGKWK-----SVSRAMVEKGFSVSPQQCEDKFNDLN  185



>ref|XP_009146876.1| PREDICTED: uncharacterized protein LOC103870494 [Brassica rapa]
Length=419

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 70/99 (71%), Gaps = 7/99 (7%)
 Frame = -3

Query  291  DQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSE--GNINDPagnkkkaagg  118
            D     DGKRK+ PW RMKWTD MVRLLIM V+YIGDE G    G+  D      K    
Sbjct  92   DSAGTTDGKRKISPWHRMKWTDTMVRLLIMAVFYIGDEAGGALGGDQTD-----AKKKII  146

Query  117  ggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
             GG ++QKKGKWKSVSRAM+E+GF VSPQQCEDKFNDLN
Sbjct  147  TGGMMLQKKGKWKSVSRAMVEKGFSVSPQQCEDKFNDLN  185



>emb|CDY00901.1| BnaC05g42990D [Brassica napus]
Length=420

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 68/91 (75%), Gaps = 6/91 (7%)
 Frame = -3

Query  273  DGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqk  94
            DGKRK+ PW RMKWTD MVRLLIM V+YIGDE G  G       ++        GG++QK
Sbjct  97   DGKRKISPWHRMKWTDTMVRLLIMAVFYIGDEAGGLGG------DQTDGKKKISGGILQK  150

Query  93   kgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            KGKWKSVSRAM+E+GF VSPQQCEDKFNDLN
Sbjct  151  KGKWKSVSRAMVEKGFSVSPQQCEDKFNDLN  181



>ref|XP_006851780.1| hypothetical protein AMTR_s00040p00233180 [Amborella trichopoda]
 gb|ERN13247.1| hypothetical protein AMTR_s00040p00233180 [Amborella trichopoda]
Length=443

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 85/113 (75%), Gaps = 16/113 (14%)
 Frame = -3

Query  324  SDDNDPGGPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGS----EGN  160
            SD+ D G         +DG+ +++ PWQRMKWTDNMV+LLIMVV+++GD+  S    EG+
Sbjct  88   SDEEDAG--------AEDGRGKRVSPWQRMKWTDNMVKLLIMVVFFVGDDPCSLQQGEGS  139

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
              D    KKK+  G GGG++QKKGKWKSVSRAMME+GFYVSPQQCEDKFNDLN
Sbjct  140  SGD---GKKKSILGSGGGMLQKKGKWKSVSRAMMEKGFYVSPQQCEDKFNDLN  189



>gb|KHN48204.1| hypothetical protein glysoja_007873 [Glycine soja]
Length=367

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 59/80 (74%), Gaps = 11/80 (14%)
 Frame = -3

Query  240  MKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAM  61
            MKWTD MVRLLIM VYYIGDE GSEG                  G+MQKKGKWKSVSRAM
Sbjct  1    MKWTDTMVRLLIMAVYYIGDEAGSEGT-----------DKKKSSGLMQKKGKWKSVSRAM  49

Query  60   MERGFYVSPQQCEDKFNDLN  1
            ME+GFYVSPQQCEDKFNDLN
Sbjct  50   MEKGFYVSPQQCEDKFNDLN  69



>ref|XP_010543479.1| PREDICTED: trihelix transcription factor GTL1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543480.1| PREDICTED: trihelix transcription factor GTL1 isoform X2 [Tarenaya 
hassleriana]
Length=451

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 95/205 (46%), Gaps = 40/205 (20%)
 Frame = -3

Query  522  MESNG----MYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSW------------  391
            MESNG    M+S    GML LEM        QNP       HP MVS+            
Sbjct  1    MESNGLSSVMFSGFSPGMLSLEMP----QNPQNPQNPIQFQHPQMVSYAGNNGGGGDQQH  56

Query  390  -------PggggGTYPSGNKPKPTPGLTLSDDNDPG-GPTADQNSVD----DGKRKMCPW  247
                   P      YP  +K K      LSD++DPG G  +  N  D    DGKRK  PW
Sbjct  57   HNHHQTQPPMKTPQYPYASKHKQLS--PLSDEDDPGSGSVSGYNPEDSTGADGKRKFSPW  114

Query  246  QRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkw---KS  76
            QRMKWTD    +      ++GDE GS    +        +A     G      K    KS
Sbjct  115  QRMKWTDT---IFFGGGIFLGDEAGSSETADAAKKKPSSSAASTSSGGGGLLQKKGKWKS  171

Query  75   VSRAMMERGFYVSPQQCEDKFNDLN  1
            VSRAMME+GFYVSPQQCEDKFNDLN
Sbjct  172  VSRAMMEKGFYVSPQQCEDKFNDLN  196



>ref|XP_009590354.1| PREDICTED: uncharacterized protein LOC104087550 isoform X2 [Nicotiana 
tomentosiformis]
Length=407

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 70/120 (58%), Gaps = 13/120 (11%)
 Frame = -3

Query  360  GNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGD  181
             +  K   G + SD+++P       N ++ GK K  PWQR+KWTD MVRLLI  V YIG+
Sbjct  42   ADHSKGERGKSASDEDEPSFTEDGLNDLNRGK-KATPWQRVKWTDQMVRLLITAVSYIGE  100

Query  180  EVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            E  +E              G      + KKGKWKSVS+ M ERG +VSPQQCEDKFNDLN
Sbjct  101  ETAAE------------YGGRRKCSNLHKKGKWKSVSKVMAERGHFVSPQQCEDKFNDLN  148



>ref|XP_009590352.1| PREDICTED: uncharacterized protein LOC104087550 isoform X1 [Nicotiana 
tomentosiformis]
Length=420

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 70/120 (58%), Gaps = 13/120 (11%)
 Frame = -3

Query  360  GNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGD  181
             +  K   G + SD+++P       N ++ GK K  PWQR+KWTD MVRLLI  V YIG+
Sbjct  55   ADHSKGERGKSASDEDEPSFTEDGLNDLNRGK-KATPWQRVKWTDQMVRLLITAVSYIGE  113

Query  180  EVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            E  +E              G      + KKGKWKSVS+ M ERG +VSPQQCEDKFNDLN
Sbjct  114  ETAAE------------YGGRRKCSNLHKKGKWKSVSKVMAERGHFVSPQQCEDKFNDLN  161



>ref|XP_010543481.1| PREDICTED: trihelix transcription factor GTL1 isoform X3 [Tarenaya 
hassleriana]
Length=454

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 71/131 (54%), Gaps = 13/131 (10%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPG-GPTADQNSVD----DGKRKMCPWQRMKWTDNMVRLLI  205
            YP  +K K      LSD++DPG G  +  N  D    DGKRK  PWQRMKWTD    +  
Sbjct  74   YPYASKHKQLS--PLSDEDDPGSGSVSGYNPEDSTGADGKRKFSPWQRMKWTDT---IFF  128

Query  204  MVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkw---KSVSRAMMERGFYVSP  34
                ++GDE GS    +        +A     G      K    KSVSRAMME+GFYVSP
Sbjct  129  GGGIFLGDEAGSSETADAAKKKPSSSAASTSSGGGGLLQKKGKWKSVSRAMMEKGFYVSP  188

Query  33   QQCEDKFNDLN  1
            QQCEDKFNDLN
Sbjct  189  QQCEDKFNDLN  199



>gb|KCW89278.1| hypothetical protein EUGRSUZ_A015721, partial [Eucalyptus grandis]
Length=147

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 63/97 (65%), Gaps = 10/97 (10%)
 Frame = -3

Query  333  LTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIN  154
            LTLSDD++ G    D     DGKRK  PWQRMKWTD MV+LLIM V YIGDE G     +
Sbjct  61   LTLSDDDEAGFNGDD--GAGDGKRKASPWQRMKWTDTMVKLLIMAVLYIGDEGGPTTESS  118

Query  153  DPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFY  43
            DP            G ++QKKGKWKSVSRAMME+GFY
Sbjct  119  DP--------KKKPGSLLQKKGKWKSVSRAMMEKGFY  147



>ref|XP_010912425.1| PREDICTED: uncharacterized protein LOC105038344 isoform X2 [Elaeis 
guineensis]
Length=404

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 68/112 (61%), Gaps = 12/112 (11%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNI  157
            ++SDD D        N  DDG +  K  PWQRMKWT  MVRLLI  V Y+GD+  SE N 
Sbjct  50   SMSDDGDQSLAEDRVNDQDDGGKGKKGTPWQRMKWTGRMVRLLITAVSYVGDDAISEYN-  108

Query  156  NDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            ND         G     V+QKK KWK +S+ M ERG YVSPQQCEDKFNDLN
Sbjct  109  ND---------GRRKSAVLQKKRKWKCISKVMTERGCYVSPQQCEDKFNDLN  151



>gb|KFK38386.1| hypothetical protein AALP_AA3G106800 [Arabis alpina]
Length=406

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 75/129 (58%), Gaps = 20/129 (16%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVD----DGKRKMCP--WQRMKWTDNMVRLL  208
            YPS    KP     +SDD+   G  +  N  D    +GKRK     W RMKWTD MVR L
Sbjct  54   YPS----KPKQLSPISDDDRGSGSGSGCNPEDSTGTNGKRKFSQSQWHRMKWTDTMVRFL  109

Query  207  IMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQ  28
            IM V+YIGDE   +                   G++QKKGKWKSVS+AM+E+GF VSPQQ
Sbjct  110  IMAVFYIGDESNDQTETKK----------KTTTGMLQKKGKWKSVSKAMVEKGFSVSPQQ  159

Query  27   CEDKFNDLN  1
            CEDKFNDLN
Sbjct  160  CEDKFNDLN  168



>ref|XP_002266272.1| PREDICTED: uncharacterized protein LOC100259010 [Vitis vinifera]
Length=440

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 74/121 (61%), Gaps = 17/121 (14%)
 Frame = -3

Query  348  KPTPGLTLSDDNDPGGPTADQNSVD-----DGKRKMCPWQRMKWTDNMVRLLIMVVYYIG  184
            K   G  L+ D D   P+ +++++D     +  +K  PWQR+KWTD MVRLLI  V YIG
Sbjct  78   KGEKGKALTSDEDE--PSFNEDAIDGHNDPNRGKKGSPWQRVKWTDKMVRLLITAVSYIG  135

Query  183  DEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDL  4
            ++  SE  +           G     ++QKKGKWKSVS+ M ERG YVSPQQCEDKFNDL
Sbjct  136  EDAASECGVG----------GRRKYAILQKKGKWKSVSKVMAERGHYVSPQQCEDKFNDL  185

Query  3    N  1
            N
Sbjct  186  N  186



>ref|XP_008784156.1| PREDICTED: uncharacterized protein LOC103703173 [Phoenix dactylifera]
 ref|XP_008784157.1| PREDICTED: uncharacterized protein LOC103703173 [Phoenix dactylifera]
 ref|XP_008784158.1| PREDICTED: uncharacterized protein LOC103703173 [Phoenix dactylifera]
Length=417

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 68/112 (61%), Gaps = 12/112 (11%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDD-GKRKMCP-WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNI  157
            ++SDD D        +  DD GKRK  P WQRMKWTD MVRLLI  V YIG++   E N 
Sbjct  75   SMSDDGDASFTEDGVHDQDDAGKRKKGPPWQRMKWTDRMVRLLITAVSYIGEDAMPEYN-  133

Query  156  NDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                       G     V+QKK KWKS+SR M ERG YVSPQQCEDKFNDLN
Sbjct  134  ---------NGGRRKCAVLQKKRKWKSISRVMAERGCYVSPQQCEDKFNDLN  176



>ref|XP_010912419.1| PREDICTED: uncharacterized protein LOC105038344 isoform X1 [Elaeis 
guineensis]
 ref|XP_010912421.1| PREDICTED: uncharacterized protein LOC105038344 isoform X1 [Elaeis 
guineensis]
 ref|XP_010912422.1| PREDICTED: uncharacterized protein LOC105038344 isoform X1 [Elaeis 
guineensis]
 ref|XP_010912423.1| PREDICTED: uncharacterized protein LOC105038344 isoform X1 [Elaeis 
guineensis]
 ref|XP_010912424.1| PREDICTED: uncharacterized protein LOC105038344 isoform X1 [Elaeis 
guineensis]
Length=429

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 68/112 (61%), Gaps = 12/112 (11%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNI  157
            ++SDD D        N  DDG +  K  PWQRMKWT  MVRLLI  V Y+GD+  SE N 
Sbjct  75   SMSDDGDQSLAEDRVNDQDDGGKGKKGTPWQRMKWTGRMVRLLITAVSYVGDDAISEYN-  133

Query  156  NDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            ND         G     V+QKK KWK +S+ M ERG YVSPQQCEDKFNDLN
Sbjct  134  ND---------GRRKSAVLQKKRKWKCISKVMTERGCYVSPQQCEDKFNDLN  176



>ref|XP_009419154.1| PREDICTED: uncharacterized protein LOC103999204 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=377

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 78/131 (60%), Gaps = 15/131 (11%)
 Frame = -3

Query  360  GNKPKPTPGLTLSDDNDPG--GPTADQN---------SVDDGKRKMCPWQRMKWTDNMVR  214
            G+   P+ G T + D++     P  D+N         S   G +K  PWQRMKWTD +VR
Sbjct  49   GSLFAPSSGTTATSDDEDHFPAPAGDENDHESHSLPASEAGGSKKASPWQRMKWTDEIVR  108

Query  213  LLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSP  34
            LLI VV Y+GD    +G +     +   AA    G  +QKKGKWK+VSR M+E+G YVSP
Sbjct  109  LLISVVAYVGDH--DDGALE--TFDGSSAAKRKHGATLQKKGKWKTVSRLMLEKGCYVSP  164

Query  33   QQCEDKFNDLN  1
            QQCEDKFNDLN
Sbjct  165  QQCEDKFNDLN  175



>gb|KDP42996.1| hypothetical protein JCGZ_25182 [Jatropha curcas]
Length=443

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 75/123 (61%), Gaps = 15/123 (12%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYY  190
            Y  G K K +     SD+++P     D N   +GK+ + PWQR+KWTD MVRLLI  V Y
Sbjct  79   YNKGEKMKNSA----SDEDEPSYTEDDGNGHSEGKKGL-PWQRVKWTDKMVRLLITAVSY  133

Query  189  IGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFN  10
            IG+++ S+G+                  ++QKKGKWK +S+ M ERGF+VS QQCEDKFN
Sbjct  134  IGEDMSSDGD----------GGVRRKLAILQKKGKWKLISKVMAERGFHVSRQQCEDKFN  183

Query  9    DLN  1
            DLN
Sbjct  184  DLN  186



>ref|XP_009419153.1| PREDICTED: uncharacterized protein LOC103999204 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=410

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 75/131 (57%), Gaps = 15/131 (11%)
 Frame = -3

Query  360  GNKPKPTPGLTLSDDNDPG--GPTADQN---------SVDDGKRKMCPWQRMKWTDNMVR  214
            G+   P+ G T + D++     P  D+N         S   G +K  PWQRMKWTD +VR
Sbjct  49   GSLFAPSSGTTATSDDEDHFPAPAGDENDHESHSLPASEAGGSKKASPWQRMKWTDEIVR  108

Query  213  LLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSP  34
            LLI VV Y+GD         D       AA    G  +QKKGKWK+VSR M+E+G YVSP
Sbjct  109  LLISVVAYVGDHDDGALETFD----GSSAAKRKHGATLQKKGKWKTVSRLMLEKGCYVSP  164

Query  33   QQCEDKFNDLN  1
            QQCEDKFNDLN
Sbjct  165  QQCEDKFNDLN  175



>ref|XP_004290521.1| PREDICTED: uncharacterized protein LOC101296534 [Fragaria vesca 
subsp. vesca]
Length=451

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 76/127 (60%), Gaps = 20/127 (16%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVV  196
            Y  G K K +    +SD+++P       +S  +  R  K  PWQR+KWTD MVRLLI  V
Sbjct  82   YNKGEKCKNS----MSDEDEPSYTEEGVDSHIEASRGKKGSPWQRVKWTDKMVRLLITAV  137

Query  195  YYIGDEVGSE--GNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCE  22
             YIG+++GS+  G +                  +QKKGKWKSVS+ M ERG++VSPQQCE
Sbjct  138  SYIGEDIGSDCGGGVR------------RKFSALQKKGKWKSVSKVMAERGYHVSPQQCE  185

Query  21   DKFNDLN  1
            DKFNDLN
Sbjct  186  DKFNDLN  192



>tpg|DAA54425.1| TPA: hypothetical protein ZEAMMB73_872770 [Zea mays]
Length=528

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  CPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKS  76
            CPW RMKWTD MVRLLI VVY +GD+           G  K   G       QKKGKWKS
Sbjct  113  CPWTRMKWTDAMVRLLIRVVYSVGDDGEGVATAGGAGGAAKAGPGHAAAAQQQKKGKWKS  172

Query  75   VSRAMMERGFYVSPQQCEDKFNDLN  1
            VS AMM++GF VSPQQCEDKFNDLN
Sbjct  173  VSHAMMDKGFVVSPQQCEDKFNDLN  197



>ref|XP_008673999.1| PREDICTED: uncharacterized protein LOC103650125 [Zea mays]
Length=537

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  CPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKS  76
            CPW RMKWTD MVRLLI VVY +GD+           G  K   G       QKKGKWKS
Sbjct  122  CPWTRMKWTDAMVRLLIRVVYSVGDDGEGVATAGGAGGAAKAGPGHAAAAQQQKKGKWKS  181

Query  75   VSRAMMERGFYVSPQQCEDKFNDLN  1
            VS AMM++GF VSPQQCEDKFNDLN
Sbjct  182  VSHAMMDKGFVVSPQQCEDKFNDLN  206



>ref|XP_002532431.1| transcription factor, putative [Ricinus communis]
 gb|EEF29946.1| transcription factor, putative [Ricinus communis]
Length=445

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 77/126 (61%), Gaps = 18/126 (14%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGP---TADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMV  199
            Y +G+K K    ++ SD+++P         QN    GK K  PW+R+KWTD MVRLLI  
Sbjct  78   YNTGDKGK----ISTSDEDEPSYSEDGVDGQNEASRGK-KGSPWRRVKWTDKMVRLLITA  132

Query  198  VYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCED  19
            V YIG+++ S+ N                  V+Q+KGKWK VS+AM ERGF+VSPQQCED
Sbjct  133  VSYIGEDMSSDCN----------GGIRRKFAVLQRKGKWKLVSKAMAERGFHVSPQQCED  182

Query  18   KFNDLN  1
            KFNDLN
Sbjct  183  KFNDLN  188



>emb|CAN65038.1| hypothetical protein VITISV_021706 [Vitis vinifera]
Length=601

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 74/121 (61%), Gaps = 17/121 (14%)
 Frame = -3

Query  348  KPTPGLTLSDDNDPGGPTADQNSVD-----DGKRKMCPWQRMKWTDNMVRLLIMVVYYIG  184
            K   G  L+ D D   P+ +++++D     +  +K  PWQR+KWTD MVRLLI  V YIG
Sbjct  78   KGEKGKALTSDEDE--PSFNEDAIDGHNDPNRGKKGSPWQRVKWTDKMVRLLITAVSYIG  135

Query  183  DEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDL  4
            ++  SE  +           G     ++QKKGKWKSVS+ M ERG YVSPQQCEDKFNDL
Sbjct  136  EDAASECGVG----------GRRKYAILQKKGKWKSVSKVMAERGHYVSPQQCEDKFNDL  185

Query  3    N  1
            N
Sbjct  186  N  186



>emb|CDM81777.1| unnamed protein product [Triticum aestivum]
Length=496

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  CPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKS  76
            C W RMKWTD MVRLLI VVY  G++          A               Q+KGKW+S
Sbjct  109  CSWSRMKWTDAMVRLLIAVVYNAGEDGEGVSAGGKAAAAHSHGKAVASAAAQQRKGKWRS  168

Query  75   VSRAMMERGFYVSPQQCEDKFNDLN  1
            VSRAM+ERGF VSPQQCEDKFNDLN
Sbjct  169  VSRAMVERGFKVSPQQCEDKFNDLN  193



>ref|XP_009420589.1| PREDICTED: uncharacterized protein LOC104000302 [Musa acuminata 
subsp. malaccensis]
Length=428

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 69/112 (62%), Gaps = 14/112 (13%)
 Frame = -3

Query  330  TLSDDNDPG-GPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNI  157
            ++SDD++P          +D GK  K   WQRMKWTD MVRLLI  V YIG++V SE   
Sbjct  81   SMSDDDEPSFTKDGTDGQIDAGKGEKGSSWQRMKWTDAMVRLLITAVSYIGEDVASECG-  139

Query  156  NDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                       G     ++QKKGKWK++S+ M ERG YVSPQQCEDKFNDLN
Sbjct  140  -----------GRRKYAILQKKGKWKAISKVMAERGCYVSPQQCEDKFNDLN  180



>ref|XP_003556151.1| PREDICTED: uncharacterized protein LOC100816474 [Glycine max]
 gb|KHN46420.1| hypothetical protein glysoja_031738 [Glycine soja]
Length=445

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 63/88 (72%), Gaps = 10/88 (11%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQR+KWTD MVRLLI  V YIG++V ++G           ++G     V+QKKGK
Sbjct  109  KKGSPWQRVKWTDKMVRLLITAVSYIGEDVTADGG----------SSGRRKFAVLQKKGK  158

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  159  WKSVSKVMAERGYHVSPQQCEDKFNDLN  186



>ref|XP_011087824.1| PREDICTED: uncharacterized protein LOC105169181 [Sesamum indicum]
Length=431

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 65/101 (64%), Gaps = 10/101 (10%)
 Frame = -3

Query  303  GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaa  124
            G   D N+  + ++K  PWQR+KWTD MV+LLI  V Y+G++ GS+              
Sbjct  91   GEHVDANNESEKEKKESPWQRVKWTDQMVKLLITAVSYLGEDAGSDNG----------GG  140

Query  123  ggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            G     ++ KKGKW+++S+ M ERGF+VSPQQCEDKFNDLN
Sbjct  141  GRRISPLLPKKGKWRAISKVMAERGFHVSPQQCEDKFNDLN  181



>ref|XP_010246931.1| PREDICTED: uncharacterized protein LOC104590097 [Nelumbo nucifera]
 ref|XP_010246932.1| PREDICTED: uncharacterized protein LOC104590097 [Nelumbo nucifera]
 ref|XP_010246933.1| PREDICTED: uncharacterized protein LOC104590097 [Nelumbo nucifera]
Length=457

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 61/88 (69%), Gaps = 10/88 (11%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQRMKWTDN+VRLLI VV ++GD+V  EG                  GV+QKKGK
Sbjct  119  KKGSPWQRMKWTDNVVRLLIAVVSFVGDDVTPEG----------VDGLKRKSGVLQKKGK  168

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK+VS  MME+G YVSPQQCEDKFNDLN
Sbjct  169  WKTVSNIMMEKGCYVSPQQCEDKFNDLN  196



>emb|CDP10040.1| unnamed protein product [Coffea canephora]
Length=445

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 72/125 (58%), Gaps = 18/125 (14%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGP--TADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVV  196
            +  G+K K      +SD+++P      AD ++     +K  PWQR+KWTD MVRLL+  V
Sbjct  79   FNKGDKAK-----CVSDEDEPSFTEDAADGHNESSKGKKTFPWQRVKWTDTMVRLLVTAV  133

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
             YIG+E  ++                     +QKKGKWKSVS+ M ERG +VSPQQCEDK
Sbjct  134  SYIGEEAAAD-----------YGGARRKFANLQKKGKWKSVSKVMAERGHFVSPQQCEDK  182

Query  15   FNDLN  1
            FNDLN
Sbjct  183  FNDLN  187



>ref|XP_010069064.1| PREDICTED: uncharacterized protein LOC104456045 [Eucalyptus grandis]
Length=461

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 63/97 (65%), Gaps = 10/97 (10%)
 Frame = -3

Query  333  LTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIN  154
            LTLSDD++ G    D     DGKRK  PWQRMKWTD MV+LLIM V YIGDE G     +
Sbjct  78   LTLSDDDEAGFNGDD--GAGDGKRKASPWQRMKWTDTMVKLLIMAVLYIGDEGGPTTESS  135

Query  153  DPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFY  43
            DP            G ++QKKGKWKSVSRAMME+GFY
Sbjct  136  DP--------KKKPGSLLQKKGKWKSVSRAMMEKGFY  164



>ref|XP_009799707.1| PREDICTED: uncharacterized protein LOC104245746 isoform X2 [Nicotiana 
sylvestris]
Length=405

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 67/114 (59%), Gaps = 14/114 (12%)
 Frame = -3

Query  336  GLTLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEG  163
            G + SD+++P       + ++D  R  K  PWQR+KWTD MVRLLI  V YIG+E  +E 
Sbjct  45   GKSASDEDEPSFTEDAADGLNDLNRGKKATPWQRVKWTDQMVRLLITAVSYIGEETAAE-  103

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                         G      + KKGKWKSVS+ M ER  +VSPQQCEDKFNDLN
Sbjct  104  -----------YGGRRKCSNLHKKGKWKSVSKVMAERDHFVSPQQCEDKFNDLN  146



>ref|XP_010459826.1| PREDICTED: uncharacterized protein LOC104740815 [Camelina sativa]
Length=447

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 69/115 (60%), Gaps = 17/115 (15%)
 Frame = -3

Query  330  TLSDDNDP-----GGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSE  166
            ++SDD++P     GG     N+  +   K  PWQR+KWTD MV+LLI  V YIGD+   +
Sbjct  85   SVSDDDEPSFTEEGGGVDGHNNEANKSTKGSPWQRVKWTDKMVKLLITAVSYIGDDSSMD  144

Query  165  GNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                                V+QKKGKWKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  145  SG------------SRRKFAVLQKKGKWKSVSKVMAERGYHVSPQQCEDKFNDLN  187



>ref|XP_008781414.1| PREDICTED: uncharacterized protein LOC103701210 isoform X2 [Phoenix 
dactylifera]
Length=436

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 72/114 (63%), Gaps = 16/114 (14%)
 Frame = -3

Query  330  TLSDDNDPGGPTAD----QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEG  163
            +LSDD+D    T D    QN   +GK K  PWQRMKWT  MVRLLI  V YIG++  SE 
Sbjct  81   SLSDDDDQN-FTEDGVDGQNEAGNGK-KGFPWQRMKWTRAMVRLLITAVSYIGEDAMSEY  138

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            N          + G     ++QKKGKWK++S+ M ERG YVSPQQCEDKFNDLN
Sbjct  139  N----------SGGRRKYTLLQKKGKWKAISKVMAERGCYVSPQQCEDKFNDLN  182



>ref|XP_009799706.1| PREDICTED: uncharacterized protein LOC104245746 isoform X1 [Nicotiana 
sylvestris]
Length=418

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 67/114 (59%), Gaps = 14/114 (12%)
 Frame = -3

Query  336  GLTLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEG  163
            G + SD+++P       + ++D  R  K  PWQR+KWTD MVRLLI  V YIG+E  +E 
Sbjct  58   GKSASDEDEPSFTEDAADGLNDLNRGKKATPWQRVKWTDQMVRLLITAVSYIGEETAAE-  116

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                         G      + KKGKWKSVS+ M ER  +VSPQQCEDKFNDLN
Sbjct  117  -----------YGGRRKCSNLHKKGKWKSVSKVMAERDHFVSPQQCEDKFNDLN  159



>ref|XP_008781412.1| PREDICTED: uncharacterized protein LOC103701210 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008781413.1| PREDICTED: uncharacterized protein LOC103701210 isoform X1 [Phoenix 
dactylifera]
Length=444

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 72/114 (63%), Gaps = 16/114 (14%)
 Frame = -3

Query  330  TLSDDNDPGGPTAD----QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEG  163
            +LSDD+D    T D    QN   +GK K  PWQRMKWT  MVRLLI  V YIG++  SE 
Sbjct  89   SLSDDDDQNF-TEDGVDGQNEAGNGK-KGFPWQRMKWTRAMVRLLITAVSYIGEDAMSEY  146

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            N          + G     ++QKKGKWK++S+ M ERG YVSPQQCEDKFNDLN
Sbjct  147  N----------SGGRRKYTLLQKKGKWKAISKVMAERGCYVSPQQCEDKFNDLN  190



>gb|KDP43003.1| hypothetical protein JCGZ_25189 [Jatropha curcas]
Length=445

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 75/127 (59%), Gaps = 20/127 (16%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVV  196
            Y  G+K K +     SD+++P       +  +D  R  K  PWQR+KWTD MVRLLI  V
Sbjct  79   YNKGDKGKNSA----SDEDEPSYTEDGADGHNDASRGKKGSPWQRVKWTDKMVRLLITAV  134

Query  195  YYIGDEVGSE--GNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCE  22
             YIG++V S+  G +                 V+QKKGKWKSVS+ M ERG +VSPQQCE
Sbjct  135  SYIGEDVTSDCGGGMR------------RKFAVLQKKGKWKSVSKVMAERGHHVSPQQCE  182

Query  21   DKFNDLN  1
            DKFNDLN
Sbjct  183  DKFNDLN  189



>emb|CDX96599.1| BnaA08g21420D [Brassica napus]
Length=302

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 69/116 (59%), Gaps = 14/116 (12%)
 Frame = -3

Query  342  TPGLTLSDDNDPGGPTAD--QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGS  169
            T G  LS+ +     + D  Q S ++   K  PWQR+KWTD MV+LLI  V YIGD+   
Sbjct  43   TCGHHLSEQHKGERESDDDEQPSFNEEATKGSPWQRVKWTDKMVKLLITAVSYIGDDSSM  102

Query  168  EGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            +G             G      +QKKGKWKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  103  DGG------------GRRKFAALQKKGKWKSVSKVMSERGYHVSPQQCEDKFNDLN  146



>ref|XP_003536428.1| PREDICTED: uncharacterized protein LOC100812134 [Glycine max]
 gb|KHN17008.1| hypothetical protein glysoja_011482 [Glycine soja]
Length=444

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 10/88 (11%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQR+KWTD MV+LLI  V YIG++V ++G           ++G     V+QKKGK
Sbjct  111  KKGSPWQRVKWTDKMVKLLITAVSYIGEDVTADGG----------SSGRRKFAVLQKKGK  160

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  161  WKSVSKVMAERGYHVSPQQCEDKFNDLN  188



>ref|XP_007200864.1| hypothetical protein PRUPE_ppa1027145mg [Prunus persica]
 gb|EMJ02063.1| hypothetical protein PRUPE_ppa1027145mg [Prunus persica]
Length=445

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 73/125 (58%), Gaps = 16/125 (13%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVV  196
            Y  G + K +     SD+++P       +   +G R  K  PWQR+KWTD MV+LLI  V
Sbjct  78   YNKGERSKNSA----SDEDEPSYTEEGTDGHAEGNRGKKGSPWQRVKWTDQMVKLLITAV  133

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
             YIG++  S+            + G      +QKKGKWKSVS+ M ERGF+VSPQQCEDK
Sbjct  134  SYIGEDTSSDCG----------SGGRRKYSTLQKKGKWKSVSKVMAERGFHVSPQQCEDK  183

Query  15   FNDLN  1
            FNDLN
Sbjct  184  FNDLN  188



>ref|XP_007019480.1| Sequence-specific DNA binding transcription factors [Theobroma 
cacao]
 gb|EOY16705.1| Sequence-specific DNA binding transcription factors [Theobroma 
cacao]
Length=446

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 73/125 (58%), Gaps = 16/125 (13%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVV  196
            Y  G + K +    +SD+++P       +  +DG +  K  PWQR+KWTD MVRLLI  V
Sbjct  79   YNKGERRKSS----VSDEDEPSFTEEGVDGHNDGTKGKKGSPWQRVKWTDKMVRLLITAV  134

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
             YIG++   +                    V+QKKGKWKSVS+ M ERG++VSPQQCEDK
Sbjct  135  SYIGEDAAGDCG----------GGMRRKFAVLQKKGKWKSVSKVMAERGYHVSPQQCEDK  184

Query  15   FNDLN  1
            FNDLN
Sbjct  185  FNDLN  189



>emb|CDM81776.1| unnamed protein product [Triticum aestivum]
Length=542

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 58/96 (60%), Gaps = 11/96 (11%)
 Frame = -3

Query  255  CPWQRMKWTDNMVRLLIMVVYYIGDE---VGSEGNINDPagnkkkaaggg--------gg  109
            CPW RMKWTD MVRLLI VVY  GD+   V + G       + K  A             
Sbjct  121  CPWSRMKWTDAMVRLLIAVVYNAGDDGEGVSAGGKAAASHSHGKAGASAAAAHGGHGPQA  180

Query  108  gvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
               QKKGKWKSVSRAMME GF VSPQQCEDKFNDLN
Sbjct  181  AAQQKKGKWKSVSRAMMENGFAVSPQQCEDKFNDLN  216



>ref|XP_008237585.1| PREDICTED: uncharacterized protein LOC103336322 [Prunus mume]
Length=445

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 73/125 (58%), Gaps = 16/125 (13%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVV  196
            Y  G + K +     SD+++P       +   +G R  K  PWQR+KWTD MV+LLI  V
Sbjct  78   YNKGERSKNSA----SDEDEPSYTEDGTDGHAEGNRGKKGSPWQRVKWTDQMVKLLITAV  133

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
             YIG++  S+            + G      +QKKGKWKSVS+ M ERGF+VSPQQCEDK
Sbjct  134  SYIGEDASSDCG----------SGGRRKYSTLQKKGKWKSVSKVMAERGFHVSPQQCEDK  183

Query  15   FNDLN  1
            FNDLN
Sbjct  184  FNDLN  188



>emb|CDY33674.1| BnaC08g19740D [Brassica napus]
Length=383

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 68/116 (59%), Gaps = 14/116 (12%)
 Frame = -3

Query  342  TPGLTLSDDNDPGGPTAD--QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGS  169
            T G  LS+ +     + D  Q S ++   K  PWQR+KWTD MV+LLI  V YIGD+   
Sbjct  43   TCGHHLSEQHKGERESDDDEQPSFNEEATKGSPWQRVKWTDKMVKLLITAVSYIGDDSSM  102

Query  168  EGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            +G                    +QKKGKWKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  103  DGG------------SRRKFAALQKKGKWKSVSKVMSERGYHVSPQQCEDKFNDLN  146



>ref|XP_010087144.1| hypothetical protein L484_007394 [Morus notabilis]
 gb|EXB27049.1| hypothetical protein L484_007394 [Morus notabilis]
Length=511

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 54/96 (56%), Gaps = 13/96 (14%)
 Frame = -3

Query  288  QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggg  109
             N V+ GK    PWQR+KWTD MV+LLI  V YIG++ GS+                G  
Sbjct  105  HNEVNRGK----PWQRVKWTDKMVKLLITAVSYIGEDAGSDCGAGGGRRKFAILQKKGKW  160

Query  108  gvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                      SVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  161  K---------SVSKVMAERGYHVSPQQCEDKFNDLN  187



>ref|XP_010241711.1| PREDICTED: uncharacterized protein LOC104586241 [Nelumbo nucifera]
Length=452

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 77/129 (60%), Gaps = 24/129 (19%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDD----GK-RKMCPWQRMKWTDNMVRLLI  205
            Y  G+K K   G T  +D     P+  ++ VD     GK +K  PW RMKWTD+MVRLLI
Sbjct  82   YNKGDKGK---GSTSEEDE----PSLTEDGVDGHAEPGKGKKGSPWHRMKWTDSMVRLLI  134

Query  204  MVVYYIGDEVGSE-GNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQ  28
             +V YIG++  SE GN            G     ++QKKGKWK VS+ M ERG YVSPQQ
Sbjct  135  TIVSYIGEDAASECGN-----------GGRRKFTILQKKGKWKLVSKVMAERGCYVSPQQ  183

Query  27   CEDKFNDLN  1
            CEDKFNDLN
Sbjct  184  CEDKFNDLN  192



>ref|XP_009413538.1| PREDICTED: uncharacterized protein LOC103994824 [Musa acuminata 
subsp. malaccensis]
Length=424

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 69/112 (62%), Gaps = 14/112 (13%)
 Frame = -3

Query  330  TLSDDNDP--GGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNI  157
            ++SDD++P       D  +    ++K CPWQRMKWTD MVRLLI  V Y+G++  SE   
Sbjct  72   SMSDDDEPILTEDGVDAQNEAGREKKGCPWQRMKWTDAMVRLLITAVSYVGEDAPSECG-  130

Query  156  NDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                       G     ++QKKGKWK++S+ M ER  YVSPQQCEDKFNDLN
Sbjct  131  -----------GRRKYAILQKKGKWKAISKVMAERRCYVSPQQCEDKFNDLN  171



>ref|XP_009110193.1| PREDICTED: uncharacterized protein LOC103835755 [Brassica rapa]
Length=383

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 69/116 (59%), Gaps = 14/116 (12%)
 Frame = -3

Query  342  TPGLTLSDDNDPGGPTAD--QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGS  169
            T G  LS+ +     + D  Q S ++   K  PWQR+KWTD MV+LLI  V YIGD+   
Sbjct  43   TCGHHLSEQHKGERESDDDEQPSFNEEATKGSPWQRVKWTDKMVKLLITAVSYIGDDSSM  102

Query  168  EGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            +G             G      +QKKGKWKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  103  DGG------------GRRKFAALQKKGKWKSVSKVMSERGYHVSPQQCEDKFNDLN  146



>gb|EYU17440.1| hypothetical protein MIMGU_mgv1a018390mg [Erythranthe guttata]
Length=384

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 55/84 (65%), Gaps = 13/84 (15%)
 Frame = -3

Query  252  PWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSV  73
            PWQR+KWTD MVRLLI  V YI +E  SE +  +                +QKKGKWKSV
Sbjct  85   PWQRVKWTDTMVRLLITAVSYISEEASSEHSKRN-------------LSNLQKKGKWKSV  131

Query  72   SRAMMERGFYVSPQQCEDKFNDLN  1
            S+AM ERG  VSPQQCEDKFNDLN
Sbjct  132  SKAMAERGHLVSPQQCEDKFNDLN  155



>ref|XP_004516631.1| PREDICTED: uncharacterized protein LOC101514780 [Cicer arietinum]
Length=447

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 59/88 (67%), Gaps = 10/88 (11%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PW R+KWTD MVRLLI  V YIG++V SEG             G     V+QKKGK
Sbjct  111  KKGLPWTRVKWTDKMVRLLITAVSYIGEDVTSEGG----------GGGRRKFAVLQKKGK  160

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WKSVS+ M ERG+ VSPQQCEDKFNDLN
Sbjct  161  WKSVSKVMAERGYRVSPQQCEDKFNDLN  188



>ref|XP_002306694.2| hypothetical protein POPTR_0005s21390g [Populus trichocarpa]
 gb|EEE93690.2| hypothetical protein POPTR_0005s21390g [Populus trichocarpa]
Length=412

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 70/114 (61%), Gaps = 16/114 (14%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSE--G  163
            ++SD+++P       +   D +R  K  PW R+KWTD MVRLLI  V YIG++  S+  G
Sbjct  88   SVSDEDEPSYTEEGADGHSDVRRGKKGTPWHRVKWTDKMVRLLITAVSYIGEDATSDCGG  147

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
             +                 V+QKKGKWKSVS+ M ERGF+VSPQQCEDKFNDLN
Sbjct  148  GMR------------RRFTVLQKKGKWKSVSKVMAERGFHVSPQQCEDKFNDLN  189



>ref|XP_006473052.1| PREDICTED: uncharacterized protein LOC102612442 [Citrus sinensis]
Length=447

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 68/112 (61%), Gaps = 12/112 (11%)
 Frame = -3

Query  330  TLSDDNDPG-GPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNI  157
            + SDD+DP       +   D GK +K  PWQR+KW D MV+LLI  V Y+G++  S+   
Sbjct  89   SFSDDDDPSLTEEGGEGHNDAGKGKKGSPWQRVKWADKMVKLLITAVSYVGEDTSSDCG-  147

Query  156  NDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                             V+QKKGKWK++S+ M ERGF+VSPQQCEDKFNDLN
Sbjct  148  ---------GGARRKFAVLQKKGKWKAISKVMAERGFHVSPQQCEDKFNDLN  190



>ref|XP_006434454.1| hypothetical protein CICLE_v10001142mg [Citrus clementina]
 gb|ESR47694.1| hypothetical protein CICLE_v10001142mg [Citrus clementina]
 gb|KDO83724.1| hypothetical protein CISIN_1g013261mg [Citrus sinensis]
 gb|KDO83725.1| hypothetical protein CISIN_1g013261mg [Citrus sinensis]
Length=447

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 68/112 (61%), Gaps = 12/112 (11%)
 Frame = -3

Query  330  TLSDDNDPG-GPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNI  157
            + SDD+DP       +   D GK +K  PWQR+KW D MV+LLI  V Y+G++  S+   
Sbjct  89   SFSDDDDPSLTEEGGEGHNDAGKGKKGSPWQRVKWADKMVKLLITAVSYVGEDTSSDCG-  147

Query  156  NDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                             V+QKKGKWK++S+ M ERGF+VSPQQCEDKFNDLN
Sbjct  148  ---------GGARRKFAVLQKKGKWKAISKVMAERGFHVSPQQCEDKFNDLN  190



>ref|XP_010498570.1| PREDICTED: uncharacterized protein LOC104776239 [Camelina sativa]
Length=447

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 69/114 (61%), Gaps = 16/114 (14%)
 Frame = -3

Query  330  TLSDDNDPG----GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEG  163
            ++SDD++P     G     N+  +   K  PWQR+KWTD MV+LLI  V YIGD+     
Sbjct  86   SVSDDDEPSFTEEGGVDGHNNEANKSTKGSPWQRVKWTDKMVKLLITAVSYIGDD-----  140

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                   +   +       V+QKKGKWKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  141  -------STMDSGSRRKFAVLQKKGKWKSVSKVMAERGYHVSPQQCEDKFNDLN  187



>ref|XP_011044210.1| PREDICTED: uncharacterized protein LOC105139468 [Populus euphratica]
Length=447

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 68/111 (61%), Gaps = 12/111 (11%)
 Frame = -3

Query  327  LSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIN  154
            +SD+++P       +  +D +R  K  PW R+KWTD MVRLLI  V YIG++  S+    
Sbjct  89   VSDEDEPSYTEEGADGHNDVRRGKKGSPWHRVKWTDKMVRLLITAVSYIGEDATSD----  144

Query  153  DPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                            V+QKKGKWKSVS+ M ERGF+VSPQQCEDKFNDLN
Sbjct  145  ------CGDGMRRRFTVLQKKGKWKSVSKVMAERGFHVSPQQCEDKFNDLN  189



>gb|EMT16151.1| hypothetical protein F775_16013 [Aegilops tauschii]
Length=485

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 57/95 (60%), Gaps = 10/95 (11%)
 Frame = -3

Query  255  CPWQRMKWTDNMVRLLIMVVYYIGDE----------VGSEGNINDPagnkkkaagggggg  106
            C W RMKWTD MVRLLI VVY  G++            S  +    A    +   G    
Sbjct  109  CSWSRMKWTDAMVRLLIAVVYNAGEDGEGVSAGGKAAASHSHGKAVASAAAQGGHGPQAA  168

Query  105  vmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
              Q+KGKW+SVSRAM+E+GF VSPQQCEDKFNDLN
Sbjct  169  AQQRKGKWRSVSRAMVEKGFKVSPQQCEDKFNDLN  203



>ref|XP_002455555.1| hypothetical protein SORBIDRAFT_03g013050 [Sorghum bicolor]
 gb|EES00675.1| hypothetical protein SORBIDRAFT_03g013050 [Sorghum bicolor]
Length=541

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 55/89 (62%), Gaps = 6/89 (7%)
 Frame = -3

Query  255  CPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwK-  79
            CPW RMKWTD MVRLLI VVY +GD+   EG          +A   G G     + + K 
Sbjct  104  CPWTRMKWTDAMVRLLIGVVYSVGDD--GEGVATAGGAGAGRAGRAGHGHAAAAQQQKKG  161

Query  78   ---SVSRAMMERGFYVSPQQCEDKFNDLN  1
               SVS AMM++GF VSPQQCEDKFNDLN
Sbjct  162  KWKSVSHAMMDKGFVVSPQQCEDKFNDLN  190



>ref|XP_002302181.2| hypothetical protein POPTR_0002s06930g [Populus trichocarpa]
 gb|EEE81454.2| hypothetical protein POPTR_0002s06930g [Populus trichocarpa]
Length=420

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 74/125 (59%), Gaps = 16/125 (13%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDG--KRKMCPWQRMKWTDNMVRLLIMVV  196
            Y  G++ K +    +SD+++P       +  +D    +K  PWQR+KWTD MVRLLI  V
Sbjct  79   YNKGDRGKNS----VSDEDEPSYTEEGADGHNDAITGKKGTPWQRVKWTDKMVRLLITAV  134

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
             YIG++  S+                    V+QKKGKWKSVS+ M ERGF+VSPQQCEDK
Sbjct  135  SYIGEDGTSD----------CGGGMRRKFTVLQKKGKWKSVSKVMAERGFHVSPQQCEDK  184

Query  15   FNDLN  1
            FNDLN
Sbjct  185  FNDLN  189



>ref|XP_009149597.1| PREDICTED: uncharacterized protein LOC103872912 [Brassica rapa]
Length=401

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 66/113 (58%), Gaps = 26/113 (23%)
 Frame = -3

Query  324  SDDNDP-----GGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGN  160
            SDD++P     GG  + + S         PWQR+KWTD MV+LLI  V YIGD+   +G 
Sbjct  64   SDDDEPSFNEEGGEKSTKGS---------PWQRVKWTDKMVKLLITAVSYIGDDSSMDGG  114

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                               +QKKGKWKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  115  ------------SRRKFAALQKKGKWKSVSKVMSERGYHVSPQQCEDKFNDLN  155



>ref|XP_010930979.1| PREDICTED: uncharacterized protein LOC105052003 [Elaeis guineensis]
Length=441

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 72/113 (64%), Gaps = 14/113 (12%)
 Frame = -3

Query  330  TLSDDNDPG--GPTAD-QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGN  160
            ++SDD+D       AD QN   +GK K  PWQRMKWT  MVRLLI  V Y+G++  SE N
Sbjct  86   SMSDDDDLNFMEDGADGQNEAGNGK-KGFPWQRMKWTRAMVRLLITAVSYVGEDAMSEYN  144

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                      + G     ++QKKGKWK++S+ M ERG YVSPQQCEDKFNDLN
Sbjct  145  ----------SGGRRKYAILQKKGKWKAISKVMAERGCYVSPQQCEDKFNDLN  187



>gb|EPS69845.1| hypothetical protein M569_04922, partial [Genlisea aurea]
Length=295

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 54/83 (65%), Gaps = 11/83 (13%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVS  70
            WQR+KW+D+MVRLLI  V YI +E G E + +                 + KKGKWKSVS
Sbjct  5    WQRVKWSDSMVRLLITAVSYISEEAGGEDHAH-----------RRKMLSLHKKGKWKSVS  53

Query  69   RAMMERGFYVSPQQCEDKFNDLN  1
            + M ERG +VSPQQCEDKFNDLN
Sbjct  54   KVMAERGHFVSPQQCEDKFNDLN  76



>ref|XP_007150380.1| hypothetical protein PHAVU_005G148400g [Phaseolus vulgaris]
 gb|ESW22374.1| hypothetical protein PHAVU_005G148400g [Phaseolus vulgaris]
Length=448

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 78/128 (61%), Gaps = 18/128 (14%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPG-GPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVV  196
            +  G    P+    LSD+++P      +  ++D GK +K  PWQRMKWTDN+VRLLI VV
Sbjct  70   FGKGKAIAPSDSNELSDEDEPSYAEEGNCENLDGGKGKKGSPWQRMKWTDNVVRLLITVV  129

Query  195  YYIGDE---VGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQC  25
              +GD+    G +G+                 GV+QKKGKWK+VS+ M+ +G +VSPQQC
Sbjct  130  SCVGDDGTIAGMDGH-------------KRKSGVLQKKGKWKTVSKIMISKGCHVSPQQC  176

Query  24   EDKFNDLN  1
            EDKFNDLN
Sbjct  177  EDKFNDLN  184



>ref|XP_010537278.1| PREDICTED: uncharacterized protein LOC104812040 [Tarenaya hassleriana]
Length=424

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (63%), Gaps = 14/112 (13%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNI  157
            ++SD+++P       +  ++G +  K  PWQR+KWTD MV+LLI  V YIG++   +   
Sbjct  82   SMSDEDEPSLTEEGGDGHNEGSKAKKGSPWQRVKWTDKMVKLLITAVSYIGEDSAMDCGT  141

Query  156  NDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                             V+QKKGKWKSVS+AM ERG++VSPQQCEDKFNDLN
Sbjct  142  R------------RKFAVLQKKGKWKSVSKAMAERGYHVSPQQCEDKFNDLN  181



>ref|XP_009628855.1| PREDICTED: uncharacterized protein LOC104119138 [Nicotiana tomentosiformis]
Length=451

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 70/111 (63%), Gaps = 14/111 (13%)
 Frame = -3

Query  324  SDDNDPGGPTADQNSVDDG---KRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIN  154
            SD+++P   T D N  ++G   ++K  PWQRMKWTDN+VRLLI VV  +GD+   EG   
Sbjct  95   SDEDEPS-FTEDGNGDNNGGALEKKGSPWQRMKWTDNVVRLLIQVVACVGDDGSLEG---  150

Query  153  DPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                           G +QKKGKWK+VSR MM  G +VSPQQCEDKFNDLN
Sbjct  151  -------TEGLKRKSGCIQKKGKWKTVSRIMMSNGCHVSPQQCEDKFNDLN  194



>ref|XP_006416324.1| hypothetical protein EUTSA_v10010018mg [Eutrema salsugineum]
 gb|ESQ34677.1| hypothetical protein EUTSA_v10010018mg [Eutrema salsugineum]
Length=438

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 69/113 (61%), Gaps = 14/113 (12%)
 Frame = -3

Query  333  LTLSDDNDPGGPT--ADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGN  160
            +++SDD++P       D ++  +   K  PWQR+KWTD MV+LLI  V YIGD+      
Sbjct  79   ISVSDDDEPSFTEEGGDGHNEANKSTKGSPWQRVKWTDKMVKLLITAVSYIGDD------  132

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                  +           V+QKKGKWKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  133  ------STMDTGSRRKFAVLQKKGKWKSVSKVMAERGYHVSPQQCEDKFNDLN  179



>ref|XP_002890430.1| hypothetical protein ARALYDRAFT_472358 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66689.1| hypothetical protein ARALYDRAFT_472358 [Arabidopsis lyrata subsp. 
lyrata]
Length=440

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 67/111 (60%), Gaps = 14/111 (13%)
 Frame = -3

Query  327  LSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIN  154
            +SDD++P       +  ++  R  K  PWQR+KWTD MV+LLI  V YIGD+   +    
Sbjct  83   VSDDDEPSFTEEGGDGHNEANRSTKGSPWQRVKWTDKMVKLLITAVSYIGDDSSMDSG--  140

Query  153  DPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                            V+QKKGKWKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  141  ----------SRRKFAVLQKKGKWKSVSKVMAERGYHVSPQQCEDKFNDLN  181



>ref|XP_011101525.1| PREDICTED: uncharacterized protein LOC105179584 [Sesamum indicum]
Length=437

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 65/114 (57%), Gaps = 12/114 (11%)
 Frame = -3

Query  336  GLTLSDDNDPG--GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEG  163
            G + SD+++P       D  +     +K  PWQR+KWTD MVRLLI  V YI +E  +E 
Sbjct  80   GKSASDEDEPSFMEDAGDGRNDSSKGKKASPWQRVKWTDTMVRLLITAVSYISEEAATE-  138

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                                +QKKGKWKSVS+ M ERG +VSPQQCEDKFNDLN
Sbjct  139  ---------YMGGMRRRLLNLQKKGKWKSVSKVMAERGHFVSPQQCEDKFNDLN  183



>ref|XP_009375065.1| PREDICTED: uncharacterized protein LOC103963911 [Pyrus x bretschneideri]
Length=446

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 72/113 (64%), Gaps = 13/113 (12%)
 Frame = -3

Query  336  GLTLSDDNDPGGPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGN  160
            G  LSD+++      D  S++  K +K CPWQRMKWTDN+VRLLI VV  +GD+   E +
Sbjct  87   GYNLSDEDEQN--YTDDESIEGAKGKKGCPWQRMKWTDNVVRLLIDVVACVGDDGSVESS  144

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                             G++QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  145  ----------EGLKRKSGILQKKGKWKTVSKIMISKGCHVSPQQCEDKFNDLN  187



>ref|XP_011042849.1| PREDICTED: uncharacterized protein LOC105138468 [Populus euphratica]
Length=447

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 74/125 (59%), Gaps = 16/125 (13%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDG--KRKMCPWQRMKWTDNMVRLLIMVV  196
            Y  G++ K +    +SD+++P       +  +D    +K  PWQR+KWTD MVRLLI  V
Sbjct  79   YNKGDRGKNS----VSDEDEPSYTEEGADGHNDAITGKKGTPWQRVKWTDKMVRLLITAV  134

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
             YIG++  S+                    V+QKKGKWKS+S+ M ERGF+VSPQQCEDK
Sbjct  135  SYIGEDGTSD----------CGGGMRRKFTVLQKKGKWKSISKVMAERGFHVSPQQCEDK  184

Query  15   FNDLN  1
            FNDLN
Sbjct  185  FNDLN  189



>ref|XP_002532438.1| transcription factor, putative [Ricinus communis]
 gb|EEF29953.1| transcription factor, putative [Ricinus communis]
Length=441

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 73/125 (58%), Gaps = 16/125 (13%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKR--KMCPWQRMKWTDNMVRLLIMVV  196
            Y  G+K K +     SD+++P       +  +D  R  K  PWQR+KWTD MVRLLI  V
Sbjct  74   YNKGDKGKNSA----SDEDEPSYTEDGADGHNDPSRGKKGSPWQRVKWTDKMVRLLITAV  129

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
             YIG++V S+            +       V+QKKGKWKSVS+ M ERG  VSPQQCEDK
Sbjct  130  SYIGEDVTSD----------YGSGMRRKFSVLQKKGKWKSVSKVMAERGHLVSPQQCEDK  179

Query  15   FNDLN  1
            FNDLN
Sbjct  180  FNDLN  184



>ref|XP_010063872.1| PREDICTED: uncharacterized protein LOC104450863 [Eucalyptus grandis]
 gb|KCW71142.1| hypothetical protein EUGRSUZ_F04240 [Eucalyptus grandis]
Length=446

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 70/113 (62%), Gaps = 14/113 (12%)
 Frame = -3

Query  330  TLSDDNDPGGP---TADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGN  160
            + SDD+DP        + N V  GK K  PWQR+KWTD MVRLLI  V YIG++ GS   
Sbjct  88   SASDDDDPSFTEDGIDNHNDVSKGK-KGSPWQRVKWTDKMVRLLITAVSYIGEDSGS---  143

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                        G     V+QKKGKWKS+S+ + ERG++VSPQQCEDKFNDLN
Sbjct  144  -------DCGGGGRRKFAVLQKKGKWKSISKVLAERGYHVSPQQCEDKFNDLN  189



>ref|XP_010652952.1| PREDICTED: stress response protein nst1-like isoform X1 [Vitis 
vinifera]
Length=454

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 11/108 (10%)
 Frame = -3

Query  324  SDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPa  145
            SD+++P   T D+N      +K  PWQRMKWTDN+VRLLI VV  +GD+   EG      
Sbjct  94   SDEDEPS-YTEDENFSGAKGKKGSPWQRMKWTDNVVRLLIAVVACVGDDGTLEG------  146

Query  144  gnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                        G++QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  147  ----VEGLKRKSGILQKKGKWKTVSKIMISKGCFVSPQQCEDKFNDLN  190



>ref|XP_002273284.1| PREDICTED: stress response protein nst1-like isoform X2 [Vitis 
vinifera]
Length=451

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 11/108 (10%)
 Frame = -3

Query  324  SDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPa  145
            SD+++P   T D+N      +K  PWQRMKWTDN+VRLLI VV  +GD+   EG      
Sbjct  91   SDEDEPS-YTEDENFSGAKGKKGSPWQRMKWTDNVVRLLIAVVACVGDDGTLEG------  143

Query  144  gnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                        G++QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  144  ----VEGLKRKSGILQKKGKWKTVSKIMISKGCFVSPQQCEDKFNDLN  187



>ref|XP_009368513.1| PREDICTED: uncharacterized protein LOC103958014 [Pyrus x bretschneideri]
Length=448

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 68/110 (62%), Gaps = 16/110 (15%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            + ++D   G P A +       +K  PWQR+KWTD MV+LLI  V YIG++ GS+     
Sbjct  97   SYAEDGADGHPEASKG------KKGSPWQRVKWTDQMVKLLITAVSYIGEDTGSDCG---  147

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                   + G     V+QKKGKWKSVS+ M ER ++VSPQQCEDKFNDLN
Sbjct  148  -------SGGRRKYSVVQKKGKWKSVSKVMAERSYHVSPQQCEDKFNDLN  190



>ref|XP_009387998.1| PREDICTED: uncharacterized protein LOC103974835 [Musa acuminata 
subsp. malaccensis]
Length=406

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 71/122 (58%), Gaps = 14/122 (11%)
 Frame = -3

Query  336  GLTLSDDNDPGGPTADQNSVDD----------GKRKMCPWQRMKWTDNMVRLLIMVVYYI  187
            G   SDD D     A +    D          G +K  PW RMKWTD +VRLLI VV ++
Sbjct  66   GAATSDDEDHFPAVAGEEDGHDPDSLPASEAGGSKKASPWHRMKWTDEVVRLLISVVAFV  125

Query  186  GDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFND  7
            GD    +G++     N   AA    G  +QKKGKWK+VS+ M+E+G YVSPQQCEDKFND
Sbjct  126  GDH--DDGSLE--ILNGSAAARRRHGASLQKKGKWKTVSKLMLEKGCYVSPQQCEDKFND  181

Query  6    LN  1
            LN
Sbjct  182  LN  183



>ref|XP_011074759.1| PREDICTED: uncharacterized protein LOC105159405 [Sesamum indicum]
Length=437

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 68/119 (57%), Gaps = 14/119 (12%)
 Frame = -3

Query  348  KPTPGLTLSDDNDPG---GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDE  178
            K   G  +SD+++P    G    +N    GK K   WQR+KWTD MVRLLI  V YI +E
Sbjct  71   KLERGKMVSDEDEPSFVEGVADGRNDPSKGK-KASMWQRVKWTDTMVRLLITAVSYISEE  129

Query  177  VGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
              +E               G     +QKKGKWKSVS+ M ERG +VSPQQCEDKFNDLN
Sbjct  130  AAAE----------HGGGSGRKYTNLQKKGKWKSVSKVMAERGHFVSPQQCEDKFNDLN  178



>ref|XP_010477381.1| PREDICTED: uncharacterized protein LOC104756477 [Camelina sativa]
Length=452

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 70/115 (61%), Gaps = 17/115 (15%)
 Frame = -3

Query  330  TLSDDNDPG----GPTAD-QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSE  166
            ++SDD++P     G   D  N+  +   K  PWQR+KWTD MV+LLI  V YIGD+    
Sbjct  88   SVSDDDEPSFTEEGCGGDGHNNEANKSTKGSPWQRVKWTDKMVKLLITAVSYIGDD----  143

Query  165  GNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                    +   +       V+QKKGKWKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  144  --------STMDSGSRRKFAVLQKKGKWKSVSKVMAERGYHVSPQQCEDKFNDLN  190



>ref|XP_003547125.1| PREDICTED: uncharacterized protein LOC100798932 isoform X1 [Glycine 
max]
 ref|XP_006597254.1| PREDICTED: uncharacterized protein LOC100798932 isoform X2 [Glycine 
max]
Length=447

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 12/125 (10%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPG-GPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVV  196
            +  G    P+    LS++++P      +  ++D GK +K  PWQRMKWTDN+VRLLI VV
Sbjct  70   FGKGKAVAPSNSNELSEEDEPSYAEEGNCENLDGGKSKKGSPWQRMKWTDNVVRLLITVV  129

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
              +GD+ G+ G ++               GV+QKKGKWK+VS+ M+ +G +VSPQQCEDK
Sbjct  130  SCVGDD-GTIGGMD---------CHKRKSGVLQKKGKWKTVSKIMIGKGCHVSPQQCEDK  179

Query  15   FNDLN  1
            FNDLN
Sbjct  180  FNDLN  184



>gb|KHN33341.1| hypothetical protein glysoja_005383 [Glycine soja]
Length=447

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 12/125 (10%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPG-GPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVV  196
            +  G    P+    LS++++P      +  ++D GK +K  PWQRMKWTDN+VRLLI VV
Sbjct  70   FGKGKAVAPSNSNELSEEDEPSYAEEGNCENLDGGKSKKGSPWQRMKWTDNVVRLLITVV  129

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
              +GD+ G+ G ++               GV+QKKGKWK+VS+ M+ +G +VSPQQCEDK
Sbjct  130  SCVGDD-GTIGGMD---------CHKRKSGVLQKKGKWKTVSKIMIGKGCHVSPQQCEDK  179

Query  15   FNDLN  1
            FNDLN
Sbjct  180  FNDLN  184



>gb|EPS68099.1| hypothetical protein M569_06676, partial [Genlisea aurea]
Length=207

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 55/90 (61%), Gaps = 10/90 (11%)
 Frame = -3

Query  270  GKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkk  91
            GK+    W R+KWTD MVRLLI  V YI +E   E            A        +QKK
Sbjct  23   GKKLSSTWHRVKWTDRMVRLLITAVSYINEETPPEN----------VAMLRRKHSNLQKK  72

Query  90   gkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            GKWKSVS+ + ERGF+VSPQQCEDKFNDLN
Sbjct  73   GKWKSVSKVLAERGFFVSPQQCEDKFNDLN  102



>ref|XP_006307528.1| hypothetical protein CARUB_v10009151mg [Capsella rubella]
 ref|XP_006307529.1| hypothetical protein CARUB_v10009151mg [Capsella rubella]
 gb|EOA40426.1| hypothetical protein CARUB_v10009151mg [Capsella rubella]
 gb|EOA40427.1| hypothetical protein CARUB_v10009151mg [Capsella rubella]
Length=442

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 68/117 (58%), Gaps = 24/117 (21%)
 Frame = -3

Query  330  TLSDDNDPG-------GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVG  172
            ++SDD++P        GP     S      K  PWQR+KWTD MV+LLI  V YIGD+  
Sbjct  81   SVSDDDEPSFTEEGGDGPNEANKST-----KGSPWQRVKWTDKMVKLLITAVSYIGDD--  133

Query  171  SEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                      +   +       V+QKKGKWKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  134  ----------STMDSGSRRKFAVLQKKGKWKSVSKVMAERGYHVSPQQCEDKFNDLN  180



>gb|KHN41268.1| hypothetical protein glysoja_030106 [Glycine soja]
Length=443

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 61/88 (69%), Gaps = 11/88 (13%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQ++KWTD MV+LLIMV+ YIG++  S+ +           +      V+Q KGK
Sbjct  109  KKSTPWQQVKWTDKMVKLLIMVMSYIGEDATSDNS-----------SKRRKFTVLQNKGK  157

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WKS+S+ M ERG++VSPQQCEDKFNDL+
Sbjct  158  WKSISKVMAERGYHVSPQQCEDKFNDLS  185



>ref|XP_008655870.1| PREDICTED: uncharacterized protein LOC103635104 [Zea mays]
 gb|AFW80662.1| hypothetical protein ZEAMMB73_350135 [Zea mays]
Length=533

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 61/92 (66%), Gaps = 7/92 (8%)
 Frame = -3

Query  255  CPWQRMKWTDNMVRLLIMVVYYIGDE-------VGSEGNINDPagnkkkaaggggggvmq  97
            CPW RMKWTD+MVRLLI VVY +GD+        G+ G     AG+     G       Q
Sbjct  113  CPWTRMKWTDDMVRLLISVVYSVGDDWEGAAMPGGAGGGKASRAGSSGHGHGHAAAAQQQ  172

Query  96   kkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            KKGKWKSVS AMM++GF VSPQQCEDKFNDLN
Sbjct  173  KKGKWKSVSHAMMDKGFVVSPQQCEDKFNDLN  204



>ref|XP_004496474.1| PREDICTED: uncharacterized protein LOC101496200 [Cicer arietinum]
Length=449

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 65/97 (67%), Gaps = 9/97 (9%)
 Frame = -3

Query  288  QNSVDDGKRKMC-PWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaagggg  112
            Q+ +  GK+ +  PWQR+KWTD MVRL+I  V YIG+++ S+             +G   
Sbjct  101  QHELGRGKKGLSSPWQRVKWTDKMVRLMITAVSYIGEDITSD--------GGGGGSGRKR  152

Query  111  ggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
              V+QKKGKWKSVS+ M ERG +VSPQQCEDKFNDLN
Sbjct  153  FAVLQKKGKWKSVSKVMAERGCHVSPQQCEDKFNDLN  189



>ref|XP_007143533.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
 ref|XP_007143534.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
 gb|ESW15527.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
 gb|ESW15528.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
Length=450

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 59/88 (67%), Gaps = 8/88 (9%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQR+KWTD MV+LLI  V YIG++V                +G     V+QKKGK
Sbjct  111  KKGSPWQRVKWTDKMVKLLITAVSYIGEDV--------TGDGGGSGSGRRKFAVLQKKGK  162

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  163  WKSVSKVMAERGYHVSPQQCEDKFNDLN  190



>ref|XP_009768464.1| PREDICTED: uncharacterized protein LOC104219473 [Nicotiana sylvestris]
Length=453

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 65/109 (60%), Gaps = 13/109 (12%)
 Frame = -3

Query  318  DNDPGGPTADQNSVDDGK---RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDP  148
            D D    T D N  ++G    +K  PWQRMKWTDN+VRLLI VV  +GD+   EG     
Sbjct  97   DEDEPSFTEDGNGDNNGGALGKKGSPWQRMKWTDNVVRLLIQVVACVGDDGSLEG-----  151

Query  147  agnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                         G +QKKGKWK+VSR MM  G +VSPQQCEDKFNDLN
Sbjct  152  -----TEGLKRKSGCVQKKGKWKTVSRIMMTNGCHVSPQQCEDKFNDLN  195



>ref|XP_009403682.1| PREDICTED: uncharacterized protein LOC103987182 [Musa acuminata 
subsp. malaccensis]
Length=418

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 71/126 (56%), Gaps = 20/126 (16%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPG---GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMV  199
            Y  G + K +    +SD+++P         QN    GK    PW RMKWTD MVRLLI  
Sbjct  56   YNKGERGKTS----VSDEDEPSLNEDGVDGQNEAGKGKNG-SPWHRMKWTDAMVRLLITA  110

Query  198  VYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCED  19
            V Y G++V SE              G     ++Q+KGKWK++S+ M +RG YVSPQQCED
Sbjct  111  VSYTGEDVASECG------------GRRKHVILQRKGKWKAISKVMAQRGCYVSPQQCED  158

Query  18   KFNDLN  1
            KFNDLN
Sbjct  159  KFNDLN  164



>ref|XP_003565719.1| PREDICTED: uncharacterized protein LOC100835008 [Brachypodium 
distachyon]
Length=480

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 52/83 (63%), Gaps = 18/83 (22%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVS  70
            W RMKWTD MVRLLIMVVY  GD+   EG +                   QKKGKWKSVS
Sbjct  100  WSRMKWTDAMVRLLIMVVYNAGDD--GEGAV----------------AAAQKKGKWKSVS  141

Query  69   RAMMERGFYVSPQQCEDKFNDLN  1
            R M E GF VSPQQCEDKFNDLN
Sbjct  142  RTMGEHGFTVSPQQCEDKFNDLN  164



>ref|XP_009421497.1| PREDICTED: uncharacterized protein LOC104001043 [Musa acuminata 
subsp. malaccensis]
Length=554

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 49/89 (55%), Gaps = 6/89 (7%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwK---  79
            W RMKWTD MVRLLI VVY++GD+ G                              +   
Sbjct  113  WHRMKWTDGMVRLLIQVVYHVGDDGGGAEGEQQQPHGTVAKGKKSAAASAPVSALLQKKG  172

Query  78   ---SVSRAMMERGFYVSPQQCEDKFNDLN  1
               SVSRAMME+GFYVSPQQCEDKFNDLN
Sbjct  173  KWKSVSRAMMEKGFYVSPQQCEDKFNDLN  201



>ref|XP_007014993.1| Sequence-specific DNA binding transcription factors [Theobroma 
cacao]
 gb|EOY32612.1| Sequence-specific DNA binding transcription factors [Theobroma 
cacao]
Length=454

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 10/96 (10%)
 Frame = -3

Query  288  QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggg  109
            +NS+    +K  PWQRMKWTDN+VRLLI VV  +GD+   EG +  P             
Sbjct  104  ENSIGGKGKKGSPWQRMKWTDNVVRLLIAVVACVGDDGMIEG-VEGP---------KRKS  153

Query  108  gvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            G++QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  154  GILQKKGKWKTVSKIMISKGCHVSPQQCEDKFNDLN  189



>ref|XP_010912197.1| PREDICTED: la-related protein CG11505-like [Elaeis guineensis]
Length=541

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 79/133 (59%), Gaps = 25/133 (19%)
 Frame = -3

Query  333  LTLSDDNDPGGPTADQNSVDDGKRKMC-------PWQRMKWTDNMVRLLIMVVYYIGDEV  175
            LTLS +++      D+    DG R++        PWQRMKWTD+MVRLLI VVY +GD+ 
Sbjct  89   LTLSSEDELQPGFGDEG---DGARRVSSQSPTPSPWQRMKWTDSMVRLLISVVYRVGDDG  145

Query  174  GSEGNI--NDPagnkkkaagggggg-------------vmqkkgkwKSVSRAMMERGFYV  40
            G  G    + P      ++   G               ++QKKGKWKSVSRAMME+GFYV
Sbjct  146  GGGGEGEPHQPHAAVSASSAAKGKKGPAASASATSASALLQKKGKWKSVSRAMMEKGFYV  205

Query  39   SPQQCEDKFNDLN  1
            SPQQCEDKFNDLN
Sbjct  206  SPQQCEDKFNDLN  218



>ref|XP_003592116.1| hypothetical protein MTR_1g098920 [Medicago truncatula]
 gb|AES62367.1| transcription factor [Medicago truncatula]
Length=450

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 9/84 (11%)
 Frame = -3

Query  252  PWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSV  73
            PWQR+KWTDNMVRL+I  V YIG++  S+G            +G     V+QKKGKW+ V
Sbjct  120  PWQRVKWTDNMVRLMITAVSYIGEDRTSDG---------VGGSGRRKFAVLQKKGKWRCV  170

Query  72   SRAMMERGFYVSPQQCEDKFNDLN  1
            S+ M ERG +VSPQQCEDKFNDLN
Sbjct  171  SKVMAERGCHVSPQQCEDKFNDLN  194



>ref|XP_010539734.1| PREDICTED: uncharacterized protein LOC104813711 [Tarenaya hassleriana]
Length=434

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 69/114 (61%), Gaps = 15/114 (13%)
 Frame = -3

Query  330  TLSDDNDPG----GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEG  163
            ++SD+++P     G     N V+  K K  PWQR+KWTD MV+LLI  V YIG++   + 
Sbjct  86   SMSDEDEPSFTEEGGGDGHNEVNKAK-KGSPWQRVKWTDKMVKLLITAVSYIGEDSAVDC  144

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                        +      V+QKKGKWKSVS+ M ER ++VSPQQCEDKFNDLN
Sbjct  145  G----------GSSRRKFAVLQKKGKWKSVSKVMAERSYHVSPQQCEDKFNDLN  188



>ref|XP_006365820.1| PREDICTED: uncharacterized protein LOC102578195 [Solanum tuberosum]
Length=459

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 56/88 (64%), Gaps = 9/88 (10%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQRMKWTDN+VRLLI VV  +GD+   EG                    +QKKGK
Sbjct  117  KKGSPWQRMKWTDNVVRLLIQVVACVGDDGSLEG---------PGVGLKRKSACLQKKGK  167

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK+VSR MM  G +VSPQQCEDKFNDLN
Sbjct  168  WKTVSRIMMSNGCHVSPQQCEDKFNDLN  195



>ref|XP_004252856.1| PREDICTED: uncharacterized protein LOC101246904 [Solanum lycopersicum]
Length=460

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 56/88 (64%), Gaps = 9/88 (10%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQRMKWTDN+VRLLI VV  +GD+   EG                    +QKKGK
Sbjct  118  KKGSPWQRMKWTDNVVRLLIQVVACVGDDGSLEG---------PGVGLKRKSACLQKKGK  168

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK+VSR MM  G +VSPQQCEDKFNDLN
Sbjct  169  WKTVSRIMMSNGCHVSPQQCEDKFNDLN  196



>ref|XP_008798770.1| PREDICTED: uncharacterized protein LOC103713568 [Phoenix dactylifera]
Length=417

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 68/128 (53%), Gaps = 15/128 (12%)
 Frame = -3

Query  360  GNKPKPTPGLTLSDDND--PGGPTADQNS------VDDGKRKMCPWQRMKWTDNMVRLLI  205
            G  P  T   T SDD+D  P    A++N          GK K  PW RMKWTD +VRLLI
Sbjct  57   GISPSSTAAAT-SDDDDQLPAAAAAEENGHGQQTGTGSGK-KGSPWHRMKWTDEVVRLLI  114

Query  204  MVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQC  25
             +V ++GD+   E            A     G   QKKGKWK VS  M E G +VSPQQC
Sbjct  115  RIVAFVGDDCAHEA-----VDGTAGAVKRKHGAAFQKKGKWKMVSLLMQENGAFVSPQQC  169

Query  24   EDKFNDLN  1
            EDKFNDLN
Sbjct  170  EDKFNDLN  177



>ref|XP_007152028.1| hypothetical protein PHAVU_004G095500g [Phaseolus vulgaris]
 gb|ESW24022.1| hypothetical protein PHAVU_004G095500g [Phaseolus vulgaris]
Length=442

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 56/88 (64%), Gaps = 11/88 (13%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQR+KWTD MVRLLI  V YIG++  S+                    V+QKKGK
Sbjct  108  KKGSPWQRVKWTDKMVRLLITAVSYIGEDATSDCG-----------GSRRKFTVLQKKGK  156

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WKSVS+ M ERG  VSPQQCEDKFNDLN
Sbjct  157  WKSVSKVMAERGHRVSPQQCEDKFNDLN  184



>ref|XP_009390139.1| PREDICTED: uncharacterized protein LOC103976598 [Musa acuminata 
subsp. malaccensis]
Length=535

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = -3

Query  252  PWQRMKWTDNMVRLLIMVVYYI------GDEVGSEGNINDPagnkkkaaggggggvmqkk  91
            PWQRMKWTDNM+RLLI VVY +        E   + ++    G K  AA       + +K
Sbjct  120  PWQRMKWTDNMIRLLIKVVYRVGDDGGAAGEGEQQAHVALAKGKKSAAAAAAASSALLQK  179

Query  90   gkw-KSVSRAMMERGFYVSPQQCEDKFNDLN  1
                KSVSRAMME GF VSPQQCEDKFNDLN
Sbjct  180  KGKWKSVSRAMMENGFCVSPQQCEDKFNDLN  210



>ref|XP_008352771.1| PREDICTED: uncharacterized protein LOC103416293 [Malus domestica]
 ref|XP_008352772.1| PREDICTED: uncharacterized protein LOC103416293 [Malus domestica]
Length=448

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 16/110 (15%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            + ++D   G P A +       +K  PWQR+KWTD MV+LLI  V YIG++  S+     
Sbjct  97   SYAEDGADGHPEASKG------KKGSPWQRVKWTDQMVKLLITAVSYIGEDTSSDCG---  147

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                   + G     V+QKKGKWKSVS+ M ER ++VSPQQCEDKFNDLN
Sbjct  148  -------SGGRRKYSVVQKKGKWKSVSKVMAERRYHVSPQQCEDKFNDLN  190



>ref|XP_008359235.1| PREDICTED: myb/SANT-like DNA-binding domain-containing protein 
4 [Malus domestica]
Length=440

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 69/113 (61%), Gaps = 13/113 (12%)
 Frame = -3

Query  336  GLTLSDDNDPGGPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGN  160
            G  LSDD++      D  S++  K +K   WQRMKWTDN+VRLLI VV  +GD+   EG 
Sbjct  81   GYNLSDDDEQN--YTDDESIEGAKGKKGSRWQRMKWTDNVVRLLIDVVACVGDDGSVEGG  138

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                              ++QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  139  ----------EGLKRKSRILQKKGKWKTVSQIMISKGCHVSPQQCEDKFNDLN  181



>gb|EYU36855.1| hypothetical protein MIMGU_mgv1a007325mg [Erythranthe guttata]
Length=411

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 52/84 (62%), Gaps = 11/84 (13%)
 Frame = -3

Query  252  PWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSV  73
            PWQR+KWTD MVRLLI  V YI +E       +                 +QKKGKWKSV
Sbjct  112  PWQRVKWTDAMVRLLITAVSYISEEAAEYSGTS-----------KRKCANLQKKGKWKSV  160

Query  72   SRAMMERGFYVSPQQCEDKFNDLN  1
            S+ M ERG +VSPQQCEDKFNDLN
Sbjct  161  SKVMAERGHFVSPQQCEDKFNDLN  184



>ref|XP_003548116.1| PREDICTED: uncharacterized protein LOC100805861 [Glycine max]
Length=443

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 60/88 (68%), Gaps = 11/88 (13%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQ++KWTD MV+LLIMV+ YIG++   + +           +      V+Q KGK
Sbjct  109  KKSTPWQQVKWTDKMVKLLIMVMSYIGEDATFDNS-----------SKRRKFTVLQNKGK  157

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WKS+S+ M ERG++VSPQQCEDKFNDL+
Sbjct  158  WKSISKVMAERGYHVSPQQCEDKFNDLS  185



>ref|XP_006850180.1| hypothetical protein AMTR_s00022p00244920 [Amborella trichopoda]
 gb|ERN11761.1| hypothetical protein AMTR_s00022p00244920 [Amborella trichopoda]
Length=441

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 10/88 (11%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQRMKW+D+MVRLLI VV Y+G++   +G           +     GG++QKKGK
Sbjct  108  KKGSPWQRMKWSDHMVRLLITVVSYVGEDGTPDGE----------SGHKRKGGILQKKGK  157

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK+VS+ MME+G  VSPQQCEDKFNDLN
Sbjct  158  WKTVSKIMMEKGCSVSPQQCEDKFNDLN  185



>ref|XP_008381817.1| PREDICTED: uncharacterized protein LOC103444641 [Malus domestica]
 ref|XP_008348746.1| PREDICTED: uncharacterized protein LOC103411910 [Malus domestica]
Length=447

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 71/124 (57%), Gaps = 15/124 (12%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPG-GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVY  193
            Y  G + K +     SD+++P      D ++     +K  PWQR+KWTD MV+LLI  V 
Sbjct  81   YSKGERCKNSA----SDEDEPSYAEEGDGHAEXSRGKKGSPWQRVKWTDQMVKLLITAVS  136

Query  192  YIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKF  13
            YIG++  S+              G     V+QKKGKWKSVS+ M ER + VSPQQCEDKF
Sbjct  137  YIGEDTSSDCG----------GGGRRKYSVLQKKGKWKSVSKVMAERSYRVSPQQCEDKF  186

Query  12   NDLN  1
            NDLN
Sbjct  187  NDLN  190



>ref|XP_002452238.1| hypothetical protein SORBIDRAFT_04g022190 [Sorghum bicolor]
 gb|EES05214.1| hypothetical protein SORBIDRAFT_04g022190 [Sorghum bicolor]
Length=409

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 60/113 (53%), Gaps = 16/113 (14%)
 Frame = -3

Query  333  LTLSDDNDPGGPTADQNSVDDGKRKMC--PWQRMKWTDNMVRLLIMVVYYIGDEVGSEGN  160
            ++LSD+ D     AD   +D GK +    PW R+KWT  MV+LL+  V YI ++V ++  
Sbjct  65   VSLSDEED-----ADDGHLDHGKAEAAASPWHRVKWTSGMVKLLVTAVSYIDEDVDADYG  119

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
             +            G   +         VS AM ERGF VSPQQCEDKFNDLN
Sbjct  120  TSSGRRKHALLKRKGKWRL---------VSSAMAERGFAVSPQQCEDKFNDLN  163



>ref|XP_009404390.1| PREDICTED: uncharacterized protein LOC103987728 [Musa acuminata 
subsp. malaccensis]
Length=547

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 64/100 (64%), Gaps = 16/100 (16%)
 Frame = -3

Query  252  PWQRMKWTDNMVRLLIMVVYYIGDEV----------------GSEGNINDPagnkkkaag  121
            PWQRMKWTD MVRLLI VVY +GD+                 G + +    A +   +A 
Sbjct  125  PWQRMKWTDGMVRLLIQVVYRVGDDGGGAEGEQQQPQGSVAKGKKSSSAAAAASASASAS  184

Query  120  gggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                 ++QKKGKWKSVSRAMM++GF+VSPQQCEDKFNDLN
Sbjct  185  ASASALLQKKGKWKSVSRAMMDKGFFVSPQQCEDKFNDLN  224



>ref|XP_008782906.1| PREDICTED: uncharacterized protein LOC103702316 [Phoenix dactylifera]
Length=412

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 67/125 (54%), Gaps = 7/125 (6%)
 Frame = -3

Query  369  YPSGNKPK--PTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVV  196
            YPS N       P    S + +  G  +  ++     +K  PWQRMKWTD +VRLLI +V
Sbjct  71   YPSANSENDDQLPAAAASAEGNGHGQQSLASAGAGQGKKGSPWQRMKWTDEVVRLLIRIV  130

Query  195  YYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDK  16
             ++GD+   E            AA    G   QKKGKWK VS  M E G YVSPQQCEDK
Sbjct  131  AFVGDDCAYEA-----VDGTAGAAKRKHGAAFQKKGKWKMVSLLMQENGAYVSPQQCEDK  185

Query  15   FNDLN  1
            FND+N
Sbjct  186  FNDMN  190



>ref|XP_008227154.1| PREDICTED: uncharacterized protein LOC103326696 [Prunus mume]
Length=449

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 11/113 (10%)
 Frame = -3

Query  336  GLTLSDDNDPGGPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGN  160
            G  LSD+++P        + +  K +K  PWQRMKWTDN+VRLLI +V  +GD+   E  
Sbjct  88   GYNLSDEDEPSYTDDGGENFEGAKGKKGSPWQRMKWTDNVVRLLIAIVACVGDDGTLESG  147

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                             G++QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  148  ----------EGLKRKSGILQKKGKWKTVSKIMISKGCHVSPQQCEDKFNDLN  190



>ref|XP_007212531.1| hypothetical protein PRUPE_ppa019358mg, partial [Prunus persica]
 gb|EMJ13730.1| hypothetical protein PRUPE_ppa019358mg, partial [Prunus persica]
Length=402

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 11/113 (10%)
 Frame = -3

Query  336  GLTLSDDNDPGGPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGN  160
            G  LSD+++P        + +  K +K  PWQRMKWTDN+VRLLI +V  +GD+   E  
Sbjct  64   GYNLSDEDEPSYTDDGGENFEGAKGKKGSPWQRMKWTDNVVRLLIAIVACVGDDGTLESG  123

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                             G++QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  124  ----------EGLKRKSGILQKKGKWKTVSKIMISKGCHVSPQQCEDKFNDLN  166



>ref|XP_009355179.1| PREDICTED: myb/SANT-like DNA-binding domain-containing protein 
4 [Pyrus x bretschneideri]
Length=449

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 70/113 (62%), Gaps = 13/113 (12%)
 Frame = -3

Query  336  GLTLSDDNDPGGPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGN  160
            G  LSDD++      D  S++  K +K   WQRMKWTDN+VRLLI VV  +GD+   EG 
Sbjct  90   GYNLSDDDEQN--YTDDESIEGAKGKKGSRWQRMKWTDNVVRLLIDVVACVGDDGSDEGG  147

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                             G++QKKGKWK++S+ M+ +G +VSPQQCEDKFNDLN
Sbjct  148  ----------EGLKRKSGILQKKGKWKTLSQIMISKGCHVSPQQCEDKFNDLN  190



>gb|EAY82367.1| hypothetical protein OsI_37579 [Oryza sativa Indica Group]
Length=432

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 65/110 (59%), Gaps = 11/110 (10%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            ++SDD + G      +S     +K   WQRMKWTD+MV+LLI  V Y G++ G++     
Sbjct  77   SMSDDEEHGVNEDATDSQSGKGKKGAAWQRMKWTDSMVKLLITAVSYTGEDPGADSGAG-  135

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                           +MQKKGKWK++S+ M ERG  VSPQQCEDKFNDLN
Sbjct  136  ----------KRNSAIMQKKGKWKAISKVMGERGCSVSPQQCEDKFNDLN  175



>ref|NP_177813.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51150.1|AC079283_7 hypothetical protein [Arabidopsis thaliana]
 dbj|BAH30377.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35897.1| uncharacterized protein AT1G76870 [Arabidopsis thaliana]
Length=385

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 16/84 (19%)
 Frame = -3

Query  252  PWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSV  73
            PWQR+KW D MV+L+I  + YIG++ GS+                    V+QKKGKW+SV
Sbjct  82   PWQRVKWMDKMVKLMITALSYIGEDSGSDKKF----------------AVLQKKGKWRSV  125

Query  72   SRAMMERGFYVSPQQCEDKFNDLN  1
            S+ M ERG++VSPQQCEDKFNDLN
Sbjct  126  SKVMDERGYHVSPQQCEDKFNDLN  149



>ref|XP_004486956.1| PREDICTED: uncharacterized protein LOC101493778 isoform X1 [Cicer 
arietinum]
Length=444

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 12/120 (10%)
 Frame = -3

Query  354  KPKPTPGLTLSDDNDPG-GPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGD  181
            K K      LS+D++ G     +  + D GK +K  PWQRMKWTDN+V LLI VV  +GD
Sbjct  72   KGKAIAEDDLSEDDEHGYAEDGNCENFDGGKGKKGSPWQRMKWTDNVVGLLIAVVSCVGD  131

Query  180  EVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            + G+ G ++               GV+QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  132  D-GTIGGVD---------GVKRKSGVLQKKGKWKTVSKIMISKGCHVSPQQCEDKFNDLN  181



>ref|NP_564136.1| sequence-specific DNA binding transcription factor [Arabidopsis 
thaliana]
 gb|AAF81362.1|AC036104_11 Contains weak similarity to DNA-binding protein (GT-1a) from 
Nicotiana tabacum gb|M93436 [Arabidopsis thaliana]
 gb|AAK76524.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14317.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30074.1| sequence-specific DNA binding transcription factor [Arabidopsis 
thaliana]
Length=443

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 69/113 (61%), Gaps = 15/113 (13%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSV-DDGKR--KMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGN  160
            ++SDD++P       + V ++  R  K  PWQR+KWTD MV+LLI  V YIG        
Sbjct  84   SVSDDDEPSFTEEGGDGVHNEANRSTKGSPWQRVKWTDKMVKLLITAVSYIG--------  135

Query  159  INDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                  +   ++      V+QKKGKWKSVS+ M ERG++VSPQQCEDKFNDLN
Sbjct  136  ----DDSSIDSSSRRKFAVLQKKGKWKSVSKVMAERGYHVSPQQCEDKFNDLN  184



>ref|NP_001066231.1| Os12g0163500 [Oryza sativa Japonica Group]
 gb|ABA95865.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29250.1| Os12g0163500 [Oryza sativa Japonica Group]
 gb|EAZ19746.1| hypothetical protein OsJ_35324 [Oryza sativa Japonica Group]
 dbj|BAG95902.1| unnamed protein product [Oryza sativa Japonica Group]
Length=432

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 12/107 (11%)
 Frame = -3

Query  318  DNDPGGPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPag  142
            D++  G   D      GK +K   WQRMKWTD+MV+LLI  V Y G++ G++        
Sbjct  80   DDEEHGVNEDATDSQSGKGKKGAAWQRMKWTDSMVKLLITAVSYTGEDPGADSGAG----  135

Query  141  nkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                        +MQKKGKWK++S+ M ERG  VSPQQCEDKFNDLN
Sbjct  136  -------KRNSAIMQKKGKWKAISKVMGERGCSVSPQQCEDKFNDLN  175



>ref|XP_004486957.1| PREDICTED: uncharacterized protein LOC101493778 isoform X2 [Cicer 
arietinum]
Length=401

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 12/120 (10%)
 Frame = -3

Query  354  KPKPTPGLTLSDDNDPG-GPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGD  181
            K K      LS+D++ G     +  + D GK +K  PWQRMKWTDN+V LLI VV  +GD
Sbjct  29   KGKAIAEDDLSEDDEHGYAEDGNCENFDGGKGKKGSPWQRMKWTDNVVGLLIAVVSCVGD  88

Query  180  EVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            + G+ G ++               GV+QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  89   D-GTIGGVD---------GVKRKSGVLQKKGKWKTVSKIMISKGCHVSPQQCEDKFNDLN  138



>emb|CDP19340.1| unnamed protein product [Coffea canephora]
Length=468

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 12/109 (11%)
 Frame = -3

Query  324  SDDNDPGGPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDP  148
            SD++DP     +      GK +K  PW RMKWTD++VRLLI VV  +G++  SEG     
Sbjct  102  SDEDDPSMAEGNGRDTGGGKGKKDAPWVRMKWTDSIVRLLIQVVANVGEDGPSEG-----  156

Query  147  agnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                  A G      + KKGKW+ VS+ +M +G  VSPQQCEDKFNDLN
Sbjct  157  ------AEGARRKSGIIKKGKWRKVSKVLMSKGLCVSPQQCEDKFNDLN  199



>gb|KHN30131.1| hypothetical protein glysoja_010509 [Glycine soja]
Length=439

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 67/117 (57%), Gaps = 12/117 (10%)
 Frame = -3

Query  345  PTPGLTLSDDNDPG-GPTADQNSVDDG-KRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVG  172
            P+    LS++++P      +  ++D G  +K  PWQRMKWTDN+VRLLI VV  +GD+ G
Sbjct  70   PSNSNELSEEDEPSYAEEGNCENLDGGNSKKGSPWQRMKWTDNVVRLLITVVSCVGDD-G  128

Query  171  SEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            + G ++            G   +         VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  129  TIGGMDGHKRKSGVLQKKGKWKM---------VSKIMIGKGCHVSPQQCEDKFNDLN  176



>ref|XP_002299233.2| hypothetical protein POPTR_0001s05670g, partial [Populus trichocarpa]
 gb|EEE84038.2| hypothetical protein POPTR_0001s05670g, partial [Populus trichocarpa]
Length=417

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 62/96 (65%), Gaps = 10/96 (10%)
 Frame = -3

Query  288  QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggg  109
            +NS     +K  PWQRMKWTDN+VRLLI VV  +GD    +G +N               
Sbjct  77   ENSTGVKGKKGSPWQRMKWTDNVVRLLIAVVACVGD----DGTLN------AVEGLKRKS  126

Query  108  gvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            G++QKKGKWK VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  127  GLLQKKGKWKMVSKLMISKGCHVSPQQCEDKFNDLN  162



>ref|XP_011037822.1| PREDICTED: uncharacterized protein LOC105134921 [Populus euphratica]
 ref|XP_011037823.1| PREDICTED: uncharacterized protein LOC105134921 [Populus euphratica]
 ref|XP_011037824.1| PREDICTED: uncharacterized protein LOC105134921 [Populus euphratica]
Length=459

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 62/96 (65%), Gaps = 10/96 (10%)
 Frame = -3

Query  288  QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggg  109
            +NS     +K  PWQRMKWTDN+VRLLI VV  +GD    +G +N               
Sbjct  106  ENSTGVKGKKGSPWQRMKWTDNVVRLLIAVVACVGD----DGTLN------AVEGLKRKS  155

Query  108  gvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            G++QKKGKWK VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  156  GLLQKKGKWKMVSKLMISKGCHVSPQQCEDKFNDLN  191



>gb|AAX95104.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABA91672.1| expressed protein [Oryza sativa Japonica Group]
 gb|EEE51699.1| hypothetical protein OsJ_33071 [Oryza sativa Japonica Group]
Length=435

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 11/97 (11%)
 Frame = -3

Query  291  DQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaagggg  112
            ++++ D   +K  PW RMKWTD+MV+LLI  V Y G++ G++              G   
Sbjct  96   NEDAADGKDKKGSPWHRMKWTDSMVKLLITAVSYTGEDPGAD-----------LGGGRRN  144

Query  111  ggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
              +MQKKGKWK++S+ M ERG +VSPQQCEDKFNDLN
Sbjct  145  YSMMQKKGKWKAISKVMGERGCHVSPQQCEDKFNDLN  181



>ref|XP_006663843.1| PREDICTED: uncharacterized protein LOC102711209 isoform X1 [Oryza 
brachyantha]
 ref|XP_006663844.1| PREDICTED: uncharacterized protein LOC102711209 isoform X2 [Oryza 
brachyantha]
 ref|XP_006663845.1| PREDICTED: uncharacterized protein LOC102711209 isoform X3 [Oryza 
brachyantha]
Length=446

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 11/109 (10%)
 Frame = -3

Query  327  LSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDP  148
            +SDD D G      +S     +K   W RMKWTD+MV+LLI  V Y G++ G++      
Sbjct  92   MSDDEDHGVNEDATDSQSGKGKKGAAWHRMKWTDSMVKLLITAVSYTGEDPGADSG----  147

Query  147  agnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                   +G     +MQKKGKWK++S+ M ERG  VSPQQCEDKFNDLN
Sbjct  148  -------SGRRNSAIMQKKGKWKAISKVMGERGCSVSPQQCEDKFNDLN  189



>ref|XP_009343631.1| PREDICTED: uncharacterized protein LOC103935584 [Pyrus x bretschneideri]
Length=447

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 67/111 (60%), Gaps = 11/111 (10%)
 Frame = -3

Query  330  TLSDDNDPGG-PTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIN  154
            + SD+++P      D ++     +K  PWQR+KWTD MV+LLI  V YIG++  S+    
Sbjct  90   SASDEDEPSYVEEGDGHAEASRGKKGSPWQRVKWTDQMVKLLITAVSYIGEDTSSDCG--  147

Query  153  DPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                      G     V+QKKGKWKSVS+ M ER + VSPQQCEDKFNDLN
Sbjct  148  --------GGGRRKYSVLQKKGKWKSVSKVMAERSYRVSPQQCEDKFNDLN  190



>gb|EAY80056.1| hypothetical protein OsI_35222 [Oryza sativa Indica Group]
Length=435

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 11/97 (11%)
 Frame = -3

Query  291  DQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaagggg  112
            ++++ D   +K  PW RMKWTD+MV+LLI  V Y G++ G++              G   
Sbjct  96   NEDAADGKDKKGSPWHRMKWTDSMVKLLITAVSYTGEDPGAD-----------LGGGRRN  144

Query  111  ggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
              +MQKKGKWK++S+ M ERG +VSPQQCEDKFNDLN
Sbjct  145  YSMMQKKGKWKAISKVMGERGCHVSPQQCEDKFNDLN  181



>ref|XP_010102326.1| hypothetical protein L484_015274 [Morus notabilis]
 gb|EXB93287.1| hypothetical protein L484_015274 [Morus notabilis]
Length=452

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 70/117 (60%), Gaps = 18/117 (15%)
 Frame = -3

Query  336  GLTLSDDNDPGGPTADQNSVDDG--KRKMCPWQRMKWTDNMVRLLIMVVYYIGDE---VG  172
            G  LS++++P           DG   +K  PWQRMKWTDN+V+LLI VV  +GD+    G
Sbjct  87   GYNLSEEDEPSYMEDGSGENFDGVKGKKGSPWQRMKWTDNVVKLLIAVVACVGDDGMVAG  146

Query  171  SEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
             EG                  G++QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  147  GEG-------------LKRKSGILQKKGKWKTVSKIMISKGCHVSPQQCEDKFNDLN  190



>ref|XP_010913949.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
TAO2-like [Elaeis guineensis]
Length=432

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 63/114 (55%), Gaps = 16/114 (14%)
 Frame = -3

Query  324  SDDNDPGGPTADQNSVDDGK------RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEG  163
            SDD+DP    A Q +  + +      +K  PWQRMKWTD +VRLLI +V ++GD+   E 
Sbjct  78   SDDDDPLPGAAVQENGHEQQTGTGPGKKGSPWQRMKWTDEVVRLLIRIVAFVGDDCAQEA  137

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                             G   QKKGKWK VS  M E G  VSPQQCEDKFNDLN
Sbjct  138  ----------VDGKRKHGAAFQKKGKWKMVSLLMQENGASVSPQQCEDKFNDLN  181



>ref|NP_001065831.1| Os11g0163500 [Oryza sativa Japonica Group]
 gb|AAX95102.1| expressed protein [Oryza sativa Japonica Group]
 gb|AAX95103.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABA91670.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABA91671.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27676.1| Os11g0163500 [Oryza sativa Japonica Group]
 dbj|BAG94929.1| unnamed protein product [Oryza sativa Japonica Group]
Length=483

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 11/97 (11%)
 Frame = -3

Query  291  DQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaagggg  112
            ++++ D   +K  PW RMKWTD+MV+LLI  V Y G++ G++              G   
Sbjct  144  NEDAADGKDKKGSPWHRMKWTDSMVKLLITAVSYTGEDPGAD-----------LGGGRRN  192

Query  111  ggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
              +MQKKGKWK++S+ M ERG +VSPQQCEDKFNDLN
Sbjct  193  YSMMQKKGKWKAISKVMGERGCHVSPQQCEDKFNDLN  229



>ref|NP_001170044.1| hypothetical protein [Zea mays]
 ref|XP_008677660.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008677661.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN35616.1| unknown [Zea mays]
 gb|AFW65617.1| hypothetical protein ZEAMMB73_122216 [Zea mays]
 gb|AFW65618.1| hypothetical protein ZEAMMB73_122216 [Zea mays]
 gb|AFW65619.1| hypothetical protein ZEAMMB73_122216 [Zea mays]
 gb|AIB05439.1| trihelix transcription factor [Zea mays]
Length=436

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 56/88 (64%), Gaps = 11/88 (13%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K   W RMKWTD+MV+LLI  V Y GD+ G++              G     + QKKGK
Sbjct  110  KKGSAWHRMKWTDSMVKLLITAVSYTGDDHGADSG-----------GGRRNIAITQKKGK  158

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK++S+ M ERG +VSPQQCEDKFNDLN
Sbjct  159  WKAISKVMGERGCHVSPQQCEDKFNDLN  186



>ref|XP_008677662.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=426

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 56/88 (64%), Gaps = 11/88 (13%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K   W RMKWTD+MV+LLI  V Y GD+ G++              G     + QKKGK
Sbjct  100  KKGSAWHRMKWTDSMVKLLITAVSYTGDDHGADSG-----------GGRRNIAITQKKGK  148

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK++S+ M ERG +VSPQQCEDKFNDLN
Sbjct  149  WKAISKVMGERGCHVSPQQCEDKFNDLN  176



>ref|XP_002449041.1| hypothetical protein SORBIDRAFT_05g003890 [Sorghum bicolor]
 gb|EES08029.1| hypothetical protein SORBIDRAFT_05g003890 [Sorghum bicolor]
Length=431

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 11/88 (13%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K   W RMKWTD+MV+LLI  V Y GD+ G++              G     +MQKKGK
Sbjct  109  KKGSAWHRMKWTDSMVKLLITAVSYTGDDHGADSG-----------GGRKNFTIMQKKGK  157

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK++S+ M ERG +VSPQQCEDKFNDLN
Sbjct  158  WKAISKVMGERGCHVSPQQCEDKFNDLN  185



>gb|ACR35490.1| unknown [Zea mays]
Length=360

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 11/88 (13%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K   W RMKWTD+MV+LLI  V Y GD+ G++              G     +MQKKGK
Sbjct  33   KKGSAWHRMKWTDSMVKLLITAVSYTGDDHGADSG-----------GGRRNFTIMQKKGK  81

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK++S+ M ERG +VSPQQCEDKFNDLN
Sbjct  82   WKAISKVMGERGCHVSPQQCEDKFNDLN  109



>ref|XP_011087822.1| PREDICTED: uncharacterized protein LOC105169180 [Sesamum indicum]
 ref|XP_011087823.1| PREDICTED: uncharacterized protein LOC105169180 [Sesamum indicum]
Length=379

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 51/83 (61%), Gaps = 21/83 (25%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVS  70
            WQR++WTD MVR+LI  V Y+GD+V S+  I                      GKW+++S
Sbjct  109  WQRIRWTDEMVRILIAAVSYVGDDVSSDCPIK---------------------GKWRAIS  147

Query  69   RAMMERGFYVSPQQCEDKFNDLN  1
              M+ERG+ VSPQQCEDKFNDLN
Sbjct  148  NIMVERGYTVSPQQCEDKFNDLN  170



>ref|XP_003542048.1| PREDICTED: uncharacterized protein LOC100801014 [Glycine max]
Length=439

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 12/117 (10%)
 Frame = -3

Query  345  PTPGLTLSDDNDPG-GPTADQNSVDDG-KRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVG  172
            P+    LS++++P      +  ++D G  +K  PWQRMKW DN+VRLLI VV  +GD+ G
Sbjct  70   PSNSNELSEEDEPSYAEEGNCENLDGGNSKKGSPWQRMKWADNVVRLLITVVSCVGDD-G  128

Query  171  SEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            + G ++            G   +         VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  129  TIGGMDGHKRKSGVLQKKGKWKM---------VSKIMIGKGCHVSPQQCEDKFNDLN  176



>ref|XP_008785828.1| PREDICTED: uncharacterized protein LOC103704355 [Phoenix dactylifera]
Length=438

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 58/110 (53%), Gaps = 13/110 (12%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            T  DD+   G      SV +  +K  PWQR+KWTD MV+LLI V+ Y+ ++  SE +I+ 
Sbjct  94   TSEDDDTEDGADLPNESVRE--KKAAPWQRVKWTDRMVKLLITVISYLNEDT-SELDISA  150

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                      G              VS+ M E+  YVSPQQCEDKFNDLN
Sbjct  151  KRKLTMLQKKGKWKL----------VSKVMAEKNCYVSPQQCEDKFNDLN  190



>ref|XP_008667671.1| PREDICTED: uncharacterized protein LOC100276786 isoform X1 [Zea 
mays]
Length=436

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 11/88 (13%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K   W RMKWTD+MV+LLI  V Y GD+ G++              G     +MQKKGK
Sbjct  109  KKGSAWHRMKWTDSMVKLLITAVSYTGDDHGADSG-----------GGRRNFTIMQKKGK  157

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK++S+ M ERG +VSPQQCEDKFNDLN
Sbjct  158  WKAISKVMGERGCHVSPQQCEDKFNDLN  185



>ref|XP_002303892.2| hypothetical protein POPTR_0003s20370g [Populus trichocarpa]
 gb|EEE78871.2| hypothetical protein POPTR_0003s20370g [Populus trichocarpa]
Length=425

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 62/96 (65%), Gaps = 10/96 (10%)
 Frame = -3

Query  288  QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggg  109
            +NS     ++  PWQRMKWTDN+VRLLI VV  +GD+   +G                  
Sbjct  77   ENSTGAKGKQGSPWQRMKWTDNIVRLLISVVACVGDDDTFDGT----------GGLKRKS  126

Query  108  gvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            G++QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  127  GLLQKKGKWKTVSKLMIGKGCHVSPQQCEDKFNDLN  162



>ref|NP_001143969.1| uncharacterized protein LOC100276786 [Zea mays]
 gb|ACG36810.1| hypothetical protein [Zea mays]
Length=436

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 11/88 (13%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K   W RMKWTD+MV+LLI  V Y GD+ G++              G     +MQKKGK
Sbjct  109  KKGSAWHRMKWTDSMVKLLITAVSYTGDDHGADSG-----------GGRRNFTIMQKKGK  157

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK++S+ M ERG +VSPQQCEDKFNDLN
Sbjct  158  WKAISKVMGERGCHVSPQQCEDKFNDLN  185



>ref|XP_007041596.1| Uncharacterized protein TCM_006441 [Theobroma cacao]
 gb|EOX97427.1| Uncharacterized protein TCM_006441 [Theobroma cacao]
Length=447

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 20/89 (22%)
 Frame = -3

Query  252  PWQRMKWTDNMVRLLIMVVYYIGDE-----VGSEGNINDPagnkkkaaggggggvmqkkg  88
            PWQRMKWT  MV+LLI ++ YIG++     VGS+  ++                +++K G
Sbjct  82   PWQRMKWTGKMVKLLITILSYIGEDPSTDCVGSQRKMS---------------SLLRKLG  126

Query  87   kwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            KWK VS+ M+ERG++VSPQQCEDKFN+LN
Sbjct  127  KWKCVSKVMVERGYHVSPQQCEDKFNNLN  155



>ref|XP_010236469.1| PREDICTED: uncharacterized protein LOC104584057 [Brachypodium 
distachyon]
Length=446

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 50/83 (60%), Gaps = 16/83 (19%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVS  70
            W R+KWTD MVRLLIMVVY  G    + G   +                  KKGKW+S S
Sbjct  97   WTRVKWTDAMVRLLIMVVYNAGPVEDASGAAAE----------------QGKKGKWRSAS  140

Query  69   RAMMERGFYVSPQQCEDKFNDLN  1
            +AM ERGF VSPQQCEDKFNDLN
Sbjct  141  QAMSERGFAVSPQQCEDKFNDLN  163



>ref|XP_010928865.1| PREDICTED: uncharacterized protein LOC105050511 [Elaeis guineensis]
Length=432

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 49/88 (56%), Gaps = 5/88 (6%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQRMKWTD +VRLLI +V  +GD+   E     P   K+K           K   
Sbjct  107  KKGSPWQRMKWTDEVVRLLIRIVALVGDDGAYEAVDGTPGAVKRKHGAAFQKKGKWKM--  164

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
               VS  M E G YVSPQQCEDKFND+N
Sbjct  165  ---VSLLMQENGAYVSPQQCEDKFNDMN  189



>ref|XP_010031815.1| PREDICTED: uncharacterized protein LOC104421532 [Eucalyptus grandis]
 gb|KCW51199.1| hypothetical protein EUGRSUZ_J00785 [Eucalyptus grandis]
Length=450

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 64/105 (61%), Gaps = 21/105 (20%)
 Frame = -3

Query  291  DQNSVDDG-------KRKMCPWQRMKWTDNMVRLLIMVVYYIGDE-VGSEGNINDPagnk  136
            D+ S DDG        +K  PW RMKWTD +VRLLI VV  +GD+ +  EG         
Sbjct  93   DEPSFDDGTGDSSGKSKKGSPWHRMKWTDEVVRLLIAVVACVGDDGIPEEG---------  143

Query  135  kkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                     G++QKKGKWK+VS+ M+ RG +VSPQQCEDKFNDLN
Sbjct  144  ----FRRKSGILQKKGKWKTVSKIMISRGCHVSPQQCEDKFNDLN  184



>ref|XP_004161693.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101205501 
[Cucumis sativus]
Length=443

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 58/92 (63%), Gaps = 20/92 (22%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDE----VGSEGNINDPagnkkkaaggggggvmq  97
            +K  PWQRMKWTD +VRLLI VV  +GD+    +GS+ N+                  + 
Sbjct  110  KKGSPWQRMKWTDEIVRLLIAVVACVGDDGEAGMGSKRNLG----------------XLH  153

Query  96   kkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            KKGKWK+VS+ M  +G +VSPQQCEDKFNDLN
Sbjct  154  KKGKWKTVSKIMQSKGCHVSPQQCEDKFNDLN  185



>ref|XP_002441874.1| hypothetical protein SORBIDRAFT_08g003990 [Sorghum bicolor]
 gb|EES15712.1| hypothetical protein SORBIDRAFT_08g003990 [Sorghum bicolor]
Length=447

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            ++SDD + G      +S     +K   W RMKWTD+MVRLLI    Y G++ G++     
Sbjct  89   SMSDDEEHGVHEDATDSQTSKGKKGSAWHRMKWTDSMVRLLITAASYAGEDPGAD-----  143

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                     G     +MQKKGKWK++S+ M ERG  VSPQQCEDKFNDLN
Sbjct  144  ------LGGGRRSCAMMQKKGKWKAISKVMGERGCLVSPQQCEDKFNDLN  187



>ref|XP_002513474.1| transcription factor, putative [Ricinus communis]
 gb|EEF48877.1| transcription factor, putative [Ricinus communis]
Length=454

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 71/118 (60%), Gaps = 14/118 (12%)
 Frame = -3

Query  345  PTPGLTLSDDNDPGGPTAD---QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEV  175
            PT    +S+D++P   T D    NS     +K  PWQRMKWTDN+VRLLI VV  +GD+ 
Sbjct  85   PTNDGNVSEDDEPS-FTEDGNGDNSSGAKSKKGSPWQRMKWTDNVVRLLIAVVACVGDDG  143

Query  174  GSEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
              +G                  G++QKKGKWK+VS+ ++ +G +VSPQQ EDKFNDLN
Sbjct  144  AFDG----------VEGLKRKSGILQKKGKWKTVSKILISKGCHVSPQQSEDKFNDLN  191



>gb|EMS59212.1| hypothetical protein TRIUR3_11128 [Triticum urartu]
Length=436

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            ++SDD + G      +S     +K   WQRMKWTD+MV+LLI    Y G++ G++     
Sbjct  87   SMSDDEEHGLNEDTTDSHSSKGKKGSAWQRMKWTDSMVKLLITAASYTGEDPGADLGCG-  145

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                           ++ KKGKWK++S+ M ERG  VSPQQCEDKFNDLN
Sbjct  146  ----------RRNCAMVHKKGKWKAISKVMGERGCNVSPQQCEDKFNDLN  185



>ref|NP_001142484.1| uncharacterized protein LOC100274707 [Zea mays]
 gb|ACG24316.1| hypothetical protein [Zea mays]
Length=446

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 66/111 (59%), Gaps = 13/111 (12%)
 Frame = -3

Query  330  TLSDDNDPG-GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIN  154
            ++SDD + G    A  + +  GK K   W RMKWTD+MVRLLI    Y G++ G++    
Sbjct  89   SMSDDEEHGVHEDATDSQIGKGK-KGSAWHRMKWTDSMVRLLITAASYTGEDPGAD----  143

Query  153  DPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                      G     +MQKKGKWK++S+ M ERG  VSPQQCEDKFNDLN
Sbjct  144  -------LGGGRRSCAMMQKKGKWKAISKVMGERGCLVSPQQCEDKFNDLN  187



>gb|EMT09164.1| hypothetical protein F775_06500 [Aegilops tauschii]
Length=442

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            ++SDD + G      +S     +K   WQRMKWTD+MV+LLI    Y G++ G++     
Sbjct  87   SMSDDEEHGLNEDTTDSHSGKGKKGSAWQRMKWTDSMVKLLITAASYTGEDPGADLGCG-  145

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                           ++ KKGKWK++S+ M ERG  VSPQQCEDKFNDLN
Sbjct  146  ----------RRNCAMVHKKGKWKAISKVMGERGCNVSPQQCEDKFNDLN  185



>ref|XP_008661671.1| PREDICTED: uncharacterized protein LOC100274707 isoform X1 [Zea 
mays]
 ref|XP_008661672.1| PREDICTED: uncharacterized protein LOC100274707 isoform X1 [Zea 
mays]
 gb|AFW56163.1| hypothetical protein ZEAMMB73_082916 [Zea mays]
 gb|AIB05440.1| trihelix transcription factor [Zea mays]
Length=446

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 66/111 (59%), Gaps = 13/111 (12%)
 Frame = -3

Query  330  TLSDDNDPG-GPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIN  154
            ++SDD + G    A  + +  GK K   W RMKWTD+MVRLLI    Y G++ G++    
Sbjct  89   SMSDDEEHGVHEDATDSQIGKGK-KGSTWHRMKWTDSMVRLLITAASYTGEDPGAD----  143

Query  153  DPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                      G     +MQKKGKWK++S+ M ERG  VSPQQCEDKFNDLN
Sbjct  144  -------LGGGRRSCAMMQKKGKWKAISKVMGERGCLVSPQQCEDKFNDLN  187



>ref|XP_008441519.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103485620 
[Cucumis melo]
Length=449

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 15/105 (14%)
 Frame = -3

Query  300  PTADQNSVDDGK-----RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnk  136
            P+ +++S+D        +K   W R+KWTD MV+LLI  V YIGD++ S+          
Sbjct  94   PSFNEDSIDGHNENSKGKKGSMWHRVKWTDKMVKLLITAVSYIGDDIASD----------  143

Query  135  kkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
               +G     ++QKKGKWK +S+ + ERG+ VSPQQCEDKFNDLN
Sbjct  144  IDGSGRRKCQIIQKKGKWKLISKVIAERGYQVSPQQCEDKFNDLN  188



>emb|CDX74006.1| BnaA03g30410D [Brassica napus]
Length=141

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = -3

Query  369  YPSGNKPKPTPGLTLSDDNDPGGPTAD----QNSV-DDGKRKMCPWQRMKWTDNMVRLLI  205
            YP  +K      L+  DD D G  +      ++SV  DGKR++ PW RMKWTD MVRLLI
Sbjct  52   YPRSSKAMQLSPLSGGDDEDRGSGSGSGCHPEDSVGTDGKRRVSPWHRMKWTDTMVRLLI  111

Query  204  MVVYYIGDE  178
            M VYYIGDE
Sbjct  112  MAVYYIGDE  120



>gb|KDP22075.1| hypothetical protein JCGZ_25906 [Jatropha curcas]
Length=455

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 10/83 (12%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVS  70
            WQRMKWTDN+VRLLI +V  +GD+   EG                  G++QKKGKWK+VS
Sbjct  119  WQRMKWTDNIVRLLIAIVACVGDDGPFEG----------VEGLKRKSGILQKKGKWKTVS  168

Query  69   RAMMERGFYVSPQQCEDKFNDLN  1
            + M+ +G +VSPQQCEDKFNDLN
Sbjct  169  KMMISKGCHVSPQQCEDKFNDLN  191



>ref|XP_004160309.1| PREDICTED: uncharacterized protein LOC101232034 [Cucumis sativus]
Length=449

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 64/105 (61%), Gaps = 15/105 (14%)
 Frame = -3

Query  300  PTADQNSVDDGK-----RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnk  136
            P+ +++S+D        +K   W R+KWTD MV+LLI  V YIGD++ S+          
Sbjct  94   PSFNEDSIDGHNENSKGKKGSMWHRVKWTDKMVKLLITAVSYIGDDIASD----------  143

Query  135  kkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                G     ++QKKGKWK +S+ + ERG+ VSPQQCEDKFNDLN
Sbjct  144  IDGGGRRKCQIIQKKGKWKLISKVIAERGYQVSPQQCEDKFNDLN  188



>ref|XP_003597439.1| hypothetical protein MTR_2g098080 [Medicago truncatula]
 gb|AES67690.1| transcription factor [Medicago truncatula]
Length=445

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 73/112 (65%), Gaps = 13/112 (12%)
 Frame = -3

Query  327  LSDDNDPG-GPTAD-QNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNI  157
            +S+D++ G G   + +N  D GK +K  PWQRMKWTDN+V LLI VV  +G++    G I
Sbjct  81   MSEDDEHGYGEDGNCENFFDGGKGKKGSPWQRMKWTDNVVGLLIAVVSCVGED----GTI  136

Query  156  NDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            +               GV+QKKGKWK+VS+ M+ +G +VSPQQCEDKFNDLN
Sbjct  137  S------GVDGVKRKSGVVQKKGKWKTVSKIMISKGCHVSPQQCEDKFNDLN  182



>gb|KEH25858.1| transcription factor [Medicago truncatula]
Length=526

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 57/88 (65%), Gaps = 10/88 (11%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQR+KWTD MVRLLI  V Y          I +   ++  + G     V+QKKGK
Sbjct  110  KKGSPWQRVKWTDKMVRLLITAVSY----------IGEDGSSEGGSGGRRKFAVLQKKGK  159

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WKS+S+ M ERG+ VSPQQCEDKFNDLN
Sbjct  160  WKSISKVMAERGYRVSPQQCEDKFNDLN  187



>ref|XP_004140967.1| PREDICTED: uncharacterized protein LOC101203313 [Cucumis sativus]
 gb|KGN46144.1| hypothetical protein Csa_6G057100 [Cucumis sativus]
Length=449

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 64/105 (61%), Gaps = 15/105 (14%)
 Frame = -3

Query  300  PTADQNSVDDGK-----RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnk  136
            P+ +++S+D        +K   W R+KWTD MV+LLI  V YIGD++ S+          
Sbjct  94   PSFNEDSIDGHNENSKGKKGSMWHRVKWTDKMVKLLITAVSYIGDDIASD----------  143

Query  135  kkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                G     ++QKKGKWK +S+ + ERG+ VSPQQCEDKFNDLN
Sbjct  144  IDGGGRRKCQIIQKKGKWKLISKVIAERGYQVSPQQCEDKFNDLN  188



>ref|XP_004142119.1| PREDICTED: uncharacterized protein LOC101205501 [Cucumis sativus]
 gb|KGN54170.1| hypothetical protein Csa_4G290850 [Cucumis sativus]
Length=443

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 56/88 (64%), Gaps = 12/88 (14%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQRMKWTD +VRLLI VV  +GD+ G  G                  G++ KKGK
Sbjct  110  KKGSPWQRMKWTDEIVRLLIAVVACVGDD-GEAG-----------MGSKRKSGILHKKGK  157

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK+VS+ M  +G +VSPQQCEDKFNDLN
Sbjct  158  WKTVSKIMQSKGCHVSPQQCEDKFNDLN  185



>ref|XP_008449727.1| PREDICTED: uncharacterized protein LOC103491522 [Cucumis melo]
Length=446

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 56/88 (64%), Gaps = 12/88 (14%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQRMKWTD +VRLLI VV  +GD+ G  G                  G++ KKGK
Sbjct  110  KKGSPWQRMKWTDEIVRLLIAVVACVGDD-GEAG-----------MGSKRKSGILHKKGK  157

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            W++VS+ M  +G +VSPQQCEDKFNDLN
Sbjct  158  WRTVSKIMQSKGCHVSPQQCEDKFNDLN  185



>ref|XP_010927385.1| PREDICTED: uncharacterized protein LOC105049444 [Elaeis guineensis]
Length=441

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 57/108 (53%), Gaps = 16/108 (15%)
 Frame = -3

Query  321  DDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIG-DEVGSEGNINDPa  145
            DD + G   AD ++ D+  +K  PW R+KWTD MV+LLI V+ Y+  D V  +G+     
Sbjct  99   DDTEDG---ADGHNEDERGKKAAPWHRVKWTDAMVKLLITVISYLNEDTVELDGSAKKKL  155

Query  144  gnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
               +K                  VS+ M ER   VSPQQCEDKFNDLN
Sbjct  156  AVLQKKGKWKL------------VSKVMAERNCCVSPQQCEDKFNDLN  191



>ref|XP_003637928.1| hypothetical protein MTR_113s0014 [Medicago truncatula]
Length=563

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 57/88 (65%), Gaps = 10/88 (11%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K  PWQR+KWTD MVRLLI  V Y          I +   ++  + G     V+QKKGK
Sbjct  110  KKGSPWQRVKWTDKMVRLLITAVSY----------IGEDGSSEGGSGGRRKFAVLQKKGK  159

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WKS+S+ M ERG+ VSPQQCEDKFNDLN
Sbjct  160  WKSISKVMAERGYRVSPQQCEDKFNDLN  187



>ref|XP_004978760.1| PREDICTED: uncharacterized protein LOC101780231 isoform X1 [Setaria 
italica]
 ref|XP_004978761.1| PREDICTED: uncharacterized protein LOC101780231 isoform X2 [Setaria 
italica]
Length=434

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 57/91 (63%), Gaps = 17/91 (19%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSE---GNINDPagnkkkaaggggggvmqk  94
            +K   W RMKWTD+MV+LLI  V Y GD+ G++   G  N                +MQK
Sbjct  106  KKASMWHRMKWTDSMVKLLITAVSYTGDDHGADLGGGRRN--------------STIMQK  151

Query  93   kgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            KGKWK++S+ M ER  +VSPQQCEDKFNDLN
Sbjct  152  KGKWKAISKVMGERDCHVSPQQCEDKFNDLN  182



>ref|XP_010911980.1| PREDICTED: uncharacterized protein LOC105038013 [Elaeis guineensis]
 ref|XP_010911981.1| PREDICTED: uncharacterized protein LOC105038013 [Elaeis guineensis]
Length=431

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 11/89 (12%)
 Frame = -3

Query  267  KRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkg  88
            ++K  PWQR+KWTD MV+LLI V+ Y+ +E  +E N          ++      ++QKKG
Sbjct  105  EKKAAPWQRVKWTDRMVKLLITVISYL-NEDATELN----------SSAKRKLTMLQKKG  153

Query  87   kwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            KWK VS+ M E+  YVSPQQCEDKFNDLN
Sbjct  154  KWKLVSKVMAEKNCYVSPQQCEDKFNDLN  182



>ref|XP_004977312.1| PREDICTED: uncharacterized protein LOC101777650 isoform X1 [Setaria 
italica]
 ref|XP_004977313.1| PREDICTED: uncharacterized protein LOC101777650 isoform X2 [Setaria 
italica]
 ref|XP_004977314.1| PREDICTED: uncharacterized protein LOC101777650 isoform X3 [Setaria 
italica]
Length=446

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 65/111 (59%), Gaps = 12/111 (11%)
 Frame = -3

Query  333  LTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIN  154
            +++SDD + G      +S     +K   W RMKWTD+MV+LLI    Y G++ G++    
Sbjct  86   ISMSDDEEHGVNEDATDSQTGKGKKGSAWHRMKWTDSMVKLLITAASYTGEDPGADSG--  143

Query  153  DPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                      G     +MQKKGKWK++S+ M +RG  VSPQQCEDKFNDLN
Sbjct  144  ----------GRRNCAMMQKKGKWKAISKVMGQRGCLVSPQQCEDKFNDLN  184



>ref|XP_009798604.1| PREDICTED: uncharacterized protein LOC104244809 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009798605.1| PREDICTED: uncharacterized protein LOC104244809 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009798606.1| PREDICTED: uncharacterized protein LOC104244809 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009798607.1| PREDICTED: uncharacterized protein LOC104244809 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009798608.1| PREDICTED: uncharacterized protein LOC104244809 isoform X2 [Nicotiana 
sylvestris]
Length=372

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 52/83 (63%), Gaps = 19/83 (23%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVS  70
            + RMKWTD MV+LLI  V YIG++V S G                   +  KKGKW+++S
Sbjct  95   YSRMKWTDEMVKLLITAVSYIGEDVWSNG-------------------IFPKKGKWRAIS  135

Query  69   RAMMERGFYVSPQQCEDKFNDLN  1
             AM ERG +VSPQQCEDKFNDLN
Sbjct  136  NAMAERGHHVSPQQCEDKFNDLN  158



>gb|EAY73746.1| hypothetical protein OsI_01620 [Oryza sativa Indica Group]
Length=284

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 55/98 (56%), Gaps = 13/98 (13%)
 Frame = -3

Query  255  CPWQRMKWTDNMVRLLIMVVY-------------YIGDEVGSEGNINDPagnkkkaaggg  115
            CPW RMKWTD MVRLLI VVY               G +  +    +  AG        G
Sbjct  77   CPWTRMKWTDGMVRLLINVVYSVGDDGDGVAAGGAAGGKASAGAAGHGKAGGSGSHGAHG  136

Query  114  gggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                 QKKGKWKSVSRAMME G  VSPQQCEDKFNDLN
Sbjct  137  QAAAQQKKGKWKSVSRAMMESGHMVSPQQCEDKFNDLN  174



>gb|EEE54438.1| hypothetical protein OsJ_01511 [Oryza sativa Japonica Group]
Length=264

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 55/98 (56%), Gaps = 13/98 (13%)
 Frame = -3

Query  255  CPWQRMKWTDNMVRLLIMVVY-------------YIGDEVGSEGNINDPagnkkkaaggg  115
            CPW RMKWTD MVRLLI VVY               G +  +    +  AG        G
Sbjct  22   CPWTRMKWTDGMVRLLINVVYSVGDDGDGVAAGGAAGGKASAGAAGHGKAGGSGSHGAHG  81

Query  114  gggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                 QKKGKWKSVSRAMME G  VSPQQCEDKFNDLN
Sbjct  82   QAAAQQKKGKWKSVSRAMMESGHMVSPQQCEDKFNDLN  119



>ref|XP_006662760.1| PREDICTED: uncharacterized protein LOC102703623 [Oryza brachyantha]
Length=433

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 57/88 (65%), Gaps = 11/88 (13%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K   W RMKWTD+MV+LLI  V Y G++ G++              G     +MQKKGK
Sbjct  105  KKGTAWHRMKWTDSMVKLLITAVSYTGEDPGAD-----------FGGGRRNYSMMQKKGK  153

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK++S+ M ERG +VSPQQCEDKFNDLN
Sbjct  154  WKAISKVMGERGCHVSPQQCEDKFNDLN  181



>ref|XP_009798603.1| PREDICTED: uncharacterized protein LOC104244809 isoform X1 [Nicotiana 
sylvestris]
Length=390

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 52/83 (63%), Gaps = 19/83 (23%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVS  70
            + RMKWTD MV+LLI  V YIG++V S G                   +  KKGKW+++S
Sbjct  113  YSRMKWTDEMVKLLITAVSYIGEDVWSNG-------------------IFPKKGKWRAIS  153

Query  69   RAMMERGFYVSPQQCEDKFNDLN  1
             AM ERG +VSPQQCEDKFNDLN
Sbjct  154  NAMAERGHHVSPQQCEDKFNDLN  176



>ref|XP_002887659.1| hypothetical protein ARALYDRAFT_895568 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63918.1| hypothetical protein ARALYDRAFT_895568 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 64/117 (55%), Gaps = 30/117 (26%)
 Frame = -3

Query  294  ADQNSVDDGKRKMC-------------------PWQRMKWTDNMVRLLIMVVYYIGDEVG  172
            A  N+VD GK+ M                    PWQR+KW D MV+L+I  + YIG++  
Sbjct  57   ARHNNVDRGKKSMSEEDELCLSCDGQNKSKNNSPWQRVKWMDKMVKLMITALSYIGEDSS  116

Query  171  SEGNINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            +            +   G    V+QKKGKW+SVS+ M ERG+ VSPQQCEDKFNDLN
Sbjct  117  T-----------SEVGCGRKFAVLQKKGKWRSVSKVMDERGYRVSPQQCEDKFNDLN  162



>ref|XP_010247986.1| PREDICTED: uncharacterized protein LOC104590914 [Nelumbo nucifera]
Length=237

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 68/131 (52%), Gaps = 21/131 (16%)
 Frame = -3

Query  516  SNGMYSNMGSGMLGLEMSLhhvppqqnphpmqhqshpPMVSWPggggGTY----------  367
            + GM S++  GMLGLEM L      Q         HP MV++ G     Y          
Sbjct  7    AGGMISSLSPGMLGLEMPL-----HQAQQQHHPHQHPQMVAFAGQDADQYSQSQFVKQHG  61

Query  366  --PSGNKPKPTPGLTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVY  193
              P   K KP    TLS++         ++S  D ++++ P QRMKWT+NMVRLLIMVV+
Sbjct  62   YPPYATKAKPQQP-TLSEEEQ---GFVREDSGADRRKRISPLQRMKWTNNMVRLLIMVVF  117

Query  192  YIGDEVGSEGN  160
            YIGD+ GSE N
Sbjct  118  YIGDDGGSEDN  128



>ref|XP_010673612.1| PREDICTED: uncharacterized protein LOC104889964 [Beta vulgaris 
subsp. vulgaris]
Length=458

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 52/88 (59%), Gaps = 10/88 (11%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            RK  PWQRMKWTDN+VRLLI VV  +GDE   E                    ++QKKGK
Sbjct  117  RKESPWQRMKWTDNVVRLLIAVVASVGDEGMFEAK----------DGLKRKSAMLQKKGK  166

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK VS  M+     VSPQQCEDKFNDLN
Sbjct  167  WKMVSNVMISNNCSVSPQQCEDKFNDLN  194



>ref|NP_001168394.1| hypothetical protein [Zea mays]
 ref|XP_008677548.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28071.1| unknown [Zea mays]
 gb|AFW62567.1| hypothetical protein ZEAMMB73_488031 [Zea mays]
 gb|AFW62568.1| hypothetical protein ZEAMMB73_488031 [Zea mays]
Length=398

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 55/110 (50%), Gaps = 13/110 (12%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            +LSD+ + G    D+       +    W R+KWT  MV+LL+  V YI ++V ++   + 
Sbjct  57   SLSDEEEGGDGHLDRGKAAAASQ----WHRVKWTSGMVKLLVSAVSYIDEDVDADHGTSS  112

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                       G   +         VS AM ERGF VSPQQCEDKFNDLN
Sbjct  113  GRRKHAVLKRMGKWKL---------VSSAMTERGFAVSPQQCEDKFNDLN  153



>dbj|BAB62605.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAB93442.1| hypothetical protein [Oryza sativa Japonica Group]
Length=547

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 55/98 (56%), Gaps = 13/98 (13%)
 Frame = -3

Query  255  CPWQRMKWTDNMVRLLIMVVY-------------YIGDEVGSEGNINDPagnkkkaaggg  115
            CPW RMKWTD MVRLLI VVY               G +  +    +  AG        G
Sbjct  99   CPWTRMKWTDGMVRLLINVVYSVGDDGDGVAAGGAAGGKASAGAAGHGKAGGSGSHGAHG  158

Query  114  gggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                 QKKGKWKSVSRAMME G  VSPQQCEDKFNDLN
Sbjct  159  QAAAQQKKGKWKSVSRAMMESGHMVSPQQCEDKFNDLN  196



>ref|XP_006854556.1| hypothetical protein AMTR_s00030p00089780 [Amborella trichopoda]
 gb|ERN16023.1| hypothetical protein AMTR_s00030p00089780 [Amborella trichopoda]
Length=429

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 55/92 (60%), Gaps = 18/92 (20%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGD----EVGSEGNINDPagnkkkaaggggggvmq  97
            +K  PWQRMKWTD MVRLLI VV  IG+    E G  G                   V+Q
Sbjct  87   KKNSPWQRMKWTDEMVRLLITVVSCIGEDSSPEFGKMGR--------------RKSTVLQ  132

Query  96   kkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            KKGKWK VS+ M ++  YVSPQQCEDKFNDLN
Sbjct  133  KKGKWKWVSKIMAKKRCYVSPQQCEDKFNDLN  164



>ref|XP_009759483.1| PREDICTED: uncharacterized protein LOC104212013 isoform X3 [Nicotiana 
sylvestris]
Length=319

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 19/83 (23%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVS  70
            + RMKWTD+MV+LLI  V YIG++V S G                   V  KKGKW+++S
Sbjct  63   YHRMKWTDDMVKLLITAVSYIGEDVLSNG-------------------VFIKKGKWRAIS  103

Query  69   RAMMERGFYVSPQQCEDKFNDLN  1
              M ERG ++SPQQCEDKFND+N
Sbjct  104  CVMAERGHHISPQQCEDKFNDMN  126



>ref|XP_008793938.1| PREDICTED: uncharacterized protein LOC103710100 [Phoenix dactylifera]
Length=440

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 66/111 (59%), Gaps = 12/111 (11%)
 Frame = -3

Query  333  LTLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIN  154
            ++ S+++D        N  + GK K  PWQR+KWTD MVRLLI V+ Y+     +EG   
Sbjct  92   ISTSEEDDTEDGADGPNKSERGK-KAAPWQRVKWTDAMVRLLITVISYL-----TEGT--  143

Query  153  DPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                 +  ++      V+QKKGKWK VS+ M ER   VSPQQCEDKFNDLN
Sbjct  144  ----AELDSSAKKKLAVLQKKGKWKLVSKVMAERNCCVSPQQCEDKFNDLN  190



>ref|XP_004952693.1| PREDICTED: stress response protein NST1-like isoform X1 [Setaria 
italica]
 ref|XP_004952694.1| PREDICTED: stress response protein NST1-like isoform X2 [Setaria 
italica]
Length=402

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 49/93 (53%), Gaps = 12/93 (13%)
 Frame = -3

Query  270  GKRKMCP---WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvm  100
            GK    P   W R+KWT +MV+LL+  V YI D++ ++   +            G   + 
Sbjct  73   GKAAAAPASQWHRVKWTSDMVKLLVSAVSYIDDDIDADHGTSSGRKKHAMLKRKGKWRL-  131

Query  99   qkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                    VS AM ERGF VSPQQCEDKFNDLN
Sbjct  132  --------VSSAMTERGFPVSPQQCEDKFNDLN  156



>ref|XP_009759481.1| PREDICTED: uncharacterized protein LOC104212013 isoform X1 [Nicotiana 
sylvestris]
Length=366

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 19/83 (23%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVS  70
            + RMKWTD+MV+LLI  V YIG++V S G                   V  KKGKW+++S
Sbjct  110  YHRMKWTDDMVKLLITAVSYIGEDVLSNG-------------------VFIKKGKWRAIS  150

Query  69   RAMMERGFYVSPQQCEDKFNDLN  1
              M ERG ++SPQQCEDKFND+N
Sbjct  151  CVMAERGHHISPQQCEDKFNDMN  173



>ref|XP_009759482.1| PREDICTED: uncharacterized protein LOC104212013 isoform X2 [Nicotiana 
sylvestris]
Length=364

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 19/83 (23%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVS  70
            + RMKWTD+MV+LLI  V YIG++V S G                   V  KKGKW+++S
Sbjct  108  YHRMKWTDDMVKLLITAVSYIGEDVLSNG-------------------VFIKKGKWRAIS  148

Query  69   RAMMERGFYVSPQQCEDKFNDLN  1
              M ERG ++SPQQCEDKFND+N
Sbjct  149  CVMAERGHHISPQQCEDKFNDMN  171



>ref|XP_006446099.1| hypothetical protein CICLE_v10015189mg [Citrus clementina]
 gb|ESR59339.1| hypothetical protein CICLE_v10015189mg [Citrus clementina]
Length=458

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = -3

Query  288  QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggg  109
            +NS     +K   W RMKWTDN+VRLLI  V  +GD+   +G                  
Sbjct  107  ENSNGGRDKKGSMWHRMKWTDNVVRLLIAAVACVGDDGTIDG----------VEGLKRKS  156

Query  108  gvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            G++QKKGKWK+VS+ M+ RG  VSPQQCEDKFNDLN
Sbjct  157  GILQKKGKWKTVSKIMISRGCQVSPQQCEDKFNDLN  192



>ref|XP_006470589.1| PREDICTED: uncharacterized protein LOC102621074 isoform X1 [Citrus 
sinensis]
Length=458

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = -3

Query  288  QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggg  109
            +NS     +K   W RMKWTDN+VRLLI  V  +GD+   +G                  
Sbjct  107  ENSNGGRDKKGSMWHRMKWTDNVVRLLIAAVACVGDDGTIDG----------VEGLKRKS  156

Query  108  gvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            G++QKKGKWK+VS+ M+ RG  VSPQQCEDKFNDLN
Sbjct  157  GILQKKGKWKTVSKIMISRGCQVSPQQCEDKFNDLN  192



>gb|KDO61296.1| hypothetical protein CISIN_1g013250mg [Citrus sinensis]
Length=447

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = -3

Query  288  QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggg  109
            +NS     +K   W RMKWTDN+VRLLI  V  +GD+   +G                  
Sbjct  107  ENSNGGRDKKGSMWHRMKWTDNVVRLLIAAVACVGDDGTIDG----------VEGLKRKS  156

Query  108  gvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            G++QKKGKWK+VS+ M+ RG  VSPQQCEDKFNDLN
Sbjct  157  GILQKKGKWKTVSKIMISRGCQVSPQQCEDKFNDLN  192



>ref|XP_006470590.1| PREDICTED: uncharacterized protein LOC102621074 isoform X2 [Citrus 
sinensis]
Length=414

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = -3

Query  288  QNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggg  109
            +NS     +K   W RMKWTDN+VRLLI  V  +GD+   +G                  
Sbjct  63   ENSNGGRDKKGSMWHRMKWTDNVVRLLIAAVACVGDDGTIDG----------VEGLKRKS  112

Query  108  gvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            G++QKKGKWK+VS+ M+ RG  VSPQQCEDKFNDLN
Sbjct  113  GILQKKGKWKTVSKIMISRGCQVSPQQCEDKFNDLN  148



>ref|XP_006432257.1| hypothetical protein CICLE_v10003451mg [Citrus clementina]
 gb|ESR45497.1| hypothetical protein CICLE_v10003451mg [Citrus clementina]
Length=360

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 59/106 (56%), Gaps = 17/106 (16%)
 Frame = -3

Query  312  DPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGD-EVGSEGN-INDPagn  139
            D   P  D++   +G R   PW+R+KWT+ MV+LLI  V YI    + + GN  N+P+  
Sbjct  55   DCAIPGVDEHYAVEGIR--TPWRRIKWTEEMVKLLIYTVSYIRQFALSNVGNGRNEPSFL  112

Query  138  kkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            +K                   VS+ M+ERG+ VSPQQCEDKFN+LN
Sbjct  113  QKIGKWKV-------------VSKVMVERGYRVSPQQCEDKFNNLN  145



>ref|XP_006495058.1| PREDICTED: uncharacterized protein LOC102628040 [Citrus sinensis]
 gb|KDO47259.1| hypothetical protein CISIN_1g039131mg [Citrus sinensis]
Length=385

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 59/106 (56%), Gaps = 17/106 (16%)
 Frame = -3

Query  312  DPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGD-EVGSEGN-INDPagn  139
            D   P  D++   +G R   PW+R+KWT+ MV+LLI  V YI    + + GN  N+P+  
Sbjct  80   DCAIPGVDEHYAVEGIR--TPWRRIKWTEEMVKLLIYTVSYIRQFALSNVGNGRNEPSFL  137

Query  138  kkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            +K                   VS+ M+ERG+ VSPQQCEDKFN+LN
Sbjct  138  QKIGKWKV-------------VSKVMVERGYRVSPQQCEDKFNNLN  170



>ref|XP_009619561.1| PREDICTED: uncharacterized protein LOC104111549 [Nicotiana tomentosiformis]
 ref|XP_009619562.1| PREDICTED: uncharacterized protein LOC104111549 [Nicotiana tomentosiformis]
 ref|XP_009619563.1| PREDICTED: uncharacterized protein LOC104111549 [Nicotiana tomentosiformis]
 ref|XP_009619564.1| PREDICTED: uncharacterized protein LOC104111549 [Nicotiana tomentosiformis]
 ref|XP_009619565.1| PREDICTED: uncharacterized protein LOC104111549 [Nicotiana tomentosiformis]
Length=371

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 51/83 (61%), Gaps = 19/83 (23%)
 Frame = -3

Query  249  WQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgkwKSVS  70
            + RMKWTD MV+LLI  V YIG++V S G                   +  KKGKW+++S
Sbjct  95   YSRMKWTDEMVKLLITAVSYIGEDVWSNG-------------------IFPKKGKWRAIS  135

Query  69   RAMMERGFYVSPQQCEDKFNDLN  1
             AM E G +VSPQQCEDKFNDLN
Sbjct  136  NAMAESGHHVSPQQCEDKFNDLN  158



>gb|EMS64901.1| hypothetical protein TRIUR3_28119 [Triticum urartu]
Length=439

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 64/110 (58%), Gaps = 12/110 (11%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGKRKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNIND  151
            ++SD+ +        ++ +D  +K   W RMKWT +MV+LLI    Y G++ G++  +  
Sbjct  89   SISDEEEHDMTEDVTDTQNDKGKKGSAWHRMKWTGSMVKLLITAASYTGEDPGADQGVR-  147

Query  150  PagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
                           ++QKKGKWK++S+ M ERG  VSPQQCEDKFNDLN
Sbjct  148  -----------RNIAIVQKKGKWKAISKVMGERGCSVSPQQCEDKFNDLN  186



>dbj|BAK02398.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 65/114 (57%), Gaps = 19/114 (17%)
 Frame = -3

Query  330  TLSDDNDPGGPTADQNSVDDGK-RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSE---G  163
            ++SDD +    T D      GK +K   W RMKWT +MV+LLI    Y G++ G++   G
Sbjct  88   SISDDEEHD-VTEDTTDAQSGKGKKGSAWHRMKWTGSMVKLLITAASYTGEDPGADLGGG  146

Query  162  NINDPagnkkkaaggggggvmqkkgkwKSVSRAMMERGFYVSPQQCEDKFNDLN  1
              N                VMQKKGKWK++S+ M ERG  VSPQQCEDKFNDLN
Sbjct  147  RRN--------------ITVMQKKGKWKAISKVMGERGCNVSPQQCEDKFNDLN  186



>ref|XP_003578873.1| PREDICTED: uncharacterized protein LOC100835589 [Brachypodium 
distachyon]
 ref|XP_010238688.1| PREDICTED: uncharacterized protein LOC100835589 [Brachypodium 
distachyon]
Length=429

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 55/88 (63%), Gaps = 11/88 (13%)
 Frame = -3

Query  264  RKMCPWQRMKWTDNMVRLLIMVVYYIGDEVGSEGNINDPagnkkkaaggggggvmqkkgk  85
            +K   WQRMKWTD MV+LLI    Y G++ G++              G     +MQKKGK
Sbjct  97   KKGSAWQRMKWTDLMVKLLITAASYTGEDPGAD-----------LGGGRKSCAMMQKKGK  145

Query  84   wKSVSRAMMERGFYVSPQQCEDKFNDLN  1
            WK++S+ M ERG  VSPQQCEDKFNDLN
Sbjct  146  WKAISKVMGERGCNVSPQQCEDKFNDLN  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1487544256264