BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c96395_g1_i1 len=115 path=[93:0-114]

Length=115
                                                                      Score     E

ref|XP_010669501.1|  PREDICTED: proteasome subunit beta type-6        82.0    1e-17   
ref|XP_011094056.1|  PREDICTED: proteasome subunit beta type-6-like   80.9    3e-17   
ref|XP_011077665.1|  PREDICTED: proteasome subunit beta type-6        80.9    3e-17   
emb|CDP12496.1|  unnamed protein product                              80.1    5e-17   
gb|AGZ15417.1|  proteasome subunit beta type-6                        80.1    5e-17   
ref|XP_003522675.1|  PREDICTED: proteasome subunit beta type-6        79.3    8e-17   
gb|KHN18228.1|  Proteasome subunit beta type-6                        79.3    1e-16   
ref|NP_001236436.1|  uncharacterized protein LOC100305513             79.0    1e-16   
gb|KDP33416.1|  hypothetical protein JCGZ_06987                       79.0    1e-16   
ref|XP_007137144.1|  hypothetical protein PHAVU_009G103400g           79.0    1e-16   
ref|XP_002527995.1|  proteasome subunit beta type 6,9, putative       79.0    2e-16   Ricinus communis
ref|XP_008445064.1|  PREDICTED: proteasome subunit beta type-6        78.2    2e-16   
ref|XP_007011513.1|  N-terminal nucleophile aminohydrolases (Ntn ...  79.0    2e-16   
ref|XP_009618094.1|  PREDICTED: proteasome subunit beta type-6-like   79.0    2e-16   
ref|XP_009783268.1|  PREDICTED: proteasome subunit beta type-6-like   78.6    2e-16   
gb|KDP32135.1|  hypothetical protein JCGZ_12596                       78.6    2e-16   
gb|KDO67174.1|  hypothetical protein CISIN_1g026587mg                 77.8    2e-16   
gb|EYU25752.1|  hypothetical protein MIMGU_mgv1a012906mg              78.6    2e-16   
gb|ACV52586.1|  proteasome subunit beta type-6 precursor              77.8    2e-16   Nicotiana benthamiana
ref|XP_003603570.1|  Proteasome subunit beta type                     78.2    2e-16   
ref|XP_007011514.1|  N-terminal nucleophile aminohydrolases (Ntn ...  78.2    2e-16   
gb|KDO67175.1|  hypothetical protein CISIN_1g026587mg                 77.8    2e-16   
ref|XP_004501214.1|  PREDICTED: proteasome subunit beta type-6-like   78.2    2e-16   
ref|XP_010927181.1|  PREDICTED: proteasome subunit beta type-6-like   78.2    3e-16   
emb|CBI20801.3|  unnamed protein product                              78.2    3e-16   
gb|ACF74359.1|  threonine endopeptidase                               77.0    3e-16   Arachis hypogaea [goober]
ref|XP_004138776.1|  PREDICTED: proteasome subunit beta type-6-like   77.8    3e-16   
ref|XP_009798527.1|  PREDICTED: proteasome subunit beta type-6        77.8    3e-16   
ref|XP_006655771.1|  PREDICTED: proteasome subunit beta type-6-like   77.8    3e-16   
ref|XP_006450098.1|  hypothetical protein CICLE_v10009349mg           77.8    4e-16   
gb|EMS49952.1|  Proteasome subunit beta type-6                        77.8    4e-16   
dbj|BAJ96616.1|  predicted protein                                    77.8    4e-16   
sp|P93395.1|PSB6_TOBAC  RecName: Full=Proteasome subunit beta typ...  77.8    4e-16   Nicotiana tabacum [American tobacco]
ref|XP_002283195.1|  PREDICTED: proteasome subunit beta type-6        77.8    4e-16   Vitis vinifera
ref|XP_006647970.1|  PREDICTED: proteasome subunit beta type-6-like   77.8    4e-16   
ref|XP_009621050.1|  PREDICTED: proteasome subunit beta type-6        77.8    4e-16   
dbj|BAJ90589.1|  predicted protein                                    77.8    4e-16   
gb|KHG26672.1|  Proteasome subunit beta type-6 -like protein          77.8    4e-16   
gb|AFK48953.1|  unknown                                               76.6    4e-16   
gb|KCW80738.1|  hypothetical protein EUGRSUZ_C02133                   76.6    5e-16   
ref|XP_006412608.1|  hypothetical protein EUTSA_v10026126mg           77.4    5e-16   
ref|NP_001048247.1|  Os02g0770000                                     77.4    5e-16   Oryza sativa Japonica Group [Japonica rice]
gb|AFK42116.1|  unknown                                               77.4    5e-16   
ref|XP_004981513.1|  PREDICTED: proteasome subunit beta type-6-like   77.4    5e-16   
gb|AAS01049.1|  putative proteasome 20S beta1.1 subunit               76.6    5e-16   Brassica napus [oilseed rape]
gb|AAS01048.1|  putative proteasome 20S beta1 subunit                 76.6    5e-16   Brassica napus [oilseed rape]
gb|AAY43812.1|  beta1 proteasome-1D                                   77.4    6e-16   Aegilops tauschii
gb|AAY43813.1|  beta1 proteasome-7D                                   77.4    6e-16   Aegilops tauschii
gb|EMT05271.1|  Proteasome subunit beta type-6                        77.4    6e-16   
gb|ACG36246.1|  proteasome subunit beta type 6 precursor              77.0    6e-16   Zea mays [maize]
ref|XP_011017616.1|  PREDICTED: proteasome subunit beta type-6        77.0    6e-16   
ref|XP_002437793.1|  hypothetical protein SORBIDRAFT_10g002700        77.0    6e-16   Sorghum bicolor [broomcorn]
ref|XP_002444629.1|  hypothetical protein SORBIDRAFT_07g025030        77.0    6e-16   Sorghum bicolor [broomcorn]
ref|XP_008647302.1|  PREDICTED: uncharacterized protein LOC100191...  77.0    6e-16   
gb|ADG86642.1|  20S proteasome subunit PBA1                           77.0    7e-16   
ref|XP_010048490.1|  PREDICTED: proteasome subunit beta type-6        77.0    7e-16   
ref|XP_006284457.1|  hypothetical protein CARUB_v10005646mg           77.0    7e-16   
emb|CDY36450.1|  BnaC03g67700D                                        77.0    8e-16   
ref|XP_006284458.1|  hypothetical protein CARUB_v10005646mg           76.3    8e-16   
ref|XP_009127104.1|  PREDICTED: proteasome subunit beta type-6        76.6    8e-16   
gb|KFK29711.1|  hypothetical protein AALP_AA7G169100                  76.6    8e-16   
ref|XP_002869337.1|  hypothetical protein ARALYDRAFT_328593           76.6    8e-16   
ref|XP_009401308.1|  PREDICTED: proteasome subunit beta type-6        76.6    8e-16   
ref|XP_006360655.1|  PREDICTED: proteasome subunit beta type-6-like   76.6    9e-16   
ref|XP_008658225.1|  PREDICTED: hypothetical protein isoform X1       77.4    9e-16   
gb|EMT09173.1|  Proteasome subunit beta type-6                        76.6    9e-16   
ref|XP_010112139.1|  Proteasome subunit beta type-6                   76.6    1e-15   
emb|CDX72300.1|  BnaC07g43220D                                        76.3    1e-15   
ref|XP_009138000.1|  PREDICTED: proteasome subunit beta type-6-like   76.3    1e-15   
ref|XP_006372204.1|  20S proteasome beta subunit A family protein     76.3    1e-15   
ref|XP_010264033.1|  PREDICTED: proteasome subunit beta type-6-like   76.3    1e-15   
ref|NP_001130703.1|  uncharacterized protein LOC100191806             75.1    1e-15   Zea mays [maize]
ref|XP_010243992.1|  PREDICTED: proteasome subunit beta type-6        76.3    1e-15   
ref|NP_001056748.1|  Os06g0139900                                     76.3    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009409586.1|  PREDICTED: proteasome subunit beta type-6-like   75.9    2e-15   
gb|ACF83694.1|  unknown                                               77.4    2e-15   Zea mays [maize]
ref|XP_009362017.1|  PREDICTED: proteasome subunit beta type-6-like   75.5    2e-15   
ref|XP_008378136.1|  PREDICTED: proteasome subunit beta type-6        75.5    2e-15   
gb|ABK21503.1|  unknown                                               75.5    2e-15   Picea sitchensis
gb|EYU26558.1|  hypothetical protein MIMGU_mgv1a012922mg              75.5    2e-15   
gb|ABK21850.1|  unknown                                               75.5    3e-15   Picea sitchensis
ref|XP_008798167.1|  PREDICTED: proteasome subunit beta type-6        75.5    3e-15   
ref|XP_002309021.1|  20S proteasome beta subunit A family protein     75.5    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011019969.1|  PREDICTED: proteasome subunit beta type-6-like   75.5    3e-15   
ref|NP_001281104.1|  hypothetical protein                             75.1    3e-15   
ref|XP_004964490.1|  PREDICTED: proteasome subunit beta type-6-like   75.1    3e-15   
gb|EMS68047.1|  Proteasome subunit beta type-6                        75.1    4e-15   
ref|XP_009375732.1|  PREDICTED: proteasome subunit beta type-6        75.1    4e-15   
ref|XP_004291266.1|  PREDICTED: proteasome subunit beta type-6-like   75.1    4e-15   
ref|XP_008341147.1|  PREDICTED: proteasome subunit beta type-6-like   74.7    4e-15   
ref|XP_008391416.1|  PREDICTED: proteasome subunit beta type-6-like   74.7    4e-15   
ref|XP_010548529.1|  PREDICTED: proteasome subunit beta type-6        74.7    5e-15   
ref|XP_010432880.1|  PREDICTED: proteasome subunit beta type-6        74.7    5e-15   
gb|ABL85039.1|  proteasome                                            74.7    5e-15   Brachypodium sylvaticum
ref|XP_003557219.1|  PREDICTED: proteasome subunit beta type-6        74.3    6e-15   
ref|XP_007223858.1|  hypothetical protein PRUPE_ppa010791mg           74.3    6e-15   
ref|XP_008393922.1|  PREDICTED: proteasome subunit beta type-6        74.3    6e-15   
ref|XP_006381167.1|  hypothetical protein POPTR_0006s07750g           74.3    6e-15   
ref|XP_002266488.1|  PREDICTED: proteasome subunit beta type-6        74.3    6e-15   Vitis vinifera
ref|XP_008352161.1|  PREDICTED: proteasome subunit beta type-6-like   72.0    1e-14   
ref|XP_006365635.1|  PREDICTED: proteasome subunit beta type-6-like   73.6    1e-14   
ref|XP_008219976.1|  PREDICTED: proteasome subunit beta type-6        73.6    1e-14   
ref|XP_006850958.1|  hypothetical protein AMTR_s00025p00199560        73.2    1e-14   
ref|NP_194858.1|  20S proteasome subunit PBA1                         73.2    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004242886.1|  PREDICTED: proteasome subunit beta type-6        73.2    1e-14   
ref|NP_001031759.1|  20S proteasome subunit PBA1                      73.2    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KHG17465.1|  Proteasome subunit beta type-6 -like protein          73.2    2e-14   
ref|XP_010525862.1|  PREDICTED: proteasome subunit beta type-6-like   71.6    6e-14   
ref|XP_008223953.1|  PREDICTED: proteasome subunit beta type-6-like   71.6    6e-14   
gb|AAM64316.1|  multicatalytic endopeptidase complex, proteasome ...  71.2    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007226082.1|  hypothetical protein PRUPE_ppa010747mg           70.9    1e-13   
gb|EPS62624.1|  hypothetical protein M569_12165                       66.6    3e-12   
ref|XP_002969356.1|  hypothetical protein SELMODRAFT_227897           60.1    8e-10   
ref|XP_002970688.1|  hypothetical protein SELMODRAFT_227995           60.1    8e-10   
ref|XP_001752251.1|  predicted protein                                55.5    4e-08   
ref|XP_005767405.1|  hypothetical protein EMIHUDRAFT_432777           53.5    2e-07   
ref|XP_009794691.1|  PREDICTED: proteasome subunit beta type-6-like   48.1    2e-05   
gb|KDD76412.1|  proteasome subunit protein                            48.1    2e-05   
ref|XP_009032940.1|  hypothetical protein AURANDRAFT_52186            48.5    2e-05   
emb|CBJ30643.1|  conserved unknown protein                            48.1    2e-05   
dbj|GAM21853.1|  hypothetical protein SAMD00019534_050280             47.8    2e-05   
emb|CCI46756.1|  unnamed protein product                              47.8    3e-05   
emb|CCA15808.1|  proteasome subunit beta type6 putative               47.8    3e-05   
ref|XP_005712113.1|  Proteasome subunit beta type                     47.4    4e-05   
ref|XP_004356133.1|  proteasome subunit beta type 6                   47.4    4e-05   
ref|XP_002901169.1|  proteasome subunit beta type-6, putative         46.6    9e-05   
ref|XP_008900536.1|  hypothetical protein PPTG_07910                  46.6    9e-05   
ref|XP_002945971.1|  hypothetical protein VOLCADRAFT_102928           46.2    1e-04   
gb|EFA75466.1|  hypothetical protein PPL_10970                        47.4    2e-04   Polysphondylium pallidum PN500
ref|XP_004352904.1|  beta1 proteasome1D, putative                     45.8    2e-04   
ref|XP_001695298.1|  20S proteasome beta subunit A1                   45.1    3e-04   Chlamydomonas reinhardtii
ref|XP_009520096.1|  hypothetical protein PHYSODRAFT_350003           46.2    4e-04   
gb|EJK74825.1|  hypothetical protein THAOC_03479                      45.1    4e-04   
ref|XP_647188.1|  proteasome subunit beta type 6                      44.7    5e-04   Dictyostelium discoideum AX4
ref|XP_003288508.1|  proteasome subunit beta type 6                   44.3    5e-04   
gb|KFM25126.1|  Proteasome subunit beta type-6                        44.3    5e-04   
ref|XP_002907149.1|  proteasome subunit beta type-6, putative         45.4    6e-04   
ref|XP_002947558.1|  hypothetical protein VOLCADRAFT_57026            44.3    8e-04   



>ref|XP_010669501.1| PREDICTED: proteasome subunit beta type-6 [Beta vulgaris subsp. 
vulgaris]
Length=236

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANLVRLLAYNN
Sbjct  67   QIVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLAYNN  104



>ref|XP_011094056.1| PREDICTED: proteasome subunit beta type-6-like [Sesamum indicum]
Length=236

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/38 (95%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP+TVKVAANLVRLL+YNN
Sbjct  68   QIVSDYVRYFLHQHTIQLGQPSTVKVAANLVRLLSYNN  105



>ref|XP_011077665.1| PREDICTED: proteasome subunit beta type-6 [Sesamum indicum]
Length=234

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/38 (95%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP+TVKVAANLVRLL+YNN
Sbjct  66   QIVSDYVRYFLHQHTIQLGQPSTVKVAANLVRLLSYNN  103



>emb|CDP12496.1| unnamed protein product [Coffea canephora]
Length=236

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN
Sbjct  68   QTISDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  105



>gb|AGZ15417.1| proteasome subunit beta type-6 [Phaseolus vulgaris]
Length=234

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  67   QVVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  104



>ref|XP_003522675.1| PREDICTED: proteasome subunit beta type-6 [Glycine max]
 gb|KHN10255.1| Proteasome subunit beta type-6 [Glycine soja]
Length=233

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  67   QIVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  104



>gb|KHN18228.1| Proteasome subunit beta type-6 [Glycine soja]
Length=233

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANLVRLLAYNN
Sbjct  67   QIVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLAYNN  104



>ref|NP_001236436.1| uncharacterized protein LOC100305513 [Glycine max]
 gb|ACU13218.1| unknown [Glycine max]
Length=233

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANLVRLLAYNN
Sbjct  67   QIVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLAYNN  104



>gb|KDP33416.1| hypothetical protein JCGZ_06987 [Jatropha curcas]
Length=231

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  63   QIVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  100



>ref|XP_007137144.1| hypothetical protein PHAVU_009G103400g [Phaseolus vulgaris]
 gb|AGV54442.1| proteasome subunit beta type-6-like protein [Phaseolus vulgaris]
 gb|ESW09138.1| hypothetical protein PHAVU_009G103400g [Phaseolus vulgaris]
Length=233

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  67   QVVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  104



>ref|XP_002527995.1| proteasome subunit beta type 6,9, putative [Ricinus communis]
 gb|EEF34407.1| proteasome subunit beta type 6,9, putative [Ricinus communis]
Length=231

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANLVRL++YNN
Sbjct  63   QIVSDYVRYFLHQHTIQLGQPATVKVAANLVRLISYNN  100



>ref|XP_008445064.1| PREDICTED: proteasome subunit beta type-6 [Cucumis melo]
Length=176

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVR+FLHQHTIQLGQP TVKVAANLVRLLAYNN
Sbjct  67   QIVSDYVRHFLHQHTIQLGQPATVKVAANLVRLLAYNN  104



>ref|XP_007011513.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY29132.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=235

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANL+RLL+YNN
Sbjct  67   QIVSDYVRYFLHQHTIQLGQPATVKVAANLIRLLSYNN  104



>ref|XP_009618094.1| PREDICTED: proteasome subunit beta type-6-like [Nicotiana tomentosiformis]
Length=236

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  68   QVVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  105



>ref|XP_009783268.1| PREDICTED: proteasome subunit beta type-6-like [Nicotiana sylvestris]
Length=236

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  68   QVVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  105



>gb|KDP32135.1| hypothetical protein JCGZ_12596 [Jatropha curcas]
Length=231

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  63   QIVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  100



>gb|KDO67174.1| hypothetical protein CISIN_1g026587mg [Citrus sinensis]
Length=171

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  68   QTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  105



>gb|EYU25752.1| hypothetical protein MIMGU_mgv1a012906mg [Erythranthe guttata]
Length=236

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRY+LHQHTIQLGQP+TVKVAANLVRL+AYNN
Sbjct  68   QIVSDYVRYYLHQHTIQLGQPSTVKVAANLVRLVAYNN  105



>gb|ACV52586.1| proteasome subunit beta type-6 precursor [Nicotiana benthamiana]
Length=175

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  34   QVVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  71



>ref|XP_003603570.1| Proteasome subunit beta type [Medicago truncatula]
 gb|ACJ84027.1| unknown [Medicago truncatula]
 gb|AES73821.1| proteasome subunit beta protein [Medicago truncatula]
 gb|AFK47451.1| unknown [Medicago truncatula]
Length=232

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAANLVRLLAYNN
Sbjct  66   QVVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLAYNN  103



>ref|XP_007011514.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 2, partial [Theobroma cacao]
 gb|EOY29133.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 2, partial [Theobroma cacao]
Length=226

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANL+RLL+YNN
Sbjct  67   QIVSDYVRYFLHQHTIQLGQPATVKVAANLIRLLSYNN  104



>gb|KDO67175.1| hypothetical protein CISIN_1g026587mg [Citrus sinensis]
Length=184

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  16   QTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  53



>ref|XP_004501214.1| PREDICTED: proteasome subunit beta type-6-like [Cicer arietinum]
Length=233

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAANLVRLLAYNN
Sbjct  67   QVVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLAYNN  104



>ref|XP_010927181.1| PREDICTED: proteasome subunit beta type-6-like [Elaeis guineensis]
Length=278

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+Y N
Sbjct  110  QIVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYQN  147



>emb|CBI20801.3| unnamed protein product [Vitis vinifera]
Length=223

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANLVRL++YNN
Sbjct  55   QIVSDYVRYFLHQHTIQLGQPATVKVAANLVRLVSYNN  92



>gb|ACF74359.1| threonine endopeptidase [Arachis hypogaea]
Length=161

 Score = 77.0 bits (188),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  63   QVVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  100



>ref|XP_004138776.1| PREDICTED: proteasome subunit beta type-6-like [Cucumis sativus]
 ref|XP_004160837.1| PREDICTED: proteasome subunit beta type-6-like [Cucumis sativus]
 gb|KGN62849.1| hypothetical protein Csa_2G377360 [Cucumis sativus]
Length=235

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAANLVRLLAY+N
Sbjct  67   QVVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLAYSN  104



>ref|XP_009798527.1| PREDICTED: proteasome subunit beta type-6 [Nicotiana sylvestris]
Length=234

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANL RLL+YNN
Sbjct  66   QIVSDYVRYFLHQHTIQLGQPATVKVAANLTRLLSYNN  103



>ref|XP_006655771.1| PREDICTED: proteasome subunit beta type-6-like [Oryza brachyantha]
Length=246

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  78   QVISDYVRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  115



>ref|XP_006450098.1| hypothetical protein CICLE_v10009349mg [Citrus clementina]
 ref|XP_006483634.1| PREDICTED: proteasome subunit beta type-6-like [Citrus sinensis]
 gb|ESR63338.1| hypothetical protein CICLE_v10009349mg [Citrus clementina]
 gb|KDO67173.1| hypothetical protein CISIN_1g026587mg [Citrus sinensis]
Length=236

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  68   QTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  105



>gb|EMS49952.1| Proteasome subunit beta type-6 [Triticum urartu]
Length=244

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QI+SDYVRYFLHQHTIQLGQP TVKVA+NLVRLLAY N
Sbjct  76   QIISDYVRYFLHQHTIQLGQPATVKVASNLVRLLAYQN  113



>dbj|BAJ96616.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=246

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QI+SDYVRYFLHQHTIQLGQP TVKVA+NLVRLLAY N
Sbjct  78   QIISDYVRYFLHQHTIQLGQPATVKVASNLVRLLAYQN  115



>sp|P93395.1|PSB6_TOBAC RecName: Full=Proteasome subunit beta type-6; AltName: Full=Proteasome 
delta chain; AltName: Full=Tobacco cryptogein-induced 
protein 7; Short=tcI 7; Flags: Precursor [Nicotiana tabacum]
 emb|CAA70699.1| proteasome delta subunit [Nicotiana tabacum]
Length=234

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANL RLL+YNN
Sbjct  66   QIVSDYVRYFLHQHTIQLGQPATVKVAANLTRLLSYNN  103



>ref|XP_002283195.1| PREDICTED: proteasome subunit beta type-6 [Vitis vinifera]
Length=231

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANLVRL++YNN
Sbjct  63   QIVSDYVRYFLHQHTIQLGQPATVKVAANLVRLVSYNN  100



>ref|XP_006647970.1| PREDICTED: proteasome subunit beta type-6-like [Oryza brachyantha]
Length=246

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  78   QVISDYVRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  115



>ref|XP_009621050.1| PREDICTED: proteasome subunit beta type-6 [Nicotiana tomentosiformis]
Length=234

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANL RLL+YNN
Sbjct  66   QIVSDYVRYFLHQHTIQLGQPATVKVAANLTRLLSYNN  103



>dbj|BAJ90589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=244

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QI+SDYVRYFLHQHTIQLGQP TVKVA+NLVRLLAY N
Sbjct  76   QIISDYVRYFLHQHTIQLGQPATVKVASNLVRLLAYQN  113



>gb|KHG26672.1| Proteasome subunit beta type-6 -like protein [Gossypium arboreum]
Length=235

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKVAANL+RLL+YNN
Sbjct  67   QIVSDYVRYFLHQHTIQLGQPATVKVAANLIRLLSYNN  104



>gb|AFK48953.1| unknown [Lotus japonicus]
Length=160

 Score = 76.6 bits (187),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  67   QVVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  104



>gb|KCW80738.1| hypothetical protein EUGRSUZ_C02133 [Eucalyptus grandis]
Length=171

 Score = 76.6 bits (187),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVAANLVRL++YNN
Sbjct  68   QVLSDYVRYFLHQHTIQLGQPATVKVAANLVRLISYNN  105



>ref|XP_006412608.1| hypothetical protein EUTSA_v10026126mg [Eutrema salsugineum]
 gb|ESQ54061.1| hypothetical protein EUTSA_v10026126mg [Eutrema salsugineum]
Length=237

 Score = 77.4 bits (189),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV+ANL+R+LAYNN
Sbjct  69   QVVSDYVRYFLHQHTIQLGQPATVKVSANLIRMLAYNN  106



>ref|NP_001048247.1| Os02g0770000 [Oryza sativa Japonica Group]
 dbj|BAA96834.1| beta 1 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAD16916.1| beta 1 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF10161.1| Os02g0770000 [Oryza sativa Japonica Group]
 gb|EAY87680.1| hypothetical protein OsI_09094 [Oryza sativa Indica Group]
 gb|EAZ24757.1| hypothetical protein OsJ_08530 [Oryza sativa Japonica Group]
 dbj|BAG96076.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96738.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87159.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score = 77.4 bits (189),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  78   QVISDYVRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  115



>gb|AFK42116.1| unknown [Lotus japonicus]
Length=233

 Score = 77.4 bits (189),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  67   QVVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  104



>ref|XP_004981513.1| PREDICTED: proteasome subunit beta type-6-like [Setaria italica]
Length=245

 Score = 77.4 bits (189),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  77   QVISDYVRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  114



>gb|AAS01049.1| putative proteasome 20S beta1.1 subunit [Brassica napus]
Length=172

 Score = 76.6 bits (187),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV+ANL+R+LAYNN
Sbjct  34   QVVSDYVRYFLHQHTIQLGQPATVKVSANLIRMLAYNN  71



>gb|AAS01048.1| putative proteasome 20S beta1 subunit, partial [Brassica napus]
Length=175

 Score = 76.6 bits (187),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV+ANL+R+LAYNN
Sbjct  34   QVVSDYVRYFLHQHTIQLGQPATVKVSANLIRMLAYNN  71



>gb|AAY43812.1| beta1 proteasome-1D [Aegilops tauschii]
Length=244

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVA+NLVRLLAY N
Sbjct  76   QVISDYVRYFLHQHTIQLGQPATVKVASNLVRLLAYQN  113



>gb|AAY43813.1| beta1 proteasome-7D [Aegilops tauschii]
 gb|AAY43814.1| beta1 proteasome-7D [Aegilops tauschii]
Length=246

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVA+NLVRLLAY N
Sbjct  78   QVISDYVRYFLHQHTIQLGQPATVKVASNLVRLLAYQN  115



>gb|EMT05271.1| Proteasome subunit beta type-6 [Aegilops tauschii]
Length=250

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVA+NLVRLLAY N
Sbjct  78   QVISDYVRYFLHQHTIQLGQPATVKVASNLVRLLAYQN  115



>gb|ACG36246.1| proteasome subunit beta type 6 precursor [Zea mays]
 gb|AFW85939.1| proteasome subunit beta type [Zea mays]
Length=243

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDY+RYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  75   QVISDYIRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  112



>ref|XP_011017616.1| PREDICTED: proteasome subunit beta type-6 [Populus euphratica]
Length=237

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  69   QTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  106



>ref|XP_002437793.1| hypothetical protein SORBIDRAFT_10g002700 [Sorghum bicolor]
 gb|EER89160.1| hypothetical protein SORBIDRAFT_10g002700 [Sorghum bicolor]
Length=245

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  77   QVISDYVRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  114



>ref|XP_002444629.1| hypothetical protein SORBIDRAFT_07g025030 [Sorghum bicolor]
 gb|EES14124.1| hypothetical protein SORBIDRAFT_07g025030 [Sorghum bicolor]
Length=245

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  77   QVISDYVRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  114



>ref|XP_008647302.1| PREDICTED: uncharacterized protein LOC100191806 isoform X1 [Zea 
mays]
 gb|ACF84736.1| unknown [Zea mays]
 gb|ACF84786.1| unknown [Zea mays]
 gb|AFW75459.1| proteasome subunit beta type [Zea mays]
Length=244

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  76   QVISDYVRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  113



>gb|ADG86642.1| 20S proteasome subunit PBA1 [Populus tomentosa]
Length=237

 Score = 77.0 bits (188),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+YNN
Sbjct  69   QTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNN  106



>ref|XP_010048490.1| PREDICTED: proteasome subunit beta type-6 [Eucalyptus grandis]
 gb|KCW80737.1| hypothetical protein EUGRSUZ_C02133 [Eucalyptus grandis]
Length=236

 Score = 77.0 bits (188),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVAANLVRL++YNN
Sbjct  68   QVLSDYVRYFLHQHTIQLGQPATVKVAANLVRLISYNN  105



>ref|XP_006284457.1| hypothetical protein CARUB_v10005646mg [Capsella rubella]
 ref|XP_006412609.1| hypothetical protein EUTSA_v10026126mg [Eutrema salsugineum]
 ref|XP_006412610.1| hypothetical protein EUTSA_v10026126mg [Eutrema salsugineum]
 ref|XP_009108934.1| PREDICTED: proteasome subunit beta type-6 [Brassica rapa]
 gb|EOA17355.1| hypothetical protein CARUB_v10005646mg [Capsella rubella]
 gb|ESQ54062.1| hypothetical protein EUTSA_v10026126mg [Eutrema salsugineum]
 gb|ESQ54063.1| hypothetical protein EUTSA_v10026126mg [Eutrema salsugineum]
 emb|CDY28254.1| BnaA01g05950D [Brassica napus]
 emb|CDY23291.1| BnaA08g12550D [Brassica napus]
 emb|CDX68732.1| BnaC01g07210D [Brassica napus]
Length=233

 Score = 77.0 bits (188),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV+ANL+R+LAYNN
Sbjct  65   QVVSDYVRYFLHQHTIQLGQPATVKVSANLIRMLAYNN  102



>emb|CDY36450.1| BnaC03g67700D [Brassica napus]
Length=233

 Score = 77.0 bits (188),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV+ANL+R+LAYNN
Sbjct  65   QVVSDYVRYFLHQHTIQLGQPATVKVSANLIRMLAYNN  102



>ref|XP_006284458.1| hypothetical protein CARUB_v10005646mg [Capsella rubella]
 gb|EOA17356.1| hypothetical protein CARUB_v10005646mg [Capsella rubella]
Length=175

 Score = 76.3 bits (186),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV+ANL+R+LAYNN
Sbjct  65   QVVSDYVRYFLHQHTIQLGQPATVKVSANLIRMLAYNN  102



>ref|XP_009127104.1| PREDICTED: proteasome subunit beta type-6 [Brassica rapa]
Length=233

 Score = 76.6 bits (187),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV+ANL+R+LAYNN
Sbjct  65   QVVSDYVRYFLHQHTIQLGQPATVKVSANLIRMLAYNN  102



>gb|KFK29711.1| hypothetical protein AALP_AA7G169100 [Arabis alpina]
Length=233

 Score = 76.6 bits (187),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV+ANL+R+LAYNN
Sbjct  65   QVVSDYVRYFLHQHTIQLGQPATVKVSANLIRMLAYNN  102



>ref|XP_002869337.1| hypothetical protein ARALYDRAFT_328593 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45596.1| hypothetical protein ARALYDRAFT_328593 [Arabidopsis lyrata subsp. 
lyrata]
Length=234

 Score = 76.6 bits (187),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV+ANL+R+LAYNN
Sbjct  65   QVVSDYVRYFLHQHTIQLGQPATVKVSANLIRMLAYNN  102



>ref|XP_009401308.1| PREDICTED: proteasome subunit beta type-6 [Musa acuminata subsp. 
malaccensis]
Length=233

 Score = 76.6 bits (187),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP+TVKVAANLVRLL+Y N
Sbjct  65   QVISDYVRYFLHQHTIQLGQPSTVKVAANLVRLLSYQN  102



>ref|XP_006360655.1| PREDICTED: proteasome subunit beta type-6-like [Solanum tuberosum]
Length=236

 Score = 76.6 bits (187),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QI+SDYVRYFLHQHTIQLGQP TVKVAANL RLL+YNN
Sbjct  68   QIISDYVRYFLHQHTIQLGQPATVKVAANLARLLSYNN  105



>ref|XP_008658225.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=316

 Score = 77.4 bits (189),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDY+RYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  148  QVISDYIRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  185



>gb|EMT09173.1| Proteasome subunit beta type-6 [Aegilops tauschii]
Length=237

 Score = 76.6 bits (187),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVA+NLVRLLAY N
Sbjct  69   QVISDYVRYFLHQHTIQLGQPATVKVASNLVRLLAYQN  106



>ref|XP_010112139.1| Proteasome subunit beta type-6 [Morus notabilis]
 gb|EXC32764.1| Proteasome subunit beta type-6 [Morus notabilis]
Length=245

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQ GQP TVKVAANLVRLL+YNN
Sbjct  69   QIVSDYVRYFLHQHTIQQGQPATVKVAANLVRLLSYNN  106



>emb|CDX72300.1| BnaC07g43220D [Brassica napus]
Length=233

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV+ANL+R+LAYNN
Sbjct  65   QVVSDYVRYFLHQHTIQLGQPATVKVSANLIRMLAYNN  102



>ref|XP_009138000.1| PREDICTED: proteasome subunit beta type-6-like [Brassica rapa]
 ref|XP_009138001.1| PREDICTED: proteasome subunit beta type-6-like [Brassica rapa]
 emb|CDY13421.1| BnaA03g51390D [Brassica napus]
Length=233

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV+ANL+R+LAYNN
Sbjct  65   QVVSDYVRYFLHQHTIQLGQPATVKVSANLIRMLAYNN  102



>ref|XP_006372204.1| 20S proteasome beta subunit A family protein [Populus trichocarpa]
 gb|ABK94336.1| unknown [Populus trichocarpa]
 gb|ERP50001.1| 20S proteasome beta subunit A family protein [Populus trichocarpa]
Length=237

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q VSDYVRYFLHQHTIQLGQP TVKVAANLVR+L+YNN
Sbjct  69   QTVSDYVRYFLHQHTIQLGQPATVKVAANLVRMLSYNN  106



>ref|XP_010264033.1| PREDICTED: proteasome subunit beta type-6-like [Nelumbo nucifera]
Length=233

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFL QHTIQLGQP TVKVAANL+RLL+YNN
Sbjct  65   QIVSDYVRYFLQQHTIQLGQPATVKVAANLIRLLSYNN  102



>ref|NP_001130703.1| uncharacterized protein LOC100191806 [Zea mays]
 gb|ACF79027.1| unknown [Zea mays]
 gb|AFW75458.1| hypothetical protein ZEAMMB73_794961 [Zea mays]
Length=155

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  76   QVISDYVRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  113



>ref|XP_010243992.1| PREDICTED: proteasome subunit beta type-6 [Nelumbo nucifera]
Length=233

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQ GQP TVKVAANL+RLL+YNN
Sbjct  65   QVVSDYVRYFLHQHTIQSGQPATVKVAANLIRLLSYNN  102



>ref|NP_001056748.1| Os06g0139900 [Oryza sativa Japonica Group]
 dbj|BAD68674.1| putative beta 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 dbj|BAF18662.1| Os06g0139900 [Oryza sativa Japonica Group]
 gb|EAY99586.1| hypothetical protein OsI_21564 [Oryza sativa Indica Group]
 gb|EAZ35771.1| hypothetical protein OsJ_20062 [Oryza sativa Japonica Group]
 dbj|BAG96457.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++S+YVRYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  78   QVISEYVRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  115



>ref|XP_009409586.1| PREDICTED: proteasome subunit beta type-6-like [Musa acuminata 
subsp. malaccensis]
Length=234

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQLGQP TVKVAANLVRLL+Y N
Sbjct  65   QVISDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYQN  102



>gb|ACF83694.1| unknown [Zea mays]
Length=395

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDY+RYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  227  QVISDYIRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  264



>ref|XP_009362017.1| PREDICTED: proteasome subunit beta type-6-like [Pyrus x bretschneideri]
Length=239

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVR+FLHQHTIQLGQP TVKVAANL+RL AYNN
Sbjct  69   QIVSDYVRHFLHQHTIQLGQPATVKVAANLIRLFAYNN  106



>ref|XP_008378136.1| PREDICTED: proteasome subunit beta type-6 [Malus domestica]
Length=236

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV ANLVRLL+Y N
Sbjct  68   QVVSDYVRYFLHQHTIQLGQPATVKVCANLVRLLSYGN  105



>gb|ABK21503.1| unknown [Picea sitchensis]
Length=233

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQH IQLGQP TVKV ANL+RLL+YNN
Sbjct  66   QVVSDYVRYFLHQHIIQLGQPATVKVTANLIRLLSYNN  103



>gb|EYU26558.1| hypothetical protein MIMGU_mgv1a012922mg [Erythranthe guttata]
Length=236

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVR++LHQHTIQLGQP+TVKVAANLVRL+AY N
Sbjct  68   QIVSDYVRFYLHQHTIQLGQPSTVKVAANLVRLVAYGN  105



>gb|ABK21850.1| unknown [Picea sitchensis]
Length=233

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQH IQLGQP TVKV ANL+RLL+YNN
Sbjct  66   QVVSDYVRYFLHQHIIQLGQPATVKVTANLIRLLSYNN  103



>ref|XP_008798167.1| PREDICTED: proteasome subunit beta type-6 [Phoenix dactylifera]
Length=233

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQP TVKV ANLVRLL+Y N
Sbjct  65   QIVSDYVRYFLHQHTIQLGQPATVKVVANLVRLLSYQN  102



>ref|XP_002309021.1| 20S proteasome beta subunit A family protein [Populus trichocarpa]
 gb|EEE92544.1| 20S proteasome beta subunit A family protein [Populus trichocarpa]
Length=237

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+Y+N
Sbjct  69   QTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYSN  106



>ref|XP_011019969.1| PREDICTED: proteasome subunit beta type-6-like [Populus euphratica]
Length=237

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+Y+N
Sbjct  69   QTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYSN  106



>ref|NP_001281104.1| hypothetical protein [Zea mays]
 gb|ACF86620.1| unknown [Zea mays]
 gb|AFW85940.1| hypothetical protein ZEAMMB73_018202 [Zea mays]
Length=216

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDY+RYFLHQHTIQLGQP TVKVAANL+RLLAY N
Sbjct  48   QVISDYIRYFLHQHTIQLGQPATVKVAANLIRLLAYQN  85



>ref|XP_004964490.1| PREDICTED: proteasome subunit beta type-6-like [Setaria italica]
Length=245

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQ GQP TVKVAANL+RLLAY N
Sbjct  77   QVISDYVRYFLHQHTIQAGQPATVKVAANLIRLLAYQN  114



>gb|EMS68047.1| Proteasome subunit beta type-6 [Triticum urartu]
Length=223

 Score = 75.1 bits (183),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QI+SDYVRYFLHQHTIQLGQP TVKVA+NLVRLLAY N
Sbjct  30   QIISDYVRYFLHQHTIQLGQPATVKVASNLVRLLAYQN  67



>ref|XP_009375732.1| PREDICTED: proteasome subunit beta type-6 [Pyrus x bretschneideri]
Length=236

 Score = 75.1 bits (183),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV ANLVRLL+Y N
Sbjct  68   QVVSDYVRYFLHQHTIQLGQPATVKVCANLVRLLSYGN  105



>ref|XP_004291266.1| PREDICTED: proteasome subunit beta type-6-like [Fragaria vesca 
subsp. vesca]
Length=240

 Score = 75.1 bits (183),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVR+FLHQHTIQLGQP TVKVAANL+RLL+Y N
Sbjct  71   QVVSDYVRHFLHQHTIQLGQPATVKVAANLIRLLSYGN  108



>ref|XP_008341147.1| PREDICTED: proteasome subunit beta type-6-like [Malus domestica]
Length=239

 Score = 74.7 bits (182),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVR+FLHQHTIQLGQP TVKVAANL+RL +YNN
Sbjct  69   QIVSDYVRHFLHQHTIQLGQPATVKVAANLIRLFSYNN  106



>ref|XP_008391416.1| PREDICTED: proteasome subunit beta type-6-like [Malus domestica]
Length=239

 Score = 74.7 bits (182),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVR+FLHQHTIQLGQP TVKVAANL+RL +YNN
Sbjct  69   QIVSDYVRHFLHQHTIQLGQPATVKVAANLIRLFSYNN  106



>ref|XP_010548529.1| PREDICTED: proteasome subunit beta type-6 [Tarenaya hassleriana]
Length=233

 Score = 74.7 bits (182),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVR+FLHQHTIQLGQP TVKVAANL+RLL+Y+N
Sbjct  65   QVVSDYVRHFLHQHTIQLGQPATVKVAANLIRLLSYSN  102



>ref|XP_010432880.1| PREDICTED: proteasome subunit beta type-6 [Camelina sativa]
 ref|XP_010438056.1| PREDICTED: proteasome subunit beta type-6 [Camelina sativa]
 ref|XP_010447590.1| PREDICTED: proteasome subunit beta type-6 [Camelina sativa]
Length=233

 Score = 74.7 bits (182),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQ GQP TVKV+ANL+R+LAYNN
Sbjct  65   QVVSDYVRYFLHQHTIQQGQPATVKVSANLIRMLAYNN  102



>gb|ABL85039.1| proteasome [Brachypodium sylvaticum]
Length=242

 Score = 74.7 bits (182),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQ GQP TVKVA+NLVRLLAY N
Sbjct  74   QVISDYVRYFLHQHTIQSGQPATVKVASNLVRLLAYQN  111



>ref|XP_003557219.1| PREDICTED: proteasome subunit beta type-6 [Brachypodium distachyon]
Length=242

 Score = 74.3 bits (181),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRYFLHQHTIQ GQP TVKVA+NLVRLLAY N
Sbjct  74   QVISDYVRYFLHQHTIQSGQPATVKVASNLVRLLAYQN  111



>ref|XP_007223858.1| hypothetical protein PRUPE_ppa010791mg [Prunus persica]
 gb|EMJ25057.1| hypothetical protein PRUPE_ppa010791mg [Prunus persica]
Length=236

 Score = 74.3 bits (181),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV ANLVRLL+Y N
Sbjct  67   QVVSDYVRYFLHQHTIQLGQPATVKVCANLVRLLSYGN  104



>ref|XP_008393922.1| PREDICTED: proteasome subunit beta type-6 [Malus domestica]
Length=237

 Score = 74.3 bits (181),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKV ANLVRLL+Y N
Sbjct  68   QVVSDYVRYFLHQHTIQLGQPATVKVCANLVRLLSYGN  105



>ref|XP_006381167.1| hypothetical protein POPTR_0006s07750g [Populus trichocarpa]
 gb|ABK92997.1| unknown [Populus trichocarpa]
 gb|ERP58964.1| hypothetical protein POPTR_0006s07750g [Populus trichocarpa]
Length=227

 Score = 74.3 bits (181),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q VSDYVRYFLHQHTIQLGQP TVKVAANLVRLL+Y+N
Sbjct  69   QTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYSN  106



>ref|XP_002266488.1| PREDICTED: proteasome subunit beta type-6 [Vitis vinifera]
 emb|CBI24056.3| unnamed protein product [Vitis vinifera]
Length=232

 Score = 74.3 bits (181),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QI+SDYVRY+LHQHTIQLGQP TVKVAANLVRL++YNN
Sbjct  64   QILSDYVRYYLHQHTIQLGQPATVKVAANLVRLISYNN  101



>ref|XP_008352161.1| PREDICTED: proteasome subunit beta type-6-like, partial [Malus 
domestica]
Length=112

 Score = 72.0 bits (175),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVK  ANLVRLL+Y N
Sbjct  68   QVVSDYVRYFLHQHTIQLGQPATVKXCANLVRLLSYGN  105



>ref|XP_006365635.1| PREDICTED: proteasome subunit beta type-6-like [Solanum tuberosum]
Length=236

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAA+LVR ++YNN
Sbjct  68   QVVSDYVRYFLHQHTIQLGQPATVKVAASLVRQISYNN  105



>ref|XP_008219976.1| PREDICTED: proteasome subunit beta type-6 [Prunus mume]
Length=236

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLG+P TVKV ANLVRLL+Y N
Sbjct  67   QVVSDYVRYFLHQHTIQLGEPATVKVCANLVRLLSYGN  104



>ref|XP_006850958.1| hypothetical protein AMTR_s00025p00199560 [Amborella trichopoda]
 gb|ERN12539.1| hypothetical protein AMTR_s00025p00199560 [Amborella trichopoda]
Length=229

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRY+LHQHTIQLGQP TVKV ANL+RLL+Y N
Sbjct  65   QVVSDYVRYYLHQHTIQLGQPATVKVTANLIRLLSYQN  102



>ref|NP_194858.1| 20S proteasome subunit PBA1 [Arabidopsis thaliana]
 ref|NP_001190879.1| 20S proteasome subunit PBA1 [Arabidopsis thaliana]
 sp|Q8LD27.2|PSB6_ARATH RecName: Full=Proteasome subunit beta type-6; AltName: Full=20S 
proteasome beta subunit A-1; AltName: Full=Proteasome component 
D; AltName: Full=Proteasome subunit beta type-1; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAA74028.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 emb|CAA16533.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAC32065.1| 20S proteasome subunit PBA1 [Arabidopsis thaliana]
 emb|CAB79848.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAK96545.1| AT4g31300/F8F16_120 [Arabidopsis thaliana]
 gb|AAL15414.1| AT4g31300/F8F16_120 [Arabidopsis thaliana]
 gb|AEE85887.1| 20S proteasome subunit PBA1 [Arabidopsis thaliana]
 gb|AEE85889.1| 20S proteasome subunit PBA1 [Arabidopsis thaliana]
Length=233

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQ GQP TVKV+ANL+R+LAYNN
Sbjct  65   QVVSDYVRYFLHQHTIQHGQPATVKVSANLIRMLAYNN  102



>ref|XP_004242886.1| PREDICTED: proteasome subunit beta type-6 [Solanum lycopersicum]
Length=236

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQLGQP TVKVAA+L+R ++YNN
Sbjct  68   QVVSDYVRYFLHQHTIQLGQPATVKVAASLIRQISYNN  105



>ref|NP_001031759.1| 20S proteasome subunit PBA1 [Arabidopsis thaliana]
 gb|AEE85888.1| 20S proteasome subunit PBA1 [Arabidopsis thaliana]
Length=234

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFLHQHTIQ GQP TVKV+ANL+R+LAYNN
Sbjct  65   QVVSDYVRYFLHQHTIQHGQPATVKVSANLIRMLAYNN  102



>gb|KHG17465.1| Proteasome subunit beta type-6 -like protein [Gossypium arboreum]
Length=235

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVRYFLHQHTIQLGQ  T KVAANL+RLL+YNN
Sbjct  67   QIVSDYVRYFLHQHTIQLGQSATSKVAANLIRLLSYNN  104



>ref|XP_010525862.1| PREDICTED: proteasome subunit beta type-6-like [Tarenaya hassleriana]
Length=233

 Score = 71.6 bits (174),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVR+ LHQHTIQ+GQP TVKVAANL+RLL+YNN
Sbjct  65   QVVSDYVRHSLHQHTIQMGQPATVKVAANLIRLLSYNN  102



>ref|XP_008223953.1| PREDICTED: proteasome subunit beta type-6-like [Prunus mume]
Length=237

 Score = 71.6 bits (174),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVR+FLHQHTIQ GQP TVKVAANL+RL AYNN
Sbjct  69   QVLSDYVRHFLHQHTIQQGQPATVKVAANLIRLFAYNN  106



>gb|AAM64316.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
Length=223

 Score = 71.2 bits (173),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVR+FLHQHTIQ GQP TVKV+ANL+R+LAYNN
Sbjct  55   QVVSDYVRHFLHQHTIQHGQPATVKVSANLIRMLAYNN  92



>ref|XP_007226082.1| hypothetical protein PRUPE_ppa010747mg [Prunus persica]
 gb|EMJ27281.1| hypothetical protein PRUPE_ppa010747mg [Prunus persica]
Length=237

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVR+FLHQHTIQ GQP TVKVAANL+RL AYNN
Sbjct  69   QVLSDYVRHFLHQHTIQQGQPATVKVAANLIRLFAYNN  106



>gb|EPS62624.1| hypothetical protein M569_12165, partial [Genlisea aurea]
Length=201

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVR +LHQH IQLGQP TVK AAN+VRLL+Y N
Sbjct  66   QIVSDYVRLYLHQHIIQLGQPATVKSAANVVRLLSYGN  103



>ref|XP_002969356.1| hypothetical protein SELMODRAFT_227897 [Selaginella moellendorffii]
 gb|EFJ29444.1| hypothetical protein SELMODRAFT_227897 [Selaginella moellendorffii]
Length=239

 Score = 60.1 bits (144),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRY LHQHTI LG+  TVK AA LVR +AY+N
Sbjct  70   QVISDYVRYLLHQHTIVLGEQATVKAAAKLVREIAYSN  107



>ref|XP_002970688.1| hypothetical protein SELMODRAFT_227995 [Selaginella moellendorffii]
 gb|EFJ28014.1| hypothetical protein SELMODRAFT_227995 [Selaginella moellendorffii]
Length=239

 Score = 60.1 bits (144),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q++SDYVRY LHQHTI LG+  TVK AA LVR +AY+N
Sbjct  70   QVISDYVRYLLHQHTIVLGEQATVKAAAKLVREIAYSN  107



>ref|XP_001752251.1| predicted protein [Physcomitrella patens]
 gb|EDQ82984.1| predicted protein [Physcomitrella patens]
Length=224

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q+VSDYVRYFL+QHTI LG+  TVK A+ LV+ L+Y N
Sbjct  66   QVVSDYVRYFLNQHTILLGRLATVKTASTLVKELSYQN  103



>ref|XP_005767405.1| hypothetical protein EMIHUDRAFT_432777 [Emiliania huxleyi CCMP1516]
 gb|EOD14976.1| hypothetical protein EMIHUDRAFT_432777 [Emiliania huxleyi CCMP1516]
Length=241

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q VSDYVRYFL QH ++ GQP  V  AANL ++L Y N
Sbjct  95   QAVSDYVRYFLDQHRMEYGQPPKVATAANLFQMLCYQN  132



>ref|XP_009794691.1| PREDICTED: proteasome subunit beta type-6-like [Nicotiana sylvestris]
Length=223

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 4/38 (11%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QIVSDYVR+      IQLGQPTTV+ AAN V  L+YNN
Sbjct  61   QIVSDYVRHL----RIQLGQPTTVRSAANFVSSLSYNN  94



>gb|KDD76412.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=225

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q V+DYVRYFL QH   L +P++V  AANLV+ + Y N
Sbjct  70   QAVADYVRYFLEQHESSLQRPSSVLTAANLVKEMNYQN  107



>ref|XP_009032940.1| hypothetical protein AURANDRAFT_52186 [Aureococcus anophagefferens]
 gb|EGB11816.1| hypothetical protein AURANDRAFT_52186 [Aureococcus anophagefferens]
Length=236

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q VSDYVR++L  H I++G+P  VK AANL + + Y N
Sbjct  74   QAVSDYVRHYLGSHAIEVGKPPLVKTAANLAKRICYTN  111



>emb|CBJ30643.1| conserved unknown protein [Ectocarpus siliculosus]
Length=218

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q ++DYVRYFL  H+++LG+   VK AA + R L YNN
Sbjct  73   QAITDYVRYFLASHSVELGRLPLVKTAAKMARGLCYNN  110



>dbj|GAM21853.1| hypothetical protein SAMD00019534_050280, partial [Acytostelium 
subglobosum LB1]
Length=213

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRY+L  H  +LG+   VK AA+L +LL YNN
Sbjct  67   QAISDYVRYYLEIHNSELGEDPEVKTAASLFQLLCYNN  104



>emb|CCI46756.1| unnamed protein product [Albugo candida]
Length=216

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRYFL  H++ +G+   V  AANL R L YNN
Sbjct  71   QALSDYVRYFLSSHSLDVGKLPKVHTAANLFRSLCYNN  108



>emb|CCA15808.1| proteasome subunit beta type6 putative [Albugo laibachii Nc14]
Length=216

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRYFL  H++ +G+   V  AANL R L YNN
Sbjct  71   QALSDYVRYFLSSHSLDVGKLPKVHTAANLFRSLCYNN  108



>ref|XP_005712113.1| Proteasome subunit beta type [Chondrus crispus]
 emb|CDF32448.1| Proteasome subunit beta type [Chondrus crispus]
Length=216

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QI+SDYVRY+L  H I+LG+   V  AA L R L Y+N
Sbjct  69   QIISDYVRYYLSMHDIELGEDPDVDTAAKLFRELCYHN  106



>ref|XP_004356133.1| proteasome subunit beta type 6 [Dictyostelium fasciculatum]
 gb|EGG17649.1| proteasome subunit beta type 6 [Dictyostelium fasciculatum]
Length=214

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRY+L  HT +L     VK AA+L +LL YNN
Sbjct  67   QAISDYVRYYLEMHTQELDDQPVVKTAASLFQLLCYNN  104



>ref|XP_002901169.1| proteasome subunit beta type-6, putative [Phytophthora infestans 
T30-4]
 gb|EEY59155.1| proteasome subunit beta type-6, putative [Phytophthora infestans 
T30-4]
Length=218

 Score = 46.6 bits (109),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRY+L  H+++LG+   V  AANL R L Y+N
Sbjct  73   QALSDYVRYYLSSHSVELGRLPKVGTAANLFRSLCYHN  110



>ref|XP_008900536.1| hypothetical protein PPTG_07910 [Phytophthora parasitica INRA-310]
 gb|ETI53752.1| hypothetical protein F443_03356 [Phytophthora parasitica P1569]
 gb|ETK93633.1| hypothetical protein L915_03223 [Phytophthora parasitica]
 gb|ETL47028.1| hypothetical protein L916_03189 [Phytophthora parasitica]
 gb|ETM00126.1| hypothetical protein L917_03124 [Phytophthora parasitica]
 gb|ETM53307.1| hypothetical protein L914_03210 [Phytophthora parasitica]
 gb|ETN14280.1| hypothetical protein PPTG_07910 [Phytophthora parasitica INRA-310]
 gb|ETO82441.1| hypothetical protein F444_03423 [Phytophthora parasitica P1976]
 gb|ETP23561.1| hypothetical protein F441_03340 [Phytophthora parasitica CJ01A1]
 gb|ETP51572.1| hypothetical protein F442_03322 [Phytophthora parasitica P10297]
Length=218

 Score = 46.6 bits (109),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRY+L  H+++LG+   V  AANL R L Y+N
Sbjct  73   QALSDYVRYYLSSHSVELGRLPKVGTAANLFRSLCYHN  110



>ref|XP_002945971.1| hypothetical protein VOLCADRAFT_102928 [Volvox carteri f. nagariensis]
 gb|EFJ52966.1| hypothetical protein VOLCADRAFT_102928 [Volvox carteri f. nagariensis]
Length=223

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q ++ YV++F+ QH  + G   TVK AANLV+++AYNN
Sbjct  68   QAIAGYVQHFIAQHQAEEGDHVTVKTAANLVKMMAYNN  105



>gb|EFA75466.1| hypothetical protein PPL_10970 [Polysphondylium pallidum PN500]
Length=848

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRY+L  H  +LG    VK AA+L +LL YNN
Sbjct  67   QAISDYVRYYLEMHNSELGDDPDVKTAASLFQLLCYNN  104



>ref|XP_004352904.1| beta1 proteasome1D, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR23376.1| beta1 proteasome1D, putative [Acanthamoeba castellanii str. Neff]
Length=217

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q ++DYV++FL+QH+++LG+   V  AANL + L Y N
Sbjct  70   QAIADYVKWFLNQHSVELGEEPEVGTAANLFKQLCYAN  107



>ref|XP_001695298.1| 20S proteasome beta subunit A1 [Chlamydomonas reinhardtii]
 gb|EDP01556.1| 20S proteasome beta subunit A1 [Chlamydomonas reinhardtii]
Length=212

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q ++ YV++F+ QH  + G+   VK AANLV+++AYNN
Sbjct  55   QAIAGYVQHFIAQHQAEEGEHINVKTAANLVKMMAYNN  92



>ref|XP_009520096.1| hypothetical protein PHYSODRAFT_350003, partial [Phytophthora 
sojae]
 gb|EGZ24808.1| hypothetical protein PHYSODRAFT_350003 [Phytophthora sojae]
Length=637

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRY+L  H+++LG+   V  AANL R L Y+N
Sbjct  492  QALSDYVRYYLSSHSVELGRLPKVGTAANLFRSLCYHN  529



>gb|EJK74825.1| hypothetical protein THAOC_03479 [Thalassiosira oceanica]
Length=235

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q ++DYVR++L Q  ++ G+P  VKVAA+L+R L Y N
Sbjct  87   QALTDYVRHYLAQLAVETGRPPEVKVAAHLMRRLCYEN  124



>ref|XP_647188.1| proteasome subunit beta type 6 [Dictyostelium discoideum AX4]
 sp|Q55GJ6.1|PSB6_DICDI RecName: Full=Proteasome subunit beta type-6; AltName: Full=Differentiation-associated 
proteasome subunit 1; Short=DAPS-1; 
Flags: Precursor [Dictyostelium discoideum]
 gb|EAL73147.1| proteasome subunit beta type 6 [Dictyostelium discoideum AX4]
Length=214

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRY+L  HT +L     VK AA+L +LL Y+N
Sbjct  67   QAISDYVRYYLEMHTSELCDEPDVKTAASLFQLLCYSN  104



>ref|XP_003288508.1| proteasome subunit beta type 6 [Dictyostelium purpureum]
 gb|EGC34983.1| proteasome subunit beta type 6 [Dictyostelium purpureum]
Length=207

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRY+L  HT +L     VK AA+L +LL Y+N
Sbjct  60   QAISDYVRYYLEMHTSELCDDPDVKTAASLFQLLCYSN  97



>gb|KFM25126.1| Proteasome subunit beta type-6 [Auxenochlorella protothecoides]
Length=226

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAY  7
            Q VSDYVRYF  QH  QL +P  VK  A ++R + Y
Sbjct  71   QAVSDYVRYFTEQHESQLQRPALVKTVAGMIRSMNY  106



>ref|XP_002907149.1| proteasome subunit beta type-6, putative [Phytophthora infestans 
T30-4]
 gb|EEY63713.1| proteasome subunit beta type-6, putative [Phytophthora infestans 
T30-4]
Length=673

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            Q +SDYVRY+L  H+++LG+   V  AANL R L Y+N
Sbjct  528  QALSDYVRYYLSSHSVELGRLPKVGTAANLFRSLCYHN  565



>ref|XP_002947558.1| hypothetical protein VOLCADRAFT_57026 [Volvox carteri f. nagariensis]
 gb|EFJ51606.1| hypothetical protein VOLCADRAFT_57026 [Volvox carteri f. nagariensis]
Length=242

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  114  QIVSDYVRYFLHQHTIQLGQPTTVKVAANLVRLLAYNN  1
            QI+SD VR++L+    + G+  +V++AANLVRL+ YNN
Sbjct  70   QIISDNVRHYLNHMIAESGEEPSVEMAANLVRLINYNN  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 534389527100