BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9695_g1_i1 len=341 path=[369:0-340]

Length=341
                                                                      Score     E

ref|XP_010098514.1|  60S ribosomal protein L35a-3                       125   3e-34   
ref|XP_006355672.1|  PREDICTED: 60S ribosomal protein L35a-3-like       125   5e-34   
ref|XP_009766547.1|  PREDICTED: 60S ribosomal protein L35a-3-like       125   6e-34   
ref|XP_004239927.1|  PREDICTED: 60S ribosomal protein L35a-3            125   6e-34   
ref|NP_001275273.1|  60S ribosomal protein L35a-3-like                  125   6e-34   
ref|XP_010537386.1|  PREDICTED: 60S ribosomal protein L35a-3            124   8e-34   
ref|XP_010093499.1|  60S ribosomal protein L35a-3                       125   9e-34   
ref|XP_009587506.1|  PREDICTED: 60S ribosomal protein L35a-3-like       124   9e-34   
ref|XP_009590569.1|  PREDICTED: 60S ribosomal protein L35a-3            124   9e-34   
ref|NP_177567.1|  60S ribosomal protein L35a-3                          124   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009762681.1|  PREDICTED: 60S ribosomal protein L35a-3-like       123   2e-33   
gb|KHG07851.1|  60S ribosomal L35a-1 -like protein                      124   2e-33   
ref|XP_011094957.1|  PREDICTED: 60S ribosomal protein L35a-3-like       123   2e-33   
ref|XP_006390443.1|  hypothetical protein EUTSA_v10019342mg             123   2e-33   
gb|KHG28839.1|  60S ribosomal L35a-3 -like protein                      123   3e-33   
ref|XP_006368064.1|  PREDICTED: 60S ribosomal protein L35a-3-like       123   3e-33   
gb|AAK25760.1|AF334840_1  ribosomal protein L33                         122   3e-33   Castanea sativa
ref|XP_009104770.1|  PREDICTED: 60S ribosomal protein L35a-1            122   3e-33   
gb|KHG27158.1|  60S ribosomal protein L35a-3                            123   3e-33   
gb|KHG27159.1|  60S ribosomal protein L35a-1                            122   4e-33   
gb|ABK22625.1|  unknown                                                 122   4e-33   Picea sitchensis
gb|ABK20910.1|  unknown                                                 122   4e-33   Picea sitchensis
ref|XP_004235258.1|  PREDICTED: 60S ribosomal protein L35a-2            122   5e-33   
ref|XP_002312115.1|  hypothetical protein POPTR_0008s05970g             122   5e-33   Populus trichocarpa [western balsam poplar]
ref|XP_007158891.1|  hypothetical protein PHAVU_002G190400g             122   5e-33   
gb|ACJ02349.1|  60S ribosomal protein L35a                              122   5e-33   Vernicia fordii [tung oil tree]
ref|NP_172188.1|  60S ribosomal protein L35a-1                          122   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128039.1|  PREDICTED: 60S ribosomal protein L35a-1-like       122   6e-33   
ref|XP_007158890.1|  hypothetical protein PHAVU_002G190400g             122   6e-33   
gb|ADR71255.1|  60S ribosomal protein L35aA                             122   6e-33   
ref|XP_002277272.1|  PREDICTED: 60S ribosomal protein L35a-1            122   6e-33   Vitis vinifera
ref|XP_010251466.1|  PREDICTED: 60S ribosomal protein L35a-1            122   7e-33   
gb|KHG03002.1|  60S ribosomal protein L35a-3                            123   8e-33   
gb|KDP44839.1|  hypothetical protein JCGZ_01339                         122   8e-33   
ref|XP_006429267.1|  hypothetical protein CICLE_v10013164mg             122   8e-33   
ref|XP_006417848.1|  hypothetical protein EUTSA_v10009155mg             122   8e-33   
gb|KHG03001.1|  60S ribosomal protein L35a-3                            122   9e-33   
ref|XP_004512402.1|  PREDICTED: 60S ribosomal protein L35a-1-like       121   9e-33   
ref|XP_010539981.1|  PREDICTED: 60S ribosomal protein L35a-3-like       121   9e-33   
gb|EPS72675.1|  hypothetical protein M569_02083                         122   1e-32   
ref|XP_011077602.1|  PREDICTED: 60S ribosomal protein L35a-3            121   1e-32   
ref|XP_002316240.1|  60S ribosomal protein L35a                         121   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011036020.1|  PREDICTED: 60S ribosomal protein L35a-1            121   1e-32   
ref|XP_002315206.1|  ribosomal protein L33                              121   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006435563.1|  hypothetical protein CICLE_v10033116mg             121   1e-32   
ref|XP_004490943.1|  PREDICTED: 60S ribosomal protein L35a-1-like       121   2e-32   
ref|NP_001235514.1|  uncharacterized protein LOC100305958               120   2e-32   
ref|XP_010428409.1|  PREDICTED: 60S ribosomal protein L35a-3-like       120   2e-32   
ref|XP_002311198.1|  ribosomal protein L33                              120   2e-32   Populus trichocarpa [western balsam poplar]
gb|KCW50525.1|  hypothetical protein EUGRSUZ_J00247                     120   2e-32   
gb|KCW50524.1|  hypothetical protein EUGRSUZ_J00247                     120   2e-32   
gb|KCW62067.1|  hypothetical protein EUGRSUZ_H04737                     120   2e-32   
ref|XP_010416278.1|  PREDICTED: 60S ribosomal protein L35a-3            120   2e-32   
ref|XP_010025413.1|  PREDICTED: 60S ribosomal protein L35a-3-like       120   2e-32   
emb|CDP14006.1|  unnamed protein product                                120   3e-32   
ref|XP_010031264.1|  PREDICTED: 60S ribosomal protein L35a-3            120   3e-32   
ref|XP_007026815.1|  Ribosomal protein L35Ae family protein isofo...    120   3e-32   
ref|XP_010534064.1|  PREDICTED: 60S ribosomal protein L35a-3-like       120   3e-32   
ref|XP_010471515.1|  PREDICTED: 60S ribosomal protein L35a-3-like       120   3e-32   
emb|CDP14072.1|  unnamed protein product                                120   3e-32   
ref|XP_010927256.1|  PREDICTED: 60S ribosomal protein L35a-1-like       121   4e-32   
ref|XP_010534541.1|  PREDICTED: 60S ribosomal protein L35a-3            120   4e-32   
ref|XP_004494288.1|  PREDICTED: 60S ribosomal protein L35a-1-like       120   4e-32   
emb|CDY49119.1|  BnaA02g16870D                                          120   4e-32   
ref|XP_010251468.1|  PREDICTED: 60S ribosomal protein L35a-1-like       120   5e-32   
ref|XP_006292080.1|  hypothetical protein CARUB_v10018275mg             120   5e-32   
gb|EPS74388.1|  hypothetical protein M569_00370                         120   5e-32   
ref|XP_010487099.1|  PREDICTED: 60S ribosomal protein L35a-1            120   5e-32   
emb|CDY02958.1|  BnaC04g25280D                                          119   6e-32   
gb|EYU41823.1|  hypothetical protein MIMGU_mgv1a015450mg                121   6e-32   
emb|CDX72205.1|  BnaC08g26690D                                          119   6e-32   
emb|CDY27268.1|  BnaA09g35340D                                          119   6e-32   
ref|NP_001241369.1|  uncharacterized protein LOC100800463               119   7e-32   
ref|XP_009763834.1|  PREDICTED: 60S ribosomal protein L35a-3-like       119   1e-31   
gb|KFK43006.1|  hypothetical protein AALP_AA1G067100                    119   1e-31   
ref|NP_174951.1|  60S ribosomal protein L35a-2                          119   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004172769.1|  PREDICTED: 60S ribosomal protein L35a-1-like       119   1e-31   
ref|XP_009139139.1|  PREDICTED: 60S ribosomal protein L35a-1-like       119   1e-31   
gb|EYU26636.1|  hypothetical protein MIMGU_mgv1a016658mg                119   1e-31   
ref|XP_009344398.1|  PREDICTED: 60S ribosomal protein L35a-1-like       119   1e-31   
ref|XP_009351088.1|  PREDICTED: 60S ribosomal protein L35a-1            119   1e-31   
ref|NP_001236077.1|  uncharacterized protein LOC100305997               118   2e-31   
ref|NP_191134.1|  60S ribosomal protein L35a-4                          118   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004308915.1|  PREDICTED: probable sugar phosphate/phosphat...    125   2e-31   
gb|AFK49212.1|  unknown                                                 118   2e-31   
ref|XP_008791426.1|  PREDICTED: 60S ribosomal protein L35a-1            118   2e-31   
ref|XP_008800888.1|  PREDICTED: 60S ribosomal protein L35a-1-like       118   2e-31   
gb|KFK41874.1|  hypothetical protein AALP_AA2G182500                    118   2e-31   
ref|XP_010256722.1|  PREDICTED: 60S ribosomal protein L35a-3-like       118   2e-31   
ref|XP_009415151.1|  PREDICTED: 60S ribosomal protein L35a-1            117   4e-31   
ref|XP_009420647.1|  PREDICTED: 60S ribosomal protein L35a-1-like       117   4e-31   
ref|XP_009385078.1|  PREDICTED: 60S ribosomal protein L35a-1-like       117   4e-31   
ref|XP_007009114.1|  Ribosomal protein L35Ae family protein isofo...    117   4e-31   
ref|XP_007141808.1|  hypothetical protein PHAVU_008G227300g             117   4e-31   
ref|XP_009405711.1|  PREDICTED: 60S ribosomal protein L35a-1            117   4e-31   
ref|XP_002530407.1|  60S ribosomal protein L35a, putative               117   4e-31   Ricinus communis
gb|AFK45582.1|  unknown                                                 117   4e-31   
gb|EYU41826.1|  hypothetical protein MIMGU_mgv1a016676mg                117   5e-31   
gb|KEH28273.1|  60S ribosomal protein L35a-3                            117   5e-31   
ref|XP_006403422.1|  hypothetical protein EUTSA_v10010844mg             117   5e-31   
ref|XP_004150243.1|  PREDICTED: probable sugar phosphate/phosphat...    124   5e-31   
ref|XP_008801979.1|  PREDICTED: 60S ribosomal protein L35a-1-like       118   6e-31   
ref|XP_004305154.1|  PREDICTED: probable sugar phosphate/phosphat...    123   6e-31   
ref|XP_008392900.1|  PREDICTED: 60S ribosomal protein L35a-1            117   7e-31   
ref|XP_007009113.1|  Ribosomal protein L35Ae family protein isofo...    117   7e-31   
gb|KEH28274.1|  60S ribosomal protein L35a-3                            117   7e-31   
gb|AFK49038.1|  unknown                                                 116   1e-30   
ref|XP_010690297.1|  PREDICTED: 60S ribosomal protein L35a-3            116   1e-30   
ref|XP_003616553.1|  Maturase                                           124   1e-30   
gb|ACJ84078.1|  unknown                                                 116   1e-30   Medicago truncatula
gb|KEH15645.1|  60S ribosomal protein L35a-3                            116   1e-30   
ref|XP_002527874.1|  60S ribosomal protein L35a, putative               115   2e-30   Ricinus communis
gb|ACJ83951.1|  unknown                                                 115   2e-30   Medicago truncatula
gb|AFK48555.1|  unknown                                                 115   2e-30   
gb|AEX93423.1|  60S ribosomal protein L35a                              115   2e-30   
ref|XP_008381900.1|  PREDICTED: 60S ribosomal protein L35a-1-like       115   3e-30   
ref|NP_001235452.1|  uncharacterized protein LOC100499746               115   3e-30   
ref|XP_006648023.1|  PREDICTED: 60S ribosomal protein L35a-1-like       115   3e-30   
gb|KDP24503.1|  hypothetical protein JCGZ_25067                         115   4e-30   
ref|NP_001048330.1|  Os02g0785800                                       115   4e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008388112.1|  PREDICTED: 60S ribosomal protein L35a-1-like       115   4e-30   
ref|XP_004155999.1|  PREDICTED: 60S ribosomal protein L35a-1-like       114   5e-30   
gb|EEC74134.1|  hypothetical protein OsI_09204                          115   5e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_006343306.1|  PREDICTED: 60S ribosomal protein L35a-3-like       114   6e-30   
ref|XP_007207502.1|  hypothetical protein PRUPE_ppa013629mg             114   7e-30   
ref|XP_008370046.1|  PREDICTED: 60S ribosomal protein L35a-1-like       113   2e-29   
ref|XP_008442180.1|  PREDICTED: 60S ribosomal protein L35a-1-like       112   3e-29   
ref|NP_001278735.1|  60S ribosomal protein L33-B                        112   5e-29   
ref|NP_001056284.1|  Os05g0556900                                       112   7e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655870.1|  PREDICTED: 60S ribosomal protein L35a-1-like       111   7e-29   
gb|AFV13458.1|  ribosomal protein L35A                                  111   7e-29   
dbj|BAJ90670.1|  predicted protein                                      111   9e-29   
ref|XP_004954154.1|  PREDICTED: 60S ribosomal protein L35a-1-like       111   9e-29   
ref|XP_002462269.1|  hypothetical protein SORBIDRAFT_02g022800          111   9e-29   Sorghum bicolor [broomcorn]
ref|XP_003570711.1|  PREDICTED: 60S ribosomal protein L35a-1-like       111   9e-29   
ref|NP_001148377.1|  60S ribosomal protein L33-B                        111   9e-29   Zea mays [maize]
gb|ACG31001.1|  60S ribosomal protein L33-B                             111   1e-28   Zea mays [maize]
ref|XP_010227918.1|  PREDICTED: 60S ribosomal protein L35a-1            111   1e-28   
tpg|DAA61143.1|  TPA: hypothetical protein ZEAMMB73_917318              111   1e-28   
ref|XP_003577481.1|  PREDICTED: 60S ribosomal protein L35a-1-like       111   1e-28   
gb|ABR25872.1|  60S ribosomal protein l33-b                             111   1e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_004309850.1|  PREDICTED: uncharacterized protein LOC101296922    112   2e-28   
gb|AFW64229.1|  hypothetical protein ZEAMMB73_493842                    110   2e-28   
ref|XP_006654760.1|  PREDICTED: 60S ribosomal protein L35a-2-like       110   2e-28   
ref|XP_001768442.1|  predicted protein                                  110   2e-28   
gb|ACF87953.1|  unknown                                                 110   2e-28   Zea mays [maize]
ref|XP_002452936.1|  hypothetical protein SORBIDRAFT_04g035260          110   2e-28   Sorghum bicolor [broomcorn]
gb|EEE64647.1|  hypothetical protein OsJ_19501                          112   2e-28   Oryza sativa Japonica Group [Japonica rice]
gb|ACR37770.1|  unknown                                                 110   3e-28   Zea mays [maize]
gb|EAY98975.1|  hypothetical protein OsI_20933                          112   3e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_001751579.1|  predicted protein                                  110   3e-28   
gb|ABF67911.1|  ribosomal protein L35A                                  110   3e-28   Zea mays [maize]
ref|XP_004961280.1|  PREDICTED: 60S ribosomal protein L35a-1-like...    111   3e-28   
ref|XP_008233703.1|  PREDICTED: 60S ribosomal protein L35a-1            110   3e-28   
ref|XP_004961282.1|  PREDICTED: 60S ribosomal protein L35a-1-like...    109   4e-28   
ref|XP_001762073.1|  predicted protein                                  109   5e-28   
ref|XP_003567930.1|  PREDICTED: 60S ribosomal protein L35a-1-like       109   5e-28   
ref|XP_001751835.1|  predicted protein                                  109   6e-28   
ref|XP_007218627.1|  hypothetical protein PRUPE_ppa013635mg             109   6e-28   
ref|XP_006848054.1|  hypothetical protein AMTR_s00029p00195890          108   9e-28   
gb|ACG27073.1|  60S ribosomal protein L33-B                             108   1e-27   Zea mays [maize]
gb|ACF85308.1|  unknown                                                 108   1e-27   Zea mays [maize]
gb|EMT16625.1|  60S ribosomal protein L35a-3                            108   1e-27   
gb|EMS50804.1|  60S ribosomal protein L35a-3                            108   1e-27   
gb|EMS67750.1|  60S ribosomal protein L35a-1                            108   1e-27   
ref|NP_001148548.1|  LOC100282164                                       108   1e-27   Zea mays [maize]
ref|XP_002440216.1|  hypothetical protein SORBIDRAFT_09g027930          108   2e-27   Sorghum bicolor [broomcorn]
emb|CDP14007.1|  unnamed protein product                                108   2e-27   
ref|XP_001760913.1|  predicted protein                                  107   3e-27   
dbj|BAK01225.1|  predicted protein                                      106   1e-26   
ref|XP_002989747.1|  hypothetical protein SELMODRAFT_184773             104   6e-26   
gb|EMS52075.1|  60S ribosomal protein L35a-1                            106   7e-26   
ref|XP_006584481.1|  PREDICTED: uncharacterized protein LOC100305...    102   4e-25   
gb|EMT01430.1|  Autophagy-related protein 7                             107   6e-25   
gb|AAV64217.1|  rpl35A                                                  101   2e-24   Zea mays [maize]
ref|XP_011069703.1|  PREDICTED: 60S ribosomal protein L35a-3-like       100   2e-24   
ref|XP_002991749.1|  hypothetical protein SELMODRAFT_134155           99.4    4e-24   
ref|XP_010243420.1|  PREDICTED: 60S ribosomal protein L35a-2-like     98.6    9e-24   
gb|AFW85500.1|  sesquiterpene cyclase1                                  104   2e-23   
gb|AGU71410.1|  60S ribosomal protein l35a                            95.1    6e-23   
ref|XP_009119450.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...  96.7    6e-23   
gb|EMS52589.1|  60S ribosomal protein L35a-3                          95.5    8e-23   
gb|EEC75435.1|  hypothetical protein OsI_11963                        95.5    3e-21   Oryza sativa Indica Group [Indian rice]
gb|AGB85018.1|  ribosomal protein L35ae                               87.0    2e-19   
gb|KDO53184.1|  hypothetical protein CISIN_1g040909mg                 86.3    4e-19   
gb|KFM26223.1|  60S ribosomal protein L35a-4                          86.7    4e-19   
gb|KDO40476.1|  hypothetical protein CISIN_1g042762mg                 85.9    6e-19   
ref|XP_006432297.1|  hypothetical protein CICLE_v10003310mg           85.5    8e-19   
ref|XP_005849146.1|  hypothetical protein CHLNCDRAFT_30584            84.0    3e-18   
gb|ACG45987.1|  hypothetical protein                                  81.6    9e-18   Zea mays [maize]
ref|XP_002947351.1|  component of cytosolic 80S ribosome and 60S ...  82.8    1e-17   
ref|XP_002367259.1|  60s ribosomal protein L33-A, putative            82.4    2e-17   Toxoplasma gondii ME49
ref|XP_003886145.1|  hypothetical protein NCLIV_065450                82.4    2e-17   
emb|CDM86481.1|  unnamed protein product                              81.6    3e-17   
ref|XP_001698582.1|  ribosomal protein L35a, component of cytosol...  81.3    4e-17   Chlamydomonas reinhardtii
ref|XP_006431645.1|  hypothetical protein CICLE_v10003325mg           79.0    2e-16   
ref|XP_002508337.1|  predicted protein                                79.0    3e-16   Micromonas commoda
gb|ERZ97554.1|  hypothetical protein GLOINDRAFT_340100                78.6    3e-16   
ref|XP_005643378.1|  ribosomal protein L35Ae                          79.0    3e-16   
gb|EXX79702.1|  ribosomal 60S subunit protein L33A                    79.0    3e-16   
emb|CEG01556.1|  Translation elongation/initiation factor/Ribosom...  77.8    8e-16   
ref|XP_001419192.1|  Ribosomal protein L35a, component of cytosol...  77.0    2e-15   Ostreococcus lucimarinus CCE9901
emb|CDI78359.1|  60s ribosomal protein L33-A, putative                76.6    3e-15   
emb|CDJ69476.1|  60s ribosomal protein L33-A, putative                75.9    6e-15   
emb|CDJ42634.1|  60s ribosomal protein L33-A, putative                75.9    7e-15   
ref|XP_007322831.1|  hypothetical protein SERLADRAFT_400095           75.5    7e-15   
ref|XP_628426.1|  60S ribosomal protein L35A                          75.5    8e-15   Cryptosporidium parvum Iowa II
emb|CDJ52943.1|  60s ribosomal protein L33-A, putative                75.5    8e-15   
gb|AGH70179.1|  60S ribosomal protein L35a                            75.1    1e-14   
emb|CDI79522.1|  60s ribosomal protein L33-A, putative                75.1    1e-14   
ref|XP_955277.1|  60S ribosomal protein l35a                          74.7    2e-14   Theileria annulata strain Ankara
ref|XP_009691267.1|  60S ribosomal protein L35a                       74.7    2e-14   
gb|KDQ51064.1|  hypothetical protein JAAARDRAFT_41530                 74.3    2e-14   
ref|XP_006461267.1|  hypothetical protein AGABI2DRAFT_151050          74.3    2e-14   
ref|XP_005780666.1|  hypothetical protein EMIHUDRAFT_429999           74.3    2e-14   
gb|ADV03036.1|  ribosomal protein L35A                                74.3    2e-14   
emb|CDJ36329.1|  60s ribosomal protein L33-A, putative                74.3    2e-14   
emb|CDJ57228.1|  60s ribosomal protein L33-A, putative                74.3    2e-14   
ref|XP_007343662.1|  60S ribosomal protein L33-A-like protein         73.9    3e-14   
ref|XP_002473563.1|  60S ribosomal protein L35                        73.9    3e-14   Postia placenta Mad-698-R
ref|XP_007865385.1|  60S ribosomal protein L33-A-like protein         73.9    3e-14   
ref|XP_003030194.1|  60S ribosomal protein L33                        73.6    3e-14   
ref|XP_007382900.1|  60S ribosomal protein L33-A-like protein         73.6    3e-14   
ref|XP_001880181.1|  60S ribosomal protein L33                        73.6    4e-14   Laccaria bicolor S238N-H82
emb|CCF75293.1|  unnamed protein product                              73.2    4e-14   
emb|CDS03706.1|  hypothetical protein LRAMOSA01107                    73.2    5e-14   
gb|EUC55718.1|  60S ribosomal protein L33-A                           73.2    5e-14   
ref|XP_002141426.1|  60S ribosomal protein L35A                       73.6    5e-14   Cryptosporidium muris RN66
gb|EPT03051.1|  hypothetical protein FOMPIDRAFT_1047412               72.8    5e-14   
ref|XP_651074.1|  60S ribosomal protein L35a                          72.8    6e-14   Entamoeba histolytica HM-1:IMSS
ref|XP_763631.1|  60S ribosomal protein L35a                          73.2    7e-14   Theileria parva strain Muguga
ref|XP_009836749.1|  hypothetical protein H257_11490                  72.8    7e-14   
ref|XP_008869809.1|  hypothetical protein H310_06490                  72.8    7e-14   
ref|XP_007362818.1|  60S ribosomal protein L33-A-like protein         72.8    7e-14   
ref|XP_005536912.1|  60S ribosomal protein L35A                       72.8    8e-14   
emb|CDH48318.1|  60s ribosomal protein l33                            72.8    8e-14   
gb|KDQ06306.1|  hypothetical protein BOTBODRAFT_181730                73.9    9e-14   
emb|CBJ32915.1|  ribosomal protein L35                                73.6    9e-14   
gb|EMT33314.1|  60S ribosomal protein L35a-1                          72.4    1e-13   
gb|ELU44255.1|  ribosomal l35Ae domain-containing protein             73.9    1e-13   
ref|XP_002391650.1|  hypothetical protein MPER_08887                  72.0    1e-13   Moniliophthora perniciosa FA553
ref|XP_007515506.1|  predicted protein                                72.8    1e-13   
ref|XP_001638125.1|  predicted protein                                72.0    1e-13   Nematostella vectensis
gb|EMD39013.1|  hypothetical protein CERSUDRAFT_81793                 72.0    1e-13   
ref|XP_008038334.1|  60S ribosomal protein L33-A-like protein         71.6    1e-13   
ref|XP_001830188.1|  60S ribosomal protein L33                        72.0    2e-13   Coprinopsis cinerea okayama7#130
ref|XP_007843336.1|  60s ribosomal protein l33                        71.6    2e-13   
ref|XP_008610290.1|  50S ribosomal protein L35Ae                      71.6    2e-13   
ref|XP_007304020.1|  60S ribosomal protein L33-A-like protein         71.2    2e-13   
gb|EJK66241.1|  hypothetical protein THAOC_12850                      71.2    2e-13   
ref|XP_002112246.1|  expressed hypothetical protein                   71.6    2e-13   Trichoplax adhaerens
ref|XP_007770609.1|  ribosomal protein L35Ae                          71.2    2e-13   
emb|CCQ18605.1|  60S ribosomal protein L35A/L37                       71.6    2e-13   
gb|KDQ28226.1|  hypothetical protein PLEOSDRAFT_1089639               71.2    2e-13   
ref|XP_004150932.1|  PREDICTED: uncharacterized protein LOC101214192  72.8    2e-13   
ref|XP_009515339.1|  hypothetical protein PHYSODRAFT_284181           71.2    3e-13   
emb|CCM00734.1|  predicted protein                                    71.6    3e-13   
ref|XP_008911720.1|  hypothetical protein PPTG_16133                  71.2    3e-13   
ref|XP_007401366.1|  hypothetical protein PHACADRAFT_264757           70.5    4e-13   
gb|AFR96119.1|  large subunit ribosomal protein L33-b                 70.5    5e-13   
ref|XP_006406347.1|  hypothetical protein EUTSA_v10021832mg           70.1    6e-13   
ref|XP_002673253.1|  predicted protein                                70.5    6e-13   Naegleria gruberi strain NEG-M
gb|EJU03502.1|  ribosomal protein L35Ae                               70.1    7e-13   
emb|CDO72089.1|  hypothetical protein BN946_scf184962.g32             69.7    8e-13   
ref|XP_774612.1|  hypothetical protein CNBF2920                       70.9    1e-12   Cryptococcus neoformans var. neoformans B-3501A
ref|XP_571529.1|  60s ribosomal protein l33-b                         70.9    1e-12   Cryptococcus neoformans var. neoformans JEC21
gb|KDD77150.1|  ribosomal protein L35Ae                               69.3    1e-12   
ref|XP_009549414.1|  hypothetical protein HETIRDRAFT_441224           69.3    1e-12   
ref|XP_002906315.1|  60S ribosomal protein L35a-4                     69.3    1e-12   
ref|XP_003329071.2|  60S ribosomal protein L33                        69.3    1e-12   
ref|XP_003194814.1|  60s ribosomal protein l33-b                      70.1    2e-12   
gb|KGB75906.1|  60S ribosomal protein L33-b                           70.5    2e-12   
emb|CEI88683.1|  Putative 60S ribosomal protein L33-A                 68.9    2e-12   
emb|CEI94924.1|  Putative 60S ribosomal protein L33-A                 68.6    2e-12   
ref|XP_009036832.1|  hypothetical protein AURANDRAFT_26032            68.6    2e-12   
gb|KFH64726.1|  60S ribosomal protein L33-A                           68.6    2e-12   
ref|XP_003059034.1|  predicted protein                                68.2    3e-12   
emb|CDH53540.1|  60s ribosomal protein l33                            68.9    3e-12   
emb|CEG68730.1|  Putative 60S ribosomal protein L33-A                 68.2    3e-12   
emb|CDS03050.1|  Putative 60S ribosomal protein L33-A                 68.2    4e-12   
ref|XP_004994981.1|  ribosomal protein L35a                           68.2    4e-12   
emb|CCA70843.1|  probable RPL33B-ribosomal protein L35a.e.c15         68.9    5e-12   
dbj|GAA97936.1|  hypothetical protein E5Q_04616                       68.6    5e-12   
gb|EIE77867.1|  hypothetical protein RO3G_02571                       67.4    6e-12   
ref|XP_002771672.1|  60S ribosomal protein L35a, putative             67.8    6e-12   
gb|EIE81627.1|  hypothetical protein RO3G_06332                       67.4    6e-12   
gb|ABG81964.1|  putative ribosomal protein L35Ae                      68.6    7e-12   
ref|XP_008479160.1|  PREDICTED: 60S ribosomal protein L35a-like       68.6    8e-12   
emb|CDS05170.1|  Putative 60S ribosomal protein L33-A                 67.0    9e-12   
emb|CEG65841.1|  Putative 60S ribosomal protein L33-A                 67.0    1e-11   
ref|XP_007261530.1|  60S ribosomal protein L33-A-like protein         66.6    1e-11   
emb|CCH46870.1|  60S ribosomal protein L33-A                          66.6    1e-11   
ref|XP_005818688.1|  large subunit ribosomal protein L35Ae, cytop...  66.6    1e-11   
gb|EJT45694.1|  60s ribosomal protein l33-b                           66.2    2e-11   
ref|XP_004832879.1|  60S ribosomal protein L35a, putative             66.2    2e-11   
emb|CDH51935.1|  60s ribosomal protein l33                            65.9    2e-11   
gb|ADV03040.1|  ribosomal protein L35A                                66.2    2e-11   
gb|ABX44838.1|  putative 60S ribosomal protein RPL35A                 65.9    3e-11   
ref|XP_005704565.1|  60S ribosomal protein L35Ae isoform 2            65.5    3e-11   
ref|XP_001611332.1|  60S ribosomal protein L35a                       65.5    4e-11   
emb|CCV00222.1|  unnamed protein product                              65.5    4e-11   
emb|CDO65225.1|  60S ribosomal protein L35ae, putative                65.9    4e-11   
ref|XP_001348107.1|  60S ribosomal protein L35Ae, putative            65.9    4e-11   
dbj|BAN65739.1|  60S ribosomal protein L35a, putative                 65.5    5e-11   
ref|XP_003958797.1|  hypothetical protein KAFR_0H02530                65.1    5e-11   
gb|ABR26119.1|  60S ribosomal protein l33-b                           64.3    5e-11   
ref|XP_011121694.1|  hypothetical protein AOL_s00078g129              65.1    6e-11   
gb|EPB81409.1|  60S ribosomal protein L33-A                           64.7    6e-11   
ref|XP_007408526.1|  hypothetical protein MELLADRAFT_71500            64.7    7e-11   
ref|XP_007872003.1|  50S ribosomal protein L35Ae                      64.7    7e-11   
ref|XP_003674608.1|  hypothetical protein NCAS_0B01480                64.7    8e-11   
ref|XP_002162566.1|  PREDICTED: 60S ribosomal protein L35a-like i...  64.7    8e-11   
ref|XP_003296525.1|  60S ribosomal protein L33                        64.3    9e-11   
ref|XP_001932844.1|  60S ribosomal protein L33                        64.3    9e-11   
gb|EPB84142.1|  60S ribosomal protein L33-A                           64.3    1e-10   
emb|CDS31980.1|  Ribosomal protein L35A                               64.7    1e-10   
emb|CBY09294.1|  unnamed protein product                              64.3    1e-10   
gb|ACR24955.1|  ribosomal protein L35a                                64.3    1e-10   
ref|XP_007007163.1|  hypothetical protein TREMEDRAFT_64953            64.7    1e-10   
gb|ABW23189.1|  ribosomal protein rpl35a                              64.3    1e-10   
ref|XP_004364961.1|  60S ribosomal protein l35a                       63.9    1e-10   
ref|XP_006678996.1|  hypothetical protein BATDEDRAFT_25042            63.9    1e-10   
gb|EMS24414.1|  60S ribosomal protein l33                             63.9    1e-10   
gb|EKG15894.1|  Ribosomal protein L35A                                63.9    1e-10   
gb|ESZ98900.1|  60S ribosomal protein L33                             63.9    1e-10   
ref|XP_007692999.1|  hypothetical protein COCMIDRAFT_9656             63.9    1e-10   
ref|XP_009010915.1|  hypothetical protein HELRODRAFT_72500            63.5    2e-10   
gb|AAX62468.1|  ribosomal protein L35a                                63.9    2e-10   
ref|XP_004258633.1|  60S ribosomal protein L35A, putative             63.5    2e-10   
emb|CCI39390.1|  unnamed protein product                              63.5    2e-10   
emb|CDR44250.1|  CYFA0S14e01288g1_1                                   63.5    2e-10   
gb|EUB60410.1|  60S ribosomal protein L35a                            64.3    2e-10   
ref|XP_008624968.1|  50S ribosomal protein L35Ae                      63.9    2e-10   
ref|XP_449454.1|  60S ribosomal protein L33                           63.2    2e-10   
emb|CDS19289.1|  Ribosomal protein L35A                               63.9    2e-10   
emb|CDJ00059.1|  Ribosomal protein L35A                               63.9    2e-10   
ref|XP_003670187.1|  ribosomal protein L33                            63.2    3e-10   
ref|XP_002418494.1|  60S ribosomal protein L33                        63.2    3e-10   
ref|XP_004178753.1|  hypothetical protein TBLA_0B03960                62.8    3e-10   
ref|XP_003686440.1|  60S ribosomal protein L33                        62.8    3e-10   
ref|XP_002259428.1|  ribosomal protein                                63.5    3e-10   
ref|XP_004255136.1|  60S ribosomal protein L35A, putative             62.8    3e-10   
gb|EZG43328.1|  60S ribosomal protein L35a                            62.8    3e-10   
gb|ABW90367.1|  putative ribosomal protein L35a                       63.2    3e-10   
ref|XP_008024474.1|  hypothetical protein SETTUDRAFT_168768           62.8    4e-10   
ref|XP_002553177.1|  60S ribosomal protein L33                        62.8    4e-10   
ref|XP_003849910.1|  60S ribosomal protein L33                        62.8    4e-10   
gb|EPB85931.1|  60S ribosomal protein L33-A                           62.4    4e-10   
ref|XP_001553626.1|  60S ribosomal protein L33                        62.4    4e-10   
ref|XP_007781878.1|  60S ribosomal protein L33-B                      62.4    5e-10   
gb|ABY27370.1|  ribosomal protein L35A                                62.4    5e-10   
ref|NP_014877.3|  ribosomal 60S subunit protein L33B                  62.4    5e-10   
ref|XP_001899218.1|  60S ribosomal protein L35a                       62.4    5e-10   
gb|EJW86839.1|  50S ribosomal protein L35Ae                           62.4    6e-10   
ref|XP_004335641.1|  ribosomal protein L35Ae, putative                62.0    6e-10   
gb|EMF11689.1|  60S ribosomal protein L33                             62.4    6e-10   
ref|XP_002738857.1|  PREDICTED: 60S ribosomal protein L35a-like       62.4    6e-10   
emb|CAQ37782.1|  60S ribosomal protein L35a                           62.0    8e-10   
ref|XP_001799711.1|  hypothetical protein SNOG_09417                  62.0    8e-10   
ref|XP_002184917.1|  predicted protein                                61.6    8e-10   
emb|CCK67991.1|  hypothetical protein KNAG_0A03030                    61.6    8e-10   
ref|XP_007927038.1|  hypothetical protein MYCFIDRAFT_49677            62.0    8e-10   
ref|XP_003954944.1|  hypothetical protein KAFR_0A03740                61.6    9e-10   
gb|KGQ89112.1|  60S ribosomal protein L33-A                           61.6    9e-10   
dbj|BAO39241.1|  60S ribosomal protein L33-B                          61.6    1e-09   
ref|XP_003141863.1|  60S ribosomal protein L35a                       62.0    1e-09   
ref|NP_983522.1|  60S ribosomal protein L33                           61.6    1e-09   
ref|XP_008816243.1|  50S ribosomal protein L35Ae                      62.0    1e-09   
emb|CDQ72179.1|  unnamed protein product                              61.6    1e-09   
ref|XP_003679144.1|  60S ribosomal protein L33                        61.2    1e-09   
gb|ESW98827.1|  60S ribosomal protein L33                             61.2    1e-09   
ref|XP_007759207.1|  60S ribosomal protein L33-B                      61.2    1e-09   
gb|EFO28329.2|  60S ribosomal protein L35a                            61.6    1e-09   
gb|AAK92169.1|AF400197_1  ribosomal protein L35A                      62.0    1e-09   
pdb|4BYN|FF  Chain f, Cryo-em Reconstruction Of The 80s-eif5b-met...  61.2    1e-09   
ref|XP_003648435.1|  hypothetical protein Ecym_8340                   61.2    1e-09   
gb|EWG85556.1|  Rpl33ap                                               61.2    1e-09   
ref|NP_015182.1|  ribosomal 60S subunit protein L33A                  61.2    1e-09   
gb|ACN09951.1|  60S ribosomal protein L35a                            61.2    2e-09   
ref|XP_001902050.1|  60S ribosomal protein L35a                       61.2    2e-09   
ref|XP_458384.2|  60S ribosomal protein L33                           60.8    2e-09   
emb|CDP96537.1|  Protein Bm3270, isoform b                            61.2    2e-09   
gb|EUD73045.1|  50S ribosomal protein L35Ae                           61.6    2e-09   
gb|EPY52853.1|  60S ribosomal protein L35a                            60.8    2e-09   
ref|XP_739385.1|  Ribosomal protein                                   61.2    2e-09   
gb|EPS26985.1|  hypothetical protein PDE_01925                        60.8    2e-09   
ref|XP_001263593.1|  60S ribosomal protein L33                        60.8    2e-09   
dbj|GAA55199.1|  large subunit ribosomal protein L35Ae                61.6    2e-09   
gb|ELT90547.1|  hypothetical protein CAPTEDRAFT_219277                60.8    2e-09   
ref|XP_001931342.1|  60S ribosomal protein L33                        60.5    2e-09   
gb|KDN52034.1|  60S ribosomal protein L33-A-like protein              60.5    2e-09   
gb|KEZ44651.1|  hypothetical protein SAPIO_CDS3696                    60.5    2e-09   
gb|EME43510.1|  hypothetical protein DOTSEDRAFT_72778                 60.5    2e-09   
emb|CAJ17422.1|  ribosomal protein L35Ae                              60.8    2e-09   
emb|CDQ77583.1|  unnamed protein product                              61.2    3e-09   
gb|EKV19269.1|  60S ribosomal protein L35Ae                           60.5    3e-09   
gb|KFM60965.1|  60S ribosomal protein L35a                            60.5    3e-09   
ref|XP_453392.1|  60S ribosomal protein L33                           60.5    3e-09   
gb|EFZ16990.1|  hypothetical protein SINV_08617                       60.8    3e-09   
gb|KFR06053.1|  60S ribosomal protein L35a                            60.1    3e-09   
gb|KFO54880.1|  60S ribosomal protein L35a                            60.1    3e-09   
ref|XP_002373577.1|  60S ribosomal protein L33                        60.1    3e-09   
emb|CCA15530.1|  DEAD/DEAH box RNA helicase putative                  63.9    3e-09   
emb|CDR96441.1|  60S ribosomal protein L35a, putative                 60.5    3e-09   
emb|CCA15532.1|  DEAD/DEAH box RNA helicase putative                  63.9    3e-09   
ref|XP_726239.1|  ribosomal protein L35Ae                             60.8    3e-09   
ref|XP_001384038.1|  60S ribosomal protein L33                        60.1    3e-09   
ref|XP_660584.1|  hypothetical protein AN2980.2                       60.1    3e-09   
ref|XP_001208989.1|  60S ribosomal protein L33                        60.1    3e-09   
ref|XP_672762.1|  Ribosomal protein                                   60.8    3e-09   
gb|EGI68265.1|  60S ribosomal protein L35a                            60.5    3e-09   
ref|XP_007374897.1|  hypothetical protein SPAPADRAFT_60744            60.1    3e-09   
ref|XP_008720458.1|  60S ribosomal protein L33-B                      60.1    3e-09   
ref|XP_010112532.1|  Pentatricopeptide repeat-containing protein      63.9    3e-09   
ref|XP_005346544.1|  PREDICTED: 60S ribosomal protein L35a-like       60.1    3e-09   
ref|XP_011050046.1|  PREDICTED: 60S ribosomal protein L35a            60.5    3e-09   
gb|EFW14318.1|  60S ribosomal protein L33                             60.1    4e-09   
ref|XP_001270866.1|  60S ribosomal protein L33                        60.1    4e-09   
ref|XP_004222644.1|  60S ribosomal protein L33-B                      60.5    4e-09   
ref|XP_009929520.1|  PREDICTED: 60S ribosomal protein L35a            60.1    4e-09   
ref|XP_001615539.1|  60S ribosomal protein L33-B                      60.5    4e-09   
ref|XP_008642774.1|  PREDICTED: 60S ribosomal protein L35a            60.1    4e-09   
ref|XP_506094.2|  60S ribosomal protein L33                           60.1    4e-09   
ref|XP_009308846.1|  60S ribosomal protein L35A                       60.5    4e-09   
gb|ABZ04243.1|  ribosomal protein rpl35a                              60.1    4e-09   
gb|EYE99261.1|  60S ribosomal protein L35Ae                           59.7    4e-09   
ref|XP_006696084.1|  60S ribosomal protein l33-like protein           59.7    4e-09   
emb|CCD59845.1|  60S ribosomal protein L35a, putative                 60.1    4e-09   
ref|XP_005344919.1|  PREDICTED: 60S ribosomal protein L35a isofor...  59.7    5e-09   
emb|CAO94749.1|  putative ribosomal protein L35a                      59.7    5e-09   
ref|XP_003656653.1|  60S ribosomal protein L33                        59.7    5e-09   
ref|XP_010901593.1|  PREDICTED: 60S ribosomal protein L35a            59.7    5e-09   
ref|XP_009858899.1|  PREDICTED: r35a protein isoform X1               59.7    5e-09   
gb|EPX72570.1|  60S ribosomal protein L35a                            59.7    5e-09   
ref|XP_005362396.1|  PREDICTED: 60S ribosomal protein L35a-like       59.7    5e-09   
ref|XP_005357056.1|  PREDICTED: 60S ribosomal protein L35a-like       59.7    5e-09   
ref|XP_003844504.1|  hypothetical protein LEMA_P021550.1              60.5    5e-09   
gb|EFN83035.1|  60S ribosomal protein L35a                            60.1    5e-09   
gb|EZA49845.1|  60S ribosomal protein L35a                            60.1    5e-09   
gb|ACY74455.1|  ribosomal protein L35Ae                               59.7    5e-09   
ref|NP_001027677.1|  r35a protein                                     59.7    5e-09   
emb|CAX72790.1|  ribosomal protein L35a                               58.9    6e-09   
ref|XP_002582873.1|  60S ribosomal protein L33-A                      59.3    6e-09   
ref|XP_004197388.1|  Piso0_004640                                     59.3    6e-09   
gb|AAY66948.1|  ribosomal protein L35a                                60.1    6e-09   
gb|ACO12970.1|  60S ribosomal protein L35a                            59.3    6e-09   
gb|EFN70783.1|  60S ribosomal protein L35a                            59.7    7e-09   
ref|XP_007528667.1|  PREDICTED: 60S ribosomal protein L35a            59.3    7e-09   
ref|XP_007586029.1|  putative 60s ribosomal protein l33 protein       59.3    7e-09   
ref|XP_003699589.1|  PREDICTED: 60S ribosomal protein L35a-like       59.7    7e-09   
ref|XP_001645016.1|  hypothetical protein Kpol_1072p28                59.3    7e-09   
gb|AAX48869.1|  L35a                                                  59.3    7e-09   
emb|CCF48281.1|  probable RPL33B-ribosomal protein L35a.e.c15         58.9    7e-09   
gb|EFA74873.1|  S60 ribosomal protein L35a                            58.9    7e-09   
ref|XP_844368.1|  60S ribosomal protein L35A                          59.7    7e-09   
emb|CDW56021.1|  LIM and Ribosomal L35Ae domain containing protein    62.0    8e-09   
ref|XP_006637905.1|  PREDICTED: 60S ribosomal protein L35a-like       58.9    8e-09   
ref|XP_003658685.1|  hypothetical protein MYCTH_2313379               58.9    8e-09   
ref|XP_006955877.1|  60S ribosomal protein L33-A-like protein         58.9    8e-09   
ref|XP_008313714.1|  PREDICTED: 60S ribosomal protein L35a            58.9    8e-09   
gb|KEQ94619.1|  hypothetical protein AUEXF2481DRAFT_80298             58.9    8e-09   
emb|CDI55126.1|  probable RPL33B-ribosomal protein L35a.e.c15         58.9    8e-09   
dbj|BAF98686.1|  ribosomal protein L35a                               58.9    8e-09   
gb|ETS60249.1|  hypothetical protein PaG_05796                        59.3    9e-09   
gb|KEQ76225.1|  60S ribosomal protein L33-A                           58.9    9e-09   
ref|XP_007741205.1|  60S ribosomal protein L33-B                      58.9    9e-09   
ref|XP_005997405.1|  PREDICTED: 60S ribosomal protein L35a isofor...  58.9    9e-09   
ref|XP_006689331.1|  hypothetical protein CANTEDRAFT_127006           58.9    1e-08   
ref|XP_001463655.1|  putative ribosomal protein l35a                  59.3    1e-08   
ref|XP_002840256.1|  60S ribosomal protein L33                        58.9    1e-08   
dbj|GAC77679.1|  molecular chaperone                                  59.7    1e-08   
gb|EEQ45976.1|  60S ribosomal protein L33-A                           58.9    1e-08   
ref|XP_003872843.1|  putative ribosomal protein l35a                  59.3    1e-08   
gb|EPQ62532.1|  Ribosomal protein L37 of the large (60S) ribosoma...  58.5    1e-08   
gb|KHN88037.1|  60S ribosomal protein L35a                            59.3    1e-08   
ref|XP_001400340.1|  60S ribosomal protein L33                        58.5    1e-08   
ref|XP_003978914.1|  PREDICTED: 60S ribosomal protein L35a-like       58.5    1e-08   
dbj|GAK66452.1|  60S ribosomal protein L33                            60.5    1e-08   
ref|XP_003485411.1|  PREDICTED: 60S ribosomal protein L35a-like       59.3    1e-08   
ref|XP_005371381.1|  PREDICTED: 60S ribosomal protein L35a-like       58.5    1e-08   
ref|XP_002171463.1|  60S ribosomal protein L35a                       58.5    1e-08   
ref|NP_001187216.1|  60S ribosomal protein L35a                       58.5    1e-08   
ref|XP_009064163.1|  hypothetical protein LOTGIDRAFT_146218           58.5    1e-08   
ref|XP_003388997.1|  PREDICTED: 60S ribosomal protein L35a-like       58.5    1e-08   
emb|CAG02142.1|  unnamed protein product                              58.5    1e-08   
ref|XP_003398022.1|  PREDICTED: 60S ribosomal protein L35a-like       58.9    1e-08   
ref|XP_009060646.1|  hypothetical protein LOTGIDRAFT_234467           58.5    1e-08   
ref|XP_002153441.1|  60S ribosomal protein L35Ae                      58.2    1e-08   
ref|XP_002593397.1|  hypothetical protein BRAFLDRAFT_277091           58.5    1e-08   
ref|XP_002490390.1|  60S ribosomal protein L33                        58.2    1e-08   
ref|XP_007917238.1|  putative 60s ribosomal protein l33 protein       58.2    1e-08   
ref|XP_003866695.1|  Rpl33a protein                                   58.2    1e-08   
gb|EFQ26539.1|  ribosomal protein L35Ae                               58.2    1e-08   
emb|CDM31936.1|  Ribosomal protein L35A                               58.2    2e-08   
gb|EIF47778.1|  60s ribosomal protein l33-a                           58.2    2e-08   
gb|EPY49930.1|  60S ribosomal protein L35a                            58.2    2e-08   
ref|XP_009966887.1|  PREDICTED: 60S ribosomal protein L35a            58.2    2e-08   
sp|P0DJ22.1|RL35A_TETTS  RecName: Full=60S ribosomal protein L35a     58.2    2e-08   
ref|XP_010748069.1|  PREDICTED: 60S ribosomal protein L35a            58.2    2e-08   
gb|EDV10809.1|  ribosomal protein L33B                                58.2    2e-08   



>ref|XP_010098514.1| 60S ribosomal protein L35a-3 [Morus notabilis]
 gb|EXB75174.1| 60S ribosomal protein L35a-3 [Morus notabilis]
Length=112

 Score =   125 bits (315),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWY+GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYRGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_006355672.1| PREDICTED: 60S ribosomal protein L35a-3-like [Solanum tuberosum]
Length=112

 Score =   125 bits (313),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY RGT+LGYKRSKSNQYPNTSL+QIEGVNTKEEVDWY GKRMAYVYKA
Sbjct  1    MVKGRQGERVRLYTRGTVLGYKRSKSNQYPNTSLVQIEGVNTKEEVDWYLGKRMAYVYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_009766547.1| PREDICTED: 60S ribosomal protein L35a-3-like [Nicotiana sylvestris]
Length=112

 Score =   125 bits (313),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYP+TSLIQIEGVNTKEEVDWY GKRMAYVYKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPSTSLIQIEGVNTKEEVDWYLGKRMAYVYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_004239927.1| PREDICTED: 60S ribosomal protein L35a-3 [Solanum lycopersicum]
 ref|XP_006355673.1| PREDICTED: 60S ribosomal protein L35a-3-like [Solanum tuberosum]
 ref|XP_010321445.1| PREDICTED: 60S ribosomal protein L35a-3 [Solanum lycopersicum]
Length=112

 Score =   125 bits (313),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY RGT+LGYKRSKSNQYPNTSL+QIEGVNTKEEVDWY GKRMAYVYKA
Sbjct  1    MVKGRQGERVRLYTRGTVLGYKRSKSNQYPNTSLVQIEGVNTKEEVDWYLGKRMAYVYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|NP_001275273.1| 60S ribosomal protein L35a-3-like [Solanum tuberosum]
 gb|AFW90559.1| 60S ribosomal protein L33 [Solanum tuberosum]
Length=112

 Score =   125 bits (313),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY RGT+LGYKRSKSNQYPNTSL+QIEGVNTKEEVDWY GKRMAYVYKA
Sbjct  1    MVKGRQGERVRLYTRGTVLGYKRSKSNQYPNTSLVQIEGVNTKEEVDWYLGKRMAYVYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_010537386.1| PREDICTED: 60S ribosomal protein L35a-3 [Tarenaya hassleriana]
Length=112

 Score =   124 bits (312),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSL+QIEGVNT+EEV WYQGKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEEVSWYQGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_010093499.1| 60S ribosomal protein L35a-3 [Morus notabilis]
 gb|EXB54152.1| 60S ribosomal protein L35a-3 [Morus notabilis]
Length=130

 Score =   125 bits (313),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQ+EGVNTKEEVDWY+GKR+AY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVDWYRGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_009587506.1| PREDICTED: 60S ribosomal protein L35a-3-like [Nicotiana tomentosiformis]
Length=112

 Score =   124 bits (311),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYP+TSLIQIEGVNTKEEVDWY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPSTSLIQIEGVNTKEEVDWYLGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_009590569.1| PREDICTED: 60S ribosomal protein L35a-3 [Nicotiana tomentosiformis]
 ref|XP_009602686.1| PREDICTED: 60S ribosomal protein L35a-3 [Nicotiana tomentosiformis]
 ref|XP_009787662.1| PREDICTED: 60S ribosomal protein L35a-3 [Nicotiana sylvestris]
Length=112

 Score =   124 bits (311),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYP+TSLIQIEGVNTKEEVDWY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPSTSLIQIEGVNTKEEVDWYLGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|NP_177567.1| 60S ribosomal protein L35a-3 [Arabidopsis thaliana]
 ref|XP_002888970.1| 60S ribosomal protein L35a [Arabidopsis lyrata subsp. lyrata]
 sp|Q9C912.1|R35A3_ARATH RecName: Full=60S ribosomal protein L35a-3 [Arabidopsis thaliana]
 gb|AAG52401.1|AC020579_3 putative ribosomal protein; 23489-24540 [Arabidopsis thaliana]
 gb|AAK44135.1|AF370320_1 putative ribosomal protein [Arabidopsis thaliana]
 gb|AAL34282.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAM63166.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|EFH65229.1| 60S ribosomal protein L35a [Arabidopsis lyrata subsp. lyrata]
 gb|AEE35572.1| 60S ribosomal protein L35a-3 [Arabidopsis thaliana]
Length=112

 Score =   124 bits (310),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSL+QIEGVNT+EEV+WY+GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_009762681.1| PREDICTED: 60S ribosomal protein L35a-3-like [Nicotiana sylvestris]
Length=112

 Score =   123 bits (309),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RGT+LGYKRSKSNQYP+TSLIQIEGVNTKEEVDWY GKRMAY+YKA
Sbjct  1    MVKGRQGERIRLYVRGTVLGYKRSKSNQYPSTSLIQIEGVNTKEEVDWYLGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>gb|KHG07851.1| 60S ribosomal L35a-1 -like protein [Gossypium arboreum]
Length=162

 Score =   124 bits (312),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  KMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYK  16
            KMVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YK
Sbjct  50   KMVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRMAYIYK  109

Query  15   AKTKK  1
            AK KK
Sbjct  110  AKVKK  114



>ref|XP_011094957.1| PREDICTED: 60S ribosomal protein L35a-3-like [Sesamum indicum]
 ref|XP_011094959.1| PREDICTED: 60S ribosomal protein L35a-3-like [Sesamum indicum]
Length=112

 Score =   123 bits (309),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT+EEV WYQGKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTQEEVAWYQGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_006390443.1| hypothetical protein EUTSA_v10019342mg [Eutrema salsugineum]
 gb|ESQ27729.1| hypothetical protein EUTSA_v10019342mg [Eutrema salsugineum]
Length=112

 Score =   123 bits (308),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT+EEV WY+GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTQEEVTWYKGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>gb|KHG28839.1| 60S ribosomal L35a-3 -like protein [Gossypium arboreum]
Length=126

 Score =   123 bits (309),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_006368064.1| PREDICTED: 60S ribosomal protein L35a-3-like [Solanum tuberosum]
Length=112

 Score =   123 bits (308),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNTKEEVDWY GKR+ Y+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYLGKRLGYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>gb|AAK25760.1|AF334840_1 ribosomal protein L33 [Castanea sativa]
Length=112

 Score =   122 bits (307),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAYVYKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYAGKRMAYVYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_009104770.1| PREDICTED: 60S ribosomal protein L35a-1 [Brassica rapa]
 ref|XP_009106087.1| PREDICTED: 60S ribosomal protein L35a-1 [Brassica rapa]
 emb|CDX96529.1| BnaA07g31400D [Brassica napus]
 emb|CDX85822.1| BnaC06g23120D [Brassica napus]
 emb|CDX73072.1| BnaC06g35200D [Brassica napus]
 emb|CDX68191.1| BnaA07g22310D [Brassica napus]
Length=112

 Score =   122 bits (307),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT EEV WY+GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTTEEVTWYKGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>gb|KHG27158.1| 60S ribosomal protein L35a-3 [Gossypium arboreum]
Length=116

 Score =   123 bits (308),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|KHG27159.1| 60S ribosomal protein L35a-1 [Gossypium arboreum]
Length=111

 Score =   122 bits (307),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|ABK22625.1| unknown [Picea sitchensis]
 gb|ABK26787.1| unknown [Picea sitchensis]
Length=112

 Score =   122 bits (307),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RG ILGYKRSKSNQYPNTSLIQIEGVNT EEVDWY+GKRMAY+YKA
Sbjct  1    MVKGRQGERIRLYVRGIILGYKRSKSNQYPNTSLIQIEGVNTPEEVDWYRGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>gb|ABK20910.1| unknown [Picea sitchensis]
 gb|ABK25279.1| unknown [Picea sitchensis]
Length=112

 Score =   122 bits (307),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RG ILGYKRSKSNQYPNTSLIQIEGVNT EEVDWY+GKRMAY+YKA
Sbjct  1    MVKGRQGERIRLYVRGIILGYKRSKSNQYPNTSLIQIEGVNTPEEVDWYRGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_004235258.1| PREDICTED: 60S ribosomal protein L35a-2 [Solanum lycopersicum]
Length=112

 Score =   122 bits (306),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNTKEEVDWY GKR+ Y+YKA
Sbjct  1    MVKGRQGERIRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYLGKRLGYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_002312115.1| hypothetical protein POPTR_0008s05970g [Populus trichocarpa]
 ref|XP_006379607.1| 60S ribosomal protein L35a [Populus trichocarpa]
 ref|XP_011034000.1| PREDICTED: 60S ribosomal protein L35a-1-like [Populus euphratica]
 gb|ABK95927.1| unknown [Populus trichocarpa]
 gb|EEE89482.1| hypothetical protein POPTR_0008s05970g [Populus trichocarpa]
 gb|ERP57404.1| 60S ribosomal protein L35a [Populus trichocarpa]
Length=112

 Score =   122 bits (306),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_007158891.1| hypothetical protein PHAVU_002G190400g [Phaseolus vulgaris]
 gb|ESW30885.1| hypothetical protein PHAVU_002G190400g [Phaseolus vulgaris]
Length=108

 Score =   122 bits (306),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|ACJ02349.1| 60S ribosomal protein L35a [Vernicia fordii]
Length=112

 Score =   122 bits (306),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|NP_172188.1| 60S ribosomal protein L35a-1 [Arabidopsis thaliana]
 ref|XP_002889631.1| 60S ribosomal protein L35a [Arabidopsis lyrata subsp. lyrata]
 sp|Q9LMK0.1|R35A1_ARATH RecName: Full=60S ribosomal protein L35a-1 [Arabidopsis thaliana]
 gb|AAF82213.1|AC067971_21 Strong similarity to a ribosomal protein from Arabidopsis thaliana 
gb|AL161667. It contains a ribosomal protein L35Ae domain 
PF|01247 [Arabidopsis thaliana]
 gb|AAM63844.1| ribosomal protein, putative [Arabidopsis thaliana]
 dbj|BAC43636.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42960.1| At1g07070 [Arabidopsis thaliana]
 gb|EFH65890.1| 60S ribosomal protein L35a [Arabidopsis lyrata subsp. lyrata]
 gb|AEE28074.1| 60S ribosomal protein L35a-1 [Arabidopsis thaliana]
Length=112

 Score =   122 bits (306),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSL+Q+EGVNT EEV WY+GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQVEGVNTTEEVSWYKGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_009128039.1| PREDICTED: 60S ribosomal protein L35a-1-like [Brassica rapa]
Length=112

 Score =   122 bits (306),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT EEV WY+GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTTEEVTWYKGKRMAYLYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_007158890.1| hypothetical protein PHAVU_002G190400g [Phaseolus vulgaris]
 gb|ESW30884.1| hypothetical protein PHAVU_002G190400g [Phaseolus vulgaris]
Length=112

 Score =   122 bits (306),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|ADR71255.1| 60S ribosomal protein L35aA [Hevea brasiliensis]
Length=112

 Score =   122 bits (306),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_002277272.1| PREDICTED: 60S ribosomal protein L35a-1 [Vitis vinifera]
 ref|XP_002280039.1| PREDICTED: 60S ribosomal protein L35a-1 [Vitis vinifera]
 emb|CAN64195.1| hypothetical protein VITISV_014336 [Vitis vinifera]
 emb|CBI31548.3| unnamed protein product [Vitis vinifera]
 emb|CBI30443.3| unnamed protein product [Vitis vinifera]
Length=112

 Score =   122 bits (306),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_010251466.1| PREDICTED: 60S ribosomal protein L35a-1 [Nelumbo nucifera]
Length=112

 Score =   122 bits (305),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|KHG03002.1| 60S ribosomal protein L35a-3 [Gossypium arboreum]
 gb|KHG29932.1| 60S ribosomal protein L35a-3 [Gossypium arboreum]
Length=153

 Score =   123 bits (308),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|KDP44839.1| hypothetical protein JCGZ_01339 [Jatropha curcas]
Length=112

 Score =   122 bits (305),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_006429267.1| hypothetical protein CICLE_v10013164mg [Citrus clementina]
 ref|XP_006429268.1| hypothetical protein CICLE_v10013164mg [Citrus clementina]
 ref|XP_006480941.1| PREDICTED: 60S ribosomal protein L35a-1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006480942.1| PREDICTED: 60S ribosomal protein L35a-1-like isoform X2 [Citrus 
sinensis]
 gb|ESR42507.1| hypothetical protein CICLE_v10013164mg [Citrus clementina]
 gb|ESR42508.1| hypothetical protein CICLE_v10013164mg [Citrus clementina]
 gb|KDO58035.1| hypothetical protein CISIN_1g033764mg [Citrus sinensis]
Length=112

 Score =   122 bits (305),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQ+EGVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVAWYCGKRLAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_006417848.1| hypothetical protein EUTSA_v10009155mg [Eutrema salsugineum]
 gb|ESQ36201.1| hypothetical protein EUTSA_v10009155mg [Eutrema salsugineum]
Length=112

 Score =   122 bits (305),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSL+Q+EGVNT EEV WY+GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQVEGVNTTEEVAWYKGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>gb|KHG03001.1| 60S ribosomal protein L35a-3 [Gossypium arboreum]
 gb|KHG29931.1| 60S ribosomal protein L35a-3 [Gossypium arboreum]
Length=112

 Score =   122 bits (305),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_004512402.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cicer arietinum]
Length=112

 Score =   121 bits (304),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSL+QIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTKEEVSWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_010539981.1| PREDICTED: 60S ribosomal protein L35a-3-like [Tarenaya hassleriana]
Length=112

 Score =   121 bits (304),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSL+QIEGVNT+EEV WY+GK+MAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEEVSWYRGKKMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>gb|EPS72675.1| hypothetical protein M569_02083, partial [Genlisea aurea]
Length=115

 Score =   122 bits (305),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -3

Query  198  SKMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVY  19
            S MVKGRQGER+RLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT+EEV WY GKRMAY+Y
Sbjct  2    SAMVKGRQGERIRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTQEEVAWYLGKRMAYIY  61

Query  18   KAKTKK  1
            KAK KK
Sbjct  62   KAKVKK  67



>ref|XP_011077602.1| PREDICTED: 60S ribosomal protein L35a-3 [Sesamum indicum]
Length=112

 Score =   121 bits (304),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT+EEV WY+GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTQEEVAWYRGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_002316240.1| 60S ribosomal protein L35a [Populus trichocarpa]
 gb|ABK93065.1| unknown [Populus trichocarpa]
 gb|EEF02411.1| 60S ribosomal protein L35a [Populus trichocarpa]
Length=112

 Score =   121 bits (304),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSL+Q+EGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQVEGVNTKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_011036020.1| PREDICTED: 60S ribosomal protein L35a-1 [Populus euphratica]
Length=112

 Score =   121 bits (303),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSL+Q+EGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQVEGVNTKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_002315206.1| ribosomal protein L33 [Populus trichocarpa]
 ref|XP_011002616.1| PREDICTED: 60S ribosomal protein L35a-1-like [Populus euphratica]
 ref|XP_011002617.1| PREDICTED: 60S ribosomal protein L35a-1-like [Populus euphratica]
 gb|EEF01377.1| ribosomal protein L33 [Populus trichocarpa]
Length=112

 Score =   121 bits (303),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K K+
Sbjct  61   KVKR  64



>ref|XP_006435563.1| hypothetical protein CICLE_v10033116mg [Citrus clementina]
 ref|XP_006486456.1| PREDICTED: 60S ribosomal protein L35a-1-like [Citrus sinensis]
 gb|ESR48803.1| hypothetical protein CICLE_v10033116mg [Citrus clementina]
 gb|KDO69263.1| hypothetical protein CISIN_1g033755mg [Citrus sinensis]
 gb|KDO69264.1| hypothetical protein CISIN_1g033755mg [Citrus sinensis]
Length=112

 Score =   121 bits (303),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEDVSWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_004490943.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cicer arietinum]
Length=112

 Score =   121 bits (303),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSL+QIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|NP_001235514.1| uncharacterized protein LOC100305958 [Glycine max]
 gb|ACU13896.1| unknown [Glycine max]
 gb|KHN28942.1| 60S ribosomal protein L35a-3 [Glycine soja]
Length=112

 Score =   120 bits (302),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GK+MAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYAGKKMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_010428409.1| PREDICTED: 60S ribosomal protein L35a-3-like [Camelina sativa]
Length=112

 Score =   120 bits (302),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVK RQGERVRLY+RGTILGYKRSKSNQYPNTSL+QIEGVNT+EEV+WY+GKRMAY+YKA
Sbjct  1    MVKERQGERVRLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_002311198.1| ribosomal protein L33 [Populus trichocarpa]
 ref|XP_006379617.1| hypothetical protein POPTR_0008s06370g [Populus trichocarpa]
 ref|XP_011039115.1| PREDICTED: 60S ribosomal protein L35a-1-like [Populus euphratica]
 ref|XP_011039191.1| PREDICTED: 60S ribosomal protein L35a-1-like [Populus euphratica]
 ref|XP_011039265.1| PREDICTED: 60S ribosomal protein L35a-1-like [Populus euphratica]
 gb|ABK93583.1| unknown [Populus trichocarpa]
 gb|ABK94271.1| unknown [Populus trichocarpa]
 gb|EEE88565.1| ribosomal protein L33 [Populus trichocarpa]
 gb|ERP57414.1| hypothetical protein POPTR_0008s06370g [Populus trichocarpa]
Length=112

 Score =   120 bits (302),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K K+
Sbjct  61   KVKR  64



>gb|KCW50525.1| hypothetical protein EUGRSUZ_J00247 [Eucalyptus grandis]
Length=101

 Score =   120 bits (301),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNT+EEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|KCW50524.1| hypothetical protein EUGRSUZ_J00247 [Eucalyptus grandis]
Length=101

 Score =   120 bits (301),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNT+EEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|KCW62067.1| hypothetical protein EUGRSUZ_H04737 [Eucalyptus grandis]
Length=113

 Score =   120 bits (302),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT+EEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTQEEVAWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_010416278.1| PREDICTED: 60S ribosomal protein L35a-3 [Camelina sativa]
Length=112

 Score =   120 bits (302),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVK RQGERVRLY+RGTILGYKRSKSNQYPNTSL+QIEGVNT+EEV+WY+GKRMAY+YKA
Sbjct  1    MVKERQGERVRLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_010025413.1| PREDICTED: 60S ribosomal protein L35a-3-like [Eucalyptus grandis]
 gb|KCW62066.1| hypothetical protein EUGRSUZ_H04737 [Eucalyptus grandis]
Length=112

 Score =   120 bits (302),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT+EEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTQEEVAWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>emb|CDP14006.1| unnamed protein product [Coffea canephora]
Length=112

 Score =   120 bits (302),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GK+MAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYLGKKMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_010031264.1| PREDICTED: 60S ribosomal protein L35a-3 [Eucalyptus grandis]
 gb|KCW50523.1| hypothetical protein EUGRSUZ_J00247 [Eucalyptus grandis]
Length=112

 Score =   120 bits (302),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNT+EEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_007026815.1| Ribosomal protein L35Ae family protein isoform 1 [Theobroma cacao]
 ref|XP_007026816.1| Ribosomal protein L35Ae family protein isoform 1 [Theobroma cacao]
 ref|XP_007026817.1| Ribosomal protein L35Ae family protein isoform 1 [Theobroma cacao]
 gb|EOY07317.1| Ribosomal protein L35Ae family protein isoform 1 [Theobroma cacao]
 gb|EOY07318.1| Ribosomal protein L35Ae family protein isoform 1 [Theobroma cacao]
 gb|EOY07319.1| Ribosomal protein L35Ae family protein isoform 1 [Theobroma cacao]
Length=112

 Score =   120 bits (302),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVN+KEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNSKEEVGWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_010534064.1| PREDICTED: 60S ribosomal protein L35a-3-like [Tarenaya hassleriana]
Length=112

 Score =   120 bits (301),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSL+QIEGVNT+EEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEEVSWYLGKRMAYIYKA  60

Query  12   KTKK  1
            KTK+
Sbjct  61   KTKQ  64



>ref|XP_010471515.1| PREDICTED: 60S ribosomal protein L35a-3-like [Camelina sativa]
Length=112

 Score =   120 bits (301),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVK RQGERVRLY+RGTILGYKRSKSNQYPNTSL+QIEGVNT+EEV+WY+GKRMAY+YKA
Sbjct  1    MVKERQGERVRLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>emb|CDP14072.1| unnamed protein product [Coffea canephora]
Length=112

 Score =   120 bits (301),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GK+MAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYLGKKMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_010927256.1| PREDICTED: 60S ribosomal protein L35a-1-like, partial [Elaeis 
guineensis]
Length=154

 Score =   121 bits (304),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -3

Query  201  QSKMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYV  22
             +KMVKGRQGERVRLY+RGTILGYKRSKSNQY NTSLIQIEGVNTKEEV WY GKRMAY+
Sbjct  40   SAKMVKGRQGERVRLYVRGTILGYKRSKSNQYENTSLIQIEGVNTKEEVAWYCGKRMAYI  99

Query  21   YKAKTK  4
            YKAKTK
Sbjct  100  YKAKTK  105



>ref|XP_010534541.1| PREDICTED: 60S ribosomal protein L35a-3 [Tarenaya hassleriana]
 ref|XP_010554629.1| PREDICTED: 60S ribosomal protein L35a-3-like [Tarenaya hassleriana]
 ref|XP_010554630.1| PREDICTED: 60S ribosomal protein L35a-3-like [Tarenaya hassleriana]
Length=112

 Score =   120 bits (300),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSL+QIEGVNT+EEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEEVAWYLGKRMAYIYKA  60

Query  12   KTKK  1
            KTK+
Sbjct  61   KTKQ  64



>ref|XP_004494288.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cicer arietinum]
Length=112

 Score =   120 bits (300),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSL+QIEGVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>emb|CDY49119.1| BnaA02g16870D [Brassica napus]
 emb|CDY42422.1| BnaC02g22860D [Brassica napus]
Length=112

 Score =   120 bits (300),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT EEV WY+GK MAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTTEEVTWYKGKGMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_010251468.1| PREDICTED: 60S ribosomal protein L35a-1-like [Nelumbo nucifera]
Length=112

 Score =   120 bits (300),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVK RQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKSRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_006292080.1| hypothetical protein CARUB_v10018275mg [Capsella rubella]
 ref|XP_010504443.1| PREDICTED: 60S ribosomal protein L35a-4 [Camelina sativa]
 ref|XP_010516163.1| PREDICTED: 60S ribosomal protein L35a-4 [Camelina sativa]
 ref|XP_010427366.1| PREDICTED: 60S ribosomal protein L35a-4 [Camelina sativa]
 gb|EOA24978.1| hypothetical protein CARUB_v10018275mg [Capsella rubella]
Length=111

 Score =   120 bits (300),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQGERVRLY+RGT+LGYKRSKSNQYPNTSL+QIEGVNT+EEV+WY+GKRMAY+YKAK
Sbjct  1    MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRMAYIYKAK  60

Query  9    TKK  1
            TKK
Sbjct  61   TKK  63



>gb|EPS74388.1| hypothetical protein M569_00370 [Genlisea aurea]
Length=112

 Score =   120 bits (300),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT+EEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERIRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTQEEVSWYTGKRMAYIYKA  60

Query  12   KTKK  1
            K K+
Sbjct  61   KVKR  64



>ref|XP_010487099.1| PREDICTED: 60S ribosomal protein L35a-1 [Camelina sativa]
 ref|XP_010457870.1| PREDICTED: 60S ribosomal protein L35a-1 [Camelina sativa]
 ref|XP_010475459.1| PREDICTED: 60S ribosomal protein L35a-1 [Camelina sativa]
Length=112

 Score =   120 bits (300),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGE VRLY+RGTILGYKRSKSNQYPNTSLIQ+EGVNT EEV WY+GKRMAY+YKA
Sbjct  1    MVKGRQGEPVRLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTTEEVGWYKGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>emb|CDY02958.1| BnaC04g25280D [Brassica napus]
Length=111

 Score =   119 bits (299),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNT EEV+WY+GKRMAY+YKAK
Sbjct  1    MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTTEEVNWYKGKRMAYIYKAK  60

Query  9    TKK  1
            TKK
Sbjct  61   TKK  63



>gb|EYU41823.1| hypothetical protein MIMGU_mgv1a015450mg [Erythranthe guttata]
Length=157

 Score =   121 bits (303),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -3

Query  198  SKMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVY  19
            + MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNT+EEV WY GK+MAY+Y
Sbjct  44   AAMVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVAWYLGKKMAYIY  103

Query  18   KAKTKK  1
            KAK KK
Sbjct  104  KAKVKK  109



>emb|CDX72205.1| BnaC08g26690D [Brassica napus]
Length=111

 Score =   119 bits (299),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNT EEV+WY+GKRMAY+YKAK
Sbjct  1    MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTTEEVNWYKGKRMAYIYKAK  60

Query  9    TKK  1
            TKK
Sbjct  61   TKK  63



>emb|CDY27268.1| BnaA09g35340D [Brassica napus]
Length=111

 Score =   119 bits (299),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNT EEV+WY GKRMAY+YKAK
Sbjct  1    MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTTEEVNWYNGKRMAYIYKAK  60

Query  9    TKK  1
            TKK
Sbjct  61   TKK  63



>ref|NP_001241369.1| uncharacterized protein LOC100800463 [Glycine max]
 gb|ACU19186.1| unknown [Glycine max]
 gb|KHN25917.1| 60S ribosomal protein L35a-1 [Glycine soja]
Length=112

 Score =   119 bits (298),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVN KEEV WY GK+MAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNAKEEVAWYAGKKMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_009763834.1| PREDICTED: 60S ribosomal protein L35a-3-like [Nicotiana sylvestris]
Length=112

 Score =   119 bits (297),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKG QGERVRLY+RGTILGYKRSKSNQYP+TSLIQIEGVN K+EVDWY GKRMAY+YKA
Sbjct  1    MVKGCQGERVRLYVRGTILGYKRSKSNQYPSTSLIQIEGVNNKKEVDWYLGKRMAYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>gb|KFK43006.1| hypothetical protein AALP_AA1G067100 [Arabis alpina]
Length=112

 Score =   119 bits (297),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGE VRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT EEV WY+GKRM Y+YKA
Sbjct  1    MVKGRQGENVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTTEEVAWYKGKRMGYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|NP_174951.1| 60S ribosomal protein L35a-2 [Arabidopsis thaliana]
 ref|XP_002876331.1| 60S ribosomal protein L35a [Arabidopsis lyrata subsp. lyrata]
 sp|Q9FZH0.1|R35A2_ARATH RecName: Full=60S ribosomal protein L35a-2 [Arabidopsis thaliana]
 gb|AAF99832.1|AC008046_4 Putative ribosomal protein [Arabidopsis thaliana]
 gb|AAK48976.1|AF370549_1 Putative ribosomal protein [Arabidopsis thaliana]
 gb|AAM61069.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAP21325.1| At1g41880 [Arabidopsis thaliana]
 gb|EFH52590.1| 60S ribosomal protein L35a [Arabidopsis lyrata subsp. lyrata]
 gb|AEE31912.1| 60S ribosomal protein L35a-2 [Arabidopsis thaliana]
Length=111

 Score =   119 bits (297),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNT+EEV+WY+GKR+AY+YKAK
Sbjct  1    MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVNWYKGKRLAYIYKAK  60

Query  9    TKK  1
            TKK
Sbjct  61   TKK  63



>ref|XP_004172769.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cucumis sativus]
 ref|XP_008463199.1| PREDICTED: 60S ribosomal protein L35a-1 [Cucumis melo]
 gb|KGN50623.1| hypothetical protein Csa_5G198130 [Cucumis sativus]
Length=112

 Score =   119 bits (297),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY RGTILGYKRSKSNQYPNTSL+QIEGVN+K+EV WYQGKR+AY+YKA
Sbjct  1    MVKGRQGERVRLYTRGTILGYKRSKSNQYPNTSLLQIEGVNSKDEVSWYQGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_009139139.1| PREDICTED: 60S ribosomal protein L35a-1-like [Brassica rapa]
 emb|CDX76074.1| BnaA04g03380D [Brassica napus]
Length=111

 Score =   119 bits (297),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNT EEV WY+GKRMAY+YKAK
Sbjct  1    MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTTEEVTWYKGKRMAYIYKAK  60

Query  9    TKK  1
            TKK
Sbjct  61   TKK  63



>gb|EYU26636.1| hypothetical protein MIMGU_mgv1a016658mg [Erythranthe guttata]
 gb|EYU26637.1| hypothetical protein MIMGU_mgv1a016658mg [Erythranthe guttata]
Length=112

 Score =   119 bits (297),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNT+EEV WY GKR+AY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVAWYLGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_009344398.1| PREDICTED: 60S ribosomal protein L35a-1-like [Pyrus x bretschneideri]
Length=112

 Score =   119 bits (297),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKGRQGERIRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTK  4
            K K
Sbjct  61   KVK  63



>ref|XP_009351088.1| PREDICTED: 60S ribosomal protein L35a-1 [Pyrus x bretschneideri]
Length=112

 Score =   119 bits (297),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKGRQGERIRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTK  4
            K K
Sbjct  61   KVK  63



>ref|NP_001236077.1| uncharacterized protein LOC100305997 [Glycine max]
 gb|ACU13956.1| unknown [Glycine max]
 gb|KHN13090.1| 60S ribosomal protein L35a-1 [Glycine soja]
Length=112

 Score =   118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RG+ILGYKRSKSNQYPNTSLIQIE VNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGSILGYKRSKSNQYPNTSLIQIENVNTKEEVAWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|NP_191134.1| 60S ribosomal protein L35a-4 [Arabidopsis thaliana]
 sp|P51422.2|R35A4_ARATH RecName: Full=60S ribosomal protein L35a-4 [Arabidopsis thaliana]
 gb|AAL38628.1|AF446895_1 AT3g55750/F1I16_160 [Arabidopsis thaliana]
 emb|CAB81600.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAK96584.1| AT3g55750/F1I16_160 [Arabidopsis thaliana]
 gb|AAM65184.1| ribosomal protein L35a-like [Arabidopsis thaliana]
 gb|AEE79430.1| 60S ribosomal protein L35a-4 [Arabidopsis thaliana]
Length=111

 Score =   118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQGERVRLY+RGT+LGYKRSKSNQYPNTSL+QIEGVNT+EEV+WY+GKR+AY+YKAK
Sbjct  1    MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRLAYIYKAK  60

Query  9    TKK  1
            TKK
Sbjct  61   TKK  63



>ref|XP_004308915.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Fragaria vesca subsp. vesca]
Length=498

 Score =   125 bits (313),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|AFK49212.1| unknown [Medicago truncatula]
 gb|KEH15646.1| 60S ribosomal protein L35a-3 [Medicago truncatula]
Length=112

 Score =   118 bits (295),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSK NQYPNTSL+QIEGVNTKEEV WY GK+MAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKVNQYPNTSLVQIEGVNTKEEVAWYAGKKMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_008791426.1| PREDICTED: 60S ribosomal protein L35a-1 [Phoenix dactylifera]
 ref|XP_008812556.1| PREDICTED: 60S ribosomal protein L35a-1 [Phoenix dactylifera]
 ref|XP_008812557.1| PREDICTED: 60S ribosomal protein L35a-1 [Phoenix dactylifera]
 ref|XP_010913675.1| PREDICTED: 60S ribosomal protein L35a-1 [Elaeis guineensis]
Length=112

 Score =   118 bits (295),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQY NTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYENTSLIQIEGVNTKEEVAWYCGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_008800888.1| PREDICTED: 60S ribosomal protein L35a-1-like [Phoenix dactylifera]
 ref|XP_010924214.1| PREDICTED: 60S ribosomal protein L35a-1-like [Elaeis guineensis]
 ref|XP_010911069.1| PREDICTED: 60S ribosomal protein L35a-1-like [Elaeis guineensis]
Length=112

 Score =   118 bits (295),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQY NTSLIQIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYENTSLIQIEGVNTKEEVAWYCGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>gb|KFK41874.1| hypothetical protein AALP_AA2G182500 [Arabis alpina]
Length=112

 Score =   118 bits (295),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQYPNTSL+QIEGVNT EEV WY+GK++ Y+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTTEEVSWYKGKKLGYIYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_010256722.1| PREDICTED: 60S ribosomal protein L35a-3-like [Nelumbo nucifera]
Length=112

 Score =   118 bits (295),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKR+AY+YK 
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYCGKRLAYIYKG  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_009415151.1| PREDICTED: 60S ribosomal protein L35a-1 [Musa acuminata subsp. 
malaccensis]
Length=112

 Score =   117 bits (294),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYENTSLVQIEGVNTKEEVAWYCGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_009420647.1| PREDICTED: 60S ribosomal protein L35a-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420656.1| PREDICTED: 60S ribosomal protein L35a-1-like [Musa acuminata 
subsp. malaccensis]
Length=112

 Score =   117 bits (294),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYENTSLVQIEGVNTKEEVAWYCGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_009385078.1| PREDICTED: 60S ribosomal protein L35a-1-like [Musa acuminata 
subsp. malaccensis]
Length=112

 Score =   117 bits (294),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYENTSLVQIEGVNTKEEVAWYCGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_007009114.1| Ribosomal protein L35Ae family protein isoform 2 [Theobroma cacao]
 gb|EOY17924.1| Ribosomal protein L35Ae family protein isoform 2 [Theobroma cacao]
Length=105

 Score =   117 bits (293),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQY NTSLIQIEGVN+KEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYTNTSLIQIEGVNSKEEVAWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_007141808.1| hypothetical protein PHAVU_008G227300g [Phaseolus vulgaris]
 gb|ESW13802.1| hypothetical protein PHAVU_008G227300g [Phaseolus vulgaris]
Length=112

 Score =   117 bits (294),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RG+ILGYKRSKSNQYPNTSLIQIE VN+KEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGSILGYKRSKSNQYPNTSLIQIENVNSKEEVGWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_009405711.1| PREDICTED: 60S ribosomal protein L35a-1 [Musa acuminata subsp. 
malaccensis]
Length=112

 Score =   117 bits (293),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYENTSLVQIEGVNTKEEVAWYCGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_002530407.1| 60S ribosomal protein L35a, putative [Ricinus communis]
 gb|EEF31977.1| 60S ribosomal protein L35a, putative [Ricinus communis]
Length=112

 Score =   117 bits (293),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR+GERVRLY+RGTILGYKRSKSNQYP+TSLIQIEGVNTKEEV WY GK+MAY+YKA
Sbjct  1    MVKGREGERVRLYVRGTILGYKRSKSNQYPSTSLIQIEGVNTKEEVGWYAGKKMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|AFK45582.1| unknown [Lotus japonicus]
Length=112

 Score =   117 bits (293),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MV+GR+GERVRLY+RGTILGYKRSKSNQYPNTSL+QIEGVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVQGRKGERVRLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|EYU41826.1| hypothetical protein MIMGU_mgv1a016676mg [Erythranthe guttata]
Length=112

 Score =   117 bits (293),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY RGT+LGYKRSKSNQYPNTSLIQIEGVNT+EEV WY GK+MAY+YKA
Sbjct  1    MVKGRQGERVRLYTRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVQWYLGKKMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|KEH28273.1| 60S ribosomal protein L35a-3 [Medicago truncatula]
Length=130

 Score =   117 bits (294),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  KMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYK  16
            KMVKGRQGER+RLY+RGT+LGYKRSK NQYPNTSL+QIEGVNTKEEV WY GK++AY+YK
Sbjct  25   KMVKGRQGERIRLYVRGTVLGYKRSKVNQYPNTSLVQIEGVNTKEEVAWYAGKKLAYIYK  84

Query  15   AKTKK  1
            AK KK
Sbjct  85   AKVKK  89



>ref|XP_006403422.1| hypothetical protein EUTSA_v10010844mg [Eutrema salsugineum]
 gb|ESQ44875.1| hypothetical protein EUTSA_v10010844mg [Eutrema salsugineum]
Length=111

 Score =   117 bits (293),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNT EEV WY+GKR+AY+YKAK
Sbjct  1    MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTTEEVAWYKGKRLAYIYKAK  60

Query  9    TKK  1
            TKK
Sbjct  61   TKK  63



>ref|XP_004150243.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Cucumis sativus]
Length=446

 Score =   124 bits (310),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY RGTILGYKRSKSNQYPNTSL+QIEGVN+K+EV WYQGKR+AY+YKA
Sbjct  1    MVKGRQGERVRLYTRGTILGYKRSKSNQYPNTSLLQIEGVNSKDEVSWYQGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_008801979.1| PREDICTED: 60S ribosomal protein L35a-1-like [Phoenix dactylifera]
Length=157

 Score =   118 bits (296),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQY NTSLIQIEG+NTKEEV WY GKRMAY+YKA
Sbjct  46   MVKGRQGERVRLYVRGTILGYKRSKSNQYENTSLIQIEGLNTKEEVAWYCGKRMAYIYKA  105

Query  12   KTK  4
            KTK
Sbjct  106  KTK  108



>ref|XP_004305154.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like 
[Fragaria vesca subsp. vesca]
Length=426

 Score =   123 bits (309),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LGYKRSKSNQYPNTSLIQIE VNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIENVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_008392900.1| PREDICTED: 60S ribosomal protein L35a-1 [Malus domestica]
Length=112

 Score =   117 bits (292),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+R T+LGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKGRQGERIRLYVRATVLGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTK  4
            K K
Sbjct  61   KVK  63



>ref|XP_007009113.1| Ribosomal protein L35Ae family protein isoform 1 [Theobroma cacao]
 gb|EOY17923.1| Ribosomal protein L35Ae family protein isoform 1 [Theobroma cacao]
Length=112

 Score =   117 bits (292),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSKSNQY NTSLIQIEGVN+KEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKSNQYTNTSLIQIEGVNSKEEVAWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|KEH28274.1| 60S ribosomal protein L35a-3 [Medicago truncatula]
Length=137

 Score =   117 bits (294),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  KMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYK  16
            KMVKGRQGER+RLY+RGT+LGYKRSK NQYPNTSL+QIEGVNTKEEV WY GK++AY+YK
Sbjct  25   KMVKGRQGERIRLYVRGTVLGYKRSKVNQYPNTSLVQIEGVNTKEEVAWYAGKKLAYIYK  84

Query  15   AKTKK  1
            AK KK
Sbjct  85   AKVKK  89



>gb|AFK49038.1| unknown [Lotus japonicus]
Length=112

 Score =   116 bits (291),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MV+GR+GERVRLY+RGTILGYKRSKSNQYPNTS++QIEGVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVQGRKGERVRLYVRGTILGYKRSKSNQYPNTSMVQIEGVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_010690297.1| PREDICTED: 60S ribosomal protein L35a-3 [Beta vulgaris subsp. 
vulgaris]
Length=112

 Score =   116 bits (291),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RG+ILGYKRSKSNQYPNTSL+QIEGVNT+EEV WY GK++AY+YKA
Sbjct  1    MVKGRQGERVRLYVRGSILGYKRSKSNQYPNTSLVQIEGVNTQEEVAWYLGKKLAYIYKA  60

Query  12   KTKK  1
            +TKK
Sbjct  61   ETKK  64



>ref|XP_003616553.1| Maturase [Medicago truncatula]
Length=657

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  KMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYK  16
            KMVKGRQGER+RLY+RGT+LGYKRSK NQYPNTSL+QIEGVNTKEEV WY GK++AY+YK
Sbjct  25   KMVKGRQGERIRLYVRGTVLGYKRSKVNQYPNTSLVQIEGVNTKEEVAWYAGKKLAYIYK  84

Query  15   AKTKK  1
            AK KK
Sbjct  85   AKVKK  89



>gb|ACJ84078.1| unknown [Medicago truncatula]
Length=112

 Score =   116 bits (290),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RGT+LGYKRSK NQYPNTSL+QIEGVNTKEEV WY GK++AYVYKA
Sbjct  1    MVKGRQGERIRLYVRGTVLGYKRSKVNQYPNTSLVQIEGVNTKEEVAWYAGKKLAYVYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|KEH15645.1| 60S ribosomal protein L35a-3 [Medicago truncatula]
Length=112

 Score =   116 bits (290),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGTILGYKRSK NQYPNTSL+QIEGVNTKEEV WY GK+M Y+YKA
Sbjct  1    MVKGRQGERVRLYVRGTILGYKRSKVNQYPNTSLVQIEGVNTKEEVAWYAGKKMTYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_002527874.1| 60S ribosomal protein L35a, putative [Ricinus communis]
 gb|EEF34505.1| 60S ribosomal protein L35a, putative [Ricinus communis]
Length=112

 Score =   115 bits (289),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVK RQGE VRLY+RGTILGYKRSKSNQYP+TSLIQ+EGVNTKEEV WY GKRMAYVYKA
Sbjct  1    MVKSRQGENVRLYVRGTILGYKRSKSNQYPSTSLIQVEGVNTKEEVAWYTGKRMAYVYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|ACJ83951.1| unknown [Medicago truncatula]
 gb|ACJ86176.1| unknown [Medicago truncatula]
 gb|AFK37397.1| unknown [Medicago truncatula]
Length=112

 Score =   115 bits (289),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RGT+LGYKRSK NQYPNTSL+QIEGVNTKEEV WY GK++AY+YKA
Sbjct  1    MVKGRQGERIRLYVRGTVLGYKRSKVNQYPNTSLVQIEGVNTKEEVAWYAGKKLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|AFK48555.1| unknown [Lotus japonicus]
Length=112

 Score =   115 bits (289),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MV+GR+GERVRLY+RG+ILGYKRSKSNQYPNTSLIQIEGVN+KEEV WY GKRMAY+YKA
Sbjct  1    MVQGRKGERVRLYVRGSILGYKRSKSNQYPNTSLIQIEGVNSKEEVAWYAGKRMAYIYKA  60

Query  12   KTKK  1
            K K+
Sbjct  61   KVKQ  64



>gb|AEX93423.1| 60S ribosomal protein L35a [Wolffia australiana]
Length=112

 Score =   115 bits (288),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RGT+LG+KRSKSNQY NTSL+QIEGVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKGRQGERVRLYVRGTVLGFKRSKSNQYENTSLVQIEGVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_008381900.1| PREDICTED: 60S ribosomal protein L35a-1-like [Malus domestica]
Length=112

 Score =   115 bits (288),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVK RQGER+RLY+RGT+LGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKERQGERIRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTK  4
            K K
Sbjct  61   KVK  63



>ref|NP_001235452.1| uncharacterized protein LOC100499746 [Glycine max]
 ref|XP_006595499.1| PREDICTED: uncharacterized protein LOC100499746 isoform X1 [Glycine 
max]
 ref|XP_006595500.1| PREDICTED: uncharacterized protein LOC100499746 isoform X2 [Glycine 
max]
 gb|ACU13467.1| unknown [Glycine max]
 gb|KHN20878.1| 60S ribosomal protein L35a-1 [Glycine soja]
Length=112

 Score =   115 bits (288),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY+RG+ILGYKRSKSNQYP+TSLIQIE VN+KEEV WY GKRMAY+YKA
Sbjct  1    MVKGRQGERVRLYVRGSILGYKRSKSNQYPSTSLIQIENVNSKEEVAWYCGKRMAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_006648023.1| PREDICTED: 60S ribosomal protein L35a-1-like [Oryza brachyantha]
Length=112

 Score =   115 bits (287),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKRMAYVYKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYENTSLVQIEGVNTKEEVAWYCGKRMAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>gb|KDP24503.1| hypothetical protein JCGZ_25067 [Jatropha curcas]
Length=127

 Score =   115 bits (288),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVK R+GE VRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKSREGENVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYNGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|NP_001048330.1| Os02g0785800 [Oryza sativa Japonica Group]
 dbj|BAD19202.1| putative ribosomal protein L35A [Oryza sativa Japonica Group]
 dbj|BAD19312.1| putative ribosomal protein L35A [Oryza sativa Japonica Group]
 dbj|BAF10244.1| Os02g0785800 [Oryza sativa Japonica Group]
 gb|EAZ24865.1| hypothetical protein OsJ_08647 [Oryza sativa Japonica Group]
 gb|ABR26106.1| 60S ribosomal protein l35a [Oryza sativa Indica Group]
 dbj|BAG88894.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00648.1| unnamed protein product [Oryza sativa Japonica Group]
Length=112

 Score =   115 bits (287),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKRMAYVYKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYENTSLVQIEGVNTKEEVAWYCGKRMAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_008388112.1| PREDICTED: 60S ribosomal protein L35a-1-like [Malus domestica]
 ref|XP_008350509.1| PREDICTED: 60S ribosomal protein L35a-1 [Malus domestica]
 ref|XP_009358834.1| PREDICTED: 60S ribosomal protein L35a-1-like [Pyrus x bretschneideri]
Length=112

 Score =   115 bits (287),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RGT+LGYKRSKSNQYP+TSLIQIE VNTKE+V WY GKR+AY+YKA
Sbjct  1    MVKGRQGERIRLYVRGTVLGYKRSKSNQYPSTSLIQIENVNTKEDVAWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_004155999.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cucumis sativus]
Length=112

 Score =   114 bits (286),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RGT+LGYKRSKSNQYP TSLIQIEGVNT+EEV WY GKR+AY+YKA
Sbjct  1    MVKGRQGERIRLYVRGTVLGYKRSKSNQYPRTSLIQIEGVNTREEVAWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K K+
Sbjct  61   KVKQ  64



>gb|EEC74134.1| hypothetical protein OsI_09204 [Oryza sativa Indica Group]
Length=120

 Score =   115 bits (287),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKRMAYVYKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYENTSLVQIEGVNTKEEVAWYCGKRMAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_006343306.1| PREDICTED: 60S ribosomal protein L35a-3-like [Solanum tuberosum]
Length=112

 Score =   114 bits (285),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGERVRLY RG +L YKRSKSNQYPNTSL+QIEGVN KEEVDWY GK MAYVYKA
Sbjct  1    MVKGRQGERVRLYTRGKVLEYKRSKSNQYPNTSLVQIEGVNIKEEVDWYLGKCMAYVYKA  60

Query  12   KTKK  1
            KTKK
Sbjct  61   KTKK  64



>ref|XP_007207502.1| hypothetical protein PRUPE_ppa013629mg [Prunus persica]
 ref|XP_008239772.1| PREDICTED: 60S ribosomal protein L35a-1 [Prunus mume]
 gb|EMJ08701.1| hypothetical protein PRUPE_ppa013629mg [Prunus persica]
Length=112

 Score =   114 bits (285),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RGT+LGYKRSKSNQYP+ SLIQIE VNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKGRQGERIRLYVRGTVLGYKRSKSNQYPSASLIQIENVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_008370046.1| PREDICTED: 60S ribosomal protein L35a-1-like [Malus domestica]
 ref|XP_008345510.1| PREDICTED: 60S ribosomal protein L35a-1-like [Malus domestica]
 ref|XP_009370236.1| PREDICTED: 60S ribosomal protein L35a-1-like [Pyrus x bretschneideri]
 ref|XP_009370257.1| PREDICTED: 60S ribosomal protein L35a-1-like [Pyrus x bretschneideri]
Length=112

 Score =   113 bits (283),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQGER+RLY+RGT+LGYKRSKSNQYP+TSLIQIE VNTKE+V WY GKR+AY+YKA
Sbjct  1    MVKGRQGERIRLYVRGTVLGYKRSKSNQYPSTSLIQIENVNTKEDVAWYAGKRLAYIYKA  60

Query  12   KTK  4
            K K
Sbjct  61   KVK  63



>ref|XP_008442180.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cucumis melo]
Length=112

 Score =   112 bits (281),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKG QGER+RLY+RGT+LGYKRSKSNQYP TSLIQIEGVNT+EEV WY GKR+AY+YKA
Sbjct  1    MVKGSQGERIRLYVRGTVLGYKRSKSNQYPRTSLIQIEGVNTREEVAWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K K+
Sbjct  61   KVKQ  64



>ref|NP_001278735.1| 60S ribosomal protein L33-B [Zea mays]
 ref|XP_008667974.1| PREDICTED: 60S ribosomal protein L33-B isoform X1 [Zea mays]
 gb|ACG33509.1| 60S ribosomal protein L33-B [Zea mays]
 gb|ACR34827.1| unknown [Zea mays]
 tpg|DAA39940.1| TPA: 60S ribosomal protein L33-B isoform 1 [Zea mays]
 tpg|DAA39941.1| TPA: 60S ribosomal protein L33-B isoform 2 [Zea mays]
 tpg|DAA39942.1| TPA: 60S ribosomal protein L33-B isoform 3 [Zea mays]
Length=112

 Score =   112 bits (279),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY  TSLIQIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYETTSLIQIEGVNTKEDVAWYAGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|NP_001056284.1| Os05g0556900 [Oryza sativa Japonica Group]
 pdb|3J61|FF Chain f, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAT58704.1| putative ribosomal protein L35A [Oryza sativa Japonica Group]
 gb|AAT58712.1| putative ribosomal protein L35A [Oryza sativa Japonica Group]
 dbj|BAF18198.1| Os05g0556900 [Oryza sativa Japonica Group]
 gb|EAY98966.1| hypothetical protein OsI_20924 [Oryza sativa Indica Group]
 dbj|BAG95713.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86776.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64640.1| hypothetical protein OsJ_19494 [Oryza sativa Japonica Group]
Length=111

 Score =   112 bits (279),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQG+RVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKR+AYVYKAK
Sbjct  1    MKGRQGQRVRLYVRGTILGYKRSKSNQYENTSLLQIEGVNTKEEVGWYAGKRIAYVYKAK  60

Query  9    TK  4
            TK
Sbjct  61   TK  62



>ref|XP_006655870.1| PREDICTED: 60S ribosomal protein L35a-1-like [Oryza brachyantha]
Length=111

 Score =   111 bits (278),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGR G+RVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKRMAYVYKAK
Sbjct  1    MKGRTGQRVRLYVRGTILGYKRSKSNQYENTSLVQIEGVNTKEEVAWYCGKRMAYVYKAK  60

Query  9    TK  4
            TK
Sbjct  61   TK  62



>gb|AFV13458.1| ribosomal protein L35A [Tripsacum dactyloides]
Length=112

 Score =   111 bits (278),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRMGQRVRLYVRGTILGYKRSKSNQYETTSLVQIEGVNTKEDVAWYAGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>dbj|BAJ90670.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=112

 Score =   111 bits (278),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILG+KRSKSNQY NTSL+QIEGVNTKE+V WY GKR+AYVYKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGFKRSKSNQYENTSLVQIEGVNTKEDVAWYGGKRLAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_004954154.1| PREDICTED: 60S ribosomal protein L35a-1-like [Setaria italica]
Length=112

 Score =   111 bits (278),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYETTSLVQIEGVNTKEDVAWYAGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_002462269.1| hypothetical protein SORBIDRAFT_02g022800 [Sorghum bicolor]
 ref|XP_002437999.1| hypothetical protein SORBIDRAFT_10g006160 [Sorghum bicolor]
 ref|XP_004964594.1| PREDICTED: 60S ribosomal protein L35a-1-like [Setaria italica]
 gb|AAL59231.1|AF448416_11 ribosomal protein L35A [Zea mays]
 gb|ABF67925.1| ribosomal protein L35A [Zea mays]
 gb|ABF67940.1| ribosomal protein L35A [Zea mays]
 gb|ABF67950.1| ribosomal protein L35A [Zea mays]
 gb|ACG29551.1| 60S ribosomal protein L33-B [Zea mays]
 gb|EER89366.1| hypothetical protein SORBIDRAFT_10g006160 [Sorghum bicolor]
 gb|EER98790.1| hypothetical protein SORBIDRAFT_02g022800 [Sorghum bicolor]
 gb|AEJ07911.1| ribosomal protein L35A [Zea luxurians]
 gb|AEJ07914.1| ribosomal protein L35A [Zea mays]
 gb|AEJ07924.1| ribosomal protein L35A [Zea mays subsp. mexicana]
 gb|AEJ07948.1| ribosomal protein L35A [Sorghum propinquum]
 gb|AFC88839.1| 60S ribosomal protein L35a-like protein, partial [Miscanthus 
sinensis]
 gb|AFW85499.1| sesquiterpene cyclase1 [Zea mays]
Length=112

 Score =   111 bits (278),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYETTSLVQIEGVNTKEDVAWYAGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_003570711.1| PREDICTED: 60S ribosomal protein L35a-1-like [Brachypodium distachyon]
Length=112

 Score =   111 bits (278),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKRMAYVYKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYETTSLVQIEGVNTKEDVAWYGGKRMAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|NP_001148377.1| 60S ribosomal protein L33-B [Zea mays]
 gb|AAK73115.1|AF391808_25 ribosomal protein L35A [Zea mays]
 gb|ABF67929.1| ribosomal protein L35A [Zea mays]
 gb|ACA21855.1| ribosomal protein L35A [Zea mays]
 gb|ACG31197.1| 60S ribosomal protein L33-B [Zea mays]
 gb|AEJ07904.1| ribosomal protein L35A [Zea mays subsp. mexicana]
Length=112

 Score =   111 bits (278),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYETTSLVQIEGVNTKEDVAWYAGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>gb|ACG31001.1| 60S ribosomal protein L33-B [Zea mays]
 gb|AEJ07941.1| ribosomal protein L35A [Zea diploperennis]
 gb|AFV13463.1| ribosomal protein L35A [Coix lacryma-jobi]
Length=112

 Score =   111 bits (277),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYETTSLVQIEGVNTKEDVAWYAGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_010227918.1| PREDICTED: 60S ribosomal protein L35a-1 [Brachypodium distachyon]
Length=112

 Score =   111 bits (277),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILG+KRSKSNQY +TSL+QIEG+NTKE+V WY GKRMAYVYKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGFKRSKSNQYESTSLVQIEGLNTKEDVSWYAGKRMAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>tpg|DAA61143.1| TPA: hypothetical protein ZEAMMB73_917318 [Zea mays]
 tpg|DAA61144.1| TPA: hypothetical protein ZEAMMB73_917318 [Zea mays]
Length=112

 Score =   111 bits (277),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYETTSLVQIEGVNTKEDVAWYAGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_003577481.1| PREDICTED: 60S ribosomal protein L35a-1-like [Brachypodium distachyon]
 ref|XP_003577482.1| PREDICTED: 60S ribosomal protein L35a-1-like [Brachypodium distachyon]
Length=112

 Score =   111 bits (277),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILG+KRSKSNQY +TSL+QIEG+NTKE+V WY GKRMAYVYKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGFKRSKSNQYESTSLVQIEGLNTKEDVSWYAGKRMAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>gb|ABR25872.1| 60S ribosomal protein l33-b [Oryza sativa Indica Group]
Length=111

 Score =   111 bits (277),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 1/63 (2%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKRMAYVYKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQY-NTSLVQIEGVNTKEEVAWYCGKRMAYVYKA  59

Query  12   KTK  4
            KTK
Sbjct  60   KTK  62



>ref|XP_004309850.1| PREDICTED: uncharacterized protein LOC101296922 [Fragaria vesca 
subsp. vesca]
Length=152

 Score =   112 bits (279),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQG+RVRLY+RGT+LGYKRSKSNQYPNTSLIQIE VNTKEEV WY G  +A +YKA
Sbjct  1    MVKGRQGDRVRLYVRGTVLGYKRSKSNQYPNTSLIQIENVNTKEEVAWYAGMHLASIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>gb|AFW64229.1| hypothetical protein ZEAMMB73_493842 [Zea mays]
Length=101

 Score =   110 bits (275),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGT+LGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTVLGYKRSKSNQYETTSLVQIEGVNTKEDVAWYCGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_006654760.1| PREDICTED: 60S ribosomal protein L35a-2-like [Oryza brachyantha]
Length=111

 Score =   110 bits (276),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQG+RVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKE+V WY GKR+AYVYKAK
Sbjct  1    MKGRQGQRVRLYVRGTILGYKRSKSNQYENTSLLQIEGVNTKEDVGWYAGKRIAYVYKAK  60

Query  9    TK  4
            TK
Sbjct  61   TK  62



>ref|XP_001768442.1| predicted protein [Physcomitrella patens]
 gb|EDQ66804.1| predicted protein [Physcomitrella patens]
Length=111

 Score =   110 bits (275),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -3

Query  180  RQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            R+GERVRLY+RGTILGYKRSKSNQYP+TSL+QIEGVNT EEV+WY GKR+AYVYKAKTKK
Sbjct  4    RKGERVRLYVRGTILGYKRSKSNQYPSTSLLQIEGVNTSEEVNWYLGKRLAYVYKAKTKK  63



>gb|ACF87953.1| unknown [Zea mays]
 gb|ACG28105.1| 60S ribosomal protein L33-B [Zea mays]
 gb|ACG47096.1| 60S ribosomal protein L33-B [Zea mays]
 gb|AFW64230.1| 60S ribosomal protein L33-B isoform 1 [Zea mays]
 gb|AFW64231.1| 60S ribosomal protein L33-B isoform 2 [Zea mays]
Length=112

 Score =   110 bits (275),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGT+LGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTVLGYKRSKSNQYETTSLVQIEGVNTKEDVAWYCGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_002452936.1| hypothetical protein SORBIDRAFT_04g035260 [Sorghum bicolor]
 gb|EES05912.1| hypothetical protein SORBIDRAFT_04g035260 [Sorghum bicolor]
Length=112

 Score =   110 bits (275),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGT+LGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTVLGYKRSKSNQYETTSLVQIEGVNTKEDVAWYCGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>gb|EEE64647.1| hypothetical protein OsJ_19501 [Oryza sativa Japonica Group]
Length=198

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQG+RVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKR+AYVYKAK
Sbjct  1    MKGRQGQRVRLYVRGTILGYKRSKSNQYENTSLLQIEGVNTKEEVGWYAGKRIAYVYKAK  60

Query  9    TK  4
            TK
Sbjct  61   TK  62



>gb|ACR37770.1| unknown [Zea mays]
 gb|AFW64228.1| hypothetical protein ZEAMMB73_493842 [Zea mays]
Length=115

 Score =   110 bits (275),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGT+LGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTVLGYKRSKSNQYETTSLVQIEGVNTKEDVAWYCGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>gb|EAY98975.1| hypothetical protein OsI_20933 [Oryza sativa Indica Group]
Length=198

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            +KGRQG+RVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKR+AYVYKAK
Sbjct  1    MKGRQGQRVRLYVRGTILGYKRSKSNQYENTSLLQIEGVNTKEEVGWYAGKRIAYVYKAK  60

Query  9    TK  4
            TK
Sbjct  61   TK  62



>ref|XP_001751579.1| predicted protein [Physcomitrella patens]
 gb|EDQ83896.1| predicted protein [Physcomitrella patens]
Length=111

 Score =   110 bits (274),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -3

Query  180  RQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            R+GER+RLY+RGTILGYKRSKSNQYP+TSL+QIEGVNT EEV+WY GKR+AYVYKAKTKK
Sbjct  4    RKGERIRLYVRGTILGYKRSKSNQYPSTSLLQIEGVNTSEEVNWYLGKRLAYVYKAKTKK  63



>gb|ABF67911.1| ribosomal protein L35A [Zea mays]
Length=112

 Score =   110 bits (274),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY  TSL+QIEGVNTKE+V WY GKR+AY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYETTSLVQIEGVNTKEDVSWYAGKRIAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_004961280.1| PREDICTED: 60S ribosomal protein L35a-1-like isoform X1 [Setaria 
italica]
 ref|XP_004961281.1| PREDICTED: 60S ribosomal protein L35a-1-like isoform X2 [Setaria 
italica]
Length=144

 Score =   111 bits (277),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQG+RVR+Y+RGTILGYKRSKSNQY NTSL+QIEGV+TK++V WY GKR+AYVYKA
Sbjct  1    MVKGRQGQRVRMYVRGTILGYKRSKSNQYENTSLLQIEGVSTKQDVAWYGGKRIAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_008233703.1| PREDICTED: 60S ribosomal protein L35a-1 [Prunus mume]
Length=112

 Score =   110 bits (274),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVK RQGER+RLY+ GT+LGYKRSKSNQYP+TSLIQI GVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKERQGERIRLYVGGTVLGYKRSKSNQYPSTSLIQINGVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_004961282.1| PREDICTED: 60S ribosomal protein L35a-1-like isoform X3 [Setaria 
italica]
 ref|XP_004961283.1| PREDICTED: 60S ribosomal protein L35a-1-like isoform X4 [Setaria 
italica]
Length=112

 Score =   109 bits (273),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQG+RVR+Y+RGTILGYKRSKSNQY NTSL+QIEGV+TK++V WY GKR+AYVYKA
Sbjct  1    MVKGRQGQRVRMYVRGTILGYKRSKSNQYENTSLLQIEGVSTKQDVAWYGGKRIAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_001762073.1| predicted protein [Physcomitrella patens]
 gb|EDQ73177.1| predicted protein [Physcomitrella patens]
Length=111

 Score =   109 bits (273),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -3

Query  180  RQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            R+GERVRLY+RGTILGYKRSKSNQYP+TSL+QIEGVNT +EV+WY GKR+AYVYKAKTKK
Sbjct  4    RKGERVRLYVRGTILGYKRSKSNQYPSTSLLQIEGVNTSDEVNWYLGKRLAYVYKAKTKK  63



>ref|XP_003567930.1| PREDICTED: 60S ribosomal protein L35a-1-like [Brachypodium distachyon]
Length=112

 Score =   109 bits (273),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQG+RVRLY+RGTILGYKRSKSNQY +TSL+QIEG++TKE+V WY GKR+AYVYKA
Sbjct  1    MVKGRQGQRVRLYVRGTILGYKRSKSNQYESTSLLQIEGLSTKEDVSWYAGKRIAYVYKA  60

Query  12   KTK  4
            KT+
Sbjct  61   KTR  63



>ref|XP_001751835.1| predicted protein [Physcomitrella patens]
 ref|XP_001763447.1| predicted protein [Physcomitrella patens]
 gb|EDQ71636.1| predicted protein [Physcomitrella patens]
 gb|EDQ83270.1| predicted protein [Physcomitrella patens]
Length=111

 Score =   109 bits (272),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -3

Query  180  RQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            R+GERVRLY+RGTILGYKRSKSNQYP+TSL+QIEGVNT +EV+WY GKR+AYVYKAKTKK
Sbjct  4    RKGERVRLYVRGTILGYKRSKSNQYPSTSLLQIEGVNTSDEVNWYLGKRLAYVYKAKTKK  63



>ref|XP_007218627.1| hypothetical protein PRUPE_ppa013635mg [Prunus persica]
 gb|EMJ19826.1| hypothetical protein PRUPE_ppa013635mg [Prunus persica]
Length=112

 Score =   109 bits (272),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVK RQGER+RLY+ GT+LGYKRSKSNQYP TSLIQI GVNTKEEV WY GKR+AY+YKA
Sbjct  1    MVKERQGERIRLYVGGTVLGYKRSKSNQYPGTSLIQINGVNTKEEVAWYAGKRLAYIYKA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_006848054.1| hypothetical protein AMTR_s00029p00195890 [Amborella trichopoda]
 gb|ERN09635.1| hypothetical protein AMTR_s00029p00195890 [Amborella trichopoda]
Length=111

 Score =   108 bits (271),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 58/64 (91%), Gaps = 1/64 (2%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVK  QGERVRLY+RGTILGYKRSKSNQY NTSL+QIEGVNTKEEV WY GKRMAY+YKA
Sbjct  1    MVKA-QGERVRLYVRGTILGYKRSKSNQYENTSLVQIEGVNTKEEVAWYLGKRMAYIYKA  59

Query  12   KTKK  1
            K KK
Sbjct  60   KVKK  63



>gb|ACG27073.1| 60S ribosomal protein L33-B [Zea mays]
Length=112

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGT+LGYKRSKSNQY  TSL+QIEGVNTKE++ WY GKRMAY+Y+A
Sbjct  1    MVKGRTGQRVRLYVRGTVLGYKRSKSNQYETTSLVQIEGVNTKEDIAWYCGKRMAYIYEA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>gb|ACF85308.1| unknown [Zea mays]
Length=112

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGT+LGYKRSKSN+Y  TSL+QIEGVNTKE+V WY GKRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTVLGYKRSKSNRYETTSLVQIEGVNTKEDVAWYCGKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>gb|EMT16625.1| 60S ribosomal protein L35a-3 [Aegilops tauschii]
Length=112

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY   SL+QIEGVNT+E+V WY GKRMAYVYKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYETASLVQIEGVNTREDVAWYGGKRMAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>gb|EMS50804.1| 60S ribosomal protein L35a-3 [Triticum urartu]
Length=112

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY   SL+QIEGVNT+E+V WY GKRMAYVYKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYETASLVQIEGVNTREDVAWYGGKRMAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>gb|EMS67750.1| 60S ribosomal protein L35a-1 [Triticum urartu]
Length=112

 Score =   108 bits (270),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MV+GRQG+RVRLY+RGTILGYKRSKSNQY +TSL+Q+EGVNTKE+V +Y GKR+AYVYKA
Sbjct  1    MVQGRQGQRVRLYVRGTILGYKRSKSNQYESTSLLQVEGVNTKEDVSYYAGKRIAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|NP_001148548.1| LOC100282164 [Zea mays]
 gb|ACG31994.1| 60S ribosomal protein L33-B [Zea mays]
Length=112

 Score =   108 bits (270),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGR G+RVRLY+RGTILGYKRSKSNQY  TSL+QIEGVNTKE+V WY  KRMAY+YKA
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRSKSNQYETTSLVQIEGVNTKEDVAWYAXKRMAYIYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_002440216.1| hypothetical protein SORBIDRAFT_09g027930 [Sorghum bicolor]
 gb|EES18646.1| hypothetical protein SORBIDRAFT_09g027930 [Sorghum bicolor]
Length=112

 Score =   108 bits (269),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKGRQG+RVR Y+RGTILGYKRSKSNQY +TSL+QIEGV+TKE+V WY GKR+AYVYKA
Sbjct  1    MVKGRQGQRVRTYVRGTILGYKRSKSNQYEHTSLLQIEGVSTKEDVAWYGGKRIAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>emb|CDP14007.1| unnamed protein product [Coffea canephora]
Length=136

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            V GRQGERVRLY+RGTILGYKR +SNQYPNTSLIQIE VNTKEEV WY GK+MAY+YKAK
Sbjct  15   VLGRQGERVRLYMRGTILGYKRLQSNQYPNTSLIQIERVNTKEEVAWYLGKKMAYIYKAK  74

Query  9    TKK  1
             KK
Sbjct  75   VKK  77



>ref|XP_001760913.1| predicted protein [Physcomitrella patens]
 gb|EDQ74302.1| predicted protein [Physcomitrella patens]
Length=111

 Score =   107 bits (267),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -3

Query  180  RQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            R+GERVRLY+RGT+LGYKRSK NQYP+TSL+QIEGVNT +EV+WY GKR+AYVYKAKTKK
Sbjct  4    RKGERVRLYVRGTVLGYKRSKCNQYPSTSLLQIEGVNTSDEVNWYLGKRLAYVYKAKTKK  63



>dbj|BAK01225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=112

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MV+GRQG+RVRLY+RGTILG+KRSKSNQY +TSL+Q+EGV+TKE+V +Y GKR+AYVYKA
Sbjct  1    MVQGRQGQRVRLYVRGTILGFKRSKSNQYESTSLLQVEGVSTKEDVSYYAGKRIAYVYKA  60

Query  12   KTK  4
            KTK
Sbjct  61   KTK  63



>ref|XP_002989747.1| hypothetical protein SELMODRAFT_184773 [Selaginella moellendorffii]
 ref|XP_002994784.1| hypothetical protein SELMODRAFT_237018 [Selaginella moellendorffii]
 gb|EFJ04151.1| hypothetical protein SELMODRAFT_237018 [Selaginella moellendorffii]
 gb|EFJ09224.1| hypothetical protein SELMODRAFT_184773 [Selaginella moellendorffii]
Length=109

 Score =   104 bits (259),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -3

Query  177  QGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            +GE +RLY+  TILGYKRSKSNQYPNTSL+QI+GVNTKEEV WYQGKR+AY+YKAKTKK
Sbjct  3    KGEPIRLYVPATILGYKRSKSNQYPNTSLLQIQGVNTKEEVAWYQGKRLAYIYKAKTKK  61



>gb|EMS52075.1| 60S ribosomal protein L35a-1 [Triticum urartu]
Length=190

 Score =   106 bits (264),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  201  QSKMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYV  22
            Q+   KGR G+RVR+Y+RGTILG+KRSKSNQY +TSL+Q+EGVNTKE+V WY GKR+AYV
Sbjct  76   QAIRAKGRTGQRVRVYVRGTILGFKRSKSNQYESTSLVQVEGVNTKEDVAWYAGKRLAYV  135

Query  21   YKAKTK  4
            YKAKTK
Sbjct  136  YKAKTK  141



>ref|XP_006584481.1| PREDICTED: uncharacterized protein LOC100305958 isoform X1 [Glycine 
max]
Length=125

 Score =   102 bits (255),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            RLY+RGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV WY GK+MAY+YKAK KK
Sbjct  24   RLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVGWYAGKKMAYIYKAKVKK  77



>gb|EMT01430.1| Autophagy-related protein 7 [Aegilops tauschii]
Length=509

 Score =   107 bits (268),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MV+ R G+RVRLY+RGTILGYKR KSNQY  TSL+QIEGVNT+E+V WY GKRMAYVYKA
Sbjct  1    MVR-RTGQRVRLYVRGTILGYKRPKSNQYETTSLLQIEGVNTREDVAWYGGKRMAYVYKA  59

Query  12   KTK  4
            KTK
Sbjct  60   KTK  62



>gb|AAV64217.1| rpl35A [Zea mays]
 gb|AFW85501.1| sesquiterpene cyclase1 [Zea mays]
Length=139

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 58/83 (70%), Gaps = 20/83 (24%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKR--------------------SKSNQYPNTSLIQIEGV  73
            MVKGR G+RVRLY+RGTILGYKR                    SKSNQY  TSL+QIEGV
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRRAHCLRFFPRPCYLDLAIPRSKSNQYETTSLVQIEGV  60

Query  72   NTKEEVDWYQGKRMAYVYKAKTK  4
            NTKE+V WY GKRMAY+YKAKTK
Sbjct  61   NTKEDVAWYAGKRMAYIYKAKTK  83



>ref|XP_011069703.1| PREDICTED: 60S ribosomal protein L35a-3-like [Sesamum indicum]
Length=112

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKG QGERV+LY RGT+ GYKRSKSNQYPN S I IEGVNT++EV WY GK MAY+Y A
Sbjct  1    MVKGCQGERVKLYERGTVRGYKRSKSNQYPNISFIHIEGVNTQDEVAWYLGKCMAYIYNA  60

Query  12   KTKK  1
            K KK
Sbjct  61   KVKK  64



>ref|XP_002991749.1| hypothetical protein SELMODRAFT_134155, partial [Selaginella 
moellendorffii]
 gb|EFJ07153.1| hypothetical protein SELMODRAFT_134155, partial [Selaginella 
moellendorffii]
Length=102

 Score = 99.4 bits (246),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            RLY+  TILGYKRSKSNQYPNTSL+QI+GVNTKEEV WYQGKR+AY+YKAKTKK
Sbjct  1    RLYVPATILGYKRSKSNQYPNTSLLQIQGVNTKEEVAWYQGKRLAYIYKAKTKK  54



>ref|XP_010243420.1| PREDICTED: 60S ribosomal protein L35a-2-like [Nelumbo nucifera]
Length=110

 Score = 98.6 bits (244),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVKG QG+RVRLY+RGT+LGYKRSKSNQYPN SLIQIEGVNTK EV WY  K++AY+YK 
Sbjct  1    MVKGHQGKRVRLYVRGTVLGYKRSKSNQYPNMSLIQIEGVNTK-EVTWYCHKQLAYIYKG  59

Query  12   KTK  4
              K
Sbjct  60   NVK  62



>gb|AFW85500.1| sesquiterpene cyclase1 [Zea mays]
Length=818

 Score =   104 bits (260),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 53/83 (64%), Positives = 58/83 (70%), Gaps = 20/83 (24%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKR--------------------SKSNQYPNTSLIQIEGV  73
            MVKGR G+RVRLY+RGTILGYKR                    SKSNQY  TSL+QIEGV
Sbjct  1    MVKGRTGQRVRLYVRGTILGYKRRAHCLRFFPRPCYLDLAIPRSKSNQYETTSLVQIEGV  60

Query  72   NTKEEVDWYQGKRMAYVYKAKTK  4
            NTKE+V WY GKRMAY+YKAKTK
Sbjct  61   NTKEDVAWYAGKRMAYIYKAKTK  83



>gb|AGU71410.1| 60S ribosomal protein l35a, partial [Lumnitzera racemosa]
Length=50

 Score = 95.1 bits (235),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQG  40
            +KGRQGERVRLY+RGTILGYKRSKSNQYPNTSLIQIEGVNT EEV WY G
Sbjct  1    LKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTTEEVAWYCG  50



>ref|XP_009119450.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L35a-1 
[Brassica rapa]
Length=121

 Score = 96.7 bits (239),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  159  LYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            LY+RG ILGYKR KSNQYPNTSLIQ+EGVNT EE +WY+GKRMAY+YKAKTKK
Sbjct  28   LYVRGVILGYKRLKSNQYPNTSLIQVEGVNTTEEAEWYKGKRMAYIYKAKTKK  80



>gb|EMS52589.1| 60S ribosomal protein L35a-3 [Triticum urartu]
Length=89

 Score = 95.5 bits (236),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -3

Query  180  RQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTK  4
            R G+RVRLY+RGTIL YKR KSNQY  TSL+QI+GVNT+E+V WY GKRMAYVYKAKTK
Sbjct  4    RTGQRVRLYVRGTILEYKRPKSNQYEMTSLVQIKGVNTREDVAWYGGKRMAYVYKAKTK  62



>gb|EEC75435.1| hypothetical protein OsI_11963 [Oryza sativa Indica Group]
Length=261

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = -3

Query  201  QSKMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYV  22
            ++ MVKGR G+  RLY++G ILGYKRSK NQY NTS++QIEG+NT E+V WY GK MAYV
Sbjct  172  EAAMVKGRTGQHRRLYVQGIILGYKRSKLNQYENTSMVQIEGMNT-EDVAWYSGKCMAYV  230

Query  21   YKAKTK  4
            YKAKTK
Sbjct  231  YKAKTK  236



>gb|AGB85018.1| ribosomal protein L35ae, partial [Auxenochlorella protothecoides]
Length=105

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  GERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            GERVRLY+ G  LG++RSKSNQY +TSL++I+GVN+K E ++Y GKR+AYVYKAKT+K
Sbjct  5    GERVRLYVTGQFLGFRRSKSNQYTHTSLVKIDGVNSKTETEFYLGKRLAYVYKAKTEK  62



>gb|KDO53184.1| hypothetical protein CISIN_1g040909mg [Citrus sinensis]
Length=98

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEV  55
            MVKGRQGER++LY+RGTILGYKRSKSNQYPNTSLIQI+GVN KEE 
Sbjct  1    MVKGRQGERIKLYVRGTILGYKRSKSNQYPNTSLIQIKGVNIKEEA  46



>gb|KFM26223.1| 60S ribosomal protein L35a-4 [Auxenochlorella protothecoides]
Length=108

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  GERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            GERVRLY+ G  LG++RSKSNQY +TSL++I+GVN+K E ++Y GKR+AYVYKAKT+K
Sbjct  3    GERVRLYVTGQFLGFRRSKSNQYTHTSLVKIDGVNSKTETEFYLGKRLAYVYKAKTEK  60



>gb|KDO40476.1| hypothetical protein CISIN_1g042762mg, partial [Citrus sinensis]
Length=96

 Score = 85.9 bits (211),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -3

Query  144  TILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            TILGYKRSKSNQYPNTSLIQIEGVNTKE+V WY  K +AY+YKAKTKK
Sbjct  1    TILGYKRSKSNQYPNTSLIQIEGVNTKEKVVWYCCKHLAYIYKAKTKK  48



>ref|XP_006432297.1| hypothetical protein CICLE_v10003310mg, partial [Citrus clementina]
 gb|ESR45537.1| hypothetical protein CICLE_v10003310mg, partial [Citrus clementina]
Length=98

 Score = 85.5 bits (210),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 13/63 (21%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            VKGRQGER++LY+RGTILGYKRSKSNQYPNTSLIQI+G             R+AY+YKAK
Sbjct  1    VKGRQGERIKLYVRGTILGYKRSKSNQYPNTSLIQIKG-------------RLAYIYKAK  47

Query  9    TKK  1
            TKK
Sbjct  48   TKK  50



>ref|XP_005849146.1| hypothetical protein CHLNCDRAFT_30584 [Chlorella variabilis]
 gb|EFN57044.1| hypothetical protein CHLNCDRAFT_30584 [Chlorella variabilis]
Length=108

 Score = 84.0 bits (206),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  GERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            GERVRLY+ G  LGYKR KS QY +T+L++++GVNTK+E ++Y GKR+AYVYKAKT+K
Sbjct  3    GERVRLYVTGQFLGYKRGKSTQYTHTALVKVDGVNTKDETEFYLGKRVAYVYKAKTEK  60



>gb|ACG45987.1| hypothetical protein [Zea mays]
Length=53

 Score = 81.6 bits (200),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVD  52
            MVKGR G+RVRLY+RGT+LGYKRSKSNQY  TSL+QIEGVNTKE+ +
Sbjct  1    MVKGRTGQRVRLYVRGTVLGYKRSKSNQYETTSLVQIEGVNTKEDAE  47



>ref|XP_002947351.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ51399.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=108

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  GERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            GE VRLY++G ILGYKRSK+NQ  +T+L++I+GV TK+E  WY GKR+AY+YKAKT+K
Sbjct  3    GENVRLYVKGHILGYKRSKANQQNHTALLKIDGVATKKETAWYLGKRIAYIYKAKTEK  60



>ref|XP_002367259.1| 60s ribosomal protein L33-A, putative [Toxoplasma gondii ME49]
 ref|XP_008883928.1| ribosomal protein RPL35A [Hammondia hammondi]
 gb|EPR63448.1| ribosomal protein RPL35A [Toxoplasma gondii GT1]
 gb|EPT25077.1| ribosomal protein RPL35A [Toxoplasma gondii ME49]
 gb|ESS34438.1| ribosomal protein RPL35A [Toxoplasma gondii VEG]
 gb|KEP65717.1| ribosomal protein RPL35A [Hammondia hammondi]
 gb|KFG46367.1| ribosomal protein RPL35A [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG48693.1| ribosomal protein RPL35A [Toxoplasma gondii p89]
 gb|KFG54185.1| ribosomal protein RPL35A [Toxoplasma gondii FOU]
 gb|KFG64319.1| ribosomal protein RPL35A [Toxoplasma gondii RUB]
 gb|KFH10688.1| ribosomal protein RPL35A [Toxoplasma gondii MAS]
 gb|KFH12046.1| ribosomal protein RPL35A [Toxoplasma gondii VAND]
Length=112

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  ERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            + VRLY+RG +LGYKRSK NQYP+ SL+Q+EGVN +++  +Y GKR+AYVYKAKT+K
Sbjct  8    QPVRLYVRGIVLGYKRSKVNQYPSCSLLQLEGVNDRKDTQFYLGKRVAYVYKAKTEK  64



>ref|XP_003886145.1| hypothetical protein NCLIV_065450 [Neospora caninum Liverpool]
 emb|CBZ56119.1| hypothetical protein NCLIV_065450 [Neospora caninum Liverpool]
Length=112

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  ERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            + VRLY+RG +LGYKRSK NQYP+ SL+Q+EGVN +++  +Y GKR+AYVYKAKT+K
Sbjct  8    QPVRLYVRGIVLGYKRSKVNQYPSCSLLQLEGVNDRKDTQFYLGKRVAYVYKAKTEK  64



>emb|CDM86481.1| unnamed protein product [Triticum aestivum]
Length=112

 Score = 81.6 bits (200),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 11/66 (17%)
 Frame = -3

Query  198  SKMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVY  19
            SKMVKGR G+RVRLY+RGTILGYKRS+  Q           VNT+E+V WY GKRMA VY
Sbjct  30   SKMVKGRTGQRVRLYVRGTILGYKRSRQIQ-----------VNTREDVAWYGGKRMACVY  78

Query  18   KAKTKK  1
            KAKTK+
Sbjct  79   KAKTKQ  84



>ref|XP_001698582.1| ribosomal protein L35a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP08075.1| ribosomal protein L35a [Chlamydomonas reinhardtii]
Length=108

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  GERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            GE VRL+++G ILGYKRSK+NQ  +T+L++++GV TK+EV WY GKR+AY+YKAK +K
Sbjct  3    GENVRLFVKGHILGYKRSKANQQNHTALLKVDGVATKKEVAWYLGKRIAYIYKAKNEK  60



>ref|XP_006431645.1| hypothetical protein CICLE_v10003325mg, partial [Citrus clementina]
 gb|ESR44885.1| hypothetical protein CICLE_v10003325mg, partial [Citrus clementina]
Length=96

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  144  TILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            TILGYKRSKSNQY NTSLIQIEGVN KE+V W  GK +AY+YKAKTKK
Sbjct  1    TILGYKRSKSNQYSNTSLIQIEGVNAKEKVAWNCGKYLAYIYKAKTKK  48



>ref|XP_002508337.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69595.1| predicted protein [Micromonas sp. RCC299]
Length=108

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  GERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            GE  RLY+RG ILGYKR+++NQ  +TSLI++E VN K   D+Y GK++ YVYKAKTKK
Sbjct  3    GESCRLYVRGIILGYKRARTNQTNHTSLIKLENVNDKSSADFYLGKKLCYVYKAKTKK  60



>gb|ERZ97554.1| hypothetical protein GLOINDRAFT_340100, partial [Rhizophagus 
irregularis DAOM 181602]
Length=82

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  177  QGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
             G+ VRLY +G +LGYKRSK+NQ PNTSLI+IEGV TK +  +Y GKR+AYVY+AK
Sbjct  2    SGQPVRLYSKGRVLGYKRSKTNQSPNTSLIKIEGVTTKADTQFYLGKRVAYVYRAK  57



>ref|XP_005643378.1| ribosomal protein L35Ae [Coccomyxa subellipsoidea C-169]
 gb|EIE18834.1| ribosomal protein L35Ae [Coccomyxa subellipsoidea C-169]
Length=108

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  GERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            GE VRLY+ G+ILGYKR K  QY +TSLIQI GV++K+E ++Y GK++AYVYKAKT K
Sbjct  3    GESVRLYVPGSILGYKRGKRTQYNHTSLIQINGVSSKDETEFYLGKKIAYVYKAKTLK  60



>gb|EXX79702.1| ribosomal 60S subunit protein L33A [Rhizophagus irregularis DAOM 
197198w]
Length=108

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  174  GERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            G+ VRLY +G +LGYKRSK+NQ PNTSLI+IEGV TK +  +Y GKR+AYVY+AK
Sbjct  3    GQPVRLYSKGRVLGYKRSKTNQSPNTSLIKIEGVTTKADTQFYLGKRVAYVYRAK  57



>emb|CEG01556.1| Translation elongation/initiation factor/Ribosomal, beta-barrel 
[Ostreococcus tauri]
Length=109

 Score = 77.8 bits (190),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  177  QGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            +GE  RLY+RG ILGYKR+++NQY +TSLI++EGV+      +Y GK++ YVYKAKTKK
Sbjct  3    KGEPTRLYVRGLILGYKRARTNQYNHTSLIKLEGVSDAPSTTFYAGKKLCYVYKAKTKK  61



>ref|XP_001419192.1| Ribosomal protein L35a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97485.1| Ribosomal protein L35a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=109

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  177  QGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            +GE  RLY+RG ILGYKR+++NQY +TSLI++EGV+      +Y GK++ YVYKAKTKK
Sbjct  3    KGEPTRLYVRGLILGYKRARTNQYNHTSLIKLEGVSDAPSTAFYGGKKLCYVYKAKTKK  61



>emb|CDI78359.1| 60s ribosomal protein L33-A, putative [Eimeria acervulina]
Length=121

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            VKG + E VRLY+RG +LGY+RSK NQ P+ SL+Q+E V T+++  +Y GKR+AYVYKAK
Sbjct  12   VKGTK-EPVRLYVRGIVLGYQRSKVNQTPSRSLLQLENVKTRQDTAFYLGKRVAYVYKAK  70

Query  9    TKK  1
            T+K
Sbjct  71   TEK  73



>emb|CDJ69476.1| 60s ribosomal protein L33-A, putative [Eimeria necatrix]
Length=121

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  VRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            VRLY+RG +LGYKRSK NQ P+ SL+Q+E V T+++  +Y GKR+AYVYKAKT+K
Sbjct  19   VRLYVRGIVLGYKRSKVNQTPSRSLLQLENVKTRKDTAFYLGKRVAYVYKAKTEK  73



>emb|CDJ42634.1| 60s ribosomal protein L33-A, putative [Eimeria tenella]
Length=121

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  VRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            VRLY+RG +LGYKRSK NQ P+ SL+Q+E V T+++  +Y GKR+AYVYKAKT+K
Sbjct  19   VRLYVRGIVLGYKRSKVNQTPSRSLLQLENVKTRKDTAFYLGKRVAYVYKAKTEK  73



>ref|XP_007322831.1| hypothetical protein SERLADRAFT_400095 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN95331.1| hypothetical protein SERLA73DRAFT_143416 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO20865.1| hypothetical protein SERLADRAFT_400095 [Serpula lacrymans var. 
lacrymans S7.9]
Length=106

 Score = 75.5 bits (184),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTK  4
            RLY +G +LG+KR+K N  PNTSL+QIEGV TKE+  +Y GKR+A+VYKAKT+
Sbjct  5    RLYCKGRVLGHKRAKRNTRPNTSLLQIEGVATKEDAQFYLGKRVAFVYKAKTE  57



>ref|XP_628426.1| 60S ribosomal protein L35A [Cryptosporidium parvum Iowa II]
 ref|XP_665886.1| 60S ribosomal protein L35a (RPL35aC) [Cryptosporidium hominis 
TU502]
 gb|EAK90274.1| 60S ribosomal protein L35A [Cryptosporidium parvum Iowa II]
Length=120

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  ERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            E VRLY +  + GYKRSK NQ PN SL++IEGV TKE+  +Y GKR AY+YKAKT K
Sbjct  16   EPVRLYSKAIVTGYKRSKVNQTPNVSLLKIEGVKTKEDAKFYLGKRCAYIYKAKTIK  72



>emb|CDJ52943.1| 60s ribosomal protein L33-A, putative [Eimeria brunetti]
Length=127

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -3

Query  195  KMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYK  16
            ++VKG + + VRLY+RG +LGY+RSK NQ P+ SL+Q+E V T+ +  +Y GKR+AYVYK
Sbjct  10   RLVKGTK-QPVRLYVRGIVLGYQRSKVNQNPSRSLLQLENVKTRADTAFYLGKRVAYVYK  68

Query  15   AKTKK  1
            AKT+K
Sbjct  69   AKTEK  73



>gb|AGH70179.1| 60S ribosomal protein L35a [Placozoa sp. H4]
Length=115

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  171  ERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTK  4
            + VRLY +G ILGYKR   NQ+ NTSLI+IEGVN K E ++Y GKR+AYVY+AK K
Sbjct  3    DPVRLYTKGLILGYKRGLRNQHTNTSLIRIEGVNNKNETEFYLGKRIAYVYRAKKK  58



>emb|CDI79522.1| 60s ribosomal protein L33-A, putative [Eimeria praecox]
Length=121

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -3

Query  201  QSKMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYV  22
            +++ VKG + + VRLY+RG +LGY+RSK NQ P  SL+Q+E V T+++ ++Y GKR+AYV
Sbjct  8    KNRPVKGTK-QPVRLYVRGIVLGYQRSKVNQNPARSLLQLENVKTRKDTEFYLGKRVAYV  66

Query  21   YKAKTKK  1
            YKAKT+K
Sbjct  67   YKAKTEK  73



>ref|XP_955277.1| 60S ribosomal protein l35a [Theileria annulata strain Ankara]
 emb|CAI75801.1| 60S ribosomal protein l35a, putative [Theileria annulata]
Length=117

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  ERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            E VRLY R   LGYKRSK NQ   +SL+++EGVNT+EE  +Y GKR+AYVYKAKT K
Sbjct  13   EPVRLYTRAVFLGYKRSKVNQDQKSSLLRLEGVNTREETSFYLGKRVAYVYKAKTLK  69



>ref|XP_009691267.1| 60S ribosomal protein L35a [Theileria orientalis strain Shintoku]
 dbj|BAM40966.1| 60S ribosomal protein L35a [Theileria orientalis strain Shintoku]
Length=117

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  ERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            E VRLY R   LGYKRSK NQ   +SL+++EGVNT+EE  +Y GKR+AYVYKAKT K
Sbjct  13   EPVRLYTRAVFLGYKRSKVNQDQKSSLLRLEGVNTREETSFYLGKRVAYVYKAKTVK  69



>gb|KDQ51064.1| hypothetical protein JAAARDRAFT_41530 [Jaapia argillacea MUCL 
33604]
Length=106

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTK  4
            RLY +G +LG+KR K N +PNTSL+QIEGV +KE+  +Y GKR+AYVY+AKT+
Sbjct  5    RLYSKGRVLGHKRGKRNTHPNTSLLQIEGVGSKEDAQFYLGKRVAYVYRAKTE  57



>ref|XP_006461267.1| hypothetical protein AGABI2DRAFT_151050 [Agaricus bisporus var. 
bisporus H97]
 ref|XP_007328624.1| hypothetical protein AGABI1DRAFT_119655 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM81135.1| hypothetical protein AGABI1DRAFT_119655 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV47617.1| hypothetical protein AGABI2DRAFT_151050 [Agaricus bisporus var. 
bisporus H97]
Length=106

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G +LG+KR+K N  PNTSLIQIEGV TKE+  +Y GKR+AYVYKAK
Sbjct  5    RLYSKGRVLGHKRAKRNSRPNTSLIQIEGVATKEDAQFYLGKRIAYVYKAK  55



>ref|XP_005780666.1| hypothetical protein EMIHUDRAFT_429999 [Emiliania huxleyi CCMP1516]
 ref|XP_005792528.1| 60S ribosomal protein L35A [Emiliania huxleyi CCMP1516]
 gb|EOD28237.1| hypothetical protein EMIHUDRAFT_429999 [Emiliania huxleyi CCMP1516]
 gb|EOD40099.1| 60S ribosomal protein L35A [Emiliania huxleyi CCMP1516]
Length=111

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = -3

Query  192  MVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            MVK + GE   LY +G ILGYKRSK NQY N SLI+IE VN+K + ++Y GKR+AY+YKA
Sbjct  1    MVK-KVGEPCTLYCKGRILGYKRSKVNQYENQSLIKIENVNSKCDTEFYMGKRVAYIYKA  59

Query  12   K  10
            K
Sbjct  60   K  60



>gb|ADV03036.1| ribosomal protein L35A [Karlodinium veneficum]
Length=122

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  171  ERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            + VRLY +G I GYKRSKSN YP  +LI+I+GV T+E+  +Y GKR+AYVYKAK
Sbjct  18   QPVRLYAKGVITGYKRSKSNTYPTCTLIKIDGVRTEEDTKFYHGKRVAYVYKAK  71



>emb|CDJ36329.1| 60s ribosomal protein L33-A, putative [Eimeria mitis]
Length=121

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = -3

Query  189  VKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            VKG + + VRLY+RG +LGY+RSK NQ P+ SL+Q+E V T+++  +Y GKR+AYVYKAK
Sbjct  12   VKGTK-QPVRLYVRGIVLGYQRSKVNQNPSRSLLQLENVKTRKDTAFYLGKRVAYVYKAK  70

Query  9    TKK  1
            T+K
Sbjct  71   TEK  73



>emb|CDJ57228.1| 60s ribosomal protein L33-A, putative [Eimeria maxima]
Length=121

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -3

Query  195  KMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYK  16
            + VKG + + VRLY+RG +LGY+RSK NQ P+ SL+Q+E V T+++  +Y GKR+AYVYK
Sbjct  10   RPVKGTK-QPVRLYVRGIVLGYQRSKVNQNPSRSLLQLENVKTRKDTAFYLGKRVAYVYK  68

Query  15   AKTKK  1
            AKT+K
Sbjct  69   AKTEK  73



>ref|XP_007343662.1| 60S ribosomal protein L33-A-like protein [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD48224.1| 60S ribosomal protein L33-A-like protein [Auricularia delicata 
TFB-10046 SS5]
Length=106

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTK  4
            RLY +G ILG+KR K N  PNTSL+QIEGV+ K++  +Y GKR+AYVYKAKT+
Sbjct  5    RLYAKGRILGHKRGKRNTRPNTSLVQIEGVSNKDDAQFYLGKRLAYVYKAKTE  57



>ref|XP_002473563.1| 60S ribosomal protein L35 [Postia placenta Mad-698-R]
 ref|XP_002475025.1| 60S ribosomal protein L33-A-like protein [Postia placenta Mad-698-R]
 gb|EED79770.1| 60S ribosomal protein L33-A-like protein [Postia placenta Mad-698-R]
 gb|EED81206.1| 60S ribosomal protein L35 [Postia placenta Mad-698-R]
Length=106

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G +LG+KR+K N  PNTSLIQIEGV+TKE+  +Y GKR+AYVY+AK
Sbjct  5    RLYSKGRVLGHKRAKRNTRPNTSLIQIEGVSTKEDAQFYLGKRVAYVYRAK  55



>ref|XP_007865385.1| 60S ribosomal protein L33-A-like protein [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ56704.1| 60S ribosomal protein L33-A-like protein [Gloeophyllum trabeum 
ATCC 11539]
Length=106

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            RLY +G +LG+KR K N +PNT+L+QIEGV +KE+  +Y GKR+AYVY+AKT++
Sbjct  5    RLYSKGRVLGHKRGKRNTHPNTTLLQIEGVGSKEDAQFYLGKRVAYVYRAKTER  58



>ref|XP_003030194.1| 60S ribosomal protein L33 [Schizophyllum commune H4-8]
 gb|EFI95291.1| hypothetical protein SCHCODRAFT_85583 [Schizophyllum commune 
H4-8]
Length=106

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G ILG+KR+K N  PNTSL+QIEGV TKE+  +Y GKR+AYVYKAK
Sbjct  5    RLYSKGRILGHKRAKRNTRPNTSLLQIEGVATKEDAQFYLGKRVAYVYKAK  55



>ref|XP_007382900.1| 60S ribosomal protein L33-A-like protein [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN09632.1| 60S ribosomal protein L33-A-like protein [Punctularia strigosozonata 
HHB-11173 SS5]
Length=106

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            RLY +G +LG+KR K N  PNTSL+QIEGV +KE+  +Y GKR+AYVY+AKT++
Sbjct  5    RLYTKGRVLGHKRGKRNTRPNTSLLQIEGVGSKEDAQFYLGKRVAYVYRAKTER  58



>ref|XP_001880181.1| 60S ribosomal protein L33 [Laccaria bicolor S238N-H82]
 gb|EDR08868.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|KDR75666.1| hypothetical protein GALMADRAFT_226308 [Galerina marginata CBS 
339.88]
Length=106

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G +LG+KR+K N  PNTSLIQIEGV TKE+  +Y GKR+A+VYKAK
Sbjct  5    RLYSKGRVLGHKRAKRNTRPNTSLIQIEGVATKEDAQFYLGKRVAFVYKAK  55



>emb|CCF75293.1| unnamed protein product [Babesia microti strain RI]
Length=111

 Score = 73.2 bits (178),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = -3

Query  186  KGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKT  7
            KG+Q   VRLY RG I+GYKRSK NQY  T+L+++EGV TK++ ++Y GKR+AY+YKAK 
Sbjct  4    KGKQP--VRLYSRGVIMGYKRSKVNQYQRTNLLKVEGVKTKKDCEFYFGKRVAYIYKAKV  61

Query  6    KK  1
             K
Sbjct  62   TK  63



>emb|CDS03706.1| hypothetical protein LRAMOSA01107 [Absidia idahoensis var. thermophila]
Length=108

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  GERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
             E  RLY +G +LG+ RSK NQYPN SL++IEGV T ++  +Y GKR+AYVY AK +K
Sbjct  3    AENTRLYAKGRVLGFARSKHNQYPNISLLKIEGVQTTDDARFYLGKRVAYVYHAKREK  60



>gb|EUC55718.1| 60S ribosomal protein L33-A, partial [Rhizoctonia solani AG-3 
Rhs1AP]
 gb|KEP54827.1| 60S ribosomal protein L33-A [Rhizoctonia solani 123E]
Length=106

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G ILG+KR K N  PNTSLIQIEGV+ KEE  +Y GKR+AYVYK K
Sbjct  5    RLYAKGRILGHKRGKRNTRPNTSLIQIEGVSNKEEAQFYLGKRLAYVYKGK  55



>ref|XP_002141426.1| 60S ribosomal protein L35A  [Cryptosporidium muris RN66]
 gb|EEA07077.1| 60S ribosomal protein L35A , putative [Cryptosporidium muris 
RN66]
Length=120

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -3

Query  201  QSKMVKGRQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYV  22
            ++K  K +  E +RLY R  + GYKRSK  Q PN SL++IEGV TKE+  +Y GKR AY+
Sbjct  6    KAKSFKNKTIEPIRLYARAVVTGYKRSKVRQTPNISLLKIEGVKTKEDTRFYLGKRCAYI  65

Query  21   YKAK  10
            YKAK
Sbjct  66   YKAK  69



>gb|EPT03051.1| hypothetical protein FOMPIDRAFT_1047412 [Fomitopsis pinicola 
FP-58527 SS1]
Length=106

 Score = 72.8 bits (177),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G ILG+KR+K N  PNTSL+QIEGV TKE+  +Y GKR+AYVY AK
Sbjct  5    RLYSKGRILGHKRAKRNTRPNTSLVQIEGVATKEDAQFYLGKRLAYVYHAK  55



>ref|XP_651074.1| 60S ribosomal protein L35a [Entamoeba histolytica HM-1:IMSS]
 ref|XP_654501.1| 60S ribosomal protein L35a [Entamoeba histolytica HM-1:IMSS]
 ref|XP_655059.1| 60S ribosomal protein L35a [Entamoeba histolytica HM-1:IMSS]
 ref|XP_001736170.1| 60S ribosomal protein L35A-3 [Entamoeba dispar SAW760]
 ref|XP_001737377.1| 60S ribosomal protein L35A-3 [Entamoeba dispar SAW760]
 ref|XP_001737706.1| 60S ribosomal protein L35A-3 [Entamoeba dispar SAW760]
 ref|XP_001914220.1| 60S ribosomal protein L35a [Entamoeba histolytica HM-1:IMSS]
 ref|XP_001914616.1| 60S ribosomal protein L35a [Entamoeba histolytica HM-1:IMSS]
 ref|XP_008858150.1| ribosomal protein L35Ae protein [Entamoeba nuttalli P19]
 gb|EAL45686.1| 60S ribosomal protein L35a, putative [Entamoeba histolytica HM-1:IMSS]
 gb|EAL49115.1| 60S ribosomal protein L35a, putative [Entamoeba histolytica HM-1:IMSS]
 gb|EAL49671.1| 60S ribosomal protein L35a, putative [Entamoeba histolytica HM-1:IMSS]
 gb|EDR25998.1| 60S ribosomal protein L35A-3, putative [Entamoeba dispar SAW760]
 gb|EDR26337.1| 60S ribosomal protein L35A-3, putative [Entamoeba dispar SAW760]
 gb|EDR27603.1| 60S ribosomal protein L35A-3, putative [Entamoeba dispar SAW760]
 gb|EDS88607.1| 60S ribosomal protein L35a, putative [Entamoeba histolytica HM-1:IMSS]
 gb|EDS89004.1| 60S ribosomal protein L35a, putative [Entamoeba histolytica HM-1:IMSS]
 gb|EKE39533.1| ribosomal protein L35Ae protein [Entamoeba nuttalli P19]
 gb|EMD44467.1| 60S ribosomal protein L35A3 [Entamoeba histolytica KU27]
 gb|EMD46068.1| 60S ribosomal protein L35A3 [Entamoeba histolytica KU27]
 gb|EMD46931.1| 60S ribosomal protein L35A3 [Entamoeba histolytica KU27]
 gb|EMH76220.1| ribosomal protein L35Ae, putative [Entamoeba histolytica HM-1:IMSS-B]
 gb|ENY61961.1| 60S ribosomal protein L35A-3, putative [Entamoeba histolytica 
HM-1:IMSS-A]
Length=108

 Score = 72.8 bits (177),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  ERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
             + RL++    +G++R++ NQYPN +L+QI GVNTKE+  +Y GKR+AYVYK   KK
Sbjct  2    SKCRLHVNAVFMGFQRAQRNQYPNVALLQISGVNTKEDTPFYIGKRVAYVYKVNVKK  58



>ref|XP_763631.1| 60S ribosomal protein L35a [Theileria parva strain Muguga]
 gb|EAN31348.1| 60S ribosomal protein L35a, putative [Theileria parva]
Length=117

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  ERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            E VRLY R   LGYKRSK NQ   +SL+++EGVNT+EE  +Y GKR+AYVYKAK  K
Sbjct  13   EPVRLYTRAVFLGYKRSKVNQDQKSSLLRLEGVNTREETSFYLGKRVAYVYKAKALK  69



>ref|XP_009836749.1| hypothetical protein H257_11490 [Aphanomyces astaci]
 gb|ETV73813.1| hypothetical protein H257_11490 [Aphanomyces astaci]
Length=111

 Score = 72.8 bits (177),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  177  QGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            +G+  RLY++G  +GYKR  +NQ+ +TSL+QI+G+  +++VD+Y GKR+AY+YKAK  K
Sbjct  5    EGQPTRLYVKGVFMGYKRGFTNQHAHTSLVQIQGLQDRKDVDFYLGKRIAYIYKAKALK  63



>ref|XP_008869809.1| hypothetical protein H310_06490 [Aphanomyces invadans]
 gb|ETW01961.1| hypothetical protein H310_06490 [Aphanomyces invadans]
Length=111

 Score = 72.8 bits (177),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  177  QGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            +G+  RLY++G  +GYKR  +NQ+ +TSL+QI+G+  +++VD+Y GKR+AY+YKAK  K
Sbjct  5    EGQPTRLYVKGVFMGYKRGFTNQHAHTSLVQIQGLQDRKDVDFYLGKRIAYIYKAKALK  63



>ref|XP_007362818.1| 60S ribosomal protein L33-A-like protein [Dichomitus squalens 
LYAD-421 SS1]
 gb|EJF64007.1| 60S ribosomal protein L33-A-like protein [Dichomitus squalens 
LYAD-421 SS1]
Length=106

 Score = 72.8 bits (177),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G +LG+KR+K N  PNTSL+QIEGV TKE+  +Y GKR+AYVY+AK
Sbjct  5    RLYTKGRVLGHKRAKRNTRPNTSLLQIEGVATKEDAQFYLGKRVAYVYRAK  55



>ref|XP_005536912.1| 60S ribosomal protein L35A [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80876.1| 60S ribosomal protein L35A [Cyanidioschyzon merolae strain 10D]
Length=113

 Score = 72.8 bits (177),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  171  ERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            + VR+Y +G ILGY+RS+  QYPN + IQIEGV T++E  +Y GKR+AYVYKAK
Sbjct  4    QPVRVYCKGVILGYRRSQRRQYPNQTRIQIEGVRTRDETTFYAGKRVAYVYKAK  57



>emb|CDH48318.1| 60s ribosomal protein l33 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=108

 Score = 72.8 bits (177),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  GERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
             E  RLY +G +LG+ RSK NQYPN SL++IEGV T ++  +Y GKR+AYVY AK +K
Sbjct  3    AENSRLYAKGRVLGFARSKHNQYPNISLLKIEGVQTTDDARFYLGKRVAYVYHAKREK  60



>gb|KDQ06306.1| hypothetical protein BOTBODRAFT_181730 [Botryobasidium botryosum 
FD-172 SS1]
Length=190

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  165  VRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTK  4
            + LY +G ILG+KR K N  PNTSLIQIEGV+TKE+  +Y GKR+AYVY+AKT+
Sbjct  88   IPLYSKGRILGHKRGKRNTRPNTSLIQIEGVSTKEDAQFYLGKRLAYVYRAKTE  141



>emb|CBJ32915.1| ribosomal protein L35 [Ectocarpus siliculosus]
Length=156

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  180  RQGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            R G+ VRLY++G +LG+KR   N Y +TSLI+I+GV  KE  ++Y GKR+AY+YKAKT K
Sbjct  49   RSGQPVRLYVKGVMLGFKRGLRNTYHHTSLIKIQGVEDKEASNFYLGKRIAYIYKAKTLK  108



>gb|EMT33314.1| 60S ribosomal protein L35a-1 [Aegilops tauschii]
Length=106

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  126  RSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTK  4
            RSKSNQY +TSL+Q+EGVNTKE+V WY GKR+AYVYKAKTK
Sbjct  17   RSKSNQYKSTSLVQVEGVNTKEDVAWYAGKRLAYVYKAKTK  57



>gb|ELU44255.1| ribosomal l35Ae domain-containing protein [Rhizoctonia solani 
AG-1 IA]
Length=199

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKA  13
            RLY +G ILG+KR K N  PNTSLIQIEGV+ K+E  +Y GKR+AYVYKA
Sbjct  5    RLYTKGRILGHKRGKRNTRPNTSLIQIEGVSNKDEAQFYLGKRLAYVYKA  54



>ref|XP_002391650.1| hypothetical protein MPER_08887 [Moniliophthora perniciosa FA553]
 gb|EEB92580.1| hypothetical protein MPER_08887 [Moniliophthora perniciosa FA553]
Length=96

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G +LG+KR K N  PNTSL+QIEGV TKE+  +Y GKR+A+VYKAK
Sbjct  5    RLYSKGRVLGHKRGKRNSRPNTSLLQIEGVATKEDAQFYLGKRVAFVYKAK  55



>ref|XP_007515506.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14385.1| predicted protein [Bathycoccus prasinos]
Length=129

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            RLY+RG ILGYKR+++NQY NTSLI++E V  K    +Y GK++ YVYKA TKK
Sbjct  28   RLYVRGVILGYKRARTNQYENTSLIKLENVPDKSSTSFYLGKKLCYVYKAHTKK  81



>ref|XP_001638125.1| predicted protein [Nematostella vectensis]
 gb|EDO46062.1| predicted protein [Nematostella vectensis]
Length=113

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  165  VRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTK  4
            VRLY +G +LG+KR   NQ+PNTSL++IEGV+ ++  ++Y GKR+A+VY+AK K
Sbjct  5    VRLYTKGIVLGFKRGLRNQHPNTSLVKIEGVDERKNTEFYLGKRLAFVYRAKNK  58



>gb|EMD39013.1| hypothetical protein CERSUDRAFT_81793 [Ceriporiopsis subvermispora 
B]
Length=106

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G +LG+KR+K N  PNTSL+QIEGV TKE+  +Y GKR+AYVY+A+
Sbjct  5    RLYTKGRVLGHKRAKRNTRPNTSLLQIEGVATKEDAQFYLGKRVAYVYRAR  55



>ref|XP_008038334.1| 60S ribosomal protein L33-A-like protein [Trametes versicolor 
FP-101664 SS1]
 gb|EIW58411.1| 60S ribosomal protein L33-A-like protein [Trametes versicolor 
FP-101664 SS1]
Length=106

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G +LG+KR+K N  PNTSL+QIEGV TKE+  +Y GKR+AY+Y+AK
Sbjct  5    RLYSKGRVLGHKRAKRNTRPNTSLVQIEGVATKEDAQFYLGKRVAYIYRAK  55



>ref|XP_001830188.1| 60S ribosomal protein L33 [Coprinopsis cinerea okayama7#130]
 gb|EAU91666.1| 60S ribosomal protein L33 [Coprinopsis cinerea okayama7#130]
Length=109

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G +LG+KR K N  PNTSLIQIEGV +KE+  +Y GKR+AYVYKAK
Sbjct  8    RLYSKGRVLGHKRGKRNTRPNTSLIQIEGVASKEDAQFYLGKRVAYVYKAK  58



>ref|XP_007843336.1| 60s ribosomal protein l33 [Moniliophthora roreri MCA 2997]
 gb|ESK97332.1| 60s ribosomal protein l33 [Moniliophthora roreri MCA 2997]
Length=106

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G +LG+KR K N  PNTSL+QIEGV TKE+  +Y GKR+A+VYKAK
Sbjct  5    RLYSKGRVLGHKRGKRNSRPNTSLLQIEGVATKEDAQFYLGKRVAFVYKAK  55



>ref|XP_008610290.1| 50S ribosomal protein L35Ae [Saprolegnia diclina VS20]
 gb|EQC36184.1| 50S ribosomal protein L35Ae [Saprolegnia diclina VS20]
 gb|KDO23064.1| 50S ribosomal protein L35Ae [Saprolegnia parasitica CBS 223.65]
Length=111

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  177  QGERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            + +  RLY++G  +GY R  +NQ+ +TSLIQI+G+  +++VD+Y GKR+AY+YKAKT K
Sbjct  5    EAQPTRLYVKGVFMGYMRGFTNQHAHTSLIQIQGLQDRKDVDFYLGKRIAYIYKAKTLK  63



>ref|XP_007304020.1| 60S ribosomal protein L33-A-like protein, partial [Stereum hirsutum 
FP-91666 SS1]
 gb|EIM86573.1| 60S ribosomal protein L33-A-like protein, partial [Stereum hirsutum 
FP-91666 SS1]
Length=105

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  162  RLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAK  10
            RLY +G ILG+KR K N  PNTSL+QIEGV+ KEE  +Y GKR+AYVY+AK
Sbjct  4    RLYSKGRILGHKRGKRNTRPNTSLLQIEGVSNKEEAQFYLGKRVAYVYRAK  54



>gb|EJK66241.1| hypothetical protein THAOC_12850 [Thalassiosira oceanica]
Length=111

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  ERVRLYIRGTILGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYQGKRMAYVYKAKTKK  1
            + VRLY+ G ILGYKR   NQY +TSLI+I+GV++KEE  +Y GKR+AY+ KAK+ K
Sbjct  7    QPVRLYVNGAILGYKRGLRNQYNHTSLIKIKGVDSKEETQFYLGKRIAYITKAKSSK  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513730317888