BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c96712_g1_i1 len=342 path=[320:0-341]

Length=342
                                                                      Score     E

gb|KDO59687.1|  hypothetical protein CISIN_1g0442261mg                  144   1e-38   
ref|XP_010482756.1|  PREDICTED: metal-nicotianamine transporter Y...    144   2e-38   
ref|XP_010442924.1|  PREDICTED: metal-nicotianamine transporter Y...    144   2e-38   
ref|XP_010445924.1|  PREDICTED: metal-nicotianamine transporter Y...    143   3e-38   
ref|XP_009762638.1|  PREDICTED: metal-nicotianamine transporter Y...    144   9e-38   
ref|XP_006491954.1|  PREDICTED: metal-nicotianamine transporter Y...    144   1e-37   
ref|XP_006441189.1|  hypothetical protein CICLE_v10019170mg             144   1e-37   
ref|XP_006491948.1|  PREDICTED: metal-nicotianamine transporter Y...    143   2e-37   
ref|XP_010442922.1|  PREDICTED: metal-nicotianamine transporter Y...    143   2e-37   
ref|XP_006441190.1|  hypothetical protein CICLE_v10019170mg             143   2e-37   
gb|ABD04075.1|  YSL transporter 3                                       143   2e-37   Noccaea caerulescens
ref|XP_010482755.1|  PREDICTED: metal-nicotianamine transporter Y...    143   2e-37   
gb|ABB76763.1|  YSL transporter 3                                       143   2e-37   Noccaea caerulescens
ref|XP_002864249.1|  predicted protein                                  143   2e-37   
ref|XP_009762636.1|  PREDICTED: metal-nicotianamine transporter Y...    144   2e-37   
ref|XP_009762637.1|  PREDICTED: metal-nicotianamine transporter Y...    144   2e-37   
ref|XP_006281523.1|  hypothetical protein CARUB_v10027623mg             143   2e-37   
ref|XP_009763790.1|  PREDICTED: metal-nicotianamine transporter Y...    142   3e-37   
ref|XP_009587674.1|  PREDICTED: metal-nicotianamine transporter Y...    142   3e-37   
ref|XP_009587676.1|  PREDICTED: metal-nicotianamine transporter Y...    142   3e-37   
ref|XP_010445905.1|  PREDICTED: metal-nicotianamine transporter Y...    142   3e-37   
emb|CDX96232.1|  BnaC02g14190D                                          142   3e-37   
ref|XP_006343788.1|  PREDICTED: metal-nicotianamine transporter Y...    142   3e-37   
ref|XP_004245462.1|  PREDICTED: metal-nicotianamine transporter YSL1    142   3e-37   
ref|XP_009763789.1|  PREDICTED: metal-nicotianamine transporter Y...    142   4e-37   
ref|XP_007039160.1|  YELLOW STRIPE like 3 isoform 1                     142   5e-37   
ref|XP_007039161.1|  YELLOW STRIPE like 3 isoform 2                     142   6e-37   
gb|KHG10996.1|  Metal-nicotianamine transporter YSL3 -like protein      141   1e-36   
gb|KCW77323.1|  hypothetical protein EUGRSUZ_D01684                     139   1e-36   
gb|KDP30688.1|  hypothetical protein JCGZ_16395                         140   1e-36   
ref|XP_008367110.1|  PREDICTED: metal-nicotianamine transporter Y...    136   2e-36   
ref|XP_011082340.1|  PREDICTED: metal-nicotianamine transporter Y...    140   2e-36   
ref|XP_011082337.1|  PREDICTED: metal-nicotianamine transporter Y...    140   2e-36   
ref|XP_002515673.1|  oligopeptide transporter, putative                 140   2e-36   Ricinus communis
ref|XP_011082339.1|  PREDICTED: metal-nicotianamine transporter Y...    140   2e-36   
gb|AFU82909.1|  yellow stripe-like transporter 3.2                      135   3e-36   
dbj|BAE98794.1|  EspB-like protein                                      139   3e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KHG05098.1|  Metal-nicotianamine transporter YSL3 -like protein      140   3e-36   
ref|XP_006431856.1|  hypothetical protein CICLE_v10003961mg             140   3e-36   
ref|XP_010053070.1|  PREDICTED: metal-nicotianamine transporter YSL1    140   3e-36   
emb|CDY20248.1|  BnaC09g29910D                                          140   3e-36   
ref|XP_009119903.1|  PREDICTED: metal-nicotianamine transporter YSL3    140   4e-36   
emb|CDY14371.1|  BnaA10g06840D                                          140   4e-36   
ref|XP_010318047.1|  PREDICTED: metal-nicotianamine transporter Y...    139   4e-36   
ref|XP_002274166.1|  PREDICTED: metal-nicotianamine transporter YSL3    139   4e-36   Vitis vinifera
dbj|BAB09731.1|  EspB-like protein                                      139   6e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136481.1|  hypothetical protein PHAVU_009G048800g             139   6e-36   
emb|CAN77891.1|  hypothetical protein VITISV_016271                     139   6e-36   Vitis vinifera
gb|EYU40692.1|  hypothetical protein MIMGU_mgv1a002430mg                139   6e-36   
ref|NP_200167.2|  metal-nicotianamine transporter YSL3                  139   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011084545.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    138   1e-35   
gb|EYU45295.1|  hypothetical protein MIMGU_mgv1a002502mg                138   1e-35   
ref|XP_006471126.1|  PREDICTED: metal-nicotianamine transporter Y...    138   2e-35   
gb|KDO53476.1|  hypothetical protein CISIN_1g047730mg                   138   2e-35   
ref|XP_010537055.1|  PREDICTED: metal-nicotianamine transporter Y...    137   3e-35   
ref|XP_010537056.1|  PREDICTED: metal-nicotianamine transporter Y...    137   3e-35   
emb|CDP05015.1|  unnamed protein product                                137   3e-35   
ref|XP_008803948.1|  PREDICTED: probable metal-nicotianamine tran...    137   3e-35   
ref|XP_006401691.1|  hypothetical protein EUTSA_v10012886mg             137   3e-35   
ref|XP_010048775.1|  PREDICTED: metal-nicotianamine transporter YSL3    137   4e-35   
ref|XP_002318472.2|  hypothetical protein POPTR_0012s03180g             137   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011043727.1|  PREDICTED: metal-nicotianamine transporter Y...    137   4e-35   
ref|XP_011043724.1|  PREDICTED: metal-nicotianamine transporter Y...    136   5e-35   
emb|CDY03488.1|  BnaC01g15940D                                          136   5e-35   
gb|AFP55583.1|  yellow stripe-like protein                              137   6e-35   
ref|XP_006413472.1|  hypothetical protein EUTSA_v10024600mg             136   7e-35   
ref|XP_007039405.1|  YELLOW STRIPE like 1 isoform 3                     135   7e-35   
ref|XP_008374112.1|  PREDICTED: metal-nicotianamine transporter Y...    136   7e-35   
ref|XP_009397635.1|  PREDICTED: probable metal-nicotianamine tran...    136   7e-35   
ref|XP_009358702.1|  PREDICTED: metal-nicotianamine transporter Y...    136   8e-35   
ref|XP_009765494.1|  PREDICTED: metal-nicotianamine transporter Y...    136   8e-35   
ref|XP_009765519.1|  PREDICTED: metal-nicotianamine transporter Y...    136   9e-35   
dbj|BAF48331.1|  putative yellow stripe-like protein                    136   9e-35   Nicotiana tabacum [American tobacco]
ref|XP_009588595.1|  PREDICTED: metal-nicotianamine transporter Y...    136   9e-35   
ref|XP_009588601.1|  PREDICTED: metal-nicotianamine transporter Y...    136   9e-35   
ref|XP_008390279.1|  PREDICTED: metal-nicotianamine transporter Y...    135   1e-34   
gb|KHN05985.1|  Metal-nicotianamine transporter YSL3-like protein       134   1e-34   
gb|EYU19676.1|  hypothetical protein MIMGU_mgv1a002464mg                135   1e-34   
ref|XP_009359556.1|  PREDICTED: metal-nicotianamine transporter Y...    135   1e-34   
ref|XP_006350625.1|  PREDICTED: metal-nicotianamine transporter Y...    137   1e-34   
ref|XP_010448607.1|  PREDICTED: metal-nicotianamine transporter Y...    135   1e-34   
ref|XP_006578879.1|  PREDICTED: metal-nicotianamine transporter Y...    135   1e-34   
ref|XP_010439083.1|  PREDICTED: metal-nicotianamine transporter YSL1    135   1e-34   
ref|XP_010433812.1|  PREDICTED: metal-nicotianamine transporter Y...    135   1e-34   
emb|CAH67443.1|  H0501D11.7                                             135   1e-34   Oryza sativa [red rice]
ref|XP_009361313.1|  PREDICTED: metal-nicotianamine transporter YSL2    135   1e-34   
ref|XP_011075924.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    135   1e-34   
ref|XP_010671369.1|  PREDICTED: metal-nicotianamine transporter Y...    135   2e-34   
ref|XP_003523338.2|  PREDICTED: metal-nicotianamine transporter Y...    135   2e-34   
ref|XP_002518903.1|  oligopeptide transporter, putative                 135   2e-34   Ricinus communis
gb|KHN19530.1|  Metal-nicotianamine transporter YSL3                    135   2e-34   
gb|KDO76708.1|  hypothetical protein CISIN_1g037863mg                   135   2e-34   
ref|XP_010676897.1|  PREDICTED: metal-nicotianamine transporter Y...    135   2e-34   
gb|EAY95020.1|  hypothetical protein OsI_16829                          135   2e-34   Oryza sativa Indica Group [Indian rice]
gb|KDP25199.1|  hypothetical protein JCGZ_20355                         135   2e-34   
ref|XP_006476298.1|  PREDICTED: metal-nicotianamine transporter Y...    135   2e-34   
ref|XP_008376798.1|  PREDICTED: metal-nicotianamine transporter YSL3    135   2e-34   
emb|CDX76329.1|  BnaA08g10710D                                          135   2e-34   
ref|XP_007039403.1|  YELLOW STRIPE like 1 isoform 1                     135   2e-34   
ref|XP_010671364.1|  PREDICTED: metal-nicotianamine transporter Y...    135   2e-34   
ref|XP_009137708.1|  PREDICTED: metal-nicotianamine transporter Y...    135   2e-34   
ref|XP_009137713.1|  PREDICTED: metal-nicotianamine transporter Y...    135   2e-34   
emb|CDY24797.1|  BnaA08g15130D                                          134   2e-34   
emb|CAN77515.1|  hypothetical protein VITISV_013366                     135   2e-34   Vitis vinifera
ref|XP_010658081.1|  PREDICTED: YS1-like protein-like isoform X1        134   2e-34   
ref|XP_003588469.1|  Metal-nicotianamine transporter YSL2               134   3e-34   
ref|XP_009109308.1|  PREDICTED: metal-nicotianamine transporter Y...    134   3e-34   
ref|XP_003551122.2|  PREDICTED: metal-nicotianamine transporter Y...    134   3e-34   
ref|XP_006601048.1|  PREDICTED: metal-nicotianamine transporter Y...    134   3e-34   
gb|KFK28976.1|  hypothetical protein AALP_AA7G072600                    134   3e-34   
ref|XP_007140989.1|  hypothetical protein PHAVU_008G157800g             134   3e-34   
emb|CDY35455.1|  BnaC03g62050D                                          134   3e-34   
ref|XP_006439232.1|  hypothetical protein CICLE_v10019189mg             134   3e-34   
ref|XP_009398090.1|  PREDICTED: probable metal-nicotianamine tran...    134   3e-34   
emb|CAB51655.1|  putative protein                                       134   3e-34   Arabidopsis thaliana [mouse-ear cress]
emb|CBI34579.3|  unnamed protein product                                134   3e-34   
ref|XP_007140990.1|  hypothetical protein PHAVU_008G157800g             134   3e-34   
ref|XP_009359553.1|  PREDICTED: metal-nicotianamine transporter Y...    134   4e-34   
ref|XP_002869737.1|  hypothetical protein ARALYDRAFT_492451             134   4e-34   
ref|XP_010919337.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    134   4e-34   
ref|XP_006283265.1|  hypothetical protein CARUB_v10004301mg             134   4e-34   
ref|XP_004309544.1|  PREDICTED: metal-nicotianamine transporter Y...    134   4e-34   
ref|XP_006581667.1|  PREDICTED: metal-nicotianamine transporter Y...    134   4e-34   
emb|CBI34580.3|  unnamed protein product                                133   4e-34   
ref|XP_010100194.1|  Metal-nicotianamine transporter YSL1               134   4e-34   
ref|XP_007220212.1|  hypothetical protein PRUPE_ppa002475mg             134   5e-34   
gb|AAB63613.1|  unknown protein                                         134   5e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AFU82908.1|  yellow stripe-like transporter 3.1                      134   5e-34   
ref|XP_008234683.1|  PREDICTED: metal-nicotianamine transporter YSL3    134   5e-34   
ref|XP_004309105.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    135   5e-34   
ref|NP_001053449.2|  Os04g0542200                                       134   5e-34   Oryza sativa Japonica Group [Japonica rice]
ref|NP_567694.2|  metal-nicotianamine transporter YSL1                  134   6e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KGN65329.1|  hypothetical protein Csa_1G329900                       133   6e-34   
ref|XP_009359552.1|  PREDICTED: metal-nicotianamine transporter Y...    134   6e-34   
ref|XP_004172903.1|  PREDICTED: metal-nicotianamine transporter Y...    134   7e-34   
ref|XP_010659999.1|  PREDICTED: metal-nicotianamine transporter Y...    133   7e-34   
ref|XP_004150025.1|  PREDICTED: metal-nicotianamine transporter Y...    133   7e-34   
sp|Q7XUJ2.2|YSL9_ORYSJ  RecName: Full=Probable metal-nicotianamin...    134   7e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653627.1|  PREDICTED: probable metal-nicotianamine tran...    133   8e-34   
gb|EMS50094.1|  putative metal-nicotianamine transporter YSL16          132   8e-34   
ref|NP_001268107.1|  YS1-like protein-like                              133   8e-34   
gb|EAZ31500.1|  hypothetical protein OsJ_15637                          133   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010034897.1|  PREDICTED: metal-nicotianamine transporter Y...    133   1e-33   
gb|AAK62460.1|AF387015_1  putative protein                              133   1e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDY70890.1|  BnaCnng70180D                                          130   1e-33   
ref|XP_006838312.1|  hypothetical protein AMTR_s00103p00133560          129   1e-33   
ref|XP_009351940.1|  PREDICTED: metal-nicotianamine transporter Y...    132   1e-33   
ref|XP_010541874.1|  PREDICTED: metal-nicotianamine transporter YSL1    132   2e-33   
ref|XP_004498492.1|  PREDICTED: metal-nicotianamine transporter Y...    132   2e-33   
ref|XP_004498494.1|  PREDICTED: metal-nicotianamine transporter Y...    132   2e-33   
ref|XP_002872112.1|  hypothetical protein ARALYDRAFT_489303             132   2e-33   
ref|XP_008444004.1|  PREDICTED: metal-nicotianamine transporter Y...    132   2e-33   
ref|NP_001141294.1|  uncharacterized protein LOC100273385               128   2e-33   Zea mays [maize]
gb|KFK27715.1|  hypothetical protein AALP_AA8G420300                    132   2e-33   
ref|XP_011026790.1|  PREDICTED: metal-nicotianamine transporter Y...    132   2e-33   
ref|XP_006287225.1|  hypothetical protein CARUB_v10000403mg             132   2e-33   
ref|XP_011026792.1|  PREDICTED: metal-nicotianamine transporter Y...    132   3e-33   
ref|XP_007211288.1|  hypothetical protein PRUPE_ppa002524mg             132   3e-33   
ref|XP_008239220.1|  PREDICTED: metal-nicotianamine transporter YSL1    132   3e-33   
ref|XP_008381368.1|  PREDICTED: metal-nicotianamine transporter Y...    132   3e-33   
ref|XP_010240192.1|  PREDICTED: probable metal-nicotianamine tran...    125   3e-33   
emb|CDO99601.1|  unnamed protein product                                132   3e-33   
emb|CDX92615.1|  BnaC07g38730D                                          132   3e-33   
dbj|BAL02122.1|  putative iron-phytosiderophore transporter             132   4e-33   
ref|XP_008456007.1|  PREDICTED: metal-nicotianamine transporter Y...    130   4e-33   
ref|XP_006394695.1|  hypothetical protein EUTSA_v10003781mg             131   5e-33   
gb|AAM98073.1|  AT5g24380/K16H17_9                                      129   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008456006.1|  PREDICTED: metal-nicotianamine transporter Y...    131   5e-33   
ref|XP_008456005.1|  PREDICTED: metal-nicotianamine transporter Y...    131   6e-33   
gb|AFU82907.1|  yellow stripe-like transporter 1                        131   6e-33   
ref|XP_010454748.1|  PREDICTED: metal-nicotianamine transporter Y...    131   6e-33   
ref|XP_010493592.1|  PREDICTED: metal-nicotianamine transporter Y...    131   6e-33   
ref|XP_010454747.1|  PREDICTED: metal-nicotianamine transporter Y...    131   6e-33   
ref|XP_010035301.1|  PREDICTED: metal-nicotianamine transporter Y...    131   6e-33   
dbj|BAH57276.1|  AT5G24380                                              129   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006653628.1|  PREDICTED: probable metal-nicotianamine tran...    129   7e-33   
ref|XP_010454749.1|  PREDICTED: metal-nicotianamine transporter Y...    130   7e-33   
ref|XP_010493593.1|  PREDICTED: metal-nicotianamine transporter Y...    130   7e-33   
ref|XP_003588462.1|  Metal-nicotianamine transporter YSL2               132   7e-33   
gb|KGN57644.1|  hypothetical protein Csa_3G238100                       130   7e-33   
ref|NP_001053450.2|  Os04g0542800                                       130   7e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004146239.1|  PREDICTED: metal-nicotianamine transporter Y...    130   7e-33   
gb|KEH35475.1|  OPT family oligopeptide transporter                     130   9e-33   
ref|XP_004165023.1|  PREDICTED: metal-nicotianamine transporter Y...    130   9e-33   
ref|XP_009137417.1|  PREDICTED: metal-nicotianamine transporter Y...    130   9e-33   
gb|AES72566.2|  OPT family oligopeptide transporter                     130   9e-33   
ref|XP_010267463.1|  PREDICTED: metal-nicotianamine transporter Y...    130   1e-32   
gb|EPS62701.1|  hypothetical protein M569_12087                         130   1e-32   
gb|EPS61530.1|  hypothetical protein M569_13263                         130   1e-32   
ref|XP_004976408.1|  PREDICTED: probable metal-nicotianamine tran...    130   1e-32   
dbj|BAE99250.1|  hypothetical protein                                   128   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|EEE61427.1|  hypothetical protein OsJ_15639                          130   1e-32   Oryza sativa Japonica Group [Japonica rice]
gb|EMT10300.1|  Putative metal-nicotianamine transporter YSL9           129   1e-32   
ref|XP_004976411.1|  PREDICTED: probable metal-nicotianamine tran...    130   1e-32   
gb|AAS00691.1|  metal-nicotianamine transporter YSL1                    130   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976407.1|  PREDICTED: probable metal-nicotianamine tran...    130   1e-32   
ref|XP_002299431.1|  hypothetical protein POPTR_0001s11310g             129   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_004976410.1|  PREDICTED: probable metal-nicotianamine tran...    130   2e-32   
gb|EMS63506.1|  putative metal-nicotianamine transporter YSL9           129   2e-32   
ref|XP_002299420.2|  hypothetical protein POPTR_0001s11510g             129   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011026765.1|  PREDICTED: metal-nicotianamine transporter Y...    129   2e-32   
ref|XP_003602315.1|  YSL transporter                                    130   2e-32   
ref|XP_009150965.1|  PREDICTED: metal-nicotianamine transporter YSL2    129   2e-32   
ref|XP_003556858.1|  PREDICTED: metal-nicotianamine transporter Y...    129   2e-32   
ref|XP_011011616.1|  PREDICTED: metal-nicotianamine transporter Y...    129   3e-32   
gb|AEQ28192.1|  yellow stripe-like protein 3                            129   3e-32   
ref|XP_011026763.1|  PREDICTED: metal-nicotianamine transporter Y...    129   3e-32   
dbj|BAB11231.1|  unnamed protein product                                129   3e-32   Arabidopsis thaliana [mouse-ear cress]
gb|EEE57481.1|  hypothetical protein OsJ_07730                          129   3e-32   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD26553.1|  putative iron-phytosiderophore transporter prote...    129   3e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_197826.2|  metal-nicotianamine transporter YSL2                  129   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495506.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    129   3e-32   
ref|XP_010676898.1|  PREDICTED: metal-nicotianamine transporter Y...    129   3e-32   
ref|XP_008465519.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    129   4e-32   
dbj|BAD72770.1|  YS1-like metal-nicotianamine transporter               129   4e-32   Oryza sativa Japonica Group [Japonica rice]
gb|KHN04996.1|  Metal-nicotianamine transporter YSL1                    129   4e-32   
ref|NP_001047586.2|  Os02g0649900                                       129   4e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007161580.1|  hypothetical protein PHAVU_001G081600g             129   4e-32   
ref|XP_006648886.1|  PREDICTED: metal-nicotianamine transporter Y...    128   5e-32   
ref|XP_010541500.1|  PREDICTED: metal-nicotianamine transporter Y...    128   5e-32   
ref|XP_006606419.1|  PREDICTED: metal-nicotianamine transporter Y...    128   5e-32   
ref|XP_003556427.1|  PREDICTED: metal-nicotianamine transporter Y...    128   5e-32   
ref|XP_003580253.1|  PREDICTED: probable metal-nicotianamine tran...    128   5e-32   
ref|XP_010541499.1|  PREDICTED: metal-nicotianamine transporter Y...    129   5e-32   
dbj|BAH98158.1|  yellow stripe 1-like                                   128   5e-32   Tulipa gesneriana
ref|XP_010034899.1|  PREDICTED: metal-nicotianamine transporter Y...    128   6e-32   
gb|EMT14696.1|  hypothetical protein F775_52546                         128   6e-32   
ref|XP_004163579.1|  PREDICTED: metal-nicotianamine transporter Y...    128   6e-32   
ref|XP_004143944.1|  PREDICTED: metal-nicotianamine transporter Y...    128   6e-32   
ref|XP_010240193.1|  PREDICTED: probable metal-nicotianamine tran...    128   7e-32   
gb|KCW46096.1|  hypothetical protein EUGRSUZ_K00012                     128   8e-32   
ref|XP_007151963.1|  hypothetical protein PHAVU_004G090100g             127   9e-32   
gb|EPS58153.1|  hypothetical protein M569_16663                         124   9e-32   
ref|XP_008661601.1|  PREDICTED: uncharacterized protein LOC100273...    127   1e-31   
ref|XP_009763791.1|  PREDICTED: metal-nicotianamine transporter Y...    127   1e-31   
ref|XP_010252366.1|  PREDICTED: metal-nicotianamine transporter YSL2    127   1e-31   
gb|EAY95023.1|  hypothetical protein OsI_16833                          127   1e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_006593833.1|  PREDICTED: metal-nicotianamine transporter Y...    127   1e-31   
ref|XP_006593836.1|  PREDICTED: metal-nicotianamine transporter Y...    127   1e-31   
ref|XP_008661599.1|  PREDICTED: uncharacterized protein LOC100273...    127   1e-31   
ref|XP_006593837.1|  PREDICTED: metal-nicotianamine transporter Y...    127   2e-31   
ref|XP_002452832.1|  hypothetical protein SORBIDRAFT_04g033320          127   2e-31   Sorghum bicolor [broomcorn]
ref|XP_002452833.1|  hypothetical protein SORBIDRAFT_04g033330          126   2e-31   Sorghum bicolor [broomcorn]
ref|XP_008437732.1|  PREDICTED: metal-nicotianamine transporter YSL1    125   2e-31   
gb|KEH42903.1|  OPT family oligopeptide transporter                     127   2e-31   
ref|NP_001168540.1|  hypothetical protein                               126   4e-31   Zea mays [maize]
ref|XP_004953295.1|  PREDICTED: iron-phytosiderophore transporter...    126   4e-31   
ref|XP_008668329.1|  PREDICTED: hypothetical protein isoform X2         126   4e-31   
ref|XP_004143842.1|  PREDICTED: metal-nicotianamine transporter Y...    125   5e-31   
gb|KHN14758.1|  Metal-nicotianamine transporter YSL1                    125   6e-31   
gb|EMS67667.1|  Metal-nicotianamine transporter YSL2                    124   6e-31   
ref|XP_006849121.1|  hypothetical protein AMTR_s00027p00045420          125   6e-31   
ref|XP_003536174.2|  PREDICTED: metal-nicotianamine transporter Y...    125   7e-31   
ref|NP_001266881.1|  probable metal-nicotianamine transporter YSL...    125   1e-30   
ref|XP_008780049.1|  PREDICTED: probable metal-nicotianamine tran...    121   1e-30   
gb|ADE76428.1|  unknown                                                 124   1e-30   
dbj|BAG88718.1|  unnamed protein product                                120   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001104952.1|  iron-phytosiderophore transporter yellow str...    124   3e-30   Zea mays [maize]
ref|XP_008644257.1|  PREDICTED: iron-phytosiderophore transporter...    124   3e-30   
ref|NP_001052640.2|  Os04g0390500                                       118   5e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003572763.1|  PREDICTED: metal-nicotianamine transporter YSL2    123   5e-30   
ref|XP_004953294.1|  PREDICTED: metal-nicotianamine transporter Y...    123   6e-30   
ref|XP_008798980.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    121   7e-30   
gb|EAZ24007.1|  hypothetical protein OsJ_07732                          120   1e-29   Oryza sativa Japonica Group [Japonica rice]
gb|KEH16132.1|  OPT family oligopeptide transporter                     122   1e-29   
ref|XP_003588466.1|  Metal-nicotianamine transporter YSL3               122   1e-29   
ref|XP_004955109.1|  PREDICTED: probable metal-nicotianamine tran...    122   1e-29   
ref|XP_002452834.1|  hypothetical protein SORBIDRAFT_04g033340          121   2e-29   Sorghum bicolor [broomcorn]
tpg|DAA38140.1|  TPA: hypothetical protein ZEAMMB73_580403              118   3e-29   
ref|XP_008360215.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    120   3e-29   
ref|XP_002448252.1|  hypothetical protein SORBIDRAFT_06g024030          120   3e-29   Sorghum bicolor [broomcorn]
gb|ADE77032.1|  unknown                                                 115   3e-29   
gb|EAY86906.1|  hypothetical protein OsI_08289                          120   4e-29   Oryza sativa Indica Group [Indian rice]
sp|Q6H3Z3.1|YSL15_ORYSJ  RecName: Full=Iron-phytosiderophore tran...    120   4e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EMT18669.1|  hypothetical protein F775_42295                         118   4e-29   
ref|XP_006648887.1|  PREDICTED: iron-phytosiderophore transporter...    119   5e-29   
gb|EMT08573.1|  Putative metal-nicotianamine transporter YSL9           118   7e-29   
gb|EMT32978.1|  Iron-phytosiderophore transporter YSL15                 119   8e-29   
gb|ACK57536.1|  iron/phytosiderophore transporter                       119   1e-28   Avena sativa [cultivated oat]
ref|XP_008367109.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    119   1e-28   
gb|EMS59689.1|  putative metal-nicotianamine transporter YSL9           117   1e-28   
ref|XP_008646003.1|  PREDICTED: probable metal-nicotianamine tran...    119   2e-28   
ref|XP_008646002.1|  PREDICTED: probable metal-nicotianamine tran...    119   2e-28   
gb|ACU22673.1|  unknown                                                 115   2e-28   
gb|AFW72573.1|  hypothetical protein ZEAMMB73_694561                    119   2e-28   
gb|EAZ30539.1|  hypothetical protein OsJ_14587                          118   2e-28   
emb|CAH66436.1|  OSIGBa0132D06.2                                        118   2e-28   
dbj|BAE91886.1|  hypothetical protein                                   118   2e-28   
sp|Q7XRV2.1|YSL6_ORYSJ  RecName: Full=Probable metal-nicotianamin...    118   2e-28   
ref|NP_001131175.1|  hypothetical protein                               117   3e-28   
gb|EMT18668.1|  Iron-phytosiderophore transporter YSL15                 117   3e-28   
ref|XP_004975420.1|  PREDICTED: probable metal-nicotianamine tran...    117   4e-28   
ref|XP_002446309.1|  hypothetical protein SORBIDRAFT_06g013960          117   4e-28   
gb|EMS45266.1|  putative metal-nicotianamine transporter YSL6           118   4e-28   
gb|EMT26359.1|  Putative metal-nicotianamine transporter YSL6           117   4e-28   
gb|ACE77056.1|  yellow stripe-like protein 6.2                          115   5e-28   
ref|XP_003579626.1|  PREDICTED: probable metal-nicotianamine tran...    117   5e-28   
ref|XP_010913001.1|  PREDICTED: probable metal-nicotianamine tran...    117   6e-28   
gb|KFK33623.1|  hypothetical protein AALP_AA5G037700                    117   6e-28   
gb|AFU82910.1|  yellow stripe-like transporter 6                        112   8e-28   
ref|XP_009415880.1|  PREDICTED: probable metal-nicotianamine tran...    117   8e-28   
ref|NP_001266844.1|  iron-phytosiderophore transporter YSL15-like       117   9e-28   
ref|NP_001052641.1|  Os04g0390600                                       114   9e-28   
ref|XP_009415879.1|  PREDICTED: probable metal-nicotianamine tran...    117   1e-27   
ref|NP_001266822.1|  iron-phytosiderophore transporter YSL15-like       117   1e-27   
ref|XP_006395492.1|  hypothetical protein EUTSA_v10003758mg             116   1e-27   
dbj|BAE71187.1|  iron-phytosiderophore transporter                      116   1e-27   
ref|XP_004306307.1|  PREDICTED: probable metal-nicotianamine tran...    116   1e-27   
ref|XP_002298639.1|  oligopeptide transporter OPT family protein        115   2e-27   
gb|AAM64930.1|  unknown                                                 116   2e-27   
gb|AAM53283.1|  unknown protein                                         115   2e-27   
ref|XP_002877011.1|  hypothetical protein ARALYDRAFT_904909             115   2e-27   
ref|XP_010502660.1|  PREDICTED: probable metal-nicotianamine tran...    115   2e-27   
ref|NP_566806.1|  putative metal-nicotianamine transporter YSL6         115   2e-27   
ref|XP_006290684.1|  hypothetical protein CARUB_v10016778mg             115   2e-27   
ref|XP_010514385.1|  PREDICTED: probable metal-nicotianamine tran...    115   2e-27   
ref|XP_010425438.1|  PREDICTED: probable metal-nicotianamine tran...    115   2e-27   
ref|XP_009111552.1|  PREDICTED: probable metal-nicotianamine tran...    115   2e-27   
ref|XP_007215002.1|  hypothetical protein PRUPE_ppa002401mg             115   2e-27   
emb|CDY00170.1|  BnaC09g01310D                                          115   2e-27   
gb|ACL83357.2|  yellow stripe-like protein 6.4                          115   2e-27   
gb|EMT09335.1|  Putative metal-nicotianamine transporter YSL6           115   2e-27   
ref|XP_008231092.1|  PREDICTED: probable metal-nicotianamine tran...    115   2e-27   
gb|ACE77055.2|  yellow stripe-like protein 6.1                          115   2e-27   
gb|KHN28282.1|  Putative metal-nicotianamine transporter YSL6           114   3e-27   
ref|XP_006653335.1|  PREDICTED: probable metal-nicotianamine tran...    116   3e-27   
ref|XP_009405479.1|  PREDICTED: probable metal-nicotianamine tran...    115   3e-27   
ref|XP_004514626.1|  PREDICTED: probable metal-nicotianamine tran...    115   4e-27   
ref|XP_008379097.1|  PREDICTED: probable metal-nicotianamine tran...    114   4e-27   
ref|XP_009344228.1|  PREDICTED: probable metal-nicotianamine tran...    114   5e-27   
gb|EEE60900.1|  hypothetical protein OsJ_14588                          114   5e-27   
ref|XP_009344229.1|  PREDICTED: probable metal-nicotianamine tran...    114   5e-27   
ref|XP_009346777.1|  PREDICTED: probable metal-nicotianamine tran...    114   5e-27   
ref|XP_009346778.1|  PREDICTED: probable metal-nicotianamine tran...    114   5e-27   
gb|KHN13497.1|  Putative metal-nicotianamine transporter YSL6           114   5e-27   
ref|XP_011000961.1|  PREDICTED: probable metal-nicotianamine tran...    114   6e-27   
gb|AEQ28191.1|  yellow stripe-like protein 6                            114   6e-27   
ref|XP_003549112.1|  PREDICTED: probable metal-nicotianamine tran...    114   6e-27   
sp|Q7XRV1.3|YSL5_ORYSJ  RecName: Full=Probable metal-nicotianamin...    114   6e-27   
emb|CAE02279.2|  OSJNBa0055C08.2                                        114   6e-27   
emb|CAH66437.1|  OSIGBa0132D06.3                                        114   7e-27   
emb|CDY20064.1|  BnaA09g01870D                                          115   7e-27   
ref|XP_003579625.1|  PREDICTED: probable metal-nicotianamine tran...    114   7e-27   
dbj|BAE91885.1|  hypothetical protein                                   114   7e-27   
ref|XP_008362099.1|  PREDICTED: probable metal-nicotianamine tran...    114   8e-27   
ref|XP_003553947.1|  PREDICTED: probable metal-nicotianamine tran...    114   8e-27   
ref|XP_003622146.1|  Yellow stripe-like protein 1.1                     114   9e-27   
ref|XP_010556294.1|  PREDICTED: probable metal-nicotianamine tran...    114   9e-27   
ref|XP_006604157.1|  PREDICTED: probable metal-nicotianamine tran...    114   9e-27   
ref|XP_010249085.1|  PREDICTED: probable metal-nicotianamine tran...    114   9e-27   
ref|XP_006844633.1|  hypothetical protein AMTR_s00016p00229210          111   1e-26   
ref|XP_010112394.1|  putative metal-nicotianamine transporter YSL6      114   1e-26   
ref|XP_010679992.1|  PREDICTED: probable metal-nicotianamine tran...    113   1e-26   
gb|KDO63889.1|  hypothetical protein CISIN_1g005868mg                   112   1e-26   
ref|XP_002274559.2|  PREDICTED: probable metal-nicotianamine tran...    113   1e-26   
gb|AAS00695.1|  metal-nicotianamine transporter YSL6                    113   2e-26   
gb|KDP41791.1|  hypothetical protein JCGZ_26809                         113   2e-26   
ref|XP_004231762.1|  PREDICTED: probable metal-nicotianamine tran...    113   2e-26   
gb|EMT12342.1|  Putative metal-nicotianamine transporter YSL6           113   2e-26   
ref|XP_006447028.1|  hypothetical protein CICLE_v10014497mg             112   2e-26   
ref|XP_011098916.1|  PREDICTED: probable metal-nicotianamine tran...    112   3e-26   
gb|KHG22766.1|  putative metal-nicotianamine transporter YSL6 -li...    112   3e-26   
ref|XP_011098915.1|  PREDICTED: probable metal-nicotianamine tran...    112   3e-26   
ref|XP_006405407.1|  hypothetical protein EUTSA_v10027673mg             112   3e-26   
gb|EMT14354.1|  Iron-phytosiderophore transporter YSL15                 112   3e-26   
gb|KDO63888.1|  hypothetical protein CISIN_1g005868mg                   112   3e-26   
ref|XP_006447029.1|  hypothetical protein CICLE_v10014497mg             112   3e-26   
gb|KFK33040.1|  hypothetical protein AALP_AA6G322700                    111   3e-26   
ref|XP_006338712.1|  PREDICTED: probable metal-nicotianamine tran...    112   4e-26   
ref|XP_009757311.1|  PREDICTED: probable metal-nicotianamine tran...    112   4e-26   
ref|XP_009613490.1|  PREDICTED: probable metal-nicotianamine tran...    112   4e-26   
gb|EEC77183.1|  hypothetical protein OsI_15675                          112   4e-26   
ref|XP_001751943.1|  predicted protein                                  112   4e-26   
gb|EMT26360.1|  Putative metal-nicotianamine transporter YSL5           111   5e-26   
ref|XP_007031922.1|  YELLOW STRIPE like 6                               112   5e-26   
ref|XP_008801346.1|  PREDICTED: probable metal-nicotianamine tran...    110   5e-26   
ref|XP_007161672.1|  hypothetical protein PHAVU_001G088900g             111   6e-26   
emb|CDP18194.1|  unnamed protein product                                111   6e-26   
ref|XP_001759545.1|  predicted protein                                  111   7e-26   
ref|XP_006652217.1|  PREDICTED: probable metal-nicotianamine tran...    111   7e-26   
ref|XP_004975421.1|  PREDICTED: probable metal-nicotianamine tran...    111   7e-26   
ref|XP_010535963.1|  PREDICTED: probable metal-nicotianamine tran...    111   7e-26   
dbj|BAK01759.1|  predicted protein                                      111   7e-26   
ref|XP_006844631.1|  hypothetical protein AMTR_s00016p00228960          110   1e-25   
ref|XP_006286072.1|  hypothetical protein CARUB_v10007605mg             110   1e-25   
ref|XP_003581149.1|  PREDICTED: probable metal-nicotianamine tran...    110   2e-25   
ref|XP_008801345.1|  PREDICTED: probable metal-nicotianamine tran...    110   2e-25   
gb|EYU31834.1|  hypothetical protein MIMGU_mgv1a002047mg                110   2e-25   
ref|XP_006847869.1|  hypothetical protein AMTR_s00029p00088690          107   3e-25   
ref|XP_010436039.1|  PREDICTED: probable metal-nicotianamine tran...    109   3e-25   
gb|EMS52485.1|  putative metal-nicotianamine transporter YSL6           109   3e-25   
ref|XP_010450578.1|  PREDICTED: probable metal-nicotianamine tran...    109   3e-25   
ref|XP_006653337.1|  PREDICTED: probable metal-nicotianamine tran...    106   3e-25   
ref|XP_010943908.1|  PREDICTED: probable metal-nicotianamine tran...    109   4e-25   
ref|XP_010028979.1|  PREDICTED: probable metal-nicotianamine tran...    109   4e-25   
emb|CDP15117.1|  unnamed protein product                                108   4e-25   
tpg|DAA38139.1|  TPA: hypothetical protein ZEAMMB73_559137              107   5e-25   
ref|NP_198916.2|  putative metal-nicotianamine transporter YSL4         108   5e-25   
ref|XP_006487169.1|  PREDICTED: probable metal-nicotianamine tran...    108   5e-25   
ref|XP_002446310.1|  hypothetical protein SORBIDRAFT_06g013970          108   5e-25   
gb|EMT24063.1|  Putative metal-nicotianamine transporter YSL6           108   6e-25   
dbj|BAB09702.1|  unnamed protein product                                108   6e-25   
gb|KHN46380.1|  Metal-nicotianamine transporter YSL1                    108   6e-25   
ref|XP_008450132.1|  PREDICTED: probable metal-nicotianamine tran...    108   6e-25   
ref|XP_009140243.1|  PREDICTED: probable metal-nicotianamine tran...    108   6e-25   
gb|KDP22031.1|  hypothetical protein JCGZ_03001                         108   6e-25   
gb|ACF54627.1|  yellow stripe-like protein 6.3                          107   7e-25   
ref|XP_002870660.1|  hypothetical protein ARALYDRAFT_493877             108   7e-25   
ref|XP_004148009.1|  PREDICTED: probable metal-nicotianamine tran...    108   7e-25   
emb|CDY15924.1|  BnaA04g11870D                                          109   7e-25   
gb|KDO46151.1|  hypothetical protein CISIN_1g005295mg                   107   7e-25   
ref|XP_006423237.1|  hypothetical protein CICLE_v10027961mg             108   8e-25   
ref|XP_006487168.1|  PREDICTED: probable metal-nicotianamine tran...    108   8e-25   
gb|KDP27275.1|  hypothetical protein JCGZ_21006                         108   1e-24   
ref|XP_002877320.1|  hypothetical protein ARALYDRAFT_905504             106   1e-24   
ref|XP_009383038.1|  PREDICTED: probable metal-nicotianamine tran...    107   1e-24   
ref|XP_002981992.1|  hypothetical protein SELMODRAFT_179245             107   1e-24   
ref|XP_002986072.1|  hypothetical protein SELMODRAFT_123451             107   1e-24   
ref|XP_006493428.1|  PREDICTED: probable metal-nicotianamine tran...    107   2e-24   
ref|XP_008667776.1|  PREDICTED: uncharacterized protein LOC100279...    107   2e-24   
gb|KDO46150.1|  hypothetical protein CISIN_1g005295mg                   107   2e-24   
ref|NP_001145872.1|  uncharacterized protein LOC100279387               107   2e-24   
ref|XP_006847871.1|  hypothetical protein AMTR_s00029p00090440          105   2e-24   
ref|XP_008667775.1|  PREDICTED: uncharacterized protein LOC100279...    107   2e-24   
ref|XP_010441262.1|  PREDICTED: probable metal-nicotianamine tran...    107   2e-24   
ref|XP_006441428.1|  hypothetical protein CICLE_v10019091mg             105   3e-24   
gb|AEN81949.1|  AT3G17650-like protein                                  102   3e-24   
gb|ACL83358.1|  yellow stripe-like protein 5.11                         104   4e-24   
ref|XP_009135544.1|  PREDICTED: probable metal-nicotianamine tran...    104   4e-24   
gb|AEN81944.1|  AT3G17650-like protein                                  101   4e-24   
gb|ACF28606.1|  yellow stripe-like protein 5.1                          105   4e-24   
ref|XP_011097988.1|  PREDICTED: probable metal-nicotianamine tran...    106   4e-24   
gb|ACF28614.1|  yellow stripe-like protein 2.3                          105   4e-24   
ref|NP_176750.1|  putative metal-nicotianamine transporter YSL7         106   4e-24   
ref|XP_006844634.1|  hypothetical protein AMTR_s00016p00229620          106   5e-24   
gb|ACF28612.1|  yellow stripe-like protein 5.7                          103   8e-24   
ref|XP_010933277.1|  PREDICTED: probable metal-nicotianamine tran...    105   8e-24   
gb|ACL83359.1|  yellow stripe-like protein 5.12                         103   8e-24   
gb|KDP40380.1|  hypothetical protein JCGZ_02378                         105   8e-24   
gb|EPS73705.1|  hypothetical protein M569_01043                         105   1e-23   
gb|ACF28610.1|  yellow stripe-like protein 2.1                          103   1e-23   
ref|XP_006441429.1|  hypothetical protein CICLE_v10019091mg             105   1e-23   
ref|XP_002525883.1|  oligopeptide transporter, putative                 105   1e-23   
ref|XP_009768859.1|  PREDICTED: probable metal-nicotianamine tran...    105   1e-23   
ref|XP_008780540.1|  PREDICTED: probable metal-nicotianamine tran...    102   1e-23   
ref|XP_010501891.1|  PREDICTED: probable metal-nicotianamine tran...    104   1e-23   
gb|EYU25678.1|  hypothetical protein MIMGU_mgv1a002252mg                105   1e-23   
ref|XP_010549025.1|  PREDICTED: probable metal-nicotianamine tran...    102   1e-23   
ref|XP_010436040.1|  PREDICTED: probable metal-nicotianamine tran...    104   2e-23   
ref|XP_010479258.1|  PREDICTED: probable metal-nicotianamine tran...    104   2e-23   
gb|ACD77012.1|  metal transporter protein                               104   2e-23   
ref|XP_009105166.1|  PREDICTED: probable metal-nicotianamine tran...    104   2e-23   
ref|XP_010461657.1|  PREDICTED: probable metal-nicotianamine tran...    104   2e-23   
ref|XP_009413131.1|  PREDICTED: probable metal-nicotianamine tran...    104   2e-23   
emb|CDY39272.1|  BnaC06g27190D                                          104   2e-23   
ref|XP_008240337.1|  PREDICTED: probable metal-nicotianamine tran...    104   2e-23   
emb|CDX82356.1|  BnaA03g34650D                                          103   3e-23   
gb|AHA84244.1|  putative metal-nicotianamine transporter YSL6           104   3e-23   
emb|CDX99626.1|  BnaC04g33830D                                          104   3e-23   
ref|XP_007211297.1|  hypothetical protein PRUPE_ppa001999mg             104   3e-23   
ref|XP_007029356.1|  YELLOW STRIPE like 5                               104   3e-23   
emb|CDY68937.1|  BnaCnng61140D                                          104   3e-23   
gb|EMT12341.1|  Putative metal-nicotianamine transporter YSL6           103   3e-23   
ref|XP_009135543.1|  PREDICTED: probable metal-nicotianamine tran...    103   3e-23   
dbj|BAJ34371.1|  unnamed protein product                                102   4e-23   
ref|XP_010465819.1|  PREDICTED: probable metal-nicotianamine tran...    102   4e-23   
ref|XP_010505677.1|  PREDICTED: probable metal-nicotianamine tran...    102   4e-23   
ref|XP_009402082.1|  PREDICTED: probable metal-nicotianamine tran...    103   4e-23   
ref|XP_010940334.1|  PREDICTED: probable metal-nicotianamine tran...    103   4e-23   
gb|KFK36098.1|  hypothetical protein AALP_AA4G077100                    103   4e-23   
ref|XP_006343309.1|  PREDICTED: probable metal-nicotianamine tran...    103   4e-23   
gb|EEC77667.1|  hypothetical protein OsI_16700                          103   4e-23   
ref|NP_001053351.1|  Os04g0524600                                       103   4e-23   
ref|XP_004234495.1|  PREDICTED: probable metal-nicotianamine tran...    103   5e-23   
ref|XP_006306886.1|  hypothetical protein CARUB_v10008440mg             103   5e-23   
ref|XP_010112079.1|  putative metal-nicotianamine transporter YSL8      100   5e-23   
gb|EYU39420.1|  hypothetical protein MIMGU_mgv1a002450mg                103   5e-23   
emb|CAI44637.1|  OSJNBb0065J09.17                                       103   5e-23   
gb|ACF54628.1|  yellow stripe-like protein 5.5                          100   6e-23   
gb|ACF28613.1|  yellow stripe-like protein 5.8                          101   6e-23   
gb|ABB76761.1|  YSL transporter 1                                       103   6e-23   
ref|XP_009593058.1|  PREDICTED: probable metal-nicotianamine tran...    103   6e-23   
ref|XP_006391519.1|  hypothetical protein EUTSA_v10018216mg             103   6e-23   
ref|XP_006653608.1|  PREDICTED: probable metal-nicotianamine tran...    103   7e-23   
ref|XP_002886962.1|  hypothetical protein ARALYDRAFT_475677             103   7e-23   
dbj|BAE91892.1|  hypothetical protein                                   103   7e-23   
ref|XP_010415119.1|  PREDICTED: probable metal-nicotianamine tran...    102   7e-23   
sp|Q5JQD7.2|YSL12_ORYSJ  RecName: Full=Probable metal-nicotianami...    103   7e-23   
ref|XP_009798435.1|  PREDICTED: probable metal-nicotianamine tran...    103   7e-23   
ref|XP_002528372.1|  oligopeptide transporter, putative                 103   7e-23   
ref|XP_004976284.1|  PREDICTED: probable metal-nicotianamine tran...    103   8e-23   
gb|KFK41018.1|  hypothetical protein AALP_AA2G074700                    102   8e-23   
ref|XP_009113870.1|  PREDICTED: probable metal-nicotianamine tran...    100   1e-22   
ref|XP_007210334.1|  hypothetical protein PRUPE_ppa002002mg             102   1e-22   
gb|ACF28615.1|  yellow stripe-like protein 2.4                        99.8    1e-22   
ref|XP_010511122.1|  PREDICTED: probable metal-nicotianamine tran...    102   1e-22   
ref|XP_010112419.1|  putative metal-nicotianamine transporter YSL7      102   1e-22   
ref|XP_010528609.1|  PREDICTED: probable metal-nicotianamine tran...    102   1e-22   
gb|AAS00697.1|  metal-nicotianamine transporter YSL8                    102   1e-22   
ref|NP_564525.1|  metal-nicotianamine transporter YSL8                  102   1e-22   



>gb|KDO59687.1| hypothetical protein CISIN_1g0442261mg, partial [Citrus sinensis]
Length=403

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  182  VALFVLAALSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  241

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A+VYRN+A + VEGFSALPQH
Sbjct  242  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIVYRNMAILGVEGFSALPQH  294



>ref|XP_010482756.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Camelina sativa]
Length=406

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  183  VALFILAAMAGKQNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  242

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+ALVYRN+A + VEGFSALPQH
Sbjct  243  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYALVYRNMAILGVEGFSALPQH  295



>ref|XP_010442924.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Camelina sativa]
Length=406

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  183  VALFILAAMAGKQNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  242

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+ALVYRN+A + VEGFSALPQH
Sbjct  243  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYALVYRNMAILGVEGFSALPQH  295



>ref|XP_010445924.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X2 [Camelina 
sativa]
Length=406

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  183  VALFILAAMAGKQNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  242

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP GEYKAP+ALVYRN+A + VEGFSALPQH
Sbjct  243  TAIGCVVAPLTFFLFYKAFDVGNPEGEYKAPYALVYRNMAILGVEGFSALPQH  295



>ref|XP_009762638.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Nicotiana sylvestris]
 ref|XP_009762640.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Nicotiana sylvestris]
Length=665

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF+MAA  GKE+GV+AGLAGCGL+KSV+N+S  LM DFKTGHLTLTS + MFLSQAIG
Sbjct  444  VGLFMMAALAGKEHGVIAGLAGCGLIKSVVNISCILMQDFKTGHLTLTSPKTMFLSQAIG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+ PLSFFLFYNAFD+GNPNGE+KAP+AL+YRN+A +SV+G SALPQH
Sbjct  504  TALGCVIGPLSFFLFYNAFDIGNPNGEFKAPYALIYRNMAILSVQGVSALPQH  556



>ref|XP_006491954.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X7 [Citrus sinensis]
Length=667

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  446  VALFVLAALSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A+VYRN+A + VEGFSALPQH
Sbjct  506  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIVYRNMAILGVEGFSALPQH  558



>ref|XP_006441189.1| hypothetical protein CICLE_v10019170mg [Citrus clementina]
 gb|ESR54429.1| hypothetical protein CICLE_v10019170mg [Citrus clementina]
Length=667

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  446  VALFVLAALSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A+VYRN+A + VEGFSALPQH
Sbjct  506  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIVYRNMAILGVEGFSALPQH  558



>ref|XP_006491948.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Citrus sinensis]
 ref|XP_006491949.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Citrus sinensis]
 ref|XP_006491950.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Citrus sinensis]
 ref|XP_006491951.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X4 [Citrus sinensis]
 ref|XP_006491952.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X5 [Citrus sinensis]
 ref|XP_006491953.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X6 [Citrus sinensis]
Length=673

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  452  VALFVLAALSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A+VYRN+A + VEGFSALPQH
Sbjct  512  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIVYRNMAILGVEGFSALPQH  564



>ref|XP_010442922.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Camelina sativa]
 ref|XP_010442923.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Camelina sativa]
Length=673

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  450  VALFILAAMAGKQNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+ALVYRN+A + VEGFSALPQH
Sbjct  510  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYALVYRNMAILGVEGFSALPQH  562



>ref|XP_006441190.1| hypothetical protein CICLE_v10019170mg [Citrus clementina]
 gb|ESR54430.1| hypothetical protein CICLE_v10019170mg [Citrus clementina]
Length=673

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  452  VALFVLAALSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A+VYRN+A + VEGFSALPQH
Sbjct  512  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIVYRNMAILGVEGFSALPQH  564



>gb|ABD04075.1| YSL transporter 3 [Noccaea caerulescens]
Length=672

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGH+TLTS R+M +SQAIG
Sbjct  450  VALFILAAMAGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHMTLTSPRSMLVSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNPNGEYKAP+ L+YRN+A + VEGFSALPQH
Sbjct  510  TAIGCVVAPLTFFLFYKAFDVGNPNGEYKAPYGLIYRNMAILGVEGFSALPQH  562



>ref|XP_010482755.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Camelina sativa]
Length=673

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  450  VALFILAAMAGKQNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+ALVYRN+A + VEGFSALPQH
Sbjct  510  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYALVYRNMAILGVEGFSALPQH  562



>gb|ABB76763.1| YSL transporter 3 [Noccaea caerulescens]
Length=672

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGH+TLTS R+M +SQAIG
Sbjct  450  VALFILAAMAGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHMTLTSPRSMLVSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNPNGEYKAP+ L+YRN+A + VEGFSALPQH
Sbjct  510  TAIGCVVAPLTFFLFYKAFDVGNPNGEYKAPYGLIYRNMAILGVEGFSALPQH  562



>ref|XP_002864249.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40508.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=675

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  450  VALFILAAMAGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP GEYKAP+ALVYRN+A + VEGFSALPQH
Sbjct  510  TAIGCVVAPLTFFLFYKAFDVGNPAGEYKAPYALVYRNMAILGVEGFSALPQH  562



>ref|XP_009762636.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Nicotiana sylvestris]
Length=737

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF+MAA  GKE+GV+AGLAGCGL+KSV+N+S  LM DFKTGHLTLTS + MFLSQAIG
Sbjct  516  VGLFMMAALAGKEHGVIAGLAGCGLIKSVVNISCILMQDFKTGHLTLTSPKTMFLSQAIG  575

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+ PLSFFLFYNAFD+GNPNGE+KAP+AL+YRN+A +SV+G SALPQH
Sbjct  576  TALGCVIGPLSFFLFYNAFDIGNPNGEFKAPYALIYRNMAILSVQGVSALPQH  628



>ref|XP_009762637.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Nicotiana sylvestris]
Length=736

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF+MAA  GKE+GV+AGLAGCGL+KSV+N+S  LM DFKTGHLTLTS + MFLSQAIG
Sbjct  515  VGLFMMAALAGKEHGVIAGLAGCGLIKSVVNISCILMQDFKTGHLTLTSPKTMFLSQAIG  574

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+ PLSFFLFYNAFD+GNPNGE+KAP+AL+YRN+A +SV+G SALPQH
Sbjct  575  TALGCVIGPLSFFLFYNAFDIGNPNGEFKAPYALIYRNMAILSVQGVSALPQH  627



>ref|XP_006281523.1| hypothetical protein CARUB_v10027623mg [Capsella rubella]
 gb|EOA14421.1| hypothetical protein CARUB_v10027623mg [Capsella rubella]
Length=672

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  450  VALFILAAMAGKQNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+AL+YRN+A + VEGFSALPQH
Sbjct  510  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYALIYRNMAILGVEGFSALPQH  562



>ref|XP_009763790.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Nicotiana sylvestris]
Length=662

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQ IG
Sbjct  438  VALFVLAALSGKDNGVVAGLIGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQGIG  497

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+AL+YRN+A + VEGFSALPQH
Sbjct  498  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYALIYRNMAILGVEGFSALPQH  550



>ref|XP_009587674.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009587675.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=668

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF+MAA  GKE+GV+AGLAGCGL+KSV NVS  LM DFKTGHLTLTS + MFLSQAIG
Sbjct  447  VGLFMMAALAGKEHGVIAGLAGCGLIKSVANVSCILMQDFKTGHLTLTSPKTMFLSQAIG  506

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+ PLSFFLFYNAFD+GNPNGE+KAP+AL+YRN+A +SV+G SALP H
Sbjct  507  TALGCVIGPLSFFLFYNAFDIGNPNGEFKAPYALIYRNMAIISVQGVSALPHH  559



>ref|XP_009587676.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=667

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF+MAA  GKE+GV+AGLAGCGL+KSV NVS  LM DFKTGHLTLTS + MFLSQAIG
Sbjct  446  VGLFMMAALAGKEHGVIAGLAGCGLIKSVANVSCILMQDFKTGHLTLTSPKTMFLSQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+ PLSFFLFYNAFD+GNPNGE+KAP+AL+YRN+A +SV+G SALP H
Sbjct  506  TALGCVIGPLSFFLFYNAFDIGNPNGEFKAPYALIYRNMAIISVQGVSALPHH  558



>ref|XP_010445905.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Camelina 
sativa]
 ref|XP_010445908.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Camelina 
sativa]
 ref|XP_010445915.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Camelina 
sativa]
 ref|XP_010445922.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Camelina 
sativa]
Length=673

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  450  VALFILAAMAGKQNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP GEYKAP+ALVYRN+A + VEGFSALPQH
Sbjct  510  TAIGCVVAPLTFFLFYKAFDVGNPEGEYKAPYALVYRNMAILGVEGFSALPQH  562



>emb|CDX96232.1| BnaC02g14190D [Brassica napus]
Length=672

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  450  VALFILAAMSGKQNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPLSFFLFY AFDVGNP GEYKAP+ALVYRN+A + VEGFSALPQH
Sbjct  510  TGIGCVVAPLSFFLFYKAFDVGNPEGEYKAPYALVYRNMAILGVEGFSALPQH  562



>ref|XP_006343788.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Solanum 
tuberosum]
Length=674

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF+MAA  GKE+GV+AGLAGCGL+KSV+N+S  LM DFKTGHLTLTS + MFLSQAIG
Sbjct  453  VGLFMMAALAGKEHGVIAGLAGCGLIKSVVNISCILMQDFKTGHLTLTSPKTMFLSQAIG  512

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+ PL FFLFYNAFD+GNPNGE+KAP+AL+YRN+A +SV+G SALPQH
Sbjct  513  TALGCVIGPLCFFLFYNAFDIGNPNGEFKAPYALIYRNMAILSVQGVSALPQH  565



>ref|XP_004245462.1| PREDICTED: metal-nicotianamine transporter YSL1 [Solanum lycopersicum]
Length=663

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF+MAA  GKE+GV+AGLAGCGL+KSV+N+S  LM DFKTGHLTLTS + MFLSQAIG
Sbjct  442  VGLFMMAALAGKEHGVIAGLAGCGLIKSVVNISCILMQDFKTGHLTLTSPKTMFLSQAIG  501

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+ PL FFLFYNAFD+GNPNGE+KAP+AL+YRN+A +SV+G SALPQH
Sbjct  502  TALGCVIGPLCFFLFYNAFDIGNPNGEFKAPYALIYRNMAILSVQGVSALPQH  554



>ref|XP_009763789.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Nicotiana sylvestris]
Length=668

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQ IG
Sbjct  444  VALFVLAALSGKDNGVVAGLIGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQGIG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+AL+YRN+A + VEGFSALPQH
Sbjct  504  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYALIYRNMAILGVEGFSALPQH  556



>ref|XP_007039160.1| YELLOW STRIPE like 3 isoform 1 [Theobroma cacao]
 gb|EOY23661.1| YELLOW STRIPE like 3 isoform 1 [Theobroma cacao]
Length=668

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  446  VALFVLAALSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+ EYKAP+AL+YRN+A + V+GFSALPQH
Sbjct  506  TAIGCVVAPLTFFLFYKAFDVGNPDSEYKAPYALIYRNMAILGVQGFSALPQH  558



>ref|XP_007039161.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao]
 ref|XP_007039162.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao]
 gb|EOY23662.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao]
 gb|EOY23663.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao]
Length=668

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  446  VALFVLAALSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+ EYKAP+AL+YRN+A + V+GFSALPQH
Sbjct  506  TAIGCVVAPLTFFLFYKAFDVGNPDSEYKAPYALIYRNMAILGVQGFSALPQH  558



>gb|KHG10996.1| Metal-nicotianamine transporter YSL3 -like protein [Gossypium 
arboreum]
Length=645

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  423  VALFVLAAMSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  482

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+AL+YRN+A + V+GFSALP H
Sbjct  483  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYALIYRNMAILGVQGFSALPHH  535



>gb|KCW77323.1| hypothetical protein EUGRSUZ_D01684 [Eucalyptus grandis]
Length=475

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENG+VAGLAGCGL+KS ++V+  LM DFKT H TLTS RAMFLSQ IG
Sbjct  254  VALFILAAMSGKENGLVAGLAGCGLIKSAVSVACILMQDFKTAHFTLTSPRAMFLSQVIG  313

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALP+H
Sbjct  314  TAIGCVVAPLSFFLFYKAFDVGNPDGEFKAPYALIYRNMAILGVQGFSALPRH  366



>gb|KDP30688.1| hypothetical protein JCGZ_16395 [Jatropha curcas]
Length=661

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G+ NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  439  VALFVLAALAGRNNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  498

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + VEGFSALPQH
Sbjct  499  TAIGCIVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVEGFSALPQH  551



>ref|XP_008367110.1| PREDICTED: metal-nicotianamine transporter YSL1-like, partial 
[Malus domestica]
Length=285

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+GVVAGLAGCGL+KSV+NV+  LM D KT HLT TS RAMF+SQA+G
Sbjct  65   VALFVLAAMTGKEHGVVAGLAGCGLIKSVVNVACILMQDLKTAHLTFTSPRAMFVSQALG  124

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+APLSFFLFY AFDVGNP+GE+KAPFAL+YRN+A + V+GFSALPQH
Sbjct  125  TALGCVIAPLSFFLFYKAFDVGNPHGEFKAPFALIYRNMAILGVQGFSALPQH  177



>ref|XP_011082340.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Sesamum indicum]
 ref|XP_011082341.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Sesamum indicum]
Length=668

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF +AA  GKE+GV+A LA CGL KS++NV+  LM DFKTGHLTLTS RAM LSQA+G
Sbjct  447  VGLFTIAAMSGKEHGVIAALAACGLFKSIINVASILMQDFKTGHLTLTSPRAMLLSQALG  506

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+V+PLSFFLFY AFD+GNP+GE+KAP+A++YRNLA + V+GFSALPQH
Sbjct  507  TALGCIVSPLSFFLFYKAFDIGNPDGEFKAPYAIIYRNLAIIGVQGFSALPQH  559



>ref|XP_011082337.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Sesamum indicum]
 ref|XP_011082338.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Sesamum indicum]
Length=672

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF +AA  GKE+GV+A LA CGL KS++NV+  LM DFKTGHLTLTS RAM LSQA+G
Sbjct  451  VGLFTIAAMSGKEHGVIAALAACGLFKSIINVASILMQDFKTGHLTLTSPRAMLLSQALG  510

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+V+PLSFFLFY AFD+GNP+GE+KAP+A++YRNLA + V+GFSALPQH
Sbjct  511  TALGCIVSPLSFFLFYKAFDIGNPDGEFKAPYAIIYRNLAIIGVQGFSALPQH  563



>ref|XP_002515673.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF46725.1| oligopeptide transporter, putative [Ricinus communis]
Length=671

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G  NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  449  VALFVLAALAGNNNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  508

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + VEGFSALPQH
Sbjct  509  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVEGFSALPQH  561



>ref|XP_011082339.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Sesamum indicum]
Length=671

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF +AA  GKE+GV+A LA CGL KS++NV+  LM DFKTGHLTLTS RAM LSQA+G
Sbjct  450  VGLFTIAAMSGKEHGVIAALAACGLFKSIINVASILMQDFKTGHLTLTSPRAMLLSQALG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+V+PLSFFLFY AFD+GNP+GE+KAP+A++YRNLA + V+GFSALPQH
Sbjct  510  TALGCIVSPLSFFLFYKAFDIGNPDGEFKAPYAIIYRNLAIIGVQGFSALPQH  562



>gb|AFU82909.1| yellow stripe-like transporter 3.2, partial [Arachis hypogaea]
Length=263

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK +GVV+GL  CGL+KS++++  +LM DFKTGHLT TS R+M LSQAIG
Sbjct  41   VALFMVAALVGKNDGVVSGLVACGLIKSIVSICSDLMHDFKTGHLTYTSPRSMLLSQAIG  100

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+AL+YRN+A + VEGFS LPQH
Sbjct  101  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYALIYRNMAILGVEGFSTLPQH  153



>dbj|BAE98794.1| EspB-like protein [Arabidopsis thaliana]
Length=491

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  266  VALFILAAMAGKQNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  325

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGN  GEYKAP+ALVYRN+A + VEGFSALPQH
Sbjct  326  TAIGCVVAPLTFFLFYKAFDVGNQEGEYKAPYALVYRNMAILGVEGFSALPQH  378



>gb|KHG05098.1| Metal-nicotianamine transporter YSL3 -like protein [Gossypium 
arboreum]
Length=668

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  446  VALFVLAALSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAPL+FFLFY AFD+GNP+GEYKAP+AL+YRN+A + V+GFSALPQ+
Sbjct  506  TAIGCIVAPLTFFLFYKAFDLGNPDGEYKAPYALIYRNMAILGVQGFSALPQY  558



>ref|XP_006431856.1| hypothetical protein CICLE_v10003961mg [Citrus clementina]
 gb|ESR45096.1| hypothetical protein CICLE_v10003961mg [Citrus clementina]
Length=673

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  452  VALFVLAALSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPLSFFLFY AFDVGNP+ EYKAP+A+VYRN+A + V+GFSALP+H
Sbjct  512  TAIGCVVAPLSFFLFYRAFDVGNPDREYKAPYAIVYRNMAILGVQGFSALPRH  564



>ref|XP_010053070.1| PREDICTED: metal-nicotianamine transporter YSL1 [Eucalyptus grandis]
 gb|KCW77322.1| hypothetical protein EUGRSUZ_D01684 [Eucalyptus grandis]
Length=669

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENG+VAGLAGCGL+KS ++V+  LM DFKT H TLTS RAMFLSQ IG
Sbjct  448  VALFILAAMSGKENGLVAGLAGCGLIKSAVSVACILMQDFKTAHFTLTSPRAMFLSQVIG  507

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALP+H
Sbjct  508  TAIGCVVAPLSFFLFYKAFDVGNPDGEFKAPYALIYRNMAILGVQGFSALPRH  560



>emb|CDY20248.1| BnaC09g29910D [Brassica napus]
Length=674

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  452  VALFILAAMAGKQDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP GEYKAP+AL+YRN+A + VEGFSALPQH
Sbjct  512  TGIGCVVAPLTFFLFYKAFDVGNPEGEYKAPYALIYRNMAILGVEGFSALPQH  564



>ref|XP_009119903.1| PREDICTED: metal-nicotianamine transporter YSL3 [Brassica rapa]
 ref|XP_009119904.1| PREDICTED: metal-nicotianamine transporter YSL3 [Brassica rapa]
 ref|XP_009119905.1| PREDICTED: metal-nicotianamine transporter YSL3 [Brassica rapa]
Length=674

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  452  VALFILAAMAGKQDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP GEYKAP+AL+YRN+A + VEGFSALPQH
Sbjct  512  TGIGCVVAPLTFFLFYKAFDVGNPEGEYKAPYALIYRNMAILGVEGFSALPQH  564



>emb|CDY14371.1| BnaA10g06840D [Brassica napus]
Length=678

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  456  VALFILAAMAGKQDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  515

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP GEYKAP+AL+YRN+A + VEGFSALPQH
Sbjct  516  TGIGCVVAPLTFFLFYKAFDVGNPEGEYKAPYALIYRNMAILGVEGFSALPQH  568



>ref|XP_010318047.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Solanum lycopersicum]
Length=666

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKT HLTLTS R+M LSQAIG
Sbjct  443  VALFVLAALSGKENGVVAGLIGCGLIKSMVSISSDLMHDFKTSHLTLTSPRSMLLSQAIG  502

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY +FDVG PNGEYKAP+AL+YRN+A + VEGFSALP+H
Sbjct  503  TAIGCVVAPLTFFLFYKSFDVGGPNGEYKAPYALIYRNMAILGVEGFSALPRH  555



>ref|XP_002274166.1| PREDICTED: metal-nicotianamine transporter YSL3 [Vitis vinifera]
Length=665

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK++GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  444  VALFVLAALAGKDSGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + VEGFSALP H
Sbjct  504  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVEGFSALPHH  556



>dbj|BAB09731.1| EspB-like protein [Arabidopsis thaliana]
Length=669

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  444  VALFILAAMAGKQNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGN  GEYKAP+ALVYRN+A + VEGFSALPQH
Sbjct  504  TAIGCVVAPLTFFLFYKAFDVGNQEGEYKAPYALVYRNMAILGVEGFSALPQH  556



>ref|XP_007136481.1| hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris]
 ref|XP_007136482.1| hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris]
 gb|ESW08475.1| hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris]
 gb|ESW08476.1| hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris]
Length=673

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLT TS R+M LSQAIG
Sbjct  449  VALFVLAALAGKSDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTFTSPRSMLLSQAIG  508

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNPNG+YKAP+A++YRN+A + VEGFSALPQH
Sbjct  509  TAIGCVVAPLTFFLFYKAFDVGNPNGDYKAPYAIIYRNMAILGVEGFSALPQH  561



>emb|CAN77891.1| hypothetical protein VITISV_016271 [Vitis vinifera]
Length=677

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK++GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  456  VALFVLAALAGKDSGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  515

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + VEGFSALP H
Sbjct  516  TAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVEGFSALPHH  568



>gb|EYU40692.1| hypothetical protein MIMGU_mgv1a002430mg [Erythranthe guttata]
Length=676

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF +AA  GKENGV+A +A CGL KS++NVS  LM DFKTGHLTLTS + M LSQAIG
Sbjct  455  VGLFTIAAMSGKENGVIAAMAACGLFKSIINVSCILMQDFKTGHLTLTSPKIMLLSQAIG  514

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+V+PLSFF+FY AFD+GNP+GE+KAP+A++YRNLA + V+GFSALPQH
Sbjct  515  TALGCIVSPLSFFMFYKAFDIGNPDGEFKAPYAIIYRNLAIIGVQGFSALPQH  567



>ref|NP_200167.2| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana]
 ref|NP_001190532.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana]
 sp|Q2EF88.1|YSL3_ARATH RecName: Full=Metal-nicotianamine transporter YSL3; AltName: 
Full=Protein YELLOW STRIPE LIKE 3; Short=AtYSL3 [Arabidopsis 
thaliana]
 gb|ABD38920.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana]
 gb|AED96375.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana]
 gb|AED96376.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana]
Length=675

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  450  VALFILAAMAGKQNGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGN  GEYKAP+ALVYRN+A + VEGFSALPQH
Sbjct  510  TAIGCVVAPLTFFLFYKAFDVGNQEGEYKAPYALVYRNMAILGVEGFSALPQH  562



>ref|XP_011084545.1| PREDICTED: LOW QUALITY PROTEIN: metal-nicotianamine transporter 
YSL3 [Sesamum indicum]
Length=655

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQA G
Sbjct  431  VALFVLAALAGKDNGVVAGLIGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLISQAFG  490

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAPLSFFLFY AFDVGNP+G+YKAP+AL+YRN+A + VEGFSALP H
Sbjct  491  TAIGCIVAPLSFFLFYKAFDVGNPDGDYKAPYALIYRNMAILGVEGFSALPHH  543



>gb|EYU45295.1| hypothetical protein MIMGU_mgv1a002502mg [Erythranthe guttata]
Length=666

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+A+  GKENGVVAGL GCGL+KS+ ++S +LM DFKTGHLTLTS R+M +SQ IG
Sbjct  442  VALFVLASMVGKENGVVAGLIGCGLIKSMASISSDLMHDFKTGHLTLTSPRSMLVSQVIG  501

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY  FDVGNPNGEYKAP+AL+YRN+A + VEGFSALP H
Sbjct  502  TAIGCVVAPLTFFLFYKTFDVGNPNGEYKAPYALIYRNMAILGVEGFSALPHH  554



>ref|XP_006471126.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Citrus 
sinensis]
Length=673

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  452  VALFVLAALSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPLSFFLFY AFDVG+P+ EYKAP+A+VYRN+A + V+GFSALP+H
Sbjct  512  TAIGCVVAPLSFFLFYKAFDVGHPDREYKAPYAIVYRNMAILGVQGFSALPRH  564



>gb|KDO53476.1| hypothetical protein CISIN_1g047730mg [Citrus sinensis]
Length=673

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  452  VALFVLAALSGKENGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPLSFFLFY AFDVG+P+ EYKAP+A+VYRN+A + V+GFSALP+H
Sbjct  512  TAIGCVVAPLSFFLFYKAFDVGHPDREYKAPYAIVYRNMAILGVQGFSALPRH  564



>ref|XP_010537055.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Tarenaya 
hassleriana]
Length=680

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGL+KS++++S +LM DFKTGHLT TS R+M +SQAIG
Sbjct  457  VALFILAAMAGKQDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTFTSPRSMLVSQAIG  516

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNPNG YKAP+ALVYRN+A + VEGFSALP+H
Sbjct  517  TAIGCVVAPLTFFLFYKAFDVGNPNGTYKAPYALVYRNMAILGVEGFSALPRH  569



>ref|XP_010537056.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X2 [Tarenaya 
hassleriana]
Length=677

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGL+KS++++S +LM DFKTGHLT TS R+M +SQAIG
Sbjct  454  VALFILAAMAGKQDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTFTSPRSMLVSQAIG  513

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNPNG YKAP+ALVYRN+A + VEGFSALP+H
Sbjct  514  TAIGCVVAPLTFFLFYKAFDVGNPNGTYKAPYALVYRNMAILGVEGFSALPRH  566



>emb|CDP05015.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M L Q IG
Sbjct  449  VALFVLAALAGKDNGVVAGLIGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLGQGIG  508

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAP++F LFY AFDVGNP+GEYKAP+AL+YRN+A + VEGFSALPQH
Sbjct  509  TAIGCIVAPITFLLFYKAFDVGNPDGEYKAPYALIYRNMAILGVEGFSALPQH  561



>ref|XP_008803948.1| PREDICTED: probable metal-nicotianamine transporter YSL9 [Phoenix 
dactylifera]
 ref|XP_008803949.1| PREDICTED: probable metal-nicotianamine transporter YSL9 [Phoenix 
dactylifera]
Length=664

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL  CGL+KSV++++ +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  443  VALFILAAWAGKDNGVVAGLVACGLIKSVVSIAADLMHDFKTGHLTLTSPRSMLLSQAIG  502

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCVVAPL+FFLFY AFDVGNP G +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  503  TAMGCVVAPLTFFLFYKAFDVGNPEGIWKAPYALIYRNMAILGVEGFSALPEH  555



>ref|XP_006401691.1| hypothetical protein EUTSA_v10012886mg [Eutrema salsugineum]
 dbj|BAJ34221.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43144.1| hypothetical protein EUTSA_v10012886mg [Eutrema salsugineum]
Length=672

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQAIG
Sbjct  450  VALFILAAMAGKKDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP GEYKAP+AL+YRN+A + VEGFSALP H
Sbjct  510  TGIGCVVAPLTFFLFYKAFDVGNPEGEYKAPYALIYRNMAILGVEGFSALPHH  562



>ref|XP_010048775.1| PREDICTED: metal-nicotianamine transporter YSL3 [Eucalyptus grandis]
 gb|KCW89105.1| hypothetical protein EUGRSUZ_A01430 [Eucalyptus grandis]
Length=670

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AAS GK++GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS RAM LSQAIG
Sbjct  445  VALFVLAASVGKDSGVVAGLIGCGLIKSIVSISSDLMQDFKTGHLTLTSPRAMLLSQAIG  504

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+VAPL FFLFY+ FDVGNP GEYKAP+A+VYRN+A +  EGFSALPQH
Sbjct  505  TALGCLVAPLIFFLFYDTFDVGNPEGEYKAPYAIVYRNMALLGTEGFSALPQH  557



>ref|XP_002318472.2| hypothetical protein POPTR_0012s03180g [Populus trichocarpa]
 ref|XP_006376676.1| hypothetical protein POPTR_0012s03180g [Populus trichocarpa]
 ref|XP_002318482.2| transporter family protein [Populus trichocarpa]
 gb|EEE96692.2| hypothetical protein POPTR_0012s03180g [Populus trichocarpa]
 gb|ERP54473.1| hypothetical protein POPTR_0012s03180g [Populus trichocarpa]
 gb|EEE96702.2| transporter family protein [Populus trichocarpa]
Length=665

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  226  DFKTGHLTLTSSRAMFLSQAIGTIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRN  47
            DFKTGHLTLTS R+M LSQAIGT+IGCVVAP++FFLFY AFDVGNP+GEYKAP+A++YRN
Sbjct  481  DFKTGHLTLTSPRSMLLSQAIGTVIGCVVAPVTFFLFYKAFDVGNPDGEYKAPYAIIYRN  540

Query  46   LASVSVEGFSALPQH  2
            +A + VEGFSALPQH
Sbjct  541  MAILGVEGFSALPQH  555



>ref|XP_011043727.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Populus euphratica]
Length=655

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  226  DFKTGHLTLTSSRAMFLSQAIGTIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRN  47
            DFKTGHLTLTS R+M LSQAIGT+IGCVVAP++FFLFY AFDVGNP+GEYKAP+A++YRN
Sbjct  471  DFKTGHLTLTSPRSMLLSQAIGTVIGCVVAPVTFFLFYKAFDVGNPDGEYKAPYAIIYRN  530

Query  46   LASVSVEGFSALPQH  2
            +A + VEGFSALPQH
Sbjct  531  MAILGVEGFSALPQH  545



>ref|XP_011043724.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Populus euphratica]
 ref|XP_011043725.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Populus euphratica]
 ref|XP_011043726.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Populus euphratica]
Length=665

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  226  DFKTGHLTLTSSRAMFLSQAIGTIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRN  47
            DFKTGHLTLTS R+M LSQAIGT+IGCVVAP++FFLFY AFDVGNP+GEYKAP+A++YRN
Sbjct  481  DFKTGHLTLTSPRSMLLSQAIGTVIGCVVAPVTFFLFYKAFDVGNPDGEYKAPYAIIYRN  540

Query  46   LASVSVEGFSALPQH  2
            +A + VEGFSALPQH
Sbjct  541  MAILGVEGFSALPQH  555



>emb|CDY03488.1| BnaC01g15940D [Brassica napus]
Length=675

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF+SQ IG
Sbjct  454  IGLFVLAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFVSQMIG  513

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            TI+GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  514  TIVGCIVTPLSFFLFYRAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  566



>gb|AFP55583.1| yellow stripe-like protein [Rosa rugosa]
Length=832

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM D KTGHLTLTS R+M +SQAIG
Sbjct  425  VALFVLAAVTGKNDGVVAGLVGCGLIKSIVSISSDLMHDLKTGHLTLTSPRSMIVSQAIG  484

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNPNG+YKAP+A++YRN+A + VEGFSALPQH
Sbjct  485  TAIGCVVAPLTFFLFYKAFDVGNPNGQYKAPYAIIYRNMAILGVEGFSALPQH  537



>ref|XP_006413472.1| hypothetical protein EUTSA_v10024600mg [Eutrema salsugineum]
 gb|ESQ54925.1| hypothetical protein EUTSA_v10024600mg [Eutrema salsugineum]
Length=672

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF+SQ IG
Sbjct  451  IGLFVLAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFVSQMIG  510

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            TI+GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  511  TIVGCIVTPLSFFLFYRAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  563



>ref|XP_007039405.1| YELLOW STRIPE like 1 isoform 3 [Theobroma cacao]
 ref|XP_007039406.1| YELLOW STRIPE like 1 isoform 3 [Theobroma cacao]
 gb|EOY23906.1| YELLOW STRIPE like 1 isoform 3 [Theobroma cacao]
 gb|EOY23907.1| YELLOW STRIPE like 1 isoform 3 [Theobroma cacao]
Length=554

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENGVVAGLAGCGL+KSV++V+  LM DFKT H TLTS RAMFLSQAIG
Sbjct  333  VALFILAALTGKENGVVAGLAGCGLIKSVVSVACILMQDFKTAHYTLTSPRAMFLSQAIG  392

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+ APLSFF+FY AFDVGNP GE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  393  TAIGCITAPLSFFVFYKAFDVGNPYGEFKAPYALIYRNMAILGVQGFSALPHH  445



>ref|XP_008374112.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Malus domestica]
Length=664

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+GVVAGLAGCGL+KSV++V+  LM D KT HLT TS RAMF+SQAIG
Sbjct  444  VALFVLAAMTGKEHGVVAGLAGCGLIKSVVSVACILMQDLKTAHLTFTSPRAMFVSQAIG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV APLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  504  TLLGCVTAPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAILGVQGFSALPQH  556



>ref|XP_009397635.1| PREDICTED: probable metal-nicotianamine transporter YSL9 [Musa 
acuminata subsp. malaccensis]
Length=700

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGL+KSV+++S +LM DFKTGHLT+TS R+M LSQAIG
Sbjct  478  VSLFILAAWAGKDSGVVAGLVGCGLIKSVVSISADLMHDFKTGHLTVTSPRSMLLSQAIG  537

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC++APL+FFLFYN FDVGNPNG +KAP+AL+YRN+A +SVEGFSALP H
Sbjct  538  TAMGCIIAPLTFFLFYNIFDVGNPNGNWKAPYALIYRNMAILSVEGFSALPHH  590



>ref|XP_009358702.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Pyrus x 
bretschneideri]
Length=664

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+GVVAGLAGCGL+KSV++V+  LM D KT HLT TS RAMF+SQAIG
Sbjct  444  VALFVLAAMTGKEHGVVAGLAGCGLIKSVVSVACILMQDLKTAHLTFTSPRAMFVSQAIG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV APLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  504  TLLGCVTAPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAILGVQGFSALPQH  556



>ref|XP_009765494.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009765501.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009765507.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009765514.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana sylvestris]
Length=675

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKT HLTLTS R+M LSQAIG
Sbjct  451  VALFVLAALSGKENGVVAGLIGCGLIKSIVSISSDLMHDFKTSHLTLTSPRSMLLSQAIG  510

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF VG+PNG+YKAP+A+VYRN+A + VEGFSALP H
Sbjct  511  TAIGCVVAPLTFFLFYKAFPVGDPNGDYKAPYAIVYRNMAILGVEGFSALPNH  563



>ref|XP_009765519.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X2 [Nicotiana sylvestris]
Length=674

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKT HLTLTS R+M LSQAIG
Sbjct  450  VALFVLAALSGKENGVVAGLIGCGLIKSIVSISSDLMHDFKTSHLTLTSPRSMLLSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF VG+PNG+YKAP+A+VYRN+A + VEGFSALP H
Sbjct  510  TAIGCVVAPLTFFLFYKAFPVGDPNGDYKAPYAIVYRNMAILGVEGFSALPNH  562



>dbj|BAF48331.1| putative yellow stripe-like protein [Nicotiana tabacum]
Length=675

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKT HLTLTS R+M LSQAIG
Sbjct  452  VALFVLAALSGKENGVVAGLIGCGLIKSIVSISSDLMHDFKTSHLTLTSPRSMLLSQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF VG+PNG+YKAP+A+VYRN+A + VEGFSALP H
Sbjct  512  TAIGCVVAPLTFFLFYKAFPVGDPNGDYKAPYAIVYRNMAILGVEGFSALPNH  564



>ref|XP_009588595.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588596.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588597.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588598.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588599.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=674

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKT HLTLTS R+M LSQAIG
Sbjct  451  VALFVLAALSGKENGVVAGLIGCGLIKSIVSISSDLMHDFKTSHLTLTSPRSMLLSQAIG  510

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF VG+PNG+YKAP+A+VYRN+A + VEGFSALP H
Sbjct  511  TAIGCVVAPLTFFLFYKAFPVGDPNGDYKAPYAIVYRNMAILGVEGFSALPNH  563



>ref|XP_009588601.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X2 [Nicotiana tomentosiformis]
Length=673

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KS++++S +LM DFKT HLTLTS R+M LSQAIG
Sbjct  450  VALFVLAALSGKENGVVAGLIGCGLIKSIVSISSDLMHDFKTSHLTLTSPRSMLLSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF VG+PNG+YKAP+A+VYRN+A + VEGFSALP H
Sbjct  510  TAIGCVVAPLTFFLFYKAFPVGDPNGDYKAPYAIVYRNMAILGVEGFSALPNH  562



>ref|XP_008390279.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Malus domestica]
Length=664

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+GVVAGLAGCGL+KSV+NV+  LM D KT HLT TS RAMF+SQA+G
Sbjct  444  VALFVLAAMTGKEHGVVAGLAGCGLIKSVVNVACILMQDLKTAHLTFTSPRAMFVSQALG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+APLSFFLFY AFDVGNP+GE+KAPFAL+YRN+A + V+GFSALPQH
Sbjct  504  TALGCVIAPLSFFLFYKAFDVGNPHGEFKAPFALIYRNMAILGVQGFSALPQH  556



>gb|KHN05985.1| Metal-nicotianamine transporter YSL3-like protein [Glycine soja]
Length=551

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA GGK +GVVAGL GCG++KS+++ S +LM DFKTGHLT  S R+M LSQAIG
Sbjct  329  VALFVLAALGGKSHGVVAGLVGCGVIKSLVSTSSDLMQDFKTGHLTFASPRSMLLSQAIG  388

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCV+APL+FFLFY AFDVGNP+G+YKAP+A++YRN+A + VEGFSALP H
Sbjct  389  TAIGCVLAPLTFFLFYKAFDVGNPDGDYKAPYAIIYRNMAILGVEGFSALPHH  441



>gb|EYU19676.1| hypothetical protein MIMGU_mgv1a002464mg [Erythranthe guttata]
Length=671

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL GCGL+KS++++S +LM D KTG+LTLTS R+M +SQAIG
Sbjct  447  VSLFILAALAGKDNGVVAGLIGCGLIKSIVSISSDLMHDLKTGYLTLTSPRSMLVSQAIG  506

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAPLSFFLFY AFDVGNP+GEYKAP+A++YRN+A + VEGFSALP+H
Sbjct  507  TAIGCIVAPLSFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVEGFSALPRH  559



>ref|XP_009359556.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Pyrus x 
bretschneideri]
Length=664

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+GVVAGLAGCGL+KSV++V+  LM D KT HLT TS RAMF+SQA+G
Sbjct  444  VALFVLAAMTGKEHGVVAGLAGCGLIKSVVSVACILMQDLKTAHLTFTSPRAMFVSQALG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV APLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A +SV+GFSALPQH
Sbjct  504  TALGCVTAPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAILSVQGFSALPQH  556



>ref|XP_006350625.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Solanum 
tuberosum]
Length=863

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK+NGVVAGL GCGL+KS++++S +LM DFKT HLTLTS R+M LSQAIG
Sbjct  464  VALFVLAALSGKDNGVVAGLIGCGLIKSMVSISSDLMHDFKTSHLTLTSPRSMLLSQAIG  523

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY +FDVG+PNGEYKAP+AL+YRN+A + VEGFSALP H
Sbjct  524  TAIGCVVAPLTFFLFYISFDVGDPNGEYKAPYALIYRNMAILGVEGFSALPLH  576



>ref|XP_010448607.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Camelina 
sativa]
Length=685

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF+SQ IG
Sbjct  464  IGLFVIAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFVSQMIG  523

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  524  TVVGCIVTPLSFFLFYKAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  576



>ref|XP_006578879.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Glycine max]
 ref|XP_006578880.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Glycine max]
Length=676

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLT TS R+M LSQAIG
Sbjct  452  VALFVLAALAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTFTSPRSMLLSQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+G+YKAP+A++YRN+A + VEGFSALP H
Sbjct  512  TAIGCVVAPLTFFLFYKAFDVGNPDGDYKAPYAIIYRNMAILGVEGFSALPHH  564



>ref|XP_010439083.1| PREDICTED: metal-nicotianamine transporter YSL1 [Camelina sativa]
Length=671

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF+SQ IG
Sbjct  450  IGLFVIAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFVSQMIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  510  TVVGCIVTPLSFFLFYKAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  562



>ref|XP_010433812.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Camelina 
sativa]
 ref|XP_010433813.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Camelina 
sativa]
Length=671

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF+SQ IG
Sbjct  450  IGLFVIAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFVSQMIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  510  TVVGCIVTPLSFFLFYKAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  562



>emb|CAH67443.1| H0501D11.7 [Oryza sativa Indica Group]
Length=684

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS R+M ++QAIG
Sbjct  462  IALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMIIAQAIG  521

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV++PL+FFLFYNAFD+GNP G +KAP+ALVYRN+A + VEGFSALPQH
Sbjct  522  TVMGCVISPLTFFLFYNAFDIGNPEGYWKAPYALVYRNMAILGVEGFSALPQH  574



>ref|XP_009361313.1| PREDICTED: metal-nicotianamine transporter YSL2 [Pyrus x bretschneideri]
Length=671

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL  CGL+KS++++S +LM D KTGHLTLTS R+M LSQAIG
Sbjct  449  VALFVLAAVAGKSDGVVAGLVACGLIKSMVSISSDLMHDLKTGHLTLTSPRSMLLSQAIG  508

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF VG+PNGEYKAP+A++YRN+A + VEGFSALP+H
Sbjct  509  TAIGCVVAPLTFFLFYKAFKVGDPNGEYKAPYAIIYRNMAILGVEGFSALPKH  561



>ref|XP_011075924.1| PREDICTED: LOW QUALITY PROTEIN: metal-nicotianamine transporter 
YSL3 [Sesamum indicum]
Length=664

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK+NGVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M +SQ IG
Sbjct  440  VALFVLAALTGKDNGVVAGLIGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQGIG  499

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+G YKAP+A++YRN+A + VEGFSALP H
Sbjct  500  TAIGCVVAPLTFFLFYKAFDVGNPDGNYKAPYAIIYRNMAILGVEGFSALPHH  552



>ref|XP_010671369.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=656

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK++GVVAGL GCGL+KS++++S +LM DFKTGHLT TS R+M LSQAIG
Sbjct  435  VALFVLAAIVGKDSGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTFTSPRSMLLSQAIG  494

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAP +FFLFY AFD+GNP GEYKAP+AL+YRN+A + V+GFSALPQH
Sbjct  495  TAIGCVVAPFTFFLFYKAFDIGNPEGEYKAPYALIYRNMAILGVQGFSALPQH  547



>ref|XP_003523338.2| PREDICTED: metal-nicotianamine transporter YSL3-like isoformX1 
[Glycine max]
Length=687

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLT TS R+M LSQAIG
Sbjct  463  VALFVLAALAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTFTSPRSMLLSQAIG  522

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+G+YKAP+A++YRN+A + VEGFSALP H
Sbjct  523  TAIGCVVAPLTFFLFYKAFDVGNPDGDYKAPYAIIYRNMAILGVEGFSALPHH  575



>ref|XP_002518903.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF43436.1| oligopeptide transporter, putative [Ricinus communis]
Length=667

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVA LAGCGL+KSV++V+  LM DFKT HLT TS RAMFLSQ IG
Sbjct  446  VALFVLAALSGKENGVVAALAGCGLIKSVVSVACILMQDFKTAHLTFTSPRAMFLSQVIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCV+APLSFF++Y AFD+GNP GE+KAP+AL+YRN+A + VEG SALP H
Sbjct  506  TAIGCVMAPLSFFIYYKAFDIGNPQGEFKAPYALIYRNMAILGVEGISALPHH  558



>gb|KHN19530.1| Metal-nicotianamine transporter YSL3 [Glycine soja]
Length=687

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLT TS R+M LSQAIG
Sbjct  463  VALFVLAALAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTFTSPRSMLLSQAIG  522

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+G+YKAP+A++YRN+A + VEGFSALP H
Sbjct  523  TAIGCVVAPLTFFLFYKAFDVGNPDGDYKAPYAIIYRNMAILGVEGFSALPHH  575



>gb|KDO76708.1| hypothetical protein CISIN_1g037863mg [Citrus sinensis]
Length=672

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G+ENG+VAG+ GCGLVKSV++V+  LM DFKT H T TS RAMFL+Q IG
Sbjct  451  VALFVLAALSGRENGLVAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIG  510

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAP+SF LFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  511  TAIGCVVAPISFLLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQH  563



>ref|XP_010676897.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Beta vulgaris 
subsp. vulgaris]
Length=665

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++A   GK+ GVVAGL G GL+KS+  VS  LM D KTGH+TLTS RAM +SQ IG
Sbjct  442  VALFILAGLTGKKYGVVAGLVGAGLIKSMALVSCTLMQDLKTGHMTLTSPRAMLVSQGIG  501

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T+IGC+V PLSFFLFY AFDVGNPNGEYKAP+AL+YRN+A + VEGFSALP+H
Sbjct  502  TVIGCIVTPLSFFLFYKAFDVGNPNGEYKAPYALIYRNMAILGVEGFSALPRH  554



>gb|EAY95020.1| hypothetical protein OsI_16829 [Oryza sativa Indica Group]
Length=716

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS R+M ++QAIG
Sbjct  494  IALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMIIAQAIG  553

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV++PL+FFLFYNAFD+GNP G +KAP+ALVYRN+A + VEGFSALPQH
Sbjct  554  TVMGCVISPLTFFLFYNAFDIGNPEGYWKAPYALVYRNMAILGVEGFSALPQH  606



>gb|KDP25199.1| hypothetical protein JCGZ_20355 [Jatropha curcas]
Length=662

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVA LAGCG++KSV++V+  LM DFKT HLT TS +AMFLSQ IG
Sbjct  441  VALFVLAALSGKENGVVAALAGCGIIKSVVSVACILMQDFKTAHLTCTSPKAMFLSQVIG  500

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+APLSFFLFY AFDVGNP GE+KAP+AL+YRN+A + V+G SALPQH
Sbjct  501  TAVGCVMAPLSFFLFYKAFDVGNPKGEFKAPYALIYRNMAILGVQGVSALPQH  553



>ref|XP_006476298.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Citrus 
sinensis]
Length=675

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G+ENG+VAG+ GCGLVKSV++V+  LM DFKT H T TS RAMFL+Q IG
Sbjct  454  VALFVLAALSGRENGLVAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIG  513

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAP+SF LFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  514  TAIGCVVAPISFLLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQH  566



>ref|XP_008376798.1| PREDICTED: metal-nicotianamine transporter YSL3 [Malus domestica]
Length=671

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL  CGL+KS++++S +LM D KTGHLTLTS R+M LSQAIG
Sbjct  449  VALFVLAAVAGKNDGVVAGLVACGLIKSMVSISSDLMHDLKTGHLTLTSPRSMLLSQAIG  508

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF VG+PNGEYKAP+A++YRN+A + VEGFSALP+H
Sbjct  509  TAIGCVVAPLTFFLFYKAFKVGDPNGEYKAPYAIIYRNMAILGVEGFSALPKH  561



>emb|CDX76329.1| BnaA08g10710D [Brassica napus]
Length=675

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+E+GVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF+SQ IG
Sbjct  454  IGLFVLAAVTGREDGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFVSQMIG  513

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            TI+GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  514  TIVGCIVTPLSFFLFYRAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  566



>ref|XP_007039403.1| YELLOW STRIPE like 1 isoform 1 [Theobroma cacao]
 ref|XP_007039404.1| YELLOW STRIPE like 1 isoform 1 [Theobroma cacao]
 gb|EOY23904.1| YELLOW STRIPE like 1 isoform 1 [Theobroma cacao]
 gb|EOY23905.1| YELLOW STRIPE like 1 isoform 1 [Theobroma cacao]
Length=664

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENGVVAGLAGCGL+KSV++V+  LM DFKT H TLTS RAMFLSQAIG
Sbjct  443  VALFILAALTGKENGVVAGLAGCGLIKSVVSVACILMQDFKTAHYTLTSPRAMFLSQAIG  502

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+ APLSFF+FY AFDVGNP GE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  503  TAIGCITAPLSFFVFYKAFDVGNPYGEFKAPYALIYRNMAILGVQGFSALPHH  555



>ref|XP_010671364.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010671365.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010671366.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010671367.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=662

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK++GVVAGL GCGL+KS++++S +LM DFKTGHLT TS R+M LSQAIG
Sbjct  441  VALFVLAAIVGKDSGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTFTSPRSMLLSQAIG  500

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAP +FFLFY AFD+GNP GEYKAP+AL+YRN+A + V+GFSALPQH
Sbjct  501  TAIGCVVAPFTFFLFYKAFDIGNPEGEYKAPYALIYRNMAILGVQGFSALPQH  553



>ref|XP_009137708.1| PREDICTED: metal-nicotianamine transporter YSL1 isoform X1 [Brassica 
rapa]
Length=675

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+E+GVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF+SQ IG
Sbjct  454  IGLFVLAAVTGREDGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFVSQMIG  513

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            TI+GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  514  TIVGCIVTPLSFFLFYRAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  566



>ref|XP_009137713.1| PREDICTED: metal-nicotianamine transporter YSL1 isoform X2 [Brassica 
rapa]
Length=667

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+E+GVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF+SQ IG
Sbjct  446  IGLFVLAAVTGREDGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFVSQMIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            TI+GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  506  TIVGCIVTPLSFFLFYRAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  558



>emb|CDY24797.1| BnaA08g15130D [Brassica napus]
Length=652

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF SQ IG
Sbjct  431  IGLFVLAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFASQMIG  490

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  491  TVVGCIVTPLSFFLFYRAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  543



>emb|CAN77515.1| hypothetical protein VITISV_013366 [Vitis vinifera]
Length=661

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENGVVA LAGCG++KSV++V+  LM DFKT + T+ S RAMFLSQAIG
Sbjct  440  VALFMLAALSGKENGVVAALAGCGIIKSVVSVACILMQDFKTSYFTMASPRAMFLSQAIG  499

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+ APLSFFLFY AFDVGNPNGEYK P+AL+YRN+A + VEG +ALPQH
Sbjct  500  TAIGCITAPLSFFLFYRAFDVGNPNGEYKVPYALIYRNMAILGVEGVAALPQH  552



>ref|XP_010658081.1| PREDICTED: YS1-like protein-like isoform X1 [Vitis vinifera]
Length=661

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENGVVA LAGCG++KSV++V+  LM DFKT + T+ S RAMFLSQAIG
Sbjct  440  VALFMLAALSGKENGVVAALAGCGIIKSVVSVACILMQDFKTSYFTMASPRAMFLSQAIG  499

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+ APLSFFLFY AFDVGNPNGEYK P+AL+YRN+A + VEG +ALPQH
Sbjct  500  TAIGCITAPLSFFLFYRAFDVGNPNGEYKVPYALIYRNMAILGVEGVAALPQH  552



>ref|XP_003588469.1| Metal-nicotianamine transporter YSL2 [Medicago truncatula]
 gb|AES58720.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=673

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA GGK NGVV+GL  CGL+KS+ + S +LM DF+TG+LTLTS R+M  +QAIG
Sbjct  451  VALFILAALGGKSNGVVSGLVACGLIKSLASTSSDLMHDFRTGYLTLTSPRSMLATQAIG  510

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FF+FYN +DVGNPNGEYKAP+A++YRN+A   VEGFSALP H
Sbjct  511  TAIGCVVAPLTFFIFYNTYDVGNPNGEYKAPYAIIYRNMAIFGVEGFSALPSH  563



>ref|XP_009109308.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Brassica 
rapa]
 ref|XP_009109309.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Brassica 
rapa]
 ref|XP_009109310.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Brassica 
rapa]
 ref|XP_009109311.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Brassica 
rapa]
Length=674

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF SQ IG
Sbjct  453  IGLFVLAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFASQMIG  512

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  513  TVVGCIVTPLSFFLFYRAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  565



>ref|XP_003551122.2| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Glycine max]
Length=669

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA GGK +GVVAGL GCG++KS+++ S +LM DFKTGHLT  S R+M LSQAIG
Sbjct  447  VALFVLAALGGKSHGVVAGLVGCGVIKSLVSTSSDLMQDFKTGHLTFASPRSMLLSQAIG  506

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCV+APL+FFLFY AFDVGNP+G+YKAP+A++YRN+A + VEGFSALP H
Sbjct  507  TAIGCVLAPLTFFLFYKAFDVGNPDGDYKAPYAIIYRNMAILGVEGFSALPHH  559



>ref|XP_006601048.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Glycine max]
 ref|XP_006601049.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Glycine max]
Length=673

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA GGK +GVVAGL GCG++KS+++ S +LM DFKTGHLT  S R+M LSQAIG
Sbjct  451  VALFVLAALGGKSHGVVAGLVGCGVIKSLVSTSSDLMQDFKTGHLTFASPRSMLLSQAIG  510

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCV+APL+FFLFY AFDVGNP+G+YKAP+A++YRN+A + VEGFSALP H
Sbjct  511  TAIGCVLAPLTFFLFYKAFDVGNPDGDYKAPYAIIYRNMAILGVEGFSALPHH  563



>gb|KFK28976.1| hypothetical protein AALP_AA7G072600 [Arabis alpina]
Length=671

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF+SQAIG
Sbjct  450  IGLFVIAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHHTMTSPKAMFVSQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+V PLSFFLFY AFD+GNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  510  TAVGCIVTPLSFFLFYKAFDIGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  562



>ref|XP_007140989.1| hypothetical protein PHAVU_008G157800g [Phaseolus vulgaris]
 gb|ESW12983.1| hypothetical protein PHAVU_008G157800g [Phaseolus vulgaris]
Length=669

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA GGK +GVVAGL GCG++KS+++ S +LM DFKTGHLT TS R+M L+QAIG
Sbjct  447  VALFVLAALGGKSHGVVAGLVGCGVIKSLVSTSSDLMQDFKTGHLTFTSPRSMLLTQAIG  506

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + VEGFSALP +
Sbjct  507  TAIGCLVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVEGFSALPHY  559



>emb|CDY35455.1| BnaC03g62050D [Brassica napus]
Length=674

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF SQ IG
Sbjct  453  IGLFVLAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFASQMIG  512

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  513  TVVGCIVTPLSFFLFYRAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  565



>ref|XP_006439232.1| hypothetical protein CICLE_v10019189mg [Citrus clementina]
 gb|ESR52472.1| hypothetical protein CICLE_v10019189mg [Citrus clementina]
Length=667

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G+ENG+VAG+ GCGLVKSV++V+  LM DFKT H T TS RAMFL+Q IG
Sbjct  446  VALFVLAALSGRENGLVAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCVVAP+SF LFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  506  TAVGCVVAPISFLLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQH  558



>ref|XP_009398090.1| PREDICTED: probable metal-nicotianamine transporter YSL9 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009398091.1| PREDICTED: probable metal-nicotianamine transporter YSL9 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=664

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK +GVVAGL GCGL+KSV+++S +LM DFKTGHLT+TS R+M LSQAIG
Sbjct  443  VSLFILAALAGKHSGVVAGLVGCGLIKSVVSISADLMHDFKTGHLTMTSPRSMLLSQAIG  502

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFD+GNP+G +KAP+AL+YRN+A + VEGFSALP H
Sbjct  503  TAIGCVVAPLTFFLFYKAFDIGNPDGNWKAPYALIYRNMAILGVEGFSALPHH  555



>emb|CAB51655.1| putative protein [Arabidopsis thaliana]
 emb|CAB81330.1| putative protein [Arabidopsis thaliana]
Length=620

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF SQ IG
Sbjct  399  IGLFVIAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFASQMIG  458

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFD+GNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  459  TVVGCIVTPLSFFLFYKAFDIGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  511



>emb|CBI34579.3| unnamed protein product [Vitis vinifera]
Length=679

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENGVVA LAGCG++KSV++V+  LM DFKT + T+ S RAMFLSQAIG
Sbjct  440  VALFMLAALSGKENGVVAALAGCGIIKSVVSVACILMQDFKTSYFTMASPRAMFLSQAIG  499

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+ APLSFFLFY AFDVGNPNGEYK P+AL+YRN+A + VEG +ALPQH
Sbjct  500  TAIGCITAPLSFFLFYRAFDVGNPNGEYKVPYALIYRNMAILGVEGVAALPQH  552



>ref|XP_007140990.1| hypothetical protein PHAVU_008G157800g [Phaseolus vulgaris]
 gb|ESW12984.1| hypothetical protein PHAVU_008G157800g [Phaseolus vulgaris]
Length=673

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA GGK +GVVAGL GCG++KS+++ S +LM DFKTGHLT TS R+M L+QAIG
Sbjct  451  VALFVLAALGGKSHGVVAGLVGCGVIKSLVSTSSDLMQDFKTGHLTFTSPRSMLLTQAIG  510

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + VEGFSALP +
Sbjct  511  TAIGCLVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVEGFSALPHY  563



>ref|XP_009359553.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009359554.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009359555.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Pyrus x bretschneideri]
Length=664

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+GVVAGLAGCG++KSV+NV+  LM D KT HLT TS RAMF+SQ +G
Sbjct  444  VALFVLAAMAGKEHGVVAGLAGCGVIKSVVNVACILMQDLKTAHLTFTSPRAMFVSQTLG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV APLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  504  TVLGCVTAPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAILGVQGFSALPQH  556



>ref|XP_002869737.1| hypothetical protein ARALYDRAFT_492451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45996.1| hypothetical protein ARALYDRAFT_492451 [Arabidopsis lyrata subsp. 
lyrata]
Length=673

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF SQ IG
Sbjct  452  IGLFVIAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFASQMIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  512  TVVGCIVTPLSFFLFYKAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  564



>ref|XP_010919337.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL9 [Elaeis guineensis]
Length=665

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGVVAGL  CGL+KSV+++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  444  VALFMLAAWAGKDNGVVAGLVACGLIKSVVSISADLMHDFKTGHLTLTSPRSMLLSQAIG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCVVAPL+FFLFY AFDVGNP G +KAP+AL+YRN+A + V+GFSALP H
Sbjct  504  TAMGCVVAPLTFFLFYKAFDVGNPEGIWKAPYALIYRNMAILGVQGFSALPHH  556



>ref|XP_006283265.1| hypothetical protein CARUB_v10004301mg [Capsella rubella]
 gb|EOA16163.1| hypothetical protein CARUB_v10004301mg [Capsella rubella]
Length=672

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF SQ IG
Sbjct  451  IGLFVIAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFASQMIG  510

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFDVGNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  511  TVVGCIVTPLSFFLFYKAFDVGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  563



>ref|XP_004309544.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Fragaria 
vesca subsp. vesca]
Length=646

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+GVVAGLAGCG+VKSV++V+ NLM D KT HLT TS RAMF+SQAIG
Sbjct  425  VALFVLAAMTGKEHGVVAGLAGCGVVKSVVSVACNLMQDLKTAHLTFTSPRAMFVSQAIG  484

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T+IGC+ APLSF LFY AFDVGNP+GE+KAP+AL+YRN+A + VEGFSALP+H
Sbjct  485  TLIGCITAPLSFLLFYKAFDVGNPHGEFKAPYALIYRNMAILGVEGFSALPRH  537



>ref|XP_006581667.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Glycine max]
 ref|XP_006581668.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Glycine max]
 ref|XP_003527996.2| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Glycine max]
 gb|KHN23328.1| Metal-nicotianamine transporter YSL3 [Glycine soja]
Length=676

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV++A  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLT TS R+M LSQAIG
Sbjct  452  VALFVLSALAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTFTSPRSMLLSQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNP+G+YKAP+A++YRN+A + VEGFSALP H
Sbjct  512  TAIGCVVAPLTFFLFYKAFDVGNPDGDYKAPYAIIYRNMAILGVEGFSALPHH  564



>emb|CBI34580.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENGVVA LAGCG++KSV +VS NLM DFKT + T+ S RAMFLSQAIG
Sbjct  344  VALFMLAALSGKENGVVAALAGCGIIKSVASVSCNLMQDFKTSYFTMASPRAMFLSQAIG  403

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+ APLSFFLFY AFDVGNP GEYKAP+AL+YRN+A + VEG +ALPQH
Sbjct  404  TAIGCITAPLSFFLFYRAFDVGNPKGEYKAPYALIYRNMAILGVEGVAALPQH  456



>ref|XP_010100194.1| Metal-nicotianamine transporter YSL1 [Morus notabilis]
 gb|EXB81865.1| Metal-nicotianamine transporter YSL1 [Morus notabilis]
Length=666

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK+NGV+AGLAGCG++KSV++V+  LM DFKT HLT TS RAMF+SQAIG
Sbjct  445  VALFILAALSGKQNGVMAGLAGCGVIKSVVSVACTLMQDFKTAHLTFTSPRAMFVSQAIG  504

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+ APLSFFLFY AFDVGNP GE+KAP+AL+YRN+A + V+GFSALP+H
Sbjct  505  TALGCITAPLSFFLFYKAFDVGNPYGEFKAPYALIYRNMAILGVQGFSALPRH  557



>ref|XP_007220212.1| hypothetical protein PRUPE_ppa002475mg [Prunus persica]
 gb|EMJ21411.1| hypothetical protein PRUPE_ppa002475mg [Prunus persica]
Length=669

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM D KTGHLTLTS R+M LSQAIG
Sbjct  447  VALFVLAAVAGKNDGVVAGLVGCGLIKSIVSISSDLMHDLKTGHLTLTSPRSMLLSQAIG  506

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF+VG+P+GEYKAP+A++YRN+A + V+GFSALPQH
Sbjct  507  TAIGCVVAPLTFFLFYKAFNVGDPDGEYKAPYAIIYRNMAILGVQGFSALPQH  559



>gb|AAB63613.1| unknown protein [Arabidopsis thaliana]
Length=667

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF SQ IG
Sbjct  446  IGLFVIAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFASQMIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFD+GNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  506  TVVGCIVTPLSFFLFYKAFDIGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  558



>gb|AFU82908.1| yellow stripe-like transporter 3.1 [Arachis hypogaea]
Length=674

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+A+  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLT TS R+M LSQAIG
Sbjct  452  VALFVLASLAGKTDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTFTSPRSMLLSQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFYNAFDVG P+G+YKAP+AL+YRN+A + VEGFSALP H
Sbjct  512  TGIGCVVAPLTFFLFYNAFDVGKPDGDYKAPYALIYRNMAILGVEGFSALPHH  564



>ref|XP_008234683.1| PREDICTED: metal-nicotianamine transporter YSL3 [Prunus mume]
Length=669

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM D KTGHLTLTS R+M LSQAIG
Sbjct  447  VALFVLAAVAGKNDGVVAGLVGCGLIKSIVSISSDLMHDLKTGHLTLTSPRSMLLSQAIG  506

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF+VG+P+GEYKAP+A++YRN+A + V+GFSALPQH
Sbjct  507  TAIGCVVAPLTFFLFYKAFNVGDPDGEYKAPYAIIYRNMAILGVQGFSALPQH  559



>ref|XP_004309105.1| PREDICTED: LOW QUALITY PROTEIN: metal-nicotianamine transporter 
YSL3-like [Fragaria vesca subsp. vesca]
Length=865

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM D KTGHLT TS R+M +SQAIG
Sbjct  469  VALFVLAAVAGKHDGVVAGLVGCGLIKSIVSISSDLMHDLKTGHLTFTSPRSMIVSQAIG  528

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AFDVGNPNGEYK P+A++YRN+A + V+GFSALPQH
Sbjct  529  TAIGCVVAPLTFFLFYKAFDVGNPNGEYKVPYAIIYRNMAILGVQGFSALPQH  581



>ref|NP_001053449.2| Os04g0542200 [Oryza sativa Japonica Group]
 gb|AAS49493.1| iron transport protein 1 [Oryza sativa]
 dbj|BAE91889.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH00231.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF15363.2| Os04g0542200 [Oryza sativa Japonica Group]
Length=657

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS R+M ++QAIG
Sbjct  435  IALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMIIAQAIG  494

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV++PL+FFLFY+AFD+GNP G +KAP+ALVYRN+A + VEGFSALPQH
Sbjct  495  TVMGCVISPLTFFLFYSAFDIGNPEGYWKAPYALVYRNMAILGVEGFSALPQH  547



>ref|NP_567694.2| metal-nicotianamine transporter YSL1 [Arabidopsis thaliana]
 sp|Q6R3L0.2|YSL1_ARATH RecName: Full=Metal-nicotianamine transporter YSL1; AltName: 
Full=Protein YELLOW STRIPE LIKE 1; Short=AtYSL1 [Arabidopsis 
thaliana]
 gb|AEE84852.1| metal-nicotianamine transporter YSL1 [Arabidopsis thaliana]
Length=673

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF SQ IG
Sbjct  452  IGLFVIAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFASQMIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFD+GNPNGE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  512  TVVGCIVTPLSFFLFYKAFDIGNPNGEFKAPYALIYRNMAILGVQGFSALPLH  564



>gb|KGN65329.1| hypothetical protein Csa_1G329900 [Cucumis sativus]
Length=617

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  393  VALFVLAAMAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  452

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+VAP++F++FY AFD+ NPNGEYK P+A++YRN+A + VEGFSALPQH
Sbjct  453  TALGCIVAPITFYMFYKAFDLANPNGEYKVPYAIIYRNMAILGVEGFSALPQH  505



>ref|XP_009359552.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Pyrus x bretschneideri]
Length=712

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+GVVAGLAGCG++KSV+NV+  LM D KT HLT TS RAMF+SQ +G
Sbjct  492  VALFVLAAMAGKEHGVVAGLAGCGVIKSVVNVACILMQDLKTAHLTFTSPRAMFVSQTLG  551

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV APLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  552  TVLGCVTAPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAILGVQGFSALPQH  604



>ref|XP_004172903.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
sativus]
Length=670

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  446  VALFVLAAMAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+VAP++F++FY AFD+ NPNGEYK P+A++YRN+A + VEGFSALPQH
Sbjct  506  TALGCIVAPITFYMFYKAFDLANPNGEYKVPYAIIYRNMAILGVEGFSALPQH  558



>ref|XP_010659999.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Vitis vinifera]
 ref|XP_010660004.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Vitis vinifera]
 ref|XP_010660011.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Vitis vinifera]
Length=649

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENGVVA LAGCG++KSV +VS NLM DFKT + T+ S RAMFLSQAIG
Sbjct  444  VALFMLAALSGKENGVVAALAGCGIIKSVASVSCNLMQDFKTSYFTMASPRAMFLSQAIG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+ APLSFFLFY AFDVGNP GEYKAP+AL+YRN+A + VEG +ALPQH
Sbjct  504  TAIGCITAPLSFFLFYRAFDVGNPKGEYKAPYALIYRNMAILGVEGVAALPQH  556



>ref|XP_004150025.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
sativus]
Length=670

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  446  VALFVLAAMAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+VAP++F++FY AFD+ NPNGEYK P+A++YRN+A + VEGFSALPQH
Sbjct  506  TALGCIVAPITFYMFYKAFDLANPNGEYKVPYAIIYRNMAILGVEGFSALPQH  558



>sp|Q7XUJ2.2|YSL9_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL9; 
AltName: Full=Protein YELLOW STRIPE LIKE 9; Short=OsYSL9 [Oryza 
sativa Japonica Group]
 emb|CAD41272.2| OSJNBb0103I08.11 [Oryza sativa Japonica Group]
Length=684

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS R+M ++QAIG
Sbjct  462  IALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMIIAQAIG  521

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV++PL+FFLFY+AFD+GNP G +KAP+ALVYRN+A + VEGFSALPQH
Sbjct  522  TVMGCVISPLTFFLFYSAFDIGNPEGYWKAPYALVYRNMAILGVEGFSALPQH  574



>ref|XP_006653627.1| PREDICTED: probable metal-nicotianamine transporter YSL9-like 
[Oryza brachyantha]
Length=621

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS ++M ++QAIG
Sbjct  399  IALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPKSMIIAQAIG  458

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV++PL+FFLFYNAFD+GNP G +KAP+ALVYRN+A + VEGFSALPQH
Sbjct  459  TAMGCVISPLTFFLFYNAFDIGNPEGYWKAPYALVYRNMAILGVEGFSALPQH  511



>gb|EMS50094.1| putative metal-nicotianamine transporter YSL16 [Triticum urartu]
Length=562

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV AA  GK+NGVVAGL  CGLVK ++ VS +LM DFKT HLTLTS R+M + QA G
Sbjct  340  VALFVFAAWAGKDNGVVAGLVTCGLVKQLVLVSADLMHDFKTAHLTLTSPRSMLVGQAAG  399

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCVVAPL+FFLFY AFDVGNP+G +KAP+AL+YRN+A + VEGFSALPQH
Sbjct  400  TLMGCVVAPLTFFLFYEAFDVGNPDGYWKAPYALIYRNMAILGVEGFSALPQH  452



>ref|NP_001268107.1| YS1-like protein-like [Vitis vinifera]
 gb|AAT09976.1| putative YS1-like protein [Vitis vinifera]
Length=661

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GKENGVVA LAGCG++KSV++V+  LM DFKT + T+ S RAMFLSQAIG
Sbjct  440  VALFMLAALSGKENGVVAALAGCGIIKSVVSVACILMQDFKTSYFTMASPRAMFLSQAIG  499

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+ APLSFFLFY AFDVGNPNGEYK P+AL+YRN+A   VEG +ALPQH
Sbjct  500  TAIGCITAPLSFFLFYRAFDVGNPNGEYKVPYALIYRNMAIPGVEGVAALPQH  552



>gb|EAZ31500.1| hypothetical protein OsJ_15637 [Oryza sativa Japonica Group]
Length=716

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS R+M ++QAIG
Sbjct  494  IALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMIIAQAIG  553

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV++PL+FFLFY+AFD+GNP G +KAP+ALVYRN+A + VEGFSALPQH
Sbjct  554  TVMGCVISPLTFFLFYSAFDIGNPEGYWKAPYALVYRNMAILGVEGFSALPQH  606



>ref|XP_010034897.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Eucalyptus 
grandis]
 gb|KCW46094.1| hypothetical protein EUGRSUZ_K00010 [Eucalyptus grandis]
Length=668

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+G+VAGL GCGL+KS++++S +LM DFKTGHLT TS RAM LSQA+G
Sbjct  446  VALFVLAAITGKESGLVAGLVGCGLIKSMVSISSDLMHDFKTGHLTFTSPRAMLLSQALG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVV+PL+FFLFY AF++G+PNGEY AP+AL+YRN+A + VEGFSALP+H
Sbjct  506  TAIGCVVSPLTFFLFYKAFNIGDPNGEYPAPYALIYRNMAILGVEGFSALPKH  558



>gb|AAK62460.1|AF387015_1 putative protein [Arabidopsis thaliana]
Length=665

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF SQ IG
Sbjct  444  IGLFVIAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFASQMIG  503

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFD+GNPNGE+KAP+AL+YRN+A + V GFSALP H
Sbjct  504  TVVGCIVTPLSFFLFYKAFDIGNPNGEFKAPYALIYRNMAILGVRGFSALPLH  556



>emb|CDY70890.1| BnaCnng70180D, partial [Brassica napus]
Length=388

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  337  GLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGT  158
             LFVMAA  G+++GVVAG+  CGL+KS+++VS +LM DFKTGHLTLTS R+M ++QAIGT
Sbjct  167  ALFVMAALAGEKDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTLTSPRSMLVAQAIGT  226

Query  157  IIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
             IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + V+G SALP +
Sbjct  227  AIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAIIGVQGLSALPHN  278



>ref|XP_006838312.1| hypothetical protein AMTR_s00103p00133560 [Amborella trichopoda]
 gb|ERN00881.1| hypothetical protein AMTR_s00103p00133560 [Amborella trichopoda]
Length=312

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcg-lvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAI  164
            V LF++AA  GK +G V        LVKS++ +S  LM DFK+ HLT+TS RAM LSQA+
Sbjct  90   VALFILAAWAGKSHGGVVAGLVGCGLVKSIVTISAELMQDFKSAHLTMTSPRAMILSQAV  149

Query  163  GTIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            GT IGCVVAP++F LFY+AFD+GNP GE+KAPFAL+YRN+A +SVEG SALPQH
Sbjct  150  GTAIGCVVAPMTFLLFYHAFDIGNPKGEFKAPFALIYRNMAILSVEGLSALPQH  203



>ref|XP_009351940.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Pyrus x 
bretschneideri]
Length=671

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM D KT HLTLTS R+M LSQAIG
Sbjct  449  VALFVLAAVAGKNDGVVAGLVGCGLIKSIVSISSDLMHDLKTAHLTLTSPRSMILSQAIG  508

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF++G+P+GEYKAP+A++YRN+A + VEGFSALPQH
Sbjct  509  TAIGCVVAPLTFFLFYKAFNIGDPDGEYKAPYAIIYRNMAILGVEGFSALPQH  561



>ref|XP_010541874.1| PREDICTED: metal-nicotianamine transporter YSL1 [Tarenaya hassleriana]
Length=654

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGLAGCGL+KSV++VS  LM DFKT H T TS RAMFLSQ +G
Sbjct  433  VALFVLAAVTGKENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHFTYTSPRAMFLSQLVG  492

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFD+GNP GE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  493  TVVGCLVTPLSFFLFYKAFDIGNPKGEFKAPYALIYRNMAILGVQGFSALPLH  545



>ref|XP_004498492.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004498493.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Cicer arietinum]
Length=670

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA GGK +GVVAGL  CGL+KS+ + S +LM DFKTGHLT TS R+M + QA+G
Sbjct  448  VALFILAALGGKSDGVVAGLVACGLIKSLASTSSDLMQDFKTGHLTFTSPRSMLVMQAVG  507

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC VAPLSFF+FY+++DVGNPNGEYKAP+A++YRN+A + VEGFSALP H
Sbjct  508  TAIGCAVAPLSFFIFYHSYDVGNPNGEYKAPYAIIYRNMAILGVEGFSALPNH  560



>ref|XP_004498494.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Cicer arietinum]
Length=674

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA GGK +GVVAGL  CGL+KS+ + S +LM DFKTGHLT TS R+M + QA+G
Sbjct  452  VALFILAALGGKSDGVVAGLVACGLIKSLASTSSDLMQDFKTGHLTFTSPRSMLVMQAVG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC VAPLSFF+FY+++DVGNPNGEYKAP+A++YRN+A + VEGFSALP H
Sbjct  512  TAIGCAVAPLSFFIFYHSYDVGNPNGEYKAPYAIIYRNMAILGVEGFSALPNH  564



>ref|XP_002872112.1| hypothetical protein ARALYDRAFT_489303 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48371.1| hypothetical protein ARALYDRAFT_489303 [Arabidopsis lyrata subsp. 
lyrata]
Length=664

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT 
Sbjct  444  LFVMAALAGKNDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGTA  503

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGN NGEYKAP+A++YRN+A + V+G SALPQH
Sbjct  504  IGCVVAPLTFFLFYKAFDVGNQNGEYKAPYAMIYRNMAIIGVQGLSALPQH  554



>ref|XP_008444004.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
melo]
 ref|XP_008444005.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
melo]
Length=704

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M LSQAIG
Sbjct  446  VALFLLAAMAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLSQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+VAP++F++FY AFD+ NPNGEYK P+A++YRN+A + VEGFSALPQH
Sbjct  506  TALGCIVAPITFYMFYKAFDLANPNGEYKVPYAIIYRNMAILGVEGFSALPQH  558



>ref|NP_001141294.1| uncharacterized protein LOC100273385 [Zea mays]
 gb|ACF86002.1| unknown [Zea mays]
Length=303

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK++GVVAGL GCGLVK ++ VS +LM DFKTGHLTLTS R+M + QA+G
Sbjct  81   VALFVLAAWAGKDSGVVAGLVGCGLVKQLVLVSADLMHDFKTGHLTLTSPRSMLVGQAVG  140

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV+APL+F LFY AFDVG P+G +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  141  TLMGCVLAPLTFMLFYRAFDVGEPDGYWKAPYALIYRNMAILGVEGFSALPRH  193



>gb|KFK27715.1| hypothetical protein AALP_AA8G420300 [Arabis alpina]
Length=661

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  G+ +GVVAG+  CGL+KS+++VS +LM DFKTGHLTLTS R+M ++QAIGT 
Sbjct  441  LFVMAALAGESDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTLTSPRSMLVAQAIGTA  500

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + V+G SALP H
Sbjct  501  IGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAIIGVQGLSALPLH  551



>ref|XP_011026790.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011026791.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Populus euphratica]
Length=669

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G+ENGVVA LAGCGLVKSVL+V+  LM DFKT  LT TS RAMFLSQ +G
Sbjct  448  VALFVLAAVSGRENGVVAALAGCGLVKSVLSVACILMQDFKTAQLTSTSPRAMFLSQVVG  507

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T+IGC+ AP SFFLFY AFDVGNP GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  508  TVIGCIAAPSSFFLFYKAFDVGNPYGEFKAPYALIYRNMAILGVDGFSALPQH  560



>ref|XP_006287225.1| hypothetical protein CARUB_v10000403mg [Capsella rubella]
 gb|EOA20123.1| hypothetical protein CARUB_v10000403mg [Capsella rubella]
Length=664

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT 
Sbjct  444  LFVMAALAGKNDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLIAQAIGTA  503

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + V+G SALP+H
Sbjct  504  IGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVQGLSALPEH  554



>ref|XP_011026792.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Populus euphratica]
Length=668

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G+ENGVVA LAGCGLVKSVL+V+  LM DFKT  LT TS RAMFLSQ +G
Sbjct  447  VALFVLAAVSGRENGVVAALAGCGLVKSVLSVACILMQDFKTAQLTSTSPRAMFLSQVVG  506

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T+IGC+ AP SFFLFY AFDVGNP GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  507  TVIGCIAAPSSFFLFYKAFDVGNPYGEFKAPYALIYRNMAILGVDGFSALPQH  559



>ref|XP_007211288.1| hypothetical protein PRUPE_ppa002524mg [Prunus persica]
 gb|EMJ12487.1| hypothetical protein PRUPE_ppa002524mg [Prunus persica]
Length=662

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+GVVAGLAGCGL+KSV++V+  LM D KT HLT TS RAMF+SQ +G
Sbjct  442  VALFVLAALTGKEHGVVAGLAGCGLIKSVVSVACILMQDLKTAHLTFTSPRAMFVSQTLG  501

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV APLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  502  TALGCVTAPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAILGVQGFSALPQH  554



>ref|XP_008239220.1| PREDICTED: metal-nicotianamine transporter YSL1 [Prunus mume]
 ref|XP_008239221.1| PREDICTED: metal-nicotianamine transporter YSL1 [Prunus mume]
Length=662

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+GVVAGLAGCGL+KSV++V+  LM D KT HLT TS RAMF+SQ +G
Sbjct  442  VALFVLAALTGKEHGVVAGLAGCGLIKSVVSVACILMQDLKTAHLTFTSPRAMFVSQTLG  501

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV APLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  502  TALGCVTAPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAILGVQGFSALPQH  554



>ref|XP_008381368.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Malus domestica]
Length=671

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM D KT HLTLTS R+M LSQAIG
Sbjct  449  VALFVLAAVAGKNDGVVAGLVGCGLIKSIVSISSDLMHDLKTAHLTLTSPRSMILSQAIG  508

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF++G+P GEYKAP+A++YRN+A + VEGFSALPQH
Sbjct  509  TAIGCVVAPLTFFLFYKAFNIGDPEGEYKAPYAIIYRNMAILGVEGFSALPQH  561



>ref|XP_010240192.1| PREDICTED: probable metal-nicotianamine transporter YSL9 [Brachypodium 
distachyon]
Length=187

 Score =   125 bits (314),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  226  DFKTGHLTLTSSRAMFLSQAIGTIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRN  47
            DFKTGHLTLTS R+M ++QAIGT +GCV+ PL+FFLFYNAFD+GNP G +KAP+AL+YRN
Sbjct  3    DFKTGHLTLTSPRSMLIAQAIGTAMGCVIGPLTFFLFYNAFDIGNPEGPWKAPYALIYRN  62

Query  46   LASVSVEGFSALPQH  2
            +A + VEGFSALP H
Sbjct  63   MAILGVEGFSALPLH  77



>emb|CDO99601.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            VGLF++AA  GKE+GVVAGLAG GL+KSV++VS  LM DFKTGHLT TS RAMFLSQAIG
Sbjct  457  VGLFLIAALVGKEHGVVAGLAGAGLMKSVISVSCVLMQDFKTGHLTSTSPRAMFLSQAIG  516

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T  GCVVAPL FFLFY AFDVGNPN E+KAP+ ++YRN+A + VEGFSALP++
Sbjct  517  TATGCVVAPLIFFLFYKAFDVGNPNSEFKAPYGIIYRNMAILGVEGFSALPRY  569



>emb|CDX92615.1| BnaC07g38730D [Brassica napus]
Length=671

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLF++AA  G+E+GVVAGLAGCGL+KSV++VS  LM DFKT H T+ S +AMF SQ IG
Sbjct  450  IGLFILAAVSGREDGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMASPKAMFASQMIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V+PLSFFLFY AFDVGNP GE+KAPFAL+YRN+A + VEGFSALP H
Sbjct  510  TVVGCIVSPLSFFLFYTAFDVGNPKGEFKAPFALIYRNMAILGVEGFSALPLH  562



>dbj|BAL02122.1| putative iron-phytosiderophore transporter [Hordeum vulgare subsp. 
vulgare]
Length=702

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV AA  GK+NGVVAGL  CGLVK ++ VS +LM DFKT HLTLTS R+M + QA+G
Sbjct  480  VALFVFAAWAGKDNGVVAGLVTCGLVKQLVLVSADLMHDFKTAHLTLTSPRSMVVGQAVG  539

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCVVAPL+FFLFY AFDVGNP+G +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  540  TLMGCVVAPLTFFLFYEAFDVGNPDGYWKAPYALIYRNMAILGVEGFSALPRH  592



>ref|XP_008456007.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X3 [Cucumis 
melo]
Length=563

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M L QAIG
Sbjct  340  VALFVLAAMAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLGQAIG  399

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAP++F++FY AFD+ NP+GEYK P+A++YRN+A + VEGFSALPQH
Sbjct  400  TAIGCIVAPVTFYMFYKAFDLANPDGEYKVPYAIIYRNMAILGVEGFSALPQH  452



>ref|XP_006394695.1| hypothetical protein EUTSA_v10003781mg [Eutrema salsugineum]
 gb|ESQ31981.1| hypothetical protein EUTSA_v10003781mg [Eutrema salsugineum]
Length=659

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  G+ +GVVAG+  CGL+KS+++VS +LM DFKTGHLTLTS R+M ++QAIGT 
Sbjct  439  LFVMAALAGESDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTLTSPRSMLVAQAIGTA  498

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
             GCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + V+G SALP+H
Sbjct  499  TGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAIIGVQGLSALPEH  549



>gb|AAM98073.1| AT5g24380/K16H17_9 [Arabidopsis thaliana]
 gb|AAO64741.1| AT5g24380/K16H17_9 [Arabidopsis thaliana]
Length=409

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -3

Query  337  GLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGT  158
             LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT
Sbjct  188  ALFVMAALAGKNDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGT  247

Query  157  IIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
             IGCVVAPL+FFLFY AFDVGN NGEYKAP+A++YRN+A + V+G SALP+H
Sbjct  248  AIGCVVAPLTFFLFYKAFDVGNQNGEYKAPYAMIYRNMAIIGVQGPSALPKH  299



>ref|XP_008456006.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X2 [Cucumis 
melo]
Length=659

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M L QAIG
Sbjct  446  VALFVLAAMAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLGQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAP++F++FY AFD+ NP+GEYK P+A++YRN+A + VEGFSALPQH
Sbjct  506  TAIGCIVAPVTFYMFYKAFDLANPDGEYKVPYAIIYRNMAILGVEGFSALPQH  558



>ref|XP_008456005.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Cucumis 
melo]
Length=669

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M L QAIG
Sbjct  446  VALFVLAAMAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLGQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAP++F++FY AFD+ NP+GEYK P+A++YRN+A + VEGFSALPQH
Sbjct  506  TAIGCIVAPVTFYMFYKAFDLANPDGEYKVPYAIIYRNMAILGVEGFSALPQH  558



>gb|AFU82907.1| yellow stripe-like transporter 1 [Arachis hypogaea]
Length=679

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF+MAA  GKENGVVAGL G G++KSV++VS  LM DFKT H TLTS RAMF+ Q IG
Sbjct  458  VALFMMAALSGKENGVVAGLVGSGVIKSVVSVSCILMQDFKTAHYTLTSPRAMFMCQVIG  517

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
              +GCV APLSFFL+Y AF+VG+PNGE+KAP+AL+YRN+A + VEGFSALP H
Sbjct  518  IAMGCVTAPLSFFLYYKAFNVGDPNGEFKAPYALIYRNMAVIGVEGFSALPHH  570



>ref|XP_010454748.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X2 [Camelina sativa]
Length=664

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT 
Sbjct  444  LFVMAALAGKHDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGTA  503

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + V+G SALP H
Sbjct  504  IGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVQGLSALPDH  554



>ref|XP_010493592.1| PREDICTED: metal-nicotianamine transporter YSL2 isoform X1 [Camelina 
sativa]
Length=667

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT 
Sbjct  447  LFVMAALAGKHDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGTA  506

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + V+G SALP H
Sbjct  507  IGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVQGLSALPDH  557



>ref|XP_010454747.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Camelina sativa]
Length=666

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT 
Sbjct  446  LFVMAALAGKHDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGTA  505

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + V+G SALP H
Sbjct  506  IGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVQGLSALPDH  556



>ref|XP_010035301.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Eucalyptus 
grandis]
 gb|KCW46603.1| hypothetical protein EUGRSUZ_K004131 [Eucalyptus grandis]
 gb|KCW46604.1| hypothetical protein EUGRSUZ_K004131 [Eucalyptus grandis]
Length=668

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKE+GVVAGL GCGL+KS++++S +LM DFKTGHLT TS RAM LSQA+G
Sbjct  446  VALFVLAAITGKESGVVAGLVGCGLIKSMVSISSDLMHDFKTGHLTFTSPRAMLLSQALG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAPL+F LFY AF++G+PNGEY AP+ALVYRN+A + VEGFSALP+H
Sbjct  506  TAIGCIVAPLTFSLFYKAFNIGDPNGEYPAPYALVYRNMAILGVEGFSALPKH  558



>dbj|BAH57276.1| AT5G24380 [Arabidopsis thaliana]
Length=419

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -3

Query  337  GLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGT  158
             LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT
Sbjct  198  ALFVMAALAGKNDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGT  257

Query  157  IIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
             IGCVVAPL+FFLFY AFDVGN NGEYKAP+A++YRN+A + V+G SALP+H
Sbjct  258  AIGCVVAPLTFFLFYKAFDVGNQNGEYKAPYAMIYRNMAIIGVQGPSALPKH  309



>ref|XP_006653628.1| PREDICTED: probable metal-nicotianamine transporter YSL16-like, 
partial [Oryza brachyantha]
Length=559

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA  GK++GVVAGL GCGLVK ++ +S +LM DFKTGHLTLTS R+M + Q +G
Sbjct  337  IALFIFAAWAGKDDGVVAGLVGCGLVKQLVLISADLMHDFKTGHLTLTSPRSMLVGQVVG  396

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCVVAPL+FFLFY AFD+G+PNG +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  397  TLMGCVVAPLTFFLFYRAFDIGDPNGYWKAPYALIYRNMAVLGVEGFSALPRH  449



>ref|XP_010454749.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X3 [Camelina sativa]
Length=629

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT 
Sbjct  409  LFVMAALAGKHDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGTA  468

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + V+G SALP H
Sbjct  469  IGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVQGLSALPDH  519



>ref|XP_010493593.1| PREDICTED: metal-nicotianamine transporter YSL2 isoform X2 [Camelina 
sativa]
Length=665

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT 
Sbjct  445  LFVMAALAGKHDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGTA  504

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + V+G SALP H
Sbjct  505  IGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAILGVQGLSALPDH  555



>ref|XP_003588462.1| Metal-nicotianamine transporter YSL2 [Medicago truncatula]
Length=1748

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++A+ GG  NGVV+ L  CGL+KS+ + S +L  DF+TG+LTLTS R+M ++QAIG
Sbjct  526  VALFILASLGGNSNGVVSELVACGLIKSLASTSSDLTHDFRTGYLTLTSPRSMLVTQAIG  585

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCV+APL+FF+FYN +DVGNPNGEYKAP+A++YRN+A   VEGFSALP H
Sbjct  586  TAIGCVIAPLTFFIFYNTYDVGNPNGEYKAPYAIIYRNMAIFGVEGFSALPSH  638


 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340   VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
             V LF++AA GGK NGVVAGL  CGL+KS+ + S +LM DFKT +LTLTS R+M +SQ IG
Sbjct  1526  VALFILAALGGKSNGVVAGLVACGLIKSLASTSADLMQDFKTSYLTLTSPRSMLVSQTIG  1585

Query  160   TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
             T IGCVVAPL+  +FY+ +DVGNP+GEYK+P+A++YRN+A + VEGFSALP H
Sbjct  1586  TAIGCVVAPLTASIFYHTYDVGNPDGEYKSPYAIIYRNMAILGVEGFSALPSH  1638



>gb|KGN57644.1| hypothetical protein Csa_3G238100 [Cucumis sativus]
Length=668

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S  L+ DFKTGHLTLTS R+M L QAIG
Sbjct  445  VALFVLAAMAGKNDGVVAGLVGCGLIKSIVSISSELIHDFKTGHLTLTSPRSMLLGQAIG  504

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAP++FF+FY AFD+ +P+GEYK P+A++YRN+A + VEGFSALPQH
Sbjct  505  TAIGCIVAPVTFFMFYKAFDLADPDGEYKVPYAIIYRNMAILGVEGFSALPQH  557



>ref|NP_001053450.2| Os04g0542800 [Oryza sativa Japonica Group]
 sp|Q7XN54.2|YSL16_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL16; 
AltName: Full=Protein YELLOW STRIPE LIKE 16; Short=OsYSL16 
[Oryza sativa Japonica Group]
 emb|CAE04269.2| OSJNBb0103I08.15 [Oryza sativa Japonica Group]
 gb|AAS49494.1| iron transport protein 2 [Oryza sativa]
 dbj|BAE91894.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF15364.2| Os04g0542800 [Oryza sativa Japonica Group]
 dbj|BAM67027.1| transporter for Cu-nicotianamine complex [Oryza sativa Japonica 
Group]
Length=675

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA  GK++GVVAGL GCGLVK ++ +S +LM DFKTGHLTLTS R+M + Q +G
Sbjct  453  IALFIFAAWAGKDDGVVAGLVGCGLVKQLVLISADLMHDFKTGHLTLTSPRSMLVGQVVG  512

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCVVAPL+FFLFY AFDVG+PNG +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  513  TLMGCVVAPLTFFLFYKAFDVGDPNGYWKAPYALIYRNMAIIGVEGFSALPRH  565



>ref|XP_004146239.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
sativus]
Length=668

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M L QAIG
Sbjct  445  VALFVLAAMAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLGQAIG  504

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAP++FF+FY AFD+ +P+GEYK P+A++YRN+A + VEGFSALPQH
Sbjct  505  TAIGCIVAPVTFFMFYKAFDLADPDGEYKVPYAIIYRNMAILGVEGFSALPQH  557



>gb|KEH35475.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=664

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM D KTGHLTLTS R+M +SQAIG
Sbjct  445  VALFVLAALAGKSDGVVAGLVGCGLIKSIVSISSDLMHDLKTGHLTLTSPRSMLVSQAIG  504

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAP++FFLFY AFDVGNP+G YKAP+A++YRN+A + VEGFSALP H
Sbjct  505  TAIGCVVAPVTFFLFYKAFDVGNPDGIYKAPYAIIYRNMAILGVEGFSALPDH  557



>ref|XP_004165023.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
sativus]
Length=668

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM DFKTGHLTLTS R+M L QAIG
Sbjct  445  VALFVLAAMAGKNDGVVAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLLGQAIG  504

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAP++FF+FY AFD+ +P+GEYK P+A++YRN+A + VEGFSALPQH
Sbjct  505  TAIGCIVAPVTFFMFYKAFDLADPDGEYKVPYAIIYRNMAILGVEGFSALPQH  557



>ref|XP_009137417.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Brassica 
rapa]
 emb|CDY10987.1| BnaA03g46460D [Brassica napus]
Length=671

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLF++AA  G+E+GVVAGLAGCGL+KSV++VS  LM DFKT H T+ S +AMF SQ IG
Sbjct  450  IGLFILAAVSGREDGVVAGLAGCGLIKSVISVSCILMQDFKTAHYTMASPKAMFASQMIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V+PLSFFLFY AFDVGNP GE+KAP+AL+YRN+A + VEGFSALP H
Sbjct  510  TVVGCIVSPLSFFLFYTAFDVGNPKGEFKAPYALIYRNMAILGVEGFSALPLH  562



>gb|AES72566.2| OPT family oligopeptide transporter [Medicago truncatula]
Length=667

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM D KTGHLTLTS R+M +SQAIG
Sbjct  445  VALFVLAALAGKSDGVVAGLVGCGLIKSIVSISSDLMHDLKTGHLTLTSPRSMLVSQAIG  504

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAP++FFLFY AFDVGNP+G YKAP+A++YRN+A + VEGFSALP H
Sbjct  505  TAIGCVVAPVTFFLFYKAFDVGNPDGIYKAPYAIIYRNMAILGVEGFSALPDH  557



>ref|XP_010267463.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Nelumbo 
nucifera]
 ref|XP_010267464.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Nelumbo 
nucifera]
 ref|XP_010267465.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Nelumbo 
nucifera]
 ref|XP_010267466.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Nelumbo 
nucifera]
 ref|XP_010267467.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Nelumbo 
nucifera]
Length=680

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK+ GVVAGL GCGL+KS++++S +LM DFK+ HLTLTS R+M +SQA+G
Sbjct  459  VALFVIAALAGKDTGVVAGLVGCGLIKSIVSISSDLMHDFKSAHLTLTSPRSMLVSQAVG  518

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCVVAPL+FFLFY AFDVGNPN E+KAP+AL+YRN+A + VEGFSALP+H
Sbjct  519  TAMGCVVAPLTFFLFYKAFDVGNPNKEFKAPYALIYRNMAILGVEGFSALPRH  571



>gb|EPS62701.1| hypothetical protein M569_12087, partial [Genlisea aurea]
Length=637

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF +AA+ G+E+GVVAGL GCG++KS+++++ +LM DFKTGHLTLTS R+M + QAIG
Sbjct  413  VALFAVAAASGREDGVVAGLIGCGIIKSMISIASDLMHDFKTGHLTLTSPRSMVVGQAIG  472

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVV PLSFFLFY AFDVG+P+G YKAP+AL+YRN+A + VEG SALP+H
Sbjct  473  TAIGCVVGPLSFFLFYKAFDVGDPDGAYKAPYALIYRNMAILGVEGLSALPEH  525



>gb|EPS61530.1| hypothetical protein M569_13263, partial [Genlisea aurea]
Length=666

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLF++AA  G+ +GVVA LA CGL KS++NVS  LMLD KTGHLT TS +AM LSQA+G
Sbjct  435  LGLFIVAALSGRRHGVVAALAACGLFKSIINVSCILMLDMKTGHLTSTSPKAMLLSQAVG  494

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCVV PLSFFLFY AFDVGNP+GEYKAPFA++YRN+A + VEG SALP+H
Sbjct  495  TALGCVVTPLSFFLFYRAFDVGNPDGEYKAPFAIIYRNIAILGVEGLSALPKH  547



>ref|XP_004976408.1| PREDICTED: probable metal-nicotianamine transporter YSL9-like 
isoform X2 [Setaria italica]
 ref|XP_004976409.1| PREDICTED: probable metal-nicotianamine transporter YSL9-like 
isoform X3 [Setaria italica]
Length=663

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS R+M ++QAIG
Sbjct  441  VALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMIIAQAIG  500

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+ PL+FFLFY AFD+GNP G +KAP+ALVYRN+A + V+GFSALPQH
Sbjct  501  TAMGCVIGPLTFFLFYKAFDIGNPYGYWKAPYALVYRNMAILGVQGFSALPQH  553



>dbj|BAE99250.1| hypothetical protein [Arabidopsis thaliana]
Length=491

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT 
Sbjct  271  LFVMAALAGKNDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGTA  330

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGN NGEYKAP+A++YRN+A + V+G SALP+H
Sbjct  331  IGCVVAPLTFFLFYKAFDVGNQNGEYKAPYAMIYRNMAIIGVQGPSALPKH  381



>gb|EEE61427.1| hypothetical protein OsJ_15639 [Oryza sativa Japonica Group]
Length=768

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA  GK++GVVAGL GCGLVK ++ +S +LM DFKTGHLTLTS R+M + Q +G
Sbjct  567  IALFIFAAWAGKDDGVVAGLVGCGLVKQLVLISADLMHDFKTGHLTLTSPRSMLVGQVVG  626

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCVVAPL+FFLFY AFDVG+PNG +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  627  TLMGCVVAPLTFFLFYKAFDVGDPNGYWKAPYALIYRNMAIIGVEGFSALPRH  679



>gb|EMT10300.1| Putative metal-nicotianamine transporter YSL9 [Aegilops tauschii]
Length=613

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS R+M ++QAIG
Sbjct  391  VALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMLIAQAIG  450

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC++ PL+F LFY AFD+GNP G +KAP+AL+YRN+A + VEGFSALPQH
Sbjct  451  TAMGCIIGPLTFMLFYKAFDIGNPEGPWKAPYALIYRNMAILGVEGFSALPQH  503



>ref|XP_004976411.1| PREDICTED: probable metal-nicotianamine transporter YSL16-like 
isoform X2 [Setaria italica]
Length=675

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+++A  GK+NGV+AGL GCGLVK ++ +S +LM DFKTGHLTLTS R+M + QA+G
Sbjct  453  IALFILSAWAGKDNGVIAGLVGCGLVKQLVLISADLMHDFKTGHLTLTSPRSMLVGQAVG  512

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV+APL+F LFY AFDVGNP+G +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  513  TLMGCVLAPLTFMLFYKAFDVGNPDGYWKAPYALIYRNMAILGVEGFSALPKH  565



>gb|AAS00691.1| metal-nicotianamine transporter YSL1 [Arabidopsis thaliana]
Length=673

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            +GLFV+AA  G+ENGVVAGLAGCGL+KSV++VS  LM DFKT H T+TS +AMF SQ IG
Sbjct  452  IGLFVIAAVTGRENGVVAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFASQMIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GC+V PLSFFLFY AFD+GNPNGE+KAP+AL+Y N+A + V+GFSALP H
Sbjct  512  TVVGCIVTPLSFFLFYKAFDIGNPNGEFKAPYALIYGNMAILGVQGFSALPLH  564



>ref|XP_004976407.1| PREDICTED: probable metal-nicotianamine transporter YSL9-like 
isoform X1 [Setaria italica]
Length=685

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS R+M ++QAIG
Sbjct  463  VALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMIIAQAIG  522

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+ PL+FFLFY AFD+GNP G +KAP+ALVYRN+A + V+GFSALPQH
Sbjct  523  TAMGCVIGPLTFFLFYKAFDIGNPYGYWKAPYALVYRNMAILGVQGFSALPQH  575



>ref|XP_002299431.1| hypothetical protein POPTR_0001s11310g [Populus trichocarpa]
 gb|EEE84236.1| hypothetical protein POPTR_0001s11310g [Populus trichocarpa]
Length=652

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G+ENGVVA LAGCGLVKSVL+V+  LM DFKT  +T TS RAMFLSQ +G
Sbjct  431  VALFVLAAVSGRENGVVAALAGCGLVKSVLSVACILMQDFKTAQMTSTSPRAMFLSQVVG  490

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+ AP SFFLFY AFDVGNP GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  491  TAIGCIAAPSSFFLFYKAFDVGNPYGEFKAPYALIYRNMAILGVDGFSALPQH  543



>ref|XP_004976410.1| PREDICTED: probable metal-nicotianamine transporter YSL16-like 
isoform X1 [Setaria italica]
Length=719

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+++A  GK+NGV+AGL GCGLVK ++ +S +LM DFKTGHLTLTS R+M + QA+G
Sbjct  497  IALFILSAWAGKDNGVIAGLVGCGLVKQLVLISADLMHDFKTGHLTLTSPRSMLVGQAVG  556

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV+APL+F LFY AFDVGNP+G +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  557  TLMGCVLAPLTFMLFYKAFDVGNPDGYWKAPYALIYRNMAILGVEGFSALPKH  609



>gb|EMS63506.1| putative metal-nicotianamine transporter YSL9 [Triticum urartu]
Length=644

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS R+M ++QAIG
Sbjct  422  VALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMLIAQAIG  481

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC++ PL+F LFY AFD+GNP G +KAP+AL+YRN+A + VEGFSALPQH
Sbjct  482  TAMGCIIGPLTFMLFYKAFDIGNPEGPWKAPYALIYRNMAILGVEGFSALPQH  534



>ref|XP_002299420.2| hypothetical protein POPTR_0001s11510g [Populus trichocarpa]
 gb|EEE84225.2| hypothetical protein POPTR_0001s11510g [Populus trichocarpa]
Length=667

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFV+AA  G+ENGVVA L G GLVKSV++VS  L+ DFKT HLT TS RAMFL+Q IGT 
Sbjct  448  LFVLAAISGRENGVVAALVGGGLVKSVISVSCILIQDFKTAHLTFTSPRAMFLNQVIGTA  507

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAP SFFLFY AFDVGNP+G +KAP AL+YRN+A + VEGFSALPQ+
Sbjct  508  IGCVVAPSSFFLFYKAFDVGNPSGGFKAPHALIYRNMAIIGVEGFSALPQY  558



>ref|XP_011026765.1| PREDICTED: metal-nicotianamine transporter YSL1 isoform X2 [Populus 
euphratica]
Length=602

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFV+AA  G+ENGVVA L G GLVKSV++VS  L+ DFKT HLT TS RAMFL+Q IGT 
Sbjct  383  LFVLAAISGRENGVVAALVGGGLVKSVISVSCILIQDFKTAHLTFTSPRAMFLNQVIGTA  442

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAP SFFLFY AFDVGNP+G++KAP AL++RN+A + VEGFSALPQ+
Sbjct  443  IGCVVAPGSFFLFYKAFDVGNPSGDFKAPHALIFRNMAIIGVEGFSALPQY  493



>ref|XP_003602315.1| YSL transporter [Medicago truncatula]
Length=841

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK +GVVAGL GCGL+KS++++S +LM D KTGHLTLTS R+M +SQAIG
Sbjct  466  VALFVLAALAGKSDGVVAGLVGCGLIKSIVSISSDLMHDLKTGHLTLTSPRSMLVSQAIG  525

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAP++FFLFY AFDVGNP+G YKAP+A++YRN+A + VEGFSALP H
Sbjct  526  TAIGCVVAPVTFFLFYKAFDVGNPDGIYKAPYAIIYRNMAILGVEGFSALPDH  578



>ref|XP_009150965.1| PREDICTED: metal-nicotianamine transporter YSL2 [Brassica rapa]
Length=666

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  G+ +GVVAG+  CGL+KS+++VS +LM DFKTGHLTLTS R+M ++QAIGT 
Sbjct  446  LFVMAALAGENDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTLTSPRSMLVAQAIGTA  505

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGNP+GEYKAP+A++YRN+A + V+G SALP +
Sbjct  506  IGCVVAPLTFFLFYKAFDVGNPDGEYKAPYAIIYRNMAIIGVQGLSALPHN  556



>ref|XP_003556858.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Glycine 
max]
Length=670

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G++NGVVAGL GCGLVKSV++V+  LM DFKT + T TS +AMF+ Q IG
Sbjct  449  VALFVVAAMSGRDNGVVAGLVGCGLVKSVVSVACTLMHDFKTAYYTCTSPKAMFICQLIG  508

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+APLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + VEGFSALPQH
Sbjct  509  TALGCVIAPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAVLGVEGFSALPQH  561



>ref|XP_011011616.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Populus 
euphratica]
 ref|XP_011011617.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Populus 
euphratica]
Length=661

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFV+AA  G+ENGVVA L G GLVKSV++VS  L+ DFKT HLT TS RAMFL+Q IGT 
Sbjct  442  LFVLAAISGRENGVVAALVGGGLVKSVISVSCILIQDFKTAHLTFTSPRAMFLNQVIGTA  501

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAP SFFLFY AFDVGNP+G++KAP AL++RN+A + VEGFSALPQ+
Sbjct  502  IGCVVAPGSFFLFYKAFDVGNPSGDFKAPHALIFRNMAIIGVEGFSALPQY  552



>gb|AEQ28192.1| yellow stripe-like protein 3 [Malus baccata var. xiaojinensis]
Length=671

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK++GVVAGL GCGL+KS++++S +LM D KT HLTLTS R++ LSQAIG
Sbjct  449  VALFVLAAVAGKDDGVVAGLVGCGLIKSIVSISSDLMHDLKTAHLTLTSPRSVILSQAIG  508

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCVVAPL+FFLFY AF+ G+P+GEYKAP+A++YRN+A + VEGFSALPQH
Sbjct  509  TAIGCVVAPLTFFLFYKAFNNGDPDGEYKAPYAIIYRNMAILGVEGFSALPQH  561



>ref|XP_011026763.1| PREDICTED: metal-nicotianamine transporter YSL1 isoform X1 [Populus 
euphratica]
Length=661

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFV+AA  G+ENGVVA L G GLVKSV++VS  L+ DFKT HLT TS RAMFL+Q IGT 
Sbjct  442  LFVLAAISGRENGVVAALVGGGLVKSVISVSCILIQDFKTAHLTFTSPRAMFLNQVIGTA  501

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAP SFFLFY AFDVGNP+G++KAP AL++RN+A + VEGFSALPQ+
Sbjct  502  IGCVVAPGSFFLFYKAFDVGNPSGDFKAPHALIFRNMAIIGVEGFSALPQY  552



>dbj|BAB11231.1| unnamed protein product [Arabidopsis thaliana]
Length=652

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT 
Sbjct  432  LFVMAALAGKNDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGTA  491

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGN NGEYKAP+A++YRN+A + V+G SALP+H
Sbjct  492  IGCVVAPLTFFLFYKAFDVGNQNGEYKAPYAMIYRNMAIIGVQGPSALPKH  542



>gb|EEE57481.1| hypothetical protein OsJ_07730 [Oryza sativa Japonica Group]
Length=633

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA GG++NGV+AGL GCG+VK ++ VS +LM DFKTGHLTLTS R+M + QAIG
Sbjct  411  IALFIFAAWGGRDNGVIAGLVGCGIVKQLVQVSADLMHDFKTGHLTLTSPRSMLVGQAIG  470

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC++APL+F LFY AFD+GNP+G +KAP+AL++RN+A + VEGFSALP+H
Sbjct  471  TAMGCIIAPLTFLLFYKAFDIGNPDGYWKAPYALIFRNMAILGVEGFSALPKH  523



>dbj|BAD26553.1| putative iron-phytosiderophore transporter protein yellow stripe 
1 [Oryza sativa Japonica Group]
 dbj|BAD25583.1| putative iron-phytosiderophore transporter protein yellow stripe 
1 [Oryza sativa Japonica Group]
Length=649

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA GG++NGV+AGL GCG+VK ++ VS +LM DFKTGHLTLTS R+M + QAIG
Sbjct  427  IALFIFAAWGGRDNGVIAGLVGCGIVKQLVQVSADLMHDFKTGHLTLTSPRSMLVGQAIG  486

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC++APL+F LFY AFD+GNP+G +KAP+AL++RN+A + VEGFSALP+H
Sbjct  487  TAMGCIIAPLTFLLFYKAFDIGNPDGYWKAPYALIFRNMAILGVEGFSALPKH  539



>ref|NP_197826.2| metal-nicotianamine transporter YSL2 [Arabidopsis thaliana]
 sp|Q6R3K9.1|YSL2_ARATH RecName: Full=Metal-nicotianamine transporter YSL2; AltName: 
Full=Protein YELLOW STRIPE LIKE 2; Short=AtYSL2 [Arabidopsis 
thaliana]
 gb|AAS00692.1| metal-nicotianamine transporter YSL2 [Arabidopsis thaliana]
 gb|AAT69741.1| putative metal-nicotianamine transporter [Arabidopsis thaliana]
 gb|AED93305.1| metal-nicotianamine transporter YSL2 [Arabidopsis thaliana]
Length=664

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  334  LFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIGTI  155
            LFVMAA  GK +GVVAG+  CGL+KS+++VS +LM DFKTGHLT TS R+M ++QAIGT 
Sbjct  444  LFVMAALAGKNDGVVAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGTA  503

Query  154  IGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            IGCVVAPL+FFLFY AFDVGN NGEYKAP+A++YRN+A + V+G SALP+H
Sbjct  504  IGCVVAPLTFFLFYKAFDVGNQNGEYKAPYAMIYRNMAIIGVQGPSALPKH  554



>ref|XP_004495506.1| PREDICTED: LOW QUALITY PROTEIN: metal-nicotianamine transporter 
YSL1-like [Cicer arietinum]
Length=687

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL GCGL+KSV++VS NLM DFKT H T TS RAMF+ Q +G
Sbjct  466  VALFVLAAVTGKENGVVAGLVGCGLIKSVISVSCNLMQDFKTAHYTRTSPRAMFICQVVG  525

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV  PLSFFL+Y AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALP+H
Sbjct  526  TAMGCVCCPLSFFLYYKAFDVGNPDGEFKAPYALIYRNMAVIGVQGFSALPRH  578



>ref|XP_010676898.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Beta vulgaris 
subsp. vulgaris]
Length=663

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V +F++AA  GK+NGVVAGL GCG++KSV  VS +LM DFKTGH+TL+S R+M LSQA+G
Sbjct  442  VAIFILAALAGKDNGVVAGLVGCGVIKSVAYVSCSLMQDFKTGHMTLSSPRSMLLSQAVG  501

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGCV A L F LFY+AFDVGNP GEYKAP+AL+YRN+A + VEGFSALP+H
Sbjct  502  TAIGCVAASLCFSLFYHAFDVGNPTGEYKAPYALIYRNMAILGVEGFSALPRH  554



>ref|XP_008465519.1| PREDICTED: LOW QUALITY PROTEIN: metal-nicotianamine transporter 
YSL1-like [Cucumis melo]
Length=663

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF++AA   K + ++AGLAGCGL+ SV++V   LM DFKT HLT TS RAMF+SQ IG
Sbjct  442  IALFILAAISPKHDALIAGLAGCGLITSVVSVGCTLMQDFKTAHLTYTSPRAMFVSQVIG  501

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC++APLSFFLFYNAFDVGNP GE+K+P+AL+YRN+A + VEG SALP+H
Sbjct  502  TTIGCIMAPLSFFLFYNAFDVGNPKGEFKSPYALIYRNMAILGVEGVSALPEH  554



>dbj|BAD72770.1| YS1-like metal-nicotianamine transporter [Oryza sativa Japonica 
Group]
 dbj|BAD90812.1| metal-nicotianamine transporter [Oryza sativa Japonica Group]
Length=674

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA GG++NGV+AGL GCG+VK ++ VS +LM DFKTGHLTLTS R+M + QAIG
Sbjct  452  IALFIFAAWGGRDNGVIAGLVGCGIVKQLVQVSADLMHDFKTGHLTLTSPRSMLVGQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC++APL+F LFY AFD+GNP+G +KAP+AL++RN+A + VEGFSALP+H
Sbjct  512  TAMGCIIAPLTFLLFYKAFDIGNPDGYWKAPYALIFRNMAILGVEGFSALPKH  564



>gb|KHN04996.1| Metal-nicotianamine transporter YSL1 [Glycine soja]
Length=662

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF +AA  GKENGVVAGL GCGL+KSV++VS  LM DFKT H T TS RAMF+ Q IG
Sbjct  441  VALFTLAAVTGKENGVVAGLVGCGLIKSVISVSCILMQDFKTAHYTRTSPRAMFICQVIG  500

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
              +GCV APLSFFL+Y AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  501  IAMGCVTAPLSFFLYYKAFDVGNPHGEFKAPYALIYRNMAIIGVQGFSALPQH  553



>ref|NP_001047586.2| Os02g0649900 [Oryza sativa Japonica Group]
 sp|Q6H3Z6.2|YSL2_ORYSJ RecName: Full=Metal-nicotianamine transporter YSL2; AltName: 
Full=Protein YELLOW STRIPE LIKE 2; Short=OsYSL2 [Oryza sativa 
Japonica Group]
 dbj|BAF09500.2| Os02g0649900 [Oryza sativa Japonica Group]
Length=674

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA GG++NGV+AGL GCG+VK ++ VS +LM DFKTGHLTLTS R+M + QAIG
Sbjct  452  IALFIFAAWGGRDNGVIAGLVGCGIVKQLVQVSADLMHDFKTGHLTLTSPRSMLVGQAIG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC++APL+F LFY AFD+GNP+G +KAP+AL++RN+A + VEGFSALP+H
Sbjct  512  TAMGCIIAPLTFLLFYKAFDIGNPDGYWKAPYALIFRNMAILGVEGFSALPKH  564



>ref|XP_007161580.1| hypothetical protein PHAVU_001G081600g [Phaseolus vulgaris]
 ref|XP_007161581.1| hypothetical protein PHAVU_001G081600g [Phaseolus vulgaris]
 gb|ESW33574.1| hypothetical protein PHAVU_001G081600g [Phaseolus vulgaris]
 gb|ESW33575.1| hypothetical protein PHAVU_001G081600g [Phaseolus vulgaris]
Length=670

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF +AA  GKENGVVAGL GCGLVKSV++VS  LM DFKT H T TS RAMF+ Q IG
Sbjct  449  VALFTLAAITGKENGVVAGLVGCGLVKSVVSVSCILMQDFKTAHYTRTSPRAMFICQVIG  508

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
              +GCV APLSFFL+Y AFDVGNP GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  509  IAMGCVTAPLSFFLYYKAFDVGNPQGEFKAPYALIYRNMAIIGVQGFSALPQH  561



>ref|XP_006648886.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Oryza brachyantha]
Length=599

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA GGK+NGV+AGL GCG+VK ++ VS +LM DFKTGHLTLTS R+M + QAIG
Sbjct  377  IALFIFAAWGGKDNGVIAGLVGCGVVKQLVQVSADLMHDFKTGHLTLTSPRSMLVGQAIG  436

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC++APL+F LFY +FD+GNP+G +KAP+AL++RN+A + VEGFSALP+H
Sbjct  437  TAMGCIIAPLTFLLFYKSFDIGNPDGYWKAPYALIFRNMAILGVEGFSALPKH  489



>ref|XP_010541500.1| PREDICTED: metal-nicotianamine transporter YSL2 isoform X2 [Tarenaya 
hassleriana]
Length=668

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK+ GVVAG+  CGLVKS+++VS +LM DFKTGHLT+TS R+M ++QAIG
Sbjct  446  VALFVIAALAGKDEGVVAGMMACGLVKSIISVSADLMHDFKTGHLTMTSPRSMLVAQAIG  505

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            + IGCVVAPL+FFLFY AFDVGNP+G+YKAP+A++YRN+A + V+G SALP H
Sbjct  506  SAIGCVVAPLTFFLFYKAFDVGNPDGDYKAPYAIIYRNMAILGVQGVSALPGH  558



>ref|XP_006606419.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Glycine max]
Length=670

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF +AA  GKENGVVAGL GCGL+KSV++VS  LM DFKT H T TS RAMF+ Q IG
Sbjct  449  VALFTLAAVTGKENGVVAGLVGCGLIKSVISVSCILMQDFKTAHYTRTSPRAMFICQVIG  508

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
              +GCV APLSFFL+Y AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  509  IAMGCVTAPLSFFLYYKAFDVGNPHGEFKAPYALIYRNMAIIGVQGFSALPQH  561



>ref|XP_003556427.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Glycine max]
 ref|XP_006606418.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Glycine max]
Length=671

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF +AA  GKENGVVAGL GCGL+KSV++VS  LM DFKT H T TS RAMF+ Q IG
Sbjct  450  VALFTLAAVTGKENGVVAGLVGCGLIKSVISVSCILMQDFKTAHYTRTSPRAMFICQVIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
              +GCV APLSFFL+Y AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALPQH
Sbjct  510  IAMGCVTAPLSFFLYYKAFDVGNPHGEFKAPYALIYRNMAIIGVQGFSALPQH  562



>ref|XP_003580253.1| PREDICTED: probable metal-nicotianamine transporter YSL16 isoform 
X2 [Brachypodium distachyon]
Length=674

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA  GK+NGVVAGL  CGLVK ++ +S +LM DFKT HLTLTS R+M   QA G
Sbjct  452  IALFIFAAWAGKDNGVVAGLVTCGLVKHLVLISADLMHDFKTAHLTLTSPRSMLAGQAAG  511

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCVVAPL+FFLFY AFDVGNP+G +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  512  TLMGCVVAPLTFFLFYEAFDVGNPDGYWKAPYALIYRNMAILGVEGFSALPRH  564



>ref|XP_010541499.1| PREDICTED: metal-nicotianamine transporter YSL2 isoform X1 [Tarenaya 
hassleriana]
Length=706

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK+ GVVAG+  CGLVKS+++VS +LM DFKTGHLT+TS R+M ++QAIG
Sbjct  484  VALFVIAALAGKDEGVVAGMMACGLVKSIISVSADLMHDFKTGHLTMTSPRSMLVAQAIG  543

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            + IGCVVAPL+FFLFY AFDVGNP+G+YKAP+A++YRN+A + V+G SALP H
Sbjct  544  SAIGCVVAPLTFFLFYKAFDVGNPDGDYKAPYAIIYRNMAILGVQGVSALPGH  596



>dbj|BAH98158.1| yellow stripe 1-like [Tulipa gesneriana]
Length=670

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  G ++GVVAGL GCGL+KSV+++S +LM DFKT HLTLTS R+M LSQAIG
Sbjct  445  VALFILAAWAGMDSGVVAGLVGCGLIKSVVSISSDLMHDFKTAHLTLTSPRSMLLSQAIG  504

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCVVAPL+FF+FY AFD+GNP+G +KAP+AL+YRN+A + V+GFSALP H
Sbjct  505  TAMGCVVAPLTFFIFYKAFDIGNPDGSWKAPYALIYRNMAILGVQGFSALPHH  557



>ref|XP_010034899.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Eucalyptus 
grandis]
Length=665

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF +AA  GKE+GVVAGL GCGL+KS++++S +LM +FKTGHLT TS RAM LSQA+G
Sbjct  443  VTLFALAAVTGKESGVVAGLVGCGLIKSIVSISSDLMHNFKTGHLTFTSPRAMLLSQALG  502

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAPL+FFLFY  F++G+PNGEY AP+ALVYRN+A + VEGFSALP+H
Sbjct  503  TAIGCIVAPLTFFLFYKDFNIGDPNGEYPAPYALVYRNMAVLGVEGFSALPKH  555



>gb|EMT14696.1| hypothetical protein F775_52546 [Aegilops tauschii]
Length=683

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV AA  GK+NGVVAGL  CGLVK ++ VS +LM DFKT HLTLTS R+M + QA G
Sbjct  461  VALFVFAAWAGKDNGVVAGLVTCGLVKQLVLVSADLMHDFKTAHLTLTSPRSMLVGQAAG  520

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQ  5
            T++GCVVAPL+FFLFY AFDVGNP+G +KAP+AL+YRN+A + VEGFSALPQ
Sbjct  521  TLMGCVVAPLTFFLFYEAFDVGNPDGYWKAPYALIYRNMAILGVEGFSALPQ  572



>ref|XP_004163579.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Cucumis 
sativus]
Length=663

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF++AA   K + ++AGLAGCGL+ SV++V   LM DFKT HLT TS RAMF+SQ IG
Sbjct  442  IALFILAAISPKHDALIAGLAGCGLITSVVSVGCTLMQDFKTAHLTSTSPRAMFVSQVIG  501

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC++APLSFFLFYNAFDVGNP GE+KAP+AL+YRN+A + VEG SALP+H
Sbjct  502  TAVGCIMAPLSFFLFYNAFDVGNPKGEFKAPYALIYRNMAILGVEGVSALPKH  554



>ref|XP_004143944.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Cucumis 
sativus]
 gb|KGN49985.1| hypothetical protein Csa_5G148560 [Cucumis sativus]
Length=663

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF++AA   K + ++AGLAGCGL+ SV++V   LM DFKT HLT TS RAMF+SQ IG
Sbjct  442  IALFILAAISPKHDALIAGLAGCGLITSVVSVGCTLMQDFKTAHLTSTSPRAMFVSQVIG  501

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC++APLSFFLFYNAFDVGNP GE+KAP+AL+YRN+A + VEG SALP+H
Sbjct  502  TAVGCIMAPLSFFLFYNAFDVGNPKGEFKAPYALIYRNMAILGVEGVSALPKH  554



>ref|XP_010240193.1| PREDICTED: probable metal-nicotianamine transporter YSL16 isoform 
X1 [Brachypodium distachyon]
Length=704

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA  GK+NGVVAGL  CGLVK ++ +S +LM DFKT HLTLTS R+M   QA G
Sbjct  482  IALFIFAAWAGKDNGVVAGLVTCGLVKHLVLISADLMHDFKTAHLTLTSPRSMLAGQAAG  541

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCVVAPL+FFLFY AFDVGNP+G +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  542  TLMGCVVAPLTFFLFYEAFDVGNPDGYWKAPYALIYRNMAILGVEGFSALPRH  594



>gb|KCW46096.1| hypothetical protein EUGRSUZ_K00012 [Eucalyptus grandis]
Length=695

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF +AA  GKE+GVVAGL GCGL+KS++++S +LM +FKTGHLT TS RAM LSQA+G
Sbjct  473  VTLFALAAVTGKESGVVAGLVGCGLIKSIVSISSDLMHNFKTGHLTFTSPRAMLLSQALG  532

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+VAPL+FFLFY  F++G+PNGEY AP+ALVYRN+A + VEGFSALP+H
Sbjct  533  TAIGCIVAPLTFFLFYKDFNIGDPNGEYPAPYALVYRNMAVLGVEGFSALPKH  585



>ref|XP_007151963.1| hypothetical protein PHAVU_004G090100g [Phaseolus vulgaris]
 gb|ESW23957.1| hypothetical protein PHAVU_004G090100g [Phaseolus vulgaris]
Length=668

 Score =   127 bits (320),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G+ENGVVAG+ GCGLVKSV++V+  LM DFKT + T +S +AMF+ Q IG
Sbjct  447  VALFVVAAMSGRENGVVAGMVGCGLVKSVVSVACTLMQDFKTAYYTRSSPKAMFVGQLIG  506

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+AP+SFFLFY AFDVGNP+GE+KAP+AL+YRN+A + VEGFSALPQH
Sbjct  507  TALGCVIAPMSFFLFYKAFDVGNPHGEFKAPYALIYRNMAVLGVEGFSALPQH  559



>gb|EPS58153.1| hypothetical protein M569_16663 [Genlisea aurea]
Length=301

 Score =   124 bits (311),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GKENGVVAGL G  ++KS +  S  L+ DF+T +LTLTS R+M  +QA+G
Sbjct  76   VALFVLAAMAGKENGVVAGLVGLSVIKSAIATSGELIHDFRTAYLTLTSPRSMLAAQAVG  135

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T IGC+V PL+FF+FY +FDVG+P+G YKAP+A++YRN+A + VEGFSALP H
Sbjct  136  TAIGCIVGPLTFFVFYRSFDVGDPDGVYKAPYAIIYRNMAILGVEGFSALPDH  188



>ref|XP_008661601.1| PREDICTED: uncharacterized protein LOC100273385 isoform X2 [Zea 
mays]
 gb|ACR36914.1| unknown [Zea mays]
 gb|AFW59028.1| hypothetical protein ZEAMMB73_172012 [Zea mays]
Length=672

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK++GVVAGL GCGLVK ++ VS +LM DFKTGHLTLTS R+M + QA+G
Sbjct  450  VALFVLAAWAGKDSGVVAGLVGCGLVKQLVLVSADLMHDFKTGHLTLTSPRSMLVGQAVG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV+APL+F LFY AFDVG P+G +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  510  TLMGCVLAPLTFMLFYRAFDVGEPDGYWKAPYALIYRNMAILGVEGFSALPRH  562



>ref|XP_009763791.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Nicotiana sylvestris]
Length=636

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  217  TGHLTLTSSRAMFLSQAIGTIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLAS  38
            +GHLTLTS R+M LSQ IGT IGCVVAPL+FFLFY AFDVGNP+GEYKAP+AL+YRN+A 
Sbjct  453  SGHLTLTSPRSMLLSQGIGTAIGCVVAPLTFFLFYKAFDVGNPDGEYKAPYALIYRNMAI  512

Query  37   VSVEGFSALPQH  2
            + VEGFSALPQH
Sbjct  513  LGVEGFSALPQH  524



>ref|XP_010252366.1| PREDICTED: metal-nicotianamine transporter YSL2 [Nelumbo nucifera]
 ref|XP_010252375.1| PREDICTED: metal-nicotianamine transporter YSL2 [Nelumbo nucifera]
 ref|XP_010252385.1| PREDICTED: metal-nicotianamine transporter YSL2 [Nelumbo nucifera]
Length=681

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK++GVVAGL GCGL+KS++++S +LM D K+ HLT TS R+M LSQA+G
Sbjct  460  VALFVIAAVAGKDSGVVAGLVGCGLIKSIVSISSDLMHDLKSAHLTHTSPRSMLLSQAVG  519

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCVVAPL+FFLFY AFDVGNP+GE+KAP+A++YRN+A + VEGFSALP+H
Sbjct  520  TAMGCVVAPLTFFLFYKAFDVGNPDGEFKAPYAIIYRNMAILGVEGFSALPRH  572



>gb|EAY95023.1| hypothetical protein OsI_16833 [Oryza sativa Indica Group]
Length=721

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA  GK++GVV       + + VL  +  +  DFKTGHLTLTS R+M + Q +G
Sbjct  500  IALFIFAAWAGKDDGVVPARRVRSVKQLVLISADLMH-DFKTGHLTLTSPRSMLVGQVVG  558

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCVVAPL+FFLFY AFDVG+PNG +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  559  TLMGCVVAPLTFFLFYKAFDVGDPNGYWKAPYALIYRNMAIIGVEGFSALPRH  611



>ref|XP_006593833.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Glycine max]
 ref|XP_003543988.2| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Glycine max]
 ref|XP_006593834.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Glycine max]
 ref|XP_006593835.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X4 [Glycine max]
Length=669

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G++NGVVAGL GCGLVKSV++V+  LMLDFKT + T TS +AMF+ Q +G
Sbjct  448  VALFVIAAMSGRDNGVVAGLVGCGLVKSVVSVACTLMLDFKTAYYTCTSPKAMFICQLVG  507

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+APLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + VEGFSALP H
Sbjct  508  TALGCVIAPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAVLGVEGFSALPHH  560



>ref|XP_006593836.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X5 [Glycine max]
Length=668

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G++NGVVAGL GCGLVKSV++V+  LMLDFKT + T TS +AMF+ Q +G
Sbjct  447  VALFVIAAMSGRDNGVVAGLVGCGLVKSVVSVACTLMLDFKTAYYTCTSPKAMFICQLVG  506

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+APLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + VEGFSALP H
Sbjct  507  TALGCVIAPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAVLGVEGFSALPHH  559



>ref|XP_008661599.1| PREDICTED: uncharacterized protein LOC100273385 isoform X1 [Zea 
mays]
 ref|XP_008661600.1| PREDICTED: uncharacterized protein LOC100273385 isoform X1 [Zea 
mays]
 gb|AFW59029.1| hypothetical protein ZEAMMB73_172012 [Zea mays]
Length=727

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  GK++GVVAGL GCGLVK ++ VS +LM DFKTGHLTLTS R+M + QA+G
Sbjct  505  VALFVLAAWAGKDSGVVAGLVGCGLVKQLVLVSADLMHDFKTGHLTLTSPRSMLVGQAVG  564

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T++GCV+APL+F LFY AFDVG P+G +KAP+AL+YRN+A + VEGFSALP+H
Sbjct  565  TLMGCVLAPLTFMLFYRAFDVGEPDGYWKAPYALIYRNMAILGVEGFSALPRH  617



>ref|XP_006593837.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X6 [Glycine max]
Length=678

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LFV+AA  G++NGVVAGL GCGLVKSV++V+  LMLDFKT + T TS +AMF+ Q +G
Sbjct  457  VALFVIAAMSGRDNGVVAGLVGCGLVKSVVSVACTLMLDFKTAYYTCTSPKAMFICQLVG  516

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+APLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + VEGFSALP H
Sbjct  517  TALGCVIAPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAVLGVEGFSALPHH  569



>ref|XP_002452832.1| hypothetical protein SORBIDRAFT_04g033320 [Sorghum bicolor]
 gb|EES05808.1| hypothetical protein SORBIDRAFT_04g033320 [Sorghum bicolor]
Length=678

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA  GK+NGV+AGLAG  LVK ++  S +LM DFKTGHLTLTS R++ ++Q IG
Sbjct  456  IALFIFAAWAGKDNGVIAGLAGGTLVKQLVMASADLMHDFKTGHLTLTSPRSLLVAQFIG  515

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC++APL+F LFYNAFD+GNPNG +KAP+ L+YRN+A + VEGFS LP+H
Sbjct  516  TAMGCIIAPLTFLLFYNAFDIGNPNGYWKAPYGLIYRNMAILGVEGFSVLPKH  568



>ref|XP_002452833.1| hypothetical protein SORBIDRAFT_04g033330 [Sorghum bicolor]
 gb|EES05809.1| hypothetical protein SORBIDRAFT_04g033330 [Sorghum bicolor]
Length=613

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA   KENGV+AGLAG  LVK ++  S +LM DFKTGHLTLTS R++ ++Q IG
Sbjct  391  IALFIFAAWASKENGVIAGLAGGTLVKQLVIASADLMHDFKTGHLTLTSPRSLLVAQFIG  450

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCVVAPL+F LFYNAFD+GNPNG +KAP+ L+YRN+A + VEGFS LP+H
Sbjct  451  TAMGCVVAPLTFLLFYNAFDIGNPNGYWKAPYGLIYRNMAILGVEGFSVLPKH  503



>ref|XP_008437732.1| PREDICTED: metal-nicotianamine transporter YSL1, partial [Cucumis 
melo]
Length=495

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA   K + ++AGLAGCGL+KSV++V+  LM DFKT HLT TS RAMF+SQ IG
Sbjct  274  VALFLLAALSPKHDALIAGLAGCGLIKSVVSVACILMQDFKTAHLTSTSPRAMFVSQMIG  333

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV APLSFFLFY AFDVGNP GE+KAP+AL+YRN+A + VEG SALP+H
Sbjct  334  TAVGCVTAPLSFFLFYKAFDVGNPEGEFKAPYALIYRNMAILGVEGVSALPKH  386



>gb|KEH42903.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=680

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++A   GKENGVVA L GCGL+KSV++VS NLM DFKT H T TS RAMF+ Q +G
Sbjct  459  VALFLLATVTGKENGVVAALVGCGLIKSVISVSCNLMQDFKTAHCTRTSPRAMFVCQVVG  518

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+  PLSFFLFY AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALP+H
Sbjct  519  TAMGCICCPLSFFLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPRH  571



>ref|NP_001168540.1| hypothetical protein [Zea mays]
 ref|XP_008668330.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668331.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668332.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28591.1| unknown [Zea mays]
 tpg|DAA36639.1| TPA: hypothetical protein ZEAMMB73_082828 [Zea mays]
 tpg|DAA36640.1| TPA: hypothetical protein ZEAMMB73_082828 [Zea mays]
Length=672

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS R+M ++QAIG
Sbjct  450  VALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMIIAQAIG  509

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+ PL+F LFY AFD+GNP+G +KAP+AL+YRN+A + V+GFSALP H
Sbjct  510  TAMGCVIGPLTFLLFYKAFDIGNPDGYWKAPYALIYRNMAILGVQGFSALPLH  562



>ref|XP_004953295.1| PREDICTED: iron-phytosiderophore transporter yellow stripe 1-like 
[Setaria italica]
Length=679

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            + LF+ AA  GK+NGV+AGLAG  LVK ++  S +LM DFKTGHLT+TS R++ ++Q IG
Sbjct  457  IALFIFAAWAGKDNGVIAGLAGGTLVKQLVMASADLMHDFKTGHLTMTSPRSLLVAQFIG  516

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GC+VAPL+F LFYNAFD+GNP G +KAP+ L+YRN+A + VEGFSALP+H
Sbjct  517  TAMGCIVAPLTFLLFYNAFDIGNPTGYWKAPYGLIYRNMAVLGVEGFSALPKH  569



>ref|XP_008668329.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 tpg|DAA36641.1| TPA: hypothetical protein ZEAMMB73_082828 [Zea mays]
Length=696

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA  GK++GVVAGL GCGLVKS++++S +LM DFKTGHLTLTS R+M ++QAIG
Sbjct  474  VALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMIIAQAIG  533

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV+ PL+F LFY AFD+GNP+G +KAP+AL+YRN+A + V+GFSALP H
Sbjct  534  TAMGCVIGPLTFLLFYKAFDIGNPDGYWKAPYALIYRNMAILGVQGFSALPLH  586



>ref|XP_004143842.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Cucumis 
sativus]
 ref|XP_004163573.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Cucumis 
sativus]
 gb|KGN49984.1| hypothetical protein Csa_5G148550 [Cucumis sativus]
Length=664

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF++AA   K + ++AGLAGCGL+KSV++V+  LM DFKT HLT TS RAMF+SQ IG
Sbjct  443  VALFLLAALSPKHDALIAGLAGCGLIKSVVSVACILMQDFKTAHLTSTSPRAMFVSQMIG  502

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
            T +GCV APLSFFLFY AFDVGNP GE+KAP+AL+YRN+A + VEG SALP+H
Sbjct  503  TAVGCVTAPLSFFLFYKAFDVGNPKGEFKAPYALIYRNMAILGVEGVSALPKH  555



>gb|KHN14758.1| Metal-nicotianamine transporter YSL1 [Glycine soja]
Length=674

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  340  VGLFVMAASGGKENgvvaglagcglvksvlnvsvnlmLDFKTGHLTLTSSRAMFLSQAIG  161
            V LF +AA  GKENGVVAGL GCGL+KSV++VS  LM DFKT H T TS RAMF+ Q IG
Sbjct  453  VALFTLAAVTGKENGVVAGLVGCGLIKSVISVSCILMQDFKTAHYTRTSPRAMFICQVIG  512

Query  160  TIIGCVVAPLSFFLFYNAFDVGNPNGEYKAPFALVYRNLASVSVEGFSALPQH  2
              +GCV APLSFFL+Y AFDVGNP+GE+KAP+AL+YRN+A + V+GFSALP H
Sbjct  513  IAMGCVTAPLSFFLYYKAFDVGNPHGEFKAPYALIYRNMAIIGVQGFSALPLH  565



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511879084288