BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9619_g1_i1 len=244 path=[1:0-243]

Length=244
                                                                      Score     E

ref|XP_004248016.1|  PREDICTED: auxin-induced protein PCNT115           150   7e-42   
ref|XP_006358809.1|  PREDICTED: probable aldo-keto reductase 4-li...    149   2e-41   
ref|XP_007034108.1|  NAD(P)-linked oxidoreductase superfamily pro...    149   2e-41   
ref|XP_007034105.1|  NAD(P)-linked oxidoreductase superfamily pro...    149   2e-41   
ref|XP_006358808.1|  PREDICTED: probable aldo-keto reductase 4-li...    149   2e-41   
ref|XP_010326945.1|  PREDICTED: auxin-induced protein PCNT115-like      149   3e-41   
ref|XP_010326948.1|  PREDICTED: auxin-induced protein PCNT115-lik...    148   3e-41   
ref|XP_010326947.1|  PREDICTED: auxin-induced protein PCNT115-lik...    148   5e-41   
ref|XP_009794431.1|  PREDICTED: probable aldo-keto reductase 3 is...    146   5e-41   
ref|XP_007034103.1|  NAD(P)-linked oxidoreductase superfamily pro...    148   9e-41   
ref|XP_009794430.1|  PREDICTED: probable aldo-keto reductase 3 is...    146   1e-40   
emb|CDP10300.1|  unnamed protein product                                147   1e-40   
ref|XP_006423749.1|  hypothetical protein CICLE_v10028769mg             147   1e-40   
emb|CDP10299.1|  unnamed protein product                                147   1e-40   
ref|XP_006423736.1|  hypothetical protein CICLE_v10028766mg             145   2e-40   
emb|CDP10298.1|  unnamed protein product                                146   2e-40   
emb|CDP20356.1|  unnamed protein product                                142   2e-40   
sp|P40691.1|A115_TOBAC  RecName: Full=Auxin-induced protein PCNT115     145   3e-40   Nicotiana tabacum [American tobacco]
ref|XP_009794429.1|  PREDICTED: auxin-induced protein PCNT115-lik...    146   3e-40   
ref|XP_009631784.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    145   3e-40   
ref|XP_009631779.1|  PREDICTED: auxin-induced protein PCNT115-like      145   4e-40   
ref|XP_009784380.1|  PREDICTED: auxin-induced protein PCNT115           145   4e-40   
ref|XP_006423738.1|  hypothetical protein CICLE_v10028781mg             144   5e-40   
ref|XP_010418012.1|  PREDICTED: probable aldo-keto reductase 2          145   6e-40   
gb|KDO50058.1|  hypothetical protein CISIN_1g019303mg                   144   7e-40   
ref|XP_006423737.1|  hypothetical protein CICLE_v10028766mg             145   7e-40   
gb|KHG21132.1|  hypothetical protein F383_07588                         145   8e-40   
ref|XP_009631780.1|  PREDICTED: auxin-induced protein PCNT115-like      145   9e-40   
ref|XP_006487489.1|  PREDICTED: probable aldo-keto reductase 2-like     144   9e-40   
ref|XP_010103734.1|  hypothetical protein L484_016650                   141   9e-40   
ref|XP_009378168.1|  PREDICTED: probable aldo-keto reductase 2          144   9e-40   
gb|ABA26981.1|  TO33-12                                                 137   1e-39   Taraxacum officinale [dandelion]
ref|XP_006358806.1|  PREDICTED: auxin-induced protein PCNT115-lik...    144   1e-39   
ref|XP_006487491.1|  PREDICTED: probable aldo-keto reductase 3-li...    142   2e-39   
ref|XP_007034107.1|  NAD(P)-linked oxidoreductase superfamily pro...    144   2e-39   
ref|XP_006487492.1|  PREDICTED: probable aldo-keto reductase 3-li...    142   2e-39   
gb|KHG15522.1|  hypothetical protein F383_16754                         144   2e-39   
gb|KDO50054.1|  hypothetical protein CISIN_1g019368mg                   142   2e-39   
ref|XP_006423739.1|  hypothetical protein CICLE_v10028781mg             144   2e-39   
ref|XP_007220849.1|  hypothetical protein PRUPE_ppa021725mg             140   2e-39   
emb|CBI39432.3|  unnamed protein product                                140   3e-39   
ref|XP_008380430.1|  PREDICTED: probable aldo-keto reductase 2          143   3e-39   
gb|KDP37897.1|  hypothetical protein JCGZ_05779                         143   3e-39   
ref|XP_010326944.1|  PREDICTED: auxin-induced protein PCNT115-like      143   3e-39   
ref|XP_006392125.1|  hypothetical protein EUTSA_v10023569mg             143   4e-39   
ref|XP_007222412.1|  hypothetical protein PRUPE_ppa008163mg             142   4e-39   
ref|XP_008244437.1|  PREDICTED: probable aldo-keto reductase 2          142   5e-39   
ref|XP_009371115.1|  PREDICTED: probable aldo-keto reductase 2          142   5e-39   
ref|XP_006392127.1|  hypothetical protein EUTSA_v10023574mg             142   7e-39   
ref|XP_006487490.1|  PREDICTED: probable aldo-keto reductase 3-li...    142   7e-39   
gb|KDO50053.1|  hypothetical protein CISIN_1g019368mg                   142   8e-39   
emb|CAN80302.1|  hypothetical protein VITISV_011599                     141   8e-39   Vitis vinifera
emb|CDP10297.1|  unnamed protein product                                142   8e-39   
emb|CDP10290.1|  unnamed protein product                                141   9e-39   
ref|XP_010244073.1|  PREDICTED: probable aldo-keto reductase 2          142   1e-38   
ref|NP_176267.3|  probable aldo-keto reductase 2                        141   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAF17106.1|AF057715_1  auxin-induced atb2                            141   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564761.1|  probable aldo-keto reductase 4                        141   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564762.2|  probable aldo-keto reductase 5                        141   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103955.1|  PREDICTED: probable aldo-keto reductase 6          141   2e-38   
ref|XP_006392133.1|  hypothetical protein EUTSA_v10023904mg             141   2e-38   
emb|CBI39431.3|  unnamed protein product                                140   2e-38   
ref|XP_008222728.1|  PREDICTED: LOW QUALITY PROTEIN: probable ald...    141   2e-38   
ref|XP_010251377.1|  PREDICTED: probable aldo-keto reductase 2          141   2e-38   
ref|XP_007224543.1|  hypothetical protein PRUPE_ppa024588mg             140   2e-38   
emb|CAN77719.1|  hypothetical protein VITISV_033356                     137   2e-38   Vitis vinifera
ref|NP_001185274.1|  probable aldo-keto reductase 5                     141   2e-38   
ref|NP_176268.1|  probable aldo-keto reductase 3                        141   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009371118.1|  PREDICTED: probable aldo-keto reductase 2          140   2e-38   
emb|CDP19923.1|  unnamed protein product                                140   3e-38   
ref|XP_002265927.1|  PREDICTED: probable aldo-keto reductase 2          140   3e-38   Vitis vinifera
ref|XP_006358803.1|  PREDICTED: probable aldo-keto reductase 4-like     140   3e-38   
emb|CAN67592.1|  hypothetical protein VITISV_015428                     140   3e-38   Vitis vinifera
ref|XP_006302496.1|  hypothetical protein CARUB_v10020589mg             140   3e-38   
ref|XP_002265775.1|  PREDICTED: probable aldo-keto reductase 2          137   3e-38   Vitis vinifera
ref|XP_009113193.1|  PREDICTED: probable aldo-keto reductase 3          140   3e-38   
emb|CBI39428.3|  unnamed protein product                                137   3e-38   
ref|XP_010553616.1|  PREDICTED: probable aldo-keto reductase 4 is...    140   4e-38   
ref|XP_004296671.1|  PREDICTED: probable aldo-keto reductase 2-like     140   4e-38   
ref|XP_002889838.1|  aldo/keto reductase family protein                 140   4e-38   
emb|CAN68994.1|  hypothetical protein VITISV_040294                     140   4e-38   Vitis vinifera
gb|KFK30953.1|  hypothetical protein AALP_AA6G049000                    140   4e-38   
ref|XP_010491933.1|  PREDICTED: probable aldo-keto reductase 1 is...    139   5e-38   
ref|XP_003531918.1|  PREDICTED: probable aldo-keto reductase 2-li...    140   5e-38   
ref|XP_010458446.1|  PREDICTED: LOW QUALITY PROTEIN: probable ald...    140   5e-38   
emb|CBI39433.3|  unnamed protein product                                139   5e-38   
gb|KFK22425.1|  hypothetical protein AALP_AAs39864U000300               140   6e-38   
ref|XP_010553615.1|  PREDICTED: probable aldo-keto reductase 4 is...    140   6e-38   
ref|XP_002886601.1|  ARF-GAP domain 2                                   140   7e-38   
emb|CDP20358.1|  unnamed protein product                                142   7e-38   
ref|XP_010418017.1|  PREDICTED: probable aldo-keto reductase 4          139   7e-38   
ref|XP_010475965.1|  PREDICTED: probable aldo-keto reductase 1 is...    139   7e-38   
ref|XP_010473254.1|  PREDICTED: probable aldo-keto reductase 4          139   7e-38   
ref|XP_010491924.1|  PREDICTED: probable aldo-keto reductase 1 is...    139   8e-38   
ref|XP_010511057.1|  PREDICTED: probable aldo-keto reductase 4          139   9e-38   
emb|CDP19924.1|  unnamed protein product                                139   9e-38   
emb|CDP10291.1|  unnamed protein product                                138   9e-38   
emb|CAN80303.1|  hypothetical protein VITISV_011600                     139   1e-37   Vitis vinifera
ref|XP_010510914.1|  PREDICTED: probable aldo-keto reductase 6          139   1e-37   
ref|XP_009113195.1|  PREDICTED: probable aldo-keto reductase 4          139   1e-37   
emb|CDP10295.1|  unnamed protein product                                138   1e-37   
ref|XP_011000038.1|  PREDICTED: probable aldo-keto reductase 2          139   1e-37   
ref|XP_009794432.1|  PREDICTED: auxin-induced protein PCNT115-like      139   1e-37   
emb|CBI39434.3|  unnamed protein product                                138   1e-37   
ref|XP_009113187.1|  PREDICTED: probable aldo-keto reductase 4          139   2e-37   
emb|CDP10303.1|  unnamed protein product                                139   2e-37   
gb|KFK30952.1|  hypothetical protein AALP_AA6G048900                    139   2e-37   
ref|XP_002266277.1|  PREDICTED: probable aldo-keto reductase 2          138   2e-37   Vitis vinifera
ref|XP_010107237.1|  hypothetical protein L484_021760                   140   2e-37   
gb|KFK30951.1|  hypothetical protein AALP_AA6G048800                    138   2e-37   
emb|CDP10302.1|  unnamed protein product                                137   2e-37   
gb|KEH21873.1|  aldo/keto reductase family oxidoreductase               133   2e-37   
ref|XP_009113191.1|  PREDICTED: probable aldo-keto reductase 4          138   3e-37   
gb|KGN53069.1|  hypothetical protein Csa_4G015100                       138   3e-37   
ref|XP_004152112.1|  PREDICTED: probable aldo-keto reductase 2-like     138   3e-37   
ref|XP_006392126.1|  hypothetical protein EUTSA_v10024059mg             138   3e-37   
ref|XP_004156942.1|  PREDICTED: probable aldo-keto reductase 4-like     138   3e-37   
ref|XP_002886596.1|  aldo/keto reductase family protein                 138   3e-37   
gb|ABK95612.1|  unknown                                                 138   3e-37   Populus trichocarpa [western balsam poplar]
ref|XP_007034102.1|  NAD(P)-linked oxidoreductase superfamily pro...    139   4e-37   
ref|XP_008454010.1|  PREDICTED: probable aldo-keto reductase 4          137   4e-37   
ref|XP_002266027.2|  PREDICTED: probable aldo-keto reductase 4          140   4e-37   Vitis vinifera
ref|XP_002886599.1|  aldo/keto reductase family protein                 137   4e-37   
ref|XP_002886597.1|  hypothetical protein ARALYDRAFT_475260             137   4e-37   
ref|XP_010251376.1|  PREDICTED: probable aldo-keto reductase 2          137   5e-37   
ref|XP_010107226.1|  hypothetical protein L484_021748                   134   5e-37   
ref|XP_010418018.1|  PREDICTED: probable aldo-keto reductase 6          137   5e-37   
ref|XP_010673286.1|  PREDICTED: probable aldo-keto reductase 2 is...    137   5e-37   
ref|XP_008337505.1|  PREDICTED: probable aldo-keto reductase 2          137   6e-37   
ref|XP_010510923.1|  PREDICTED: probable aldo-keto reductase 3 is...    137   6e-37   
ref|XP_008367679.1|  PREDICTED: LOW QUALITY PROTEIN: probable ald...    137   7e-37   
gb|EYU24276.1|  hypothetical protein MIMGU_mgv1a009306mg                137   7e-37   
ref|XP_010510924.1|  PREDICTED: probable aldo-keto reductase 3 is...    137   7e-37   
gb|ABA26959.1|  TO3-34                                                  130   7e-37   Taraxacum officinale [dandelion]
gb|EMT06430.1|  Auxin-induced protein                                   135   8e-37   
ref|XP_002302899.2|  hypothetical protein POPTR_0002s23510g             137   9e-37   Populus trichocarpa [western balsam poplar]
gb|ABN08809.1|  Aldo/keto reductase                                     132   9e-37   Medicago truncatula
ref|XP_006423333.1|  hypothetical protein CICLE_v10028780mg             135   9e-37   
ref|XP_008453991.1|  PREDICTED: probable aldo-keto reductase 2          136   9e-37   
gb|AAB71980.1|  Highly similar to auxin-induced protein (aldo/ket...    136   9e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAX84672.1|  aldo/keto reductase AKR                                 136   1e-36   Manihot esculenta [manioc]
ref|XP_009378167.1|  PREDICTED: probable aldo-keto reductase 2          136   1e-36   
ref|XP_006487529.1|  PREDICTED: probable aldo-keto reductase 2-like     139   1e-36   
ref|XP_002321097.2|  aldo/keto reductase family protein                 136   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009113189.1|  PREDICTED: probable aldo-keto reductase 4 is...    136   1e-36   
ref|XP_010244068.1|  PREDICTED: probable aldo-keto reductase 2          136   1e-36   
ref|XP_002460689.1|  hypothetical protein SORBIDRAFT_02g033230          136   1e-36   Sorghum bicolor [broomcorn]
ref|XP_010069398.1|  PREDICTED: probable aldo-keto reductase 2 is...    136   1e-36   
ref|XP_006302482.1|  hypothetical protein CARUB_v10020576mg             136   1e-36   
ref|XP_006392128.1|  hypothetical protein EUTSA_v10023573mg             136   1e-36   
emb|CDP10305.1|  unnamed protein product                                135   2e-36   
ref|XP_006423748.1|  hypothetical protein CICLE_v10028770mg             136   2e-36   
ref|XP_006301580.1|  hypothetical protein CARUB_v10022018mg             139   2e-36   
ref|XP_010107228.1|  hypothetical protein L484_021750                   136   2e-36   
emb|CDP10287.1|  unnamed protein product                                135   2e-36   
gb|KCW57727.1|  hypothetical protein EUGRSUZ_H00480                     135   2e-36   
ref|XP_010089803.1|  hypothetical protein L484_022319                   135   2e-36   
ref|XP_010510916.1|  PREDICTED: probable aldo-keto reductase 4          135   3e-36   
ref|XP_008357878.1|  PREDICTED: LOW QUALITY PROTEIN: probable ald...    134   3e-36   
ref|XP_010673287.1|  PREDICTED: probable aldo-keto reductase 4 is...    137   3e-36   
gb|EMT17499.1|  Auxin-induced protein                                   132   3e-36   
gb|KCW57713.1|  hypothetical protein EUGRSUZ_H004702                    134   3e-36   
ref|XP_008454009.1|  PREDICTED: probable aldo-keto reductase 2          135   3e-36   
ref|XP_003621701.1|  Aldo/keto reductase                                135   3e-36   
gb|KCW57707.1|  hypothetical protein EUGRSUZ_H00466                     135   3e-36   
ref|XP_011073936.1|  PREDICTED: auxin-induced protein PCNT115-like      135   3e-36   
ref|XP_010069393.1|  PREDICTED: probable aldo-keto reductase 2 is...    135   4e-36   
ref|XP_010069397.1|  PREDICTED: probable aldo-keto reductase 2 is...    135   4e-36   
gb|EYU32745.1|  hypothetical protein MIMGU_mgv1a009439mg                135   4e-36   
ref|XP_010533925.1|  PREDICTED: probable aldo-keto reductase 4          135   4e-36   
dbj|BAD44104.1|  putative auxin-induced protein                         135   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172551.1|  probable aldo-keto reductase 1                        135   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006423334.1|  hypothetical protein CICLE_v10028780mg             135   5e-36   
ref|XP_010069386.1|  PREDICTED: probable aldo-keto reductase 2          135   5e-36   
gb|KCW57729.1|  hypothetical protein EUGRSUZ_H004811                    133   5e-36   
ref|XP_008379789.1|  PREDICTED: probable aldo-keto reductase 2          134   5e-36   
ref|XP_010069389.1|  PREDICTED: probable aldo-keto reductase 2 is...    134   5e-36   
ref|XP_010040399.1|  PREDICTED: probable aldo-keto reductase 2          134   5e-36   
ref|XP_010069390.1|  PREDICTED: probable aldo-keto reductase 2 is...    134   6e-36   
ref|XP_009334075.1|  PREDICTED: probable aldo-keto reductase 2 is...    134   7e-36   
ref|XP_009334074.1|  PREDICTED: probable aldo-keto reductase 2 is...    134   7e-36   
gb|KCW57720.1|  hypothetical protein EUGRSUZ_H00474                     133   8e-36   
ref|XP_003575317.1|  PREDICTED: probable aldo-keto reductase 2          134   1e-35   
ref|XP_004492046.1|  PREDICTED: probable aldo-keto reductase 2-like     134   1e-35   
dbj|BAK02817.1|  predicted protein                                      134   1e-35   
gb|KDP37896.1|  hypothetical protein JCGZ_05778                         133   1e-35   
gb|EMT06691.1|  Auxin-induced protein                                   134   1e-35   
ref|XP_002461348.1|  hypothetical protein SORBIDRAFT_02g001350          132   1e-35   Sorghum bicolor [broomcorn]
ref|XP_010040397.1|  PREDICTED: probable aldo-keto reductase 2          133   2e-35   
ref|XP_010069396.1|  PREDICTED: probable aldo-keto reductase 2          133   2e-35   
ref|XP_010069399.1|  PREDICTED: probable aldo-keto reductase 2          133   2e-35   
emb|CDP10289.1|  unnamed protein product                                133   2e-35   
ref|XP_010042438.1|  PREDICTED: probable aldo-keto reductase 2          133   2e-35   
ref|XP_010069403.1|  PREDICTED: probable aldo-keto reductase 2          133   2e-35   
gb|KCW57735.1|  hypothetical protein EUGRSUZ_H00487                     133   2e-35   
ref|XP_007222405.1|  hypothetical protein PRUPE_ppa008144mg             133   2e-35   
ref|NP_001169979.1|  uncharacterized protein LOC100383880               133   2e-35   Zea mays [maize]
gb|ABK22508.1|  unknown                                                 133   2e-35   Picea sitchensis
ref|XP_006388520.1|  hypothetical protein POPTR_0166s00210g             131   3e-35   
dbj|BAJ95968.1|  predicted protein                                      134   3e-35   
ref|XP_010042782.1|  PREDICTED: probable aldo-keto reductase 2          129   3e-35   
ref|XP_003527298.1|  PREDICTED: probable aldo-keto reductase 2-li...    132   3e-35   
gb|KHN06048.1|  Putative aldo-keto reductase 2                          132   3e-35   
gb|ACJ85229.1|  unknown                                                 132   4e-35   Medicago truncatula
ref|XP_008379790.1|  PREDICTED: probable aldo-keto reductase 2          131   4e-35   
ref|XP_006388518.1|  hypothetical protein POPTR_0166s00200g             132   4e-35   
ref|XP_006487220.1|  PREDICTED: probable aldo-keto reductase 2-li...    132   4e-35   
gb|AAB71982.1|  Highly similar to auxin-induced protein (aldo/ket...    132   4e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KFK22426.1|  hypothetical protein AALP_AAs39864U000400               132   4e-35   
ref|XP_007222406.1|  hypothetical protein PRUPE_ppa008145mg             132   5e-35   
gb|ABK21001.1|  unknown                                                 132   5e-35   Picea sitchensis
ref|XP_003621699.1|  Aldo-keto reductase yakc                           134   5e-35   
gb|ABN08782.1|  Aldo/keto reductase                                     130   6e-35   Medicago truncatula
ref|XP_008379248.1|  PREDICTED: probable aldo-keto reductase 2 is...    131   7e-35   
ref|XP_008379247.1|  PREDICTED: probable aldo-keto reductase 2 is...    132   7e-35   
gb|AAB84222.1|  auxin-induced protein                                   131   8e-35   Helianthus annuus
ref|XP_003621684.1|  Aldo-keto reductase yakc                           131   1e-34   
ref|XP_010069392.1|  PREDICTED: probable aldo-keto reductase 2 is...    131   1e-34   
ref|XP_008222724.1|  PREDICTED: probable aldo-keto reductase 2          131   1e-34   
gb|EPS71567.1|  hypothetical protein M569_03191                         131   1e-34   
ref|NP_001052497.1|  Os04g0339400                                       131   2e-34   Oryza sativa Japonica Group [Japonica rice]
sp|A2XRZ6.1|AKR3_ORYSI  RecName: Full=Probable aldo-keto reductase 3    131   2e-34   Oryza sativa Indica Group [Indian rice]
gb|KCW57717.1|  hypothetical protein EUGRSUZ_H004701                    127   2e-34   
gb|ABR92332.1|  putative aldo/keto reductase 2                          130   2e-34   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004975286.1|  PREDICTED: probable aldo-keto reductase 2-like     130   3e-34   
ref|XP_010673285.1|  PREDICTED: probable aldo-keto reductase 2          130   3e-34   
gb|ABK22828.1|  unknown                                                 130   3e-34   Picea sitchensis
ref|XP_006653275.1|  PREDICTED: probable aldo-keto reductase 3-like     130   3e-34   
ref|XP_010069388.1|  PREDICTED: probable aldo-keto reductase 2 is...    130   3e-34   
ref|XP_010673288.1|  PREDICTED: probable aldo-keto reductase 5          130   4e-34   
sp|A2XRZ0.1|AKR2_ORYSI  RecName: Full=Probable aldo-keto reductase 2    130   4e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_010069400.1|  PREDICTED: probable aldo-keto reductase 2 is...    129   4e-34   
ref|XP_010069401.1|  PREDICTED: probable aldo-keto reductase 2 is...    129   4e-34   
ref|NP_001052494.1|  Os04g0338000                                       130   4e-34   Oryza sativa Japonica Group [Japonica rice]
emb|CDP10282.1|  unnamed protein product                                129   4e-34   
emb|CDP10280.1|  unnamed protein product                                130   4e-34   
ref|XP_010037371.1|  PREDICTED: probable aldo-keto reductase 2          129   5e-34   
ref|XP_011015381.1|  PREDICTED: probable aldo-keto reductase 2          129   6e-34   
ref|XP_010069391.1|  PREDICTED: probable aldo-keto reductase 2          129   6e-34   
ref|XP_011042753.1|  PREDICTED: probable aldo-keto reductase 2          129   7e-34   
ref|XP_011042752.1|  PREDICTED: probable aldo-keto reductase 2          129   8e-34   
ref|XP_011042750.1|  PREDICTED: probable aldo-keto reductase 2 is...    128   9e-34   
gb|EYU32744.1|  hypothetical protein MIMGU_mgv11b007689mg               129   9e-34   
ref|NP_001141057.1|  putative oxidoreductase, aldo/keto reductase...    128   1e-33   Zea mays [maize]
ref|XP_009113194.1|  PREDICTED: probable aldo-keto reductase 6          128   1e-33   
ref|XP_004975287.1|  PREDICTED: probable aldo-keto reductase 2-like     128   1e-33   
ref|XP_010673284.1|  PREDICTED: auxin-induced protein PCNT115-like      128   1e-33   
ref|XP_010929910.1|  PREDICTED: probable aldo-keto reductase 2          128   1e-33   
gb|ABR16883.1|  unknown                                                 128   2e-33   Picea sitchensis
ref|XP_004975285.1|  PREDICTED: probable aldo-keto reductase 2-like     128   2e-33   
ref|XP_009103926.1|  PREDICTED: probable aldo-keto reductase 6          128   2e-33   
ref|XP_004975289.1|  PREDICTED: probable aldo-keto reductase 2-like     128   2e-33   
gb|KHN06049.1|  Putative aldo-keto reductase 2                          127   2e-33   
ref|XP_010470238.1|  PREDICTED: probable aldo-keto reductase 4          127   2e-33   
ref|XP_010069402.1|  PREDICTED: probable aldo-keto reductase 2          127   3e-33   
ref|XP_006652179.1|  PREDICTED: probable aldo-keto reductase 2-like     127   3e-33   
ref|XP_011042806.1|  PREDICTED: probable aldo-keto reductase 2          126   4e-33   
gb|EMT30228.1|  Auxin-induced protein                                   128   4e-33   
gb|ABK24567.1|  unknown                                                 124   4e-33   Picea sitchensis
gb|KCW57733.1|  hypothetical protein EUGRSUZ_H004851                    122   5e-33   
ref|XP_003527296.1|  PREDICTED: probable aldo-keto reductase 2-li...    127   5e-33   
ref|XP_011073932.1|  PREDICTED: auxin-induced protein PCNT115-lik...    127   5e-33   
ref|XP_010069394.1|  PREDICTED: probable aldo-keto reductase 2 is...    126   5e-33   
ref|XP_007139301.1|  hypothetical protein PHAVU_008G017800g             126   6e-33   
emb|CDP16012.1|  unnamed protein product                                126   6e-33   
ref|XP_002436403.1|  hypothetical protein SORBIDRAFT_10g001900          126   6e-33   Sorghum bicolor [broomcorn]
ref|XP_002303002.2|  hypothetical protein POPTR_0002s23530g             126   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010547656.1|  PREDICTED: probable aldo-keto reductase 4          126   7e-33   
ref|XP_002436875.1|  hypothetical protein SORBIDRAFT_10g010420          126   8e-33   Sorghum bicolor [broomcorn]
ref|XP_011073935.1|  PREDICTED: auxin-induced protein PCNT115-like      126   8e-33   
gb|EYU32743.1|  hypothetical protein MIMGU_mgv1a018455mg                125   1e-32   
ref|XP_011091713.1|  PREDICTED: probable aldo-keto reductase 2          125   1e-32   
ref|XP_008231715.1|  PREDICTED: probable aldo-keto reductase 2          122   2e-32   
ref|XP_002436402.1|  hypothetical protein SORBIDRAFT_10g001890          125   3e-32   Sorghum bicolor [broomcorn]
emb|CDP10285.1|  unnamed protein product                                125   3e-32   
gb|AFV99149.1|  alcohol dehydrogenase                                   125   3e-32   
gb|AFK33677.1|  unknown                                                 122   5e-32   
ref|XP_002518605.1|  aldo/keto reductase, putative                      124   5e-32   Ricinus communis
ref|XP_003568949.1|  PREDICTED: probable aldo-keto reductase 2          124   5e-32   
emb|CDP09056.1|  unnamed protein product                                123   5e-32   
gb|AFV99148.1|  alcohol dehydrogenase                                   124   6e-32   
gb|AFV99150.1|  alcohol dehydrogenase                                   124   6e-32   
gb|ABK24562.1|  unknown                                                 124   6e-32   
ref|XP_009401025.1|  PREDICTED: probable aldo-keto reductase 2          124   6e-32   
ref|XP_004975288.1|  PREDICTED: probable aldo-keto reductase 3-like     123   9e-32   
ref|XP_010326936.1|  PREDICTED: auxin-induced protein PCNT115-like      123   1e-31   
emb|CAE01600.2|  OSJNBa0008A08.8                                        123   1e-31   
ref|XP_004975284.1|  PREDICTED: probable aldo-keto reductase 2-like     123   2e-31   
ref|NP_001052491.1|  Os04g0337500                                       122   2e-31   
gb|ABR92331.1|  putative aldo/keto reductase 1                          123   2e-31   
gb|ADW66141.1|  auxin-induced protein PCNT115                           120   2e-31   
gb|AFW75370.1|  putative oxidoreductase, aldo/keto reductase fami...    122   2e-31   
ref|XP_006363583.1|  PREDICTED: probable aldo-keto reductase 2-li...    120   4e-31   
gb|ACF85021.1|  unknown                                                 121   5e-31   
gb|AFW75369.1|  LOW QUALITY PROTEIN: putative oxidoreductase, ald...    121   5e-31   
ref|NP_001149335.1|  LOC100282958                                       121   5e-31   
ref|XP_009602070.1|  PREDICTED: probable aldo-keto reductase 2          121   6e-31   
ref|XP_003575318.1|  PREDICTED: probable aldo-keto reductase 2          121   7e-31   
ref|XP_011084159.1|  PREDICTED: probable aldo-keto reductase 2 is...    121   8e-31   
ref|XP_011084158.1|  PREDICTED: auxin-induced protein PCNT115-lik...    121   8e-31   
gb|AGT17123.1|  hypothetical protein SHCRBa_116_M17_F_140               120   1e-30   
ref|XP_006363582.1|  PREDICTED: probable aldo-keto reductase 2-li...    120   1e-30   
gb|KCW57739.1|  hypothetical protein EUGRSUZ_H00491                     120   1e-30   
ref|XP_002972426.1|  hypothetical protein SELMODRAFT_148322             119   2e-30   
ref|XP_002984257.1|  hypothetical protein SELMODRAFT_229003             119   2e-30   
gb|EEE60756.1|  hypothetical protein OsJ_14313                          123   2e-30   
gb|KCW57711.1|  hypothetical protein EUGRSUZ_H00469                     119   3e-30   
emb|CDP10334.1|  unnamed protein product                                119   4e-30   
ref|XP_006358815.1|  PREDICTED: probable aldo-keto reductase 2-like     119   4e-30   
gb|KCW57718.1|  hypothetical protein EUGRSUZ_H004701                    114   6e-30   
ref|XP_009774032.1|  PREDICTED: probable aldo-keto reductase 2          117   2e-29   
gb|EMT06310.1|  Auxin-induced protein                                   117   2e-29   
ref|XP_002984256.1|  hypothetical protein SELMODRAFT_271687             117   2e-29   
ref|XP_002988596.1|  hypothetical protein SELMODRAFT_447377             117   4e-29   
ref|XP_009774031.1|  PREDICTED: probable aldo-keto reductase 2          115   1e-28   
ref|XP_002972425.1|  hypothetical protein SELMODRAFT_270951             114   1e-28   
ref|XP_002979290.1|  hypothetical protein SELMODRAFT_110508             114   2e-28   
ref|XP_002972240.1|  hypothetical protein SELMODRAFT_172677             113   6e-28   
ref|XP_002984154.1|  hypothetical protein SELMODRAFT_156405             112   8e-28   
ref|XP_002984255.1|  hypothetical protein SELMODRAFT_180766             111   3e-27   
emb|CDP19922.1|  unnamed protein product                                110   5e-27   
gb|AAD31332.1|AC007354_5  Strong similarity to gb|X56267 auxin-in...    110   5e-27   
ref|WP_006462812.1|  aldo/keto reductase                                110   6e-27   
gb|EPS71568.1|  hypothetical protein M569_03192                         110   6e-27   
ref|WP_016869935.1|  hypothetical protein                               110   7e-27   
ref|XP_009113190.1|  PREDICTED: probable aldo-keto reductase 4 is...    109   2e-26   
emb|CDY70614.1|  BnaAnng34370D                                          108   3e-26   
ref|WP_037292614.1|  aldo/keto reductase                                104   4e-26   
emb|CAG29825.1|  aryl alcohol dehydrogenase                             107   6e-26   
emb|CAN75394.1|  hypothetical protein VITISV_007319                     106   8e-26   
ref|WP_031179396.1|  aldo/keto reductase                                107   1e-25   
ref|WP_012809693.1|  aldo/keto reductase                                106   1e-25   
ref|WP_039784929.1|  aldo/keto reductase                                106   1e-25   
ref|WP_035469343.1|  aldo/keto reductase                                106   1e-25   
ref|WP_034338308.1|  aldo/keto reductase                                106   2e-25   
gb|EED06808.1|  aldo/keto reductase                                     106   2e-25   
emb|CDI03759.1|  putative aldo-keto reductase 2                         106   2e-25   
ref|WP_034351161.1|  aldo/keto reductase                                105   2e-25   
gb|EIJ45736.1|  oxidoreductase protein                                  105   2e-25   
ref|WP_025605456.1|  aldo/keto reductase                                105   3e-25   
ref|WP_019495706.1|  aldo/keto reductase                                105   3e-25   
ref|WP_034311418.1|  aldo/keto reductase                                105   3e-25   
ref|WP_026052204.1|  aldo/keto reductase                                105   3e-25   
ref|WP_011531290.1|  aldo/keto reductase                                105   4e-25   
ref|WP_014463213.1|  aldo/keto reductase                                105   5e-25   
ref|WP_029926257.1|  aldo/keto reductase                                105   5e-25   
emb|CAN72769.1|  hypothetical protein VITISV_020057                     102   5e-25   
ref|WP_012091029.1|  aldo/keto reductase                                104   8e-25   
ref|WP_010657707.1|  aldo/keto reductase                                104   8e-25   
ref|WP_038166356.1|  aldo/keto reductase                                104   9e-25   
ref|XP_002963342.1|  hypothetical protein SELMODRAFT_270369             104   1e-24   
ref|WP_006000084.1|  aldo/keto reductase                                103   1e-24   
ref|WP_021587592.1|  aldo/keto reductase                                103   1e-24   
ref|XP_002974629.1|  hypothetical protein SELMODRAFT_267791             103   2e-24   
ref|WP_025089847.1|  aldo/keto reductase                                103   2e-24   
ref|WP_029742446.1|  aldo/keto reductase                                103   2e-24   
ref|WP_034804639.1|  aldo/keto reductase                                103   2e-24   
ref|WP_006473265.1|  aldo/keto reductase                                103   2e-24   
ref|WP_022568610.1|  aldo/keto reductase                                103   2e-24   
ref|WP_027417182.1|  aldo/keto reductase                                103   2e-24   
ref|WP_013235297.1|  aldo/keto reductase                                103   2e-24   
ref|WP_006468105.1|  aldo/keto reductase                                103   3e-24   
ref|NP_176274.1|  probable aldo-keto reductase 6                        102   3e-24   
gb|AIZ64106.1|  aldo/keto reductase                                     102   3e-24   
ref|WP_027319609.1|  aldo/keto reductase                                102   3e-24   
ref|WP_012097688.1|  aldo/keto reductase                                102   3e-24   
ref|XP_002993752.1|  hypothetical protein SELMODRAFT_272338             102   3e-24   
ref|WP_002616582.1|  aldo/keto reductase                                102   4e-24   
ref|WP_018235172.1|  aldo/keto reductase                                102   4e-24   
ref|XP_011098847.1|  PREDICTED: perakine reductase-like                 102   4e-24   
ref|WP_009960402.1|  aldo/keto reductase                                102   4e-24   
gb|KEH43781.1|  aldo/keto reductase family oxidoreductase               102   4e-24   
ref|WP_019142717.1|  hypothetical protein                               102   4e-24   
gb|KIF83616.1|  aldo/keto reductase                                     102   4e-24   
ref|WP_028557730.1|  aldo/keto reductase                                102   5e-24   
ref|WP_009631375.1|  putative oxidoreductase, aryl-alcohol dehydr...    102   5e-24   
ref|WP_007416137.1|  aldo/keto reductase                                102   5e-24   
gb|KEH43782.1|  aldo/keto reductase family oxidoreductase               102   5e-24   
ref|WP_021297621.1|  aldo/keto reductase                                102   5e-24   
ref|WP_034489187.1|  aldo/keto reductase                                102   5e-24   
ref|WP_020095052.1|  aldo/keto reductase                                102   6e-24   
ref|WP_020737572.1|  aldo/keto reductase                                102   7e-24   
ref|WP_028779421.1|  aldo/keto reductase                                102   7e-24   
ref|WP_025889972.1|  aldo/keto reductase                                102   7e-24   
ref|XP_002987780.1|  hypothetical protein SELMODRAFT_183426             102   7e-24   
ref|WP_025008968.1|  aldo/keto reductase                                101   8e-24   
ref|WP_032125784.1|  aldo/keto reductase                                101   8e-24   
ref|WP_012191986.1|  aldo/keto reductase                                101   8e-24   
ref|WP_024352404.1|  aldo/keto reductase                                101   8e-24   
ref|WP_015205140.1|  pyridoxine 4-dehydrogenase                         101   8e-24   
gb|AHJ97444.1|  aldo/keto reductase family oxidoreductase               101   9e-24   
ref|WP_016822556.1|  aldo/keto reductase                                101   9e-24   
ref|WP_036591555.1|  aldo/keto reductase                                101   1e-23   
ref|WP_037552759.1|  aldo/keto reductase                                101   1e-23   
ref|WP_015246180.1|  aldo/keto reductase                                101   1e-23   
ref|WP_015345920.1|  aldo/keto reductase                                101   1e-23   
gb|KFE63941.1|  Aldo-keto reductase                                     101   1e-23   
ref|WP_026734659.1|  aldo/keto reductase                                100   1e-23   
ref|WP_027481278.1|  aldo/keto reductase                                100   1e-23   
ref|WP_026099159.1|  aldo/keto reductase                                100   1e-23   
ref|WP_006447439.1|  aldo/keto reductase                                100   2e-23   
gb|EPN67364.1|  oxidoreductase, aldo/keto reductase family protein    99.8    2e-23   
ref|WP_019853357.1|  hypothetical protein                               100   2e-23   
ref|WP_038625033.1|  aldo/keto reductase                                100   2e-23   
ref|XP_004496669.1|  PREDICTED: perakine reductase-like isoform X1      100   2e-23   
ref|XP_004488050.1|  PREDICTED: probable aldo-keto reductase 1-li...    100   2e-23   
ref|WP_030813047.1|  aldo/keto reductase                                100   2e-23   
ref|WP_011140840.1|  aldo/keto reductase                                100   2e-23   
ref|WP_028539888.1|  aldo/keto reductase                                100   2e-23   
ref|WP_017909601.1|  aldo/keto reductase                                100   2e-23   
ref|WP_026635091.1|  aldo/keto reductase                                100   2e-23   
ref|WP_016312616.1|  hypothetical protein                               100   2e-23   
ref|WP_017706896.1|  aldo/keto reductase                              99.8    3e-23   
gb|ESA07073.1|  hypothetical protein GLOINDRAFT_33340                 98.6    3e-23   
ref|WP_008738066.1|  aldo/keto reductase                                100   3e-23   
emb|CDM64158.1|  predicted oxidoreductase, aryl-alcohol dehydroge...    100   3e-23   
ref|WP_037197334.1|  aldo/keto reductase                                100   3e-23   
ref|WP_024696593.1|  aldo/keto reductase                                100   3e-23   
ref|WP_024679592.1|  aldo/keto reductase                                100   3e-23   
ref|WP_024656056.1|  aldo/keto reductase                                100   3e-23   
ref|WP_007243961.1|  aldo/keto reductase                                100   3e-23   
ref|WP_011104195.1|  MULTISPECIES: aldo/keto reductase                  100   3e-23   
ref|WP_017701591.1|  aldo/keto reductase                                100   3e-23   
ref|WP_017684291.1|  aldo/keto reductase                                100   3e-23   
ref|WP_005618068.1|  aldo/keto reductase                                100   3e-23   
ref|WP_005762451.1|  aldo/keto reductase                                100   3e-23   
ref|WP_003379747.1|  aldo/keto reductase                                100   3e-23   
ref|WP_005737642.1|  aldo/keto reductase                                100   3e-23   
ref|WP_028076357.1|  aldo/keto reductase                                100   3e-23   
gb|AJC46119.1|  aldo/keto reductase                                     100   3e-23   
ref|WP_021014410.1|  Pyridoxine 4-dehydrogenase                         100   3e-23   
ref|WP_026568630.1|  aldo/keto reductase                                100   3e-23   
ref|WP_025695009.1|  aldo/keto reductase                              99.8    4e-23   
gb|ESA20064.1|  hypothetical protein GLOINDRAFT_75205                 97.4    4e-23   
ref|WP_028799784.1|  aldo/keto reductase                              99.8    4e-23   
ref|WP_009226708.1|  aldo/keto reductase                              99.8    4e-23   
ref|WP_038623060.1|  aldo/keto reductase                              99.8    4e-23   
ref|WP_035880341.1|  aldo/keto reductase                              99.8    5e-23   
ref|WP_009674039.1|  MULTISPECIES: aldo/keto reductase                99.8    5e-23   
ref|WP_020718639.1|  hypothetical protein                             99.8    5e-23   
ref|WP_015338489.1|  aldo-keto reductase                              99.8    5e-23   
ref|WP_028057283.1|  aldo/keto reductase                              99.8    5e-23   
emb|CEG22803.1|  General stress protein 69                            99.4    5e-23   
ref|WP_025716504.1|  aldo/keto reductase                              99.4    5e-23   
ref|XP_010025049.1|  PREDICTED: probable aldo-keto reductase 1 is...  99.8    5e-23   
ref|WP_027273421.1|  aldo/keto reductase                              99.4    5e-23   
gb|AFK44718.1|  unknown                                               98.6    5e-23   
dbj|GAK87567.1|  aldo-keto reductase                                  99.4    5e-23   
ref|WP_014400516.1|  aldo/keto reductase                              99.4    5e-23   
ref|XP_002517067.1|  aldo/keto reductase, putative                    99.8    5e-23   
gb|EXX71739.1|  pyridoxine 4-dehydrogenase                            99.4    5e-23   
ref|WP_026769241.1|  aldo/keto reductase                              99.4    6e-23   
ref|WP_004885565.1|  oxidoreductase, aldo/keto reductase family p...  99.4    6e-23   
ref|WP_036357589.1|  aldo/keto reductase                              99.4    6e-23   
ref|WP_022537034.1|  aldo/keto reductase                              99.4    6e-23   
ref|WP_029562186.1|  aldo/keto reductase                              99.0    6e-23   
ref|WP_026774266.1|  aldo/keto reductase                              99.4    6e-23   
ref|XP_010025047.1|  PREDICTED: probable aldo-keto reductase 1 is...  99.4    6e-23   
ref|WP_019689014.1|  aldo/keto reductase                              99.4    6e-23   
ref|WP_017426064.1|  MULTISPECIES: aldo/keto reductase                99.4    7e-23   
ref|WP_008215092.1|  aldo/keto reductase                              99.0    7e-23   
ref|WP_036540364.1|  aldo/keto reductase                              99.0    7e-23   
ref|WP_007433115.1|  aldo/keto reductase                              99.0    7e-23   
ref|WP_009494046.1|  aldo/keto reductase                              99.0    7e-23   
ref|WP_017301833.1|  aldo/keto reductase                              99.0    7e-23   
ref|WP_016766722.1|  oxidoreductase                                   99.0    7e-23   
ref|WP_019587057.1|  aldo/keto reductase                              99.0    7e-23   
ref|WP_027867972.1|  aldo/keto reductase                              99.0    7e-23   
gb|AJC60073.1|  aldo/keto reductase                                   99.0    7e-23   
ref|WP_025686201.1|  aldo/keto reductase                              99.0    7e-23   
ref|WP_011142835.1|  aldo/keto reductase                              99.0    7e-23   
ref|WP_039638301.1|  aldo/keto reductase                              99.0    7e-23   
ref|WP_023174677.1|  aldo/keto reductase                              99.0    8e-23   
ref|WP_025366194.1|  aldo/keto reductase                              99.0    8e-23   
ref|WP_013373791.1|  aldo/keto reductase                              99.0    8e-23   
ref|WP_028540908.1|  aldo/keto reductase                              99.0    8e-23   
ref|WP_029242439.1|  aldo/keto reductase                              99.0    8e-23   
ref|WP_025675726.1|  aldo/keto reductase                              99.0    8e-23   
ref|WP_023991025.1|  aldo/keto reductase                              99.0    8e-23   
ref|WP_013936515.1|  aldo/keto reductase                              99.0    8e-23   
ref|WP_007872697.1|  aldo/keto reductase                              99.0    9e-23   
ref|WP_025995816.1|  aldo/keto reductase                              99.0    9e-23   
ref|WP_021881972.1|  Probable aldo-keto reductase 2                   99.0    9e-23   
ref|WP_033570701.1|  aldo/keto reductase                              99.0    9e-23   
gb|AIQ14100.1|  aldo/keto reductase                                   98.6    9e-23   
ref|WP_029434238.1|  aldo/keto reductase                              98.6    9e-23   
gb|EXX71731.1|  pyridoxine 4-dehydrogenase                            98.6    1e-22   
gb|ESA09352.1|  hypothetical protein GLOINDRAFT_204516                95.5    1e-22   
gb|KHG27361.1|  putative aldo-keto reductase 1                        97.1    1e-22   
gb|AIQ47906.1|  aldo/keto reductase                                   98.6    1e-22   
ref|WP_013917174.1|  aldo/keto reductase                              98.6    1e-22   
ref|WP_024666083.1|  aldo/keto reductase                              98.6    1e-22   
gb|AIQ30560.1|  aldo/keto reductase                                   98.6    1e-22   
ref|WP_039744198.1|  aldo/keto reductase                              98.6    1e-22   
ref|WP_011550447.1|  aldo/keto reductase                              98.6    1e-22   
ref|WP_014649761.1|  aldo/keto reductase                              98.6    1e-22   
ref|WP_026856626.1|  aldo/keto reductase                              98.6    1e-22   
ref|WP_010346908.1|  aldo/keto reductase                              98.6    1e-22   
ref|WP_014368896.1|  aldo/keto reductase                              98.2    1e-22   
gb|AHG47734.1|  aldo/keto reductase                                   98.2    1e-22   



>ref|XP_004248016.1| PREDICTED: auxin-induced protein PCNT115 [Solanum lycopersicum]
Length=351

 Score =   150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGPKL+E+ SN+DYRK LPRFQAENLEHNK+ YE+
Sbjct  199  EIIPTCRELGIGIVAYSPLGRGFLSSGPKLLEDLSNEDYRKHLPRFQAENLEHNKKLYER  258

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I ++A KKGCTPSQLALAWVH
Sbjct  259  ICQMAAKKGCTPSQLALAWVH  279



>ref|XP_006358809.1| PREDICTED: probable aldo-keto reductase 4-like isoform X2 [Solanum 
tuberosum]
Length=346

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGPKLVE+ +N+D+RK LPRFQ ENLEHNK+FYE+
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFLSSGPKLVEDLTNEDFRKHLPRFQGENLEHNKKFYER  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I ++A KKGCTPSQLALAWVH
Sbjct  254  ICQMAAKKGCTPSQLALAWVH  274



>ref|XP_007034108.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY05034.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=344

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSGP+LVE  S+DDYRK LPRFQ ENLEHNKR YE+
Sbjct  192  EIVPTCRELGIGIVAYSPLGRGFLSSGPELVETLSDDDYRKFLPRFQPENLEHNKRLYER  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA KKGCTPSQLALAWVH
Sbjct  252  VNEIAAKKGCTPSQLALAWVH  272



>ref|XP_007034105.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY05031.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=344

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCREL IGIVAYSPLGRGFLSSGPK+VE  SNDD+RK LPRFQ ENLEHN+R YE+
Sbjct  192  DIIPTCRELEIGIVAYSPLGRGFLSSGPKIVETLSNDDFRKSLPRFQPENLEHNQRLYER  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA KKGCTPSQLALAWVH
Sbjct  252  VNEIAAKKGCTPSQLALAWVH  272



>ref|XP_006358808.1| PREDICTED: probable aldo-keto reductase 4-like isoform X1 [Solanum 
tuberosum]
Length=346

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGPKLVE+ +N+D+RK LPRFQ ENLEHNK+FYE+
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFLSSGPKLVEDLTNEDFRKHLPRFQGENLEHNKKFYER  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I ++A KKGCTPSQLALAWVH
Sbjct  254  ICQMAAKKGCTPSQLALAWVH  274



>ref|XP_010326945.1| PREDICTED: auxin-induced protein PCNT115-like [Solanum lycopersicum]
Length=346

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGFLSSGPKL+E+ SN+D+RK LPRFQ ENLEHNK+ YE+
Sbjct  194  DIVPTCRELGIGIVAYSPLGRGFLSSGPKLLEDCSNEDFRKYLPRFQGENLEHNKKLYER  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I +IA KKGCTPSQLALAWVH
Sbjct  254  ICQIAAKKGCTPSQLALAWVH  274



>ref|XP_010326948.1| PREDICTED: auxin-induced protein PCNT115-like isoform X2 [Solanum 
lycopersicum]
Length=346

 Score =   148 bits (374),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGPKLVE+ +N+D+RK LPRFQ ENLEHNK+ YE+
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFLSSGPKLVEDLTNEDFRKHLPRFQGENLEHNKKLYER  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A KKGCTPSQLALAWVH
Sbjct  254  ICELATKKGCTPSQLALAWVH  274



>ref|XP_010326947.1| PREDICTED: auxin-induced protein PCNT115-like isoform X1 [Solanum 
lycopersicum]
Length=346

 Score =   148 bits (373),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGPKLVE+ +N+D+RK LPRFQ ENLEHNK+ YE+
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFLSSGPKLVEDLTNEDFRKHLPRFQGENLEHNKKLYER  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A KKGCTPSQLALAWVH
Sbjct  254  ICELATKKGCTPSQLALAWVH  274



>ref|XP_009794431.1| PREDICTED: probable aldo-keto reductase 3 isoform X3 [Nicotiana 
sylvestris]
Length=286

 Score =   146 bits (369),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLG+GFLSSGPKL+E+ SN+D+RK +PRFQAENLEHNK  YE+
Sbjct  134  EIIPTCRELGIGIVAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLEHNKILYER  193

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I ++AEKKGCTPSQLALAWVH
Sbjct  194  ICKMAEKKGCTPSQLALAWVH  214



>ref|XP_007034103.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY05029.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=370

 Score =   148 bits (373),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIG+VAYSPLGRGF SSGPK+VE  SNDD RK  PRFQ ENLEHNKR YE+
Sbjct  192  DIIPTCRELGIGVVAYSPLGRGFFSSGPKIVETLSNDDLRKSQPRFQPENLEHNKRLYEQ  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA KKGCTPSQLALAWVH
Sbjct  252  VNEIAAKKGCTPSQLALAWVH  272



>ref|XP_009794430.1| PREDICTED: probable aldo-keto reductase 3 isoform X2 [Nicotiana 
sylvestris]
Length=299

 Score =   146 bits (368),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLG+GFLSSGPKL+E+ SN+D+RK +PRFQAENLEHNK  YE+
Sbjct  147  EIIPTCRELGIGIVAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLEHNKILYER  206

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I ++AEKKGCTPSQLALAWVH
Sbjct  207  ICKMAEKKGCTPSQLALAWVH  227



>emb|CDP10300.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKLVEN ++DDYRK +PRFQAENLEHNK  YE+
Sbjct  193  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLVENLTDDDYRKYMPRFQAENLEHNKNLYEQ  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTPSQLALAWVH
Sbjct  253  VNAIASRKGCTPSQLALAWVH  273



>ref|XP_006423749.1| hypothetical protein CICLE_v10028769mg [Citrus clementina]
 ref|XP_006487497.1| PREDICTED: probable aldo-keto reductase 2-like [Citrus sinensis]
 gb|ESR36989.1| hypothetical protein CICLE_v10028769mg [Citrus clementina]
 gb|KDO51546.1| hypothetical protein CISIN_1g019272mg [Citrus sinensis]
Length=343

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSGP+L EN S DDYR+ LPRFQAENLEHNK+ +E+
Sbjct  191  EIVPTCRELGIGIVAYSPLGRGFFSSGPELAENLSKDDYRQSLPRFQAENLEHNKKLFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA KKGCTPSQLALAWVH
Sbjct  251  VNEIAAKKGCTPSQLALAWVH  271



>emb|CDP10299.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKLVEN ++DDYRK +PRFQAENLEHNK  YE+
Sbjct  193  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLVENLTDDDYRKYMPRFQAENLEHNKNLYER  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTPSQLALAWVH
Sbjct  253  VNAIASRKGCTPSQLALAWVH  273



>ref|XP_006423736.1| hypothetical protein CICLE_v10028766mg [Citrus clementina]
 gb|ESR36976.1| hypothetical protein CICLE_v10028766mg [Citrus clementina]
Length=278

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSGPKLVE+FS +D+R+ LPRFQAENLEHNK+ +E+
Sbjct  191  EIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQYLPRFQAENLEHNKKLFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  251  VNEIATRKGCTPSQLALAWVH  271



>emb|CDP10298.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKLVEN ++DDYRK +PRFQAENLEHNK  YE+
Sbjct  193  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLVENLTDDDYRKHVPRFQAENLEHNKNLYER  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTPSQLALAWVH
Sbjct  253  VNAIASRKGCTPSQLALAWVH  273



>emb|CDP20356.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   142 bits (359),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKL+EN +  D+RK LPRFQAENLEHNK+ YE+
Sbjct  63   EIIPTCRELGIGIVAYSPLGRGFFSSGPKLMENLAEGDFRKGLPRFQAENLEHNKKLYER  122

Query  63   IVEIAEKKGCTPSQLALAWVH  1
               IA +KGCTPSQLALAWVH
Sbjct  123  ATAIASRKGCTPSQLALAWVH  143



>sp|P40691.1|A115_TOBAC RecName: Full=Auxin-induced protein PCNT115 [Nicotiana tabacum]
 emb|CAA39708.1| auxin-induced protein [Nicotiana tabacum]
Length=307

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGPKL+E+ SN+DYRK LPRFQAENLE+NK  YE+
Sbjct  199  EIIPTCRELGIGIVAYSPLGRGFLSSGPKLLEDMSNEDYRKYLPRFQAENLENNKNLYER  258

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A +KGCTPSQLALAWVH
Sbjct  259  ICEMAVRKGCTPSQLALAWVH  279



>ref|XP_009794429.1| PREDICTED: auxin-induced protein PCNT115-like isoform X1 [Nicotiana 
sylvestris]
Length=356

 Score =   146 bits (368),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLG+GFLSSGPKL+E+ SN+D+RK +PRFQAENLEHNK  YE+
Sbjct  204  EIIPTCRELGIGIVAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLEHNKILYER  263

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I ++AEKKGCTPSQLALAWVH
Sbjct  264  ICKMAEKKGCTPSQLALAWVH  284



>ref|XP_009631784.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein PCNT115-like 
[Nicotiana tomentosiformis]
Length=307

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGPKL+E+ SN+DYRK LPRFQAENLE+NK  YE+
Sbjct  199  EIIPTCRELGIGIVAYSPLGRGFLSSGPKLLEDMSNEDYRKHLPRFQAENLENNKNLYER  258

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A +KGCTPSQLALAWVH
Sbjct  259  ICEMAVRKGCTPSQLALAWVH  279



>ref|XP_009631779.1| PREDICTED: auxin-induced protein PCNT115-like [Nicotiana tomentosiformis]
Length=346

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGPKL+E+ SN+D+RK LPRFQA+NLEHNK  YE+
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFLSSGPKLLEDLSNEDFRKHLPRFQADNLEHNKILYER  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I ++A KKGCTPSQLALAWVH
Sbjct  254  ICQMAAKKGCTPSQLALAWVH  274



>ref|XP_009784380.1| PREDICTED: auxin-induced protein PCNT115 [Nicotiana sylvestris]
Length=351

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGPKL+E+ SN+DYRK LPRFQAENLE+NK  YE+
Sbjct  199  EIIPTCRELGIGIVAYSPLGRGFLSSGPKLLEDMSNEDYRKHLPRFQAENLENNKNLYER  258

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A +KGCTPSQLALAWVH
Sbjct  259  ICEMAVRKGCTPSQLALAWVH  279



>ref|XP_006423738.1| hypothetical protein CICLE_v10028781mg [Citrus clementina]
 gb|ESR36978.1| hypothetical protein CICLE_v10028781mg [Citrus clementina]
Length=276

 Score =   144 bits (362),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAY PLG+GFLSSGPKLVE+FS DD+RKC+P+FQAENLEHNK+ +E 
Sbjct  124  EIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKDDFRKCMPKFQAENLEHNKKLFES  183

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTP+QLAL WVH
Sbjct  184  VNEIAMRKGCTPAQLALGWVH  204



>ref|XP_010418012.1| PREDICTED: probable aldo-keto reductase 2 [Camelina sativa]
Length=345

 Score =   145 bits (365),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFL+SGPKLVEN  NDD+RK LPRFQ ENL+HNK  +EK
Sbjct  193  DIIPTCRELGIGIVAYSPLGRGFLASGPKLVENMDNDDFRKTLPRFQQENLDHNKILFEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGC+P+QLALAWVH
Sbjct  253  VCAMSEKKGCSPAQLALAWVH  273



>gb|KDO50058.1| hypothetical protein CISIN_1g019303mg [Citrus sinensis]
Length=317

 Score =   144 bits (363),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSGPKLVE+FS +D+R+ LPRFQAENLEHNK+ +E+
Sbjct  165  EIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQYLPRFQAENLEHNKKLFER  224

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  225  VNEIATRKGCTPSQLALAWVH  245



>ref|XP_006423737.1| hypothetical protein CICLE_v10028766mg [Citrus clementina]
 gb|ESR36977.1| hypothetical protein CICLE_v10028766mg [Citrus clementina]
Length=343

 Score =   145 bits (365),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSGPKLVE+FS +D+R+ LPRFQAENLEHNK+ +E+
Sbjct  191  EIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQYLPRFQAENLEHNKKLFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  251  VNEIATRKGCTPSQLALAWVH  271



>gb|KHG21132.1| hypothetical protein F383_07588 [Gossypium arboreum]
Length=343

 Score =   145 bits (365),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF S GPK+VE  SNDD+RK LPRFQ EN+EHN+R Y++
Sbjct  192  DIIPTCRELGIGIVAYSPLGRGFFSFGPKIVETLSNDDFRKNLPRFQPENMEHNQRLYDR  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA KKGCTPSQLALAWVH
Sbjct  252  VNEIAAKKGCTPSQLALAWVH  272



>ref|XP_009631780.1| PREDICTED: auxin-induced protein PCNT115-like [Nicotiana tomentosiformis]
Length=356

 Score =   145 bits (365),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLG+GFLSSGPKL+E+ SN+D+RK +PRFQAENLEHNK  YE+
Sbjct  204  EIIPTCRELGIGIVAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLEHNKILYER  263

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I ++A KKGCTPSQLALAWVH
Sbjct  264  ICQMAAKKGCTPSQLALAWVH  284



>ref|XP_006487489.1| PREDICTED: probable aldo-keto reductase 2-like [Citrus sinensis]
 gb|KDO50059.1| hypothetical protein CISIN_1g019303mg [Citrus sinensis]
Length=343

 Score =   144 bits (364),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSGPKLVE+FS +D+R+ LPRFQAENLEHNK+ +E+
Sbjct  191  EIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFSKEDFRQYLPRFQAENLEHNKKLFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  251  VNEIATRKGCTPSQLALAWVH  271



>ref|XP_010103734.1| hypothetical protein L484_016650 [Morus notabilis]
 gb|EXB96876.1| hypothetical protein L484_016650 [Morus notabilis]
Length=222

 Score =   141 bits (356),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF+SSGPK+VEN S+DD+RK LPRFQ ENL+HN + +E+
Sbjct  71   DIIPTCRELGIGIVAYSPLGRGFMSSGPKIVENLSDDDFRKTLPRFQPENLDHNGKVFER  130

Query  63   IVEIAEKKGCTPSQLALAWV  4
            + EIA +KGCTPSQL LAWV
Sbjct  131  VNEIASRKGCTPSQLTLAWV  150



>ref|XP_009378168.1| PREDICTED: probable aldo-keto reductase 2 [Pyrus x bretschneideri]
Length=339

 Score =   144 bits (364),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG KLV+N +NDD+RK LPRFQAENLEHNK  +E+
Sbjct  191  DIIPTCRELGIGIVAYSPLGRGFFSSGAKLVDNLANDDFRKYLPRFQAENLEHNKTIFEQ  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  251  VSDLAARKGCTPSQLALAWVH  271



>gb|ABA26981.1| TO33-12 [Taraxacum officinale]
Length=101

 Score =   137 bits (346),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLS GPK+ EN ++ D+R+ LPRFQ ENLE+N++ YE+
Sbjct  3    DIIPTCRELGIGIVAYSPLGRGFLSLGPKMAENLADGDFRQSLPRFQVENLENNRKLYER  62

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA KKGCTPSQLALAWVH
Sbjct  63   VSAIAAKKGCTPSQLALAWVH  83



>ref|XP_006358806.1| PREDICTED: auxin-induced protein PCNT115-like isoform X1 [Solanum 
tuberosum]
Length=354

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSGPKL+E+  N+DYRK LPRFQAENLE NK  YE+
Sbjct  201  EIVPTCRELGIGIVAYSPLGRGFLSSGPKLLEDMENEDYRKHLPRFQAENLEQNKILYER  260

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A KKGCTPSQLALAWVH
Sbjct  261  ICEMAAKKGCTPSQLALAWVH  281



>ref|XP_006487491.1| PREDICTED: probable aldo-keto reductase 3-like isoform X2 [Citrus 
sinensis]
Length=276

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAY PLG+GFLSSGPKLVE+FS  D+RKC+P+FQAENLEHNK+ +E+
Sbjct  124  EIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQAENLEHNKKLFER  183

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTP+QLALAWVH
Sbjct  184  VNEIAMRKGCTPAQLALAWVH  204



>ref|XP_007034107.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY05033.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=344

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -2

Query  240  VIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEKI  61
            +IPTCRELGIGIVAYSPLGRGF SSGPK+VE  SNDD+RK  PRFQ ENL HNKR YE++
Sbjct  193  IIPTCRELGIGIVAYSPLGRGFFSSGPKIVETLSNDDFRKSQPRFQPENLAHNKRLYERV  252

Query  60   VEIAEKKGCTPSQLALAWVH  1
             EIA KKGCTPSQLALAWVH
Sbjct  253  NEIAVKKGCTPSQLALAWVH  272



>ref|XP_006487492.1| PREDICTED: probable aldo-keto reductase 3-like isoform X3 [Citrus 
sinensis]
Length=265

 Score =   142 bits (357),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAY PLG+GFLSSGPKLVE+FS  D+RKC+P+FQAENLEHNK+ +E+
Sbjct  113  EIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQAENLEHNKKLFER  172

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTP+QLALAWVH
Sbjct  173  VNEIAMRKGCTPAQLALAWVH  193



>gb|KHG15522.1| hypothetical protein F383_16754 [Gossypium arboreum]
Length=343

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSGPK++E  S  D+RK LPRFQ ENLEHNKR YE+
Sbjct  192  DIIPTCRELGIGIVAYSPLGRGFFSSGPKMMETLSEGDFRKYLPRFQPENLEHNKRLYER  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA KKGCTPSQLALAWVH
Sbjct  252  VNEIAVKKGCTPSQLALAWVH  272



>gb|KDO50054.1| hypothetical protein CISIN_1g019368mg [Citrus sinensis]
Length=265

 Score =   142 bits (357),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAY PLG+GFLSSGPKLVE+FS  D+RKC+P+FQAENLEHNK+ +E+
Sbjct  113  EIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQAENLEHNKKLFER  172

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTP+QLALAWVH
Sbjct  173  VNEIAMRKGCTPAQLALAWVH  193



>ref|XP_006423739.1| hypothetical protein CICLE_v10028781mg [Citrus clementina]
 gb|ESR36979.1| hypothetical protein CICLE_v10028781mg [Citrus clementina]
Length=342

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAY PLG+GFLSSGPKLVE+FS DD+RKC+P+FQAENLEHNK+ +E 
Sbjct  190  EIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKDDFRKCMPKFQAENLEHNKKLFES  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTP+QLAL WVH
Sbjct  250  VNEIAMRKGCTPAQLALGWVH  270



>ref|XP_007220849.1| hypothetical protein PRUPE_ppa021725mg [Prunus persica]
 gb|EMJ22048.1| hypothetical protein PRUPE_ppa021725mg [Prunus persica]
Length=206

 Score =   140 bits (352),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG K  EN  NDD+RK LPRFQAENLEHNK  +E+
Sbjct  54   DIIPTCRELGIGIVAYSPLGRGFFSSGAKFFENLPNDDFRKYLPRFQAENLEHNKTIFEQ  113

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  114  VRDLAARKGCTPSQLALAWVH  134



>emb|CBI39432.3| unnamed protein product [Vitis vinifera]
Length=219

 Score =   140 bits (352),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYS LGRGFLSSG K+VEN S++D RK LPRFQ ENLEHNK  YE+
Sbjct  68   DIVPTCRELGIGIVAYSSLGRGFLSSGAKMVENLSDNDLRKNLPRFQPENLEHNKILYER  127

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  128  VSEIATRKGCTPSQLALAWVH  148



>ref|XP_008380430.1| PREDICTED: probable aldo-keto reductase 2 [Malus domestica]
Length=339

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG K V+N +NDD+RK LPRFQAENLEHNK  +E+
Sbjct  191  DIIPTCRELGIGIVAYSPLGRGFFSSGAKFVDNLANDDFRKYLPRFQAENLEHNKTIFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  251  VSDLAARKGCTPSQLALAWVH  271



>gb|KDP37897.1| hypothetical protein JCGZ_05779 [Jatropha curcas]
Length=344

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF SSGPKLVE    DD+RK LPRFQAENLEHNK+ +E+
Sbjct  192  DIVPTCRELGIGIVAYSPLGRGFFSSGPKLVETLKEDDFRKYLPRFQAENLEHNKKLFER  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +K CTPSQLALAWVH
Sbjct  252  VSEIAARKQCTPSQLALAWVH  272



>ref|XP_010326944.1| PREDICTED: auxin-induced protein PCNT115-like [Solanum lycopersicum]
Length=349

 Score =   143 bits (361),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLG+GFLSSGPKL+E+ SN+D+RK +PRFQAENL+HNK  YE+
Sbjct  196  EIIPTCRELGIGIVAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLKHNKILYER  255

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I ++A KKGCTPSQLALAWVH
Sbjct  256  ICQMATKKGCTPSQLALAWVH  276



>ref|XP_006392125.1| hypothetical protein EUTSA_v10023569mg [Eutrema salsugineum]
 gb|ESQ29411.1| hypothetical protein EUTSA_v10023569mg [Eutrema salsugineum]
Length=346

 Score =   143 bits (360),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFL+SGPKLVEN   DDYRK LPRFQ ENL+HNK  YEK
Sbjct  194  DIIPTCRELGIGIVAYSPLGRGFLASGPKLVENLDQDDYRKDLPRFQQENLDHNKILYEK  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A KK CTP+QLALAWVH
Sbjct  254  VQAMATKKSCTPAQLALAWVH  274



>ref|XP_007222412.1| hypothetical protein PRUPE_ppa008163mg [Prunus persica]
 gb|EMJ23611.1| hypothetical protein PRUPE_ppa008163mg [Prunus persica]
Length=343

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG  LVEN  NDD+RK LPRFQAENLEHNK  +E+
Sbjct  191  DIIPTCRELGIGIVAYSPLGRGFFSSGANLVENLPNDDFRKYLPRFQAENLEHNKTIFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  251  VSDLAARKGCTPSQLALAWVH  271



>ref|XP_008244437.1| PREDICTED: probable aldo-keto reductase 2 [Prunus mume]
Length=343

 Score =   142 bits (359),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG  LVEN  NDD+RK LPRFQAENLEHNK  +E+
Sbjct  191  DIIPTCRELGIGIVAYSPLGRGFFSSGANLVENLPNDDFRKYLPRFQAENLEHNKTIFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  251  VSDLAARKGCTPSQLALAWVH  271



>ref|XP_009371115.1| PREDICTED: probable aldo-keto reductase 2 [Pyrus x bretschneideri]
Length=343

 Score =   142 bits (359),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG  LV+N +NDD+RK LPRFQAENLEHNK  +E+
Sbjct  191  DIIPTCRELGIGIVAYSPLGRGFFSSGANLVDNLANDDFRKYLPRFQAENLEHNKTVFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  251  VSDLAARKGCTPSQLALAWVH  271



>ref|XP_006392127.1| hypothetical protein EUTSA_v10023574mg [Eutrema salsugineum]
 gb|ESQ29413.1| hypothetical protein EUTSA_v10023574mg [Eutrema salsugineum]
Length=345

 Score =   142 bits (358),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SGPKLVEN  N+D+RK LPRFQ ENL+HNK  YEK
Sbjct  193  EIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLENNDFRKTLPRFQQENLDHNKILYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  253  VCAMSEKKGCTPAQLALAWVH  273



>ref|XP_006487490.1| PREDICTED: probable aldo-keto reductase 3-like isoform X1 [Citrus 
sinensis]
Length=342

 Score =   142 bits (358),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAY PLG+GFLSSGPKLVE+FS  D+RKC+P+FQAENLEHNK+ +E+
Sbjct  190  EIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQAENLEHNKKLFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTP+QLALAWVH
Sbjct  250  VNEIAMRKGCTPAQLALAWVH  270



>gb|KDO50053.1| hypothetical protein CISIN_1g019368mg [Citrus sinensis]
Length=342

 Score =   142 bits (358),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAY PLG+GFLSSGPKLVE+FS  D+RKC+P+FQAENLEHNK+ +E+
Sbjct  190  EIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQAENLEHNKKLFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTP+QLALAWVH
Sbjct  250  VNEIAMRKGCTPAQLALAWVH  270



>emb|CAN80302.1| hypothetical protein VITISV_011599 [Vitis vinifera]
Length=317

 Score =   141 bits (356),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSG KLVEN SN+D+RK LPRFQ ENL HNK  YE+
Sbjct  166  EIVPTCRELGIGIVAYSPLGRGFLSSGTKLVENLSNNDFRKNLPRFQPENLGHNKILYER  225

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  226  VSEIATRKGCTPSQLALAWVH  246



>emb|CDP10297.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   142 bits (358),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKLVENF+  D RK +PRFQAENLEHNK  YE+
Sbjct  193  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLVENFTEGDARKNMPRFQAENLEHNKNLYEQ  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTPSQLALAWVH
Sbjct  253  VNGIASRKGCTPSQLALAWVH  273



>emb|CDP10290.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   141 bits (356),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGP L+ENFS  D+RK LPRFQ+EN+EHNK  YE+
Sbjct  165  EIIPTCRELGIGIVAYSPLGRGFFSSGPTLIENFSEGDFRKNLPRFQSENMEHNKNMYER  224

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA KKGCTPSQLALAWVH
Sbjct  225  VNVIASKKGCTPSQLALAWVH  245



>ref|XP_010244073.1| PREDICTED: probable aldo-keto reductase 2 [Nelumbo nucifera]
Length=341

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSGPK+VENF+ +D+R+ LPRFQ ENLEHNK  +++
Sbjct  190  DIIPTCRELGIGIVAYSPLGRGFFSSGPKVVENFTENDFRRNLPRFQPENLEHNKSVFDR  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  250  VNEIATRKGCTPSQLALAWVH  270



>ref|NP_176267.3| probable aldo-keto reductase 2 [Arabidopsis thaliana]
 sp|Q84M96.1|ALKR2_ARATH RecName: Full=Probable aldo-keto reductase 2; AltName: Full=ARF-GAP 
domain-containing protein 2 [Arabidopsis thaliana]
 gb|AAP21270.1| At1g60680 [Arabidopsis thaliana]
 dbj|BAE99526.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33719.1| probable aldo-keto reductase 2 [Arabidopsis thaliana]
Length=346

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IP CRELGIGIVAYSPLGRGFL++GPKL EN  NDD+RK LPRFQ EN++HNK  +EK
Sbjct  194  DIIPICRELGIGIVAYSPLGRGFLAAGPKLAENLENDDFRKTLPRFQQENVDHNKILFEK  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AEKKGCTP+QLALAWVH
Sbjct  254  VSAMAEKKGCTPAQLALAWVH  274



>gb|AAF17106.1|AF057715_1 auxin-induced atb2 [Arabidopsis thaliana]
Length=345

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SGPKLVEN   DD+RK LPRFQ ENL+HNK  YEK
Sbjct  193  EIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLEKDDFRKALPRFQEENLDHNKIVYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  I+EKKGCTP QLALAWVH
Sbjct  253  VCAISEKKGCTPGQLALAWVH  273



>ref|NP_564761.1| probable aldo-keto reductase 4 [Arabidopsis thaliana]
 sp|Q93ZN2.1|ALKR4_ARATH RecName: Full=Probable aldo-keto reductase 4 [Arabidopsis thaliana]
 gb|AAL08296.1| At1g60710/F8A5_23 [Arabidopsis thaliana]
 gb|AAM20506.1| auxin-induced protein, putative [Arabidopsis thaliana]
 gb|AAN15570.1| auxin-induced protein, putative [Arabidopsis thaliana]
 emb|CAE55217.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33722.1| probable aldo-keto reductase 4 [Arabidopsis thaliana]
Length=345

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SGPKLVEN   DD+RK LPRFQ ENL+HNK  YEK
Sbjct  193  EIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLEKDDFRKALPRFQEENLDHNKIVYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  I+EKKGCTP QLALAWVH
Sbjct  253  VCAISEKKGCTPGQLALAWVH  273



>ref|NP_564762.2| probable aldo-keto reductase 5 [Arabidopsis thaliana]
 sp|Q9ASZ9.1|ALKR5_ARATH RecName: Full=Probable aldo-keto reductase 5 [Arabidopsis thaliana]
 gb|AAK32744.1|AF361576_1 At1g60730/F8A5_24 [Arabidopsis thaliana]
 gb|AAM70571.1| At1g60730/F8A5_24 [Arabidopsis thaliana]
 gb|AEE33724.1| probable aldo-keto reductase 5 [Arabidopsis thaliana]
Length=345

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SGPKLVEN  N+D RK LPRFQ ENL+HNK  +EK
Sbjct  193  DIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLDNNDVRKTLPRFQQENLDHNKILFEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  253  VSAMSEKKGCTPAQLALAWVH  273



>ref|XP_009103955.1| PREDICTED: probable aldo-keto reductase 6 [Brassica rapa]
Length=346

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFL++GPKL ENF + DYRK LPRFQ ENL HNK  YEK
Sbjct  194  DIIPTCRELGIGIVAYSPLGRGFLAAGPKLAENFEDHDYRKGLPRFQEENLNHNKILYEK  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A KKGCTP+QLALAWVH
Sbjct  254  VQAMATKKGCTPAQLALAWVH  274



>ref|XP_006392133.1| hypothetical protein EUTSA_v10023904mg [Eutrema salsugineum]
 dbj|BAJ33645.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29419.1| hypothetical protein EUTSA_v10023904mg [Eutrema salsugineum]
Length=345

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLG+GF +SGPKLVEN +N+D+RK LPRFQ ENL+HNK  YEK
Sbjct  193  DIVPTCRELGIGIVAYSPLGKGFFASGPKLVENLNNNDFRKRLPRFQQENLDHNKILYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  253  VCAMSEKKGCTPAQLALAWVH  273



>emb|CBI39431.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGFLSSG K+VEN S++D RK  PRFQ ENLEHNK  YE+
Sbjct  167  DIVPTCRELGIGIVAYSPLGRGFLSSGAKMVENLSDNDSRKYFPRFQPENLEHNKILYER  226

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  227  VSEIATRKGCTPSQLALAWVH  247



>ref|XP_008222728.1| PREDICTED: LOW QUALITY PROTEIN: probable aldo-keto reductase 
2 [Prunus mume]
Length=343

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG KL EN  NDD RK LPRFQAENLEHNK  +E+
Sbjct  191  DIIPTCRELGIGIVAYSPLGRGFFSSGAKLFENLPNDDVRKYLPRFQAENLEHNKTIFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  251  VSDLAARKGCTPSQLALAWVH  271



>ref|XP_010251377.1| PREDICTED: probable aldo-keto reductase 2 [Nelumbo nucifera]
Length=342

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG K+VEN S+DD+RK LPRFQ ENLEHNK  +E+
Sbjct  190  DIIPTCRELGIGIVAYSPLGRGFFSSGYKVVENLSDDDFRKTLPRFQPENLEHNKHIFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+++KKGCTP+QLALAWVH
Sbjct  250  VNEMSKKKGCTPAQLALAWVH  270



>ref|XP_007224543.1| hypothetical protein PRUPE_ppa024588mg [Prunus persica]
 gb|EMJ25742.1| hypothetical protein PRUPE_ppa024588mg [Prunus persica]
Length=334

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG K  EN  NDD+RK LPRFQAENLEHNK  +E+
Sbjct  182  DIIPTCRELGIGIVAYSPLGRGFFSSGAKFFENLPNDDFRKYLPRFQAENLEHNKTIFEQ  241

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  242  VSDLAARKGCTPSQLALAWVH  262



>emb|CAN77719.1| hypothetical protein VITISV_033356 [Vitis vinifera]
Length=202

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF SSGPKLVEN S DDYRK LPRF+ ENL+ N   +E+
Sbjct  52   DIVPTCRELGIGIVAYSPLGRGFFSSGPKLVENLSQDDYRKDLPRFRPENLKDNSNIFER  111

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + +IA +KGCTPSQLALAWVH
Sbjct  112  VNKIAARKGCTPSQLALAWVH  132



>ref|NP_001185274.1| probable aldo-keto reductase 5 [Arabidopsis thaliana]
 gb|AEE33726.1| probable aldo-keto reductase 5 [Arabidopsis thaliana]
Length=365

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SGPKLVEN  N+D RK LPRFQ ENL+HNK  +EK
Sbjct  213  DIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLDNNDVRKTLPRFQQENLDHNKILFEK  272

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  273  VSAMSEKKGCTPAQLALAWVH  293



>ref|NP_176268.1| probable aldo-keto reductase 3 [Arabidopsis thaliana]
 sp|O22707.1|ALKR3_ARATH RecName: Full=Probable aldo-keto reductase 3 [Arabidopsis thaliana]
 gb|AAB71981.1| Highly similar to auxin-induced protein (aldo/keto reductase 
family) [Arabidopsis thaliana]
 gb|AEE33720.1| NAD(P)-linked oxidoreductase superfamily protein [Arabidopsis 
thaliana]
Length=345

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIV+YSPLGRGF +SGPKLVEN  N+D+RK LPRFQ ENL+HNK  YEK
Sbjct  193  EIVPTCRELGIGIVSYSPLGRGFFASGPKLVENLDNNDFRKALPRFQQENLDHNKILYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  253  VSAMSEKKGCTPAQLALAWVH  273



>ref|XP_009371118.1| PREDICTED: probable aldo-keto reductase 2 [Pyrus x bretschneideri]
Length=343

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG   V+N +NDD+RK LPRFQAENLEHNK  +E+
Sbjct  191  DIIPTCRELGIGIVAYSPLGRGFFSSGANFVDNLANDDFRKYLPRFQAENLEHNKTVFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  251  VSDLAARKGCTPSQLALAWVH  271



>emb|CDP19923.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLG+GF SSGPKL+EN +  D+RK LPRFQAENLEHNK+ YE+
Sbjct  201  EIIPTCRELGIGIVAYSPLGQGFFSSGPKLIENLTEGDFRKYLPRFQAENLEHNKKLYER  260

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTPSQLALAWVH
Sbjct  261  VNAIASRKGCTPSQLALAWVH  281



>ref|XP_002265927.1| PREDICTED: probable aldo-keto reductase 2 [Vitis vinifera]
Length=341

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGFLSSG K+VEN S++D RK  PRFQ ENLEHNK  YE+
Sbjct  190  DIVPTCRELGIGIVAYSPLGRGFLSSGAKMVENLSDNDSRKYFPRFQPENLEHNKILYER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  250  VSEIATRKGCTPSQLALAWVH  270



>ref|XP_006358803.1| PREDICTED: probable aldo-keto reductase 4-like [Solanum tuberosum]
Length=349

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IP CRELGIGIVAYSPLG+GFLSSGPKL+E+ SN+D+RK +PRFQAENLEHNK  Y++
Sbjct  196  EIIPICRELGIGIVAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLEHNKILYKR  255

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I ++A KKGCTPSQLALAWVH
Sbjct  256  ICQMATKKGCTPSQLALAWVH  276



>emb|CAN67592.1| hypothetical protein VITISV_015428 [Vitis vinifera]
Length=335

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGFLSSG K+VEN S++D RK  PRFQ ENLEHNK  YE+
Sbjct  184  DIVPTCRELGIGIVAYSPLGRGFLSSGAKMVENLSDNDSRKYFPRFQPENLEHNKILYER  243

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  244  VSEIATRKGCTPSQLALAWVH  264



>ref|XP_006302496.1| hypothetical protein CARUB_v10020589mg [Capsella rubella]
 gb|EOA35394.1| hypothetical protein CARUB_v10020589mg [Capsella rubella]
Length=344

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF ++GPKLVEN   DD+RK LPRFQ ENL+HNK  YEK
Sbjct  192  EIIPTCRELGIGIVAYSPLGRGFFAAGPKLVENLEKDDFRKALPRFQEENLDHNKIVYEK  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  I+EKKGCTP+QLALAWVH
Sbjct  252  VCAISEKKGCTPAQLALAWVH  272



>ref|XP_002265775.1| PREDICTED: probable aldo-keto reductase 2 [Vitis vinifera]
Length=203

 Score =   137 bits (345),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF SSGPKLVEN S DDYRK LPRF  ENL+ N   +E+
Sbjct  52   DIVPTCRELGIGIVAYSPLGRGFFSSGPKLVENLSQDDYRKDLPRFHPENLKDNSNIFER  111

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + +IA +KGCTPSQLALAWVH
Sbjct  112  VNKIAARKGCTPSQLALAWVH  132



>ref|XP_009113193.1| PREDICTED: probable aldo-keto reductase 3 [Brassica rapa]
Length=347

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIV+YSPLGRGF +SGPKLVE   NDD+RK LPRFQ ENL+HNK  Y+K
Sbjct  194  DIVPTCRELGIGIVSYSPLGRGFFASGPKLVEKLDNDDFRKTLPRFQQENLDHNKILYDK  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  254  VCAMSEKKGCTPAQLALAWVH  274



>emb|CBI39428.3| unnamed protein product [Vitis vinifera]
Length=200

 Score =   137 bits (344),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF SSGPKLVEN S DDYRK LPRF  ENL+ N   +E+
Sbjct  49   DIVPTCRELGIGIVAYSPLGRGFFSSGPKLVENLSQDDYRKDLPRFHPENLKDNSNIFER  108

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + +IA +KGCTPSQLALAWVH
Sbjct  109  VNKIAARKGCTPSQLALAWVH  129



>ref|XP_010553616.1| PREDICTED: probable aldo-keto reductase 4 isoform X2 [Tarenaya 
hassleriana]
Length=345

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SGPKL+E     D+RK LPRFQAENL+HNK  YEK
Sbjct  192  DIIPTCRELGIGIVAYSPLGRGFFASGPKLLEKLEQGDFRKNLPRFQAENLDHNKVLYEK  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AEKKGCTP QLALAWVH
Sbjct  252  VTAMAEKKGCTPGQLALAWVH  272



>ref|XP_004296671.1| PREDICTED: probable aldo-keto reductase 2-like [Fragaria vesca 
subsp. vesca]
Length=342

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLSSG K VEN +NDD+RK LPRFQ ENLEHNK  +E+
Sbjct  190  DIIPTCRELGIGIVAYSPLGRGFLSSGAKFVENLANDDFRKFLPRFQGENLEHNKSIFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCT SQLALAWVH
Sbjct  250  VSDLATRKGCTSSQLALAWVH  270



>ref|XP_002889838.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66097.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=331

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF ++GPK +EN  N DYRK LPRFQ ENL+HNK  YEK
Sbjct  180  DIIPTCRELGIGIVAYSPLGRGFFAAGPKFIENMDNGDYRKGLPRFQQENLDHNKILYEK  239

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AEKK CTP+QLALAWVH
Sbjct  240  VNAMAEKKSCTPAQLALAWVH  260



>emb|CAN68994.1| hypothetical protein VITISV_040294 [Vitis vinifera]
Length=341

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSG KLVEN SN+D+RK LPRFQ ENL HNK  YE+
Sbjct  190  EIVPTCRELGIGIVAYSPLGRGFFSSGAKLVENLSNNDFRKNLPRFQPENLGHNKILYER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  250  VSEIATRKGCTPSQLALAWVH  270



>gb|KFK30953.1| hypothetical protein AALP_AA6G049000 [Arabis alpina]
Length=336

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF +SGPK+VEN  N+D RK LPRFQ ENL+HNK  YEK
Sbjct  184  EIVPTCRELGIGIVAYSPLGRGFFASGPKIVENLDNNDIRKTLPRFQQENLDHNKTLYEK  243

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  244  VCAMSEKKGCTPAQLALAWVH  264



>ref|XP_010491933.1| PREDICTED: probable aldo-keto reductase 1 isoform X2 [Camelina 
sativa]
Length=278

 Score =   139 bits (349),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF ++GPK +EN  N DYRK LPRFQ ENL+HNK  YEK
Sbjct  127  DIIPTCRELGIGIVAYSPLGRGFFAAGPKFIENMDNGDYRKGLPRFQQENLDHNKILYEK  186

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AEKK CTP+QLALAWVH
Sbjct  187  VNAMAEKKSCTPAQLALAWVH  207



>ref|XP_003531918.1| PREDICTED: probable aldo-keto reductase 2-like isoformX1 [Glycine 
max]
 ref|XP_006585846.1| PREDICTED: probable aldo-keto reductase 2-like isoform X2 [Glycine 
max]
 gb|KHN15572.1| Putative aldo-keto reductase 2 [Glycine soja]
Length=342

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSGPKL+EN + DD+R+ LPRFQ ENLE NK  +E+
Sbjct  190  EIVPTCRELGIGIVAYSPLGRGFLSSGPKLLENLTQDDFRQSLPRFQPENLEQNKTIFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A KKGCTPSQLALAWVH
Sbjct  250  VNELAAKKGCTPSQLALAWVH  270



>ref|XP_010458446.1| PREDICTED: LOW QUALITY PROTEIN: probable aldo-keto reductase 
1 [Camelina sativa]
Length=344

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF ++GPK +EN  N DYRK LPRFQ ENL+HNK  YEK
Sbjct  193  DIIPTCRELGIGIVAYSPLGRGFFAAGPKFIENMDNGDYRKGLPRFQQENLDHNKILYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AEKK CTP+QLALAWVH
Sbjct  253  VNAMAEKKSCTPAQLALAWVH  273



>emb|CBI39433.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   139 bits (350),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSG KL+EN SN+D+RK LPRFQ ENL HNK  YE+
Sbjct  165  EIVPTCRELGIGIVAYSPLGRGFFSSGTKLIENLSNNDFRKNLPRFQPENLGHNKILYER  224

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  225  VSEIATRKGCTPSQLALAWVH  245



>gb|KFK22425.1| hypothetical protein AALP_AAs39864U000300 [Arabis alpina]
Length=346

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLG+GFL+SGPKLVEN   DDYRK LPR Q ENL+HNK  YEK
Sbjct  194  DIVPTCRELGIGIVAYSPLGKGFLASGPKLVENLDQDDYRKTLPRLQQENLDHNKILYEK  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A KKGC P+QLALAWVH
Sbjct  254  VQAMATKKGCNPAQLALAWVH  274



>ref|XP_010553615.1| PREDICTED: probable aldo-keto reductase 4 isoform X1 [Tarenaya 
hassleriana]
Length=383

 Score =   140 bits (353),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SGPKL+E     D+RK LPRFQAENL+HNK  YEK
Sbjct  230  DIIPTCRELGIGIVAYSPLGRGFFASGPKLLEKLEQGDFRKNLPRFQAENLDHNKVLYEK  289

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AEKKGCTP QLALAWVH
Sbjct  290  VTAMAEKKGCTPGQLALAWVH  310



>ref|XP_002886601.1| ARF-GAP domain 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62860.1| ARF-GAP domain 2 [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   140 bits (352),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFL+SGPKL EN  +DD+RK LPRFQ ENL+HNK  +EK
Sbjct  194  DIIPTCRELGIGIVAYSPLGRGFLASGPKLAENLEDDDFRKTLPRFQQENLDHNKILFEK  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++ KKGC+P+QLALAWVH
Sbjct  254  VSAMSAKKGCSPAQLALAWVH  274



>emb|CDP20358.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   142 bits (357),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKLVENF+  D RK +PRFQAENLEHNK  YE+
Sbjct  354  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLVENFTEGDRRKGMPRFQAENLEHNKNLYEQ  413

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTPSQLALAWVH
Sbjct  414  VNAIASRKGCTPSQLALAWVH  434


 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRF  73
            ++IPTCRELGIGIVAYSPLGRGF SSGPKL+EN +  DYRK L       +E   +F
Sbjct  195  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLIENLAEGDYRKALKEGIRAKVELATKF  251



>ref|XP_010418017.1| PREDICTED: probable aldo-keto reductase 4 [Camelina sativa]
Length=344

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SGPKLVEN   DD+RK LPRFQ ENL++NK  YEK
Sbjct  192  EIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLDKDDFRKALPRFQEENLDNNKIVYEK  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  I+EKKGCTP+QLALAWVH
Sbjct  252  VCAISEKKGCTPAQLALAWVH  272



>ref|XP_010475965.1| PREDICTED: probable aldo-keto reductase 1 isoform X1 [Camelina 
sativa]
 ref|XP_010475966.1| PREDICTED: probable aldo-keto reductase 1 isoform X2 [Camelina 
sativa]
Length=344

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF ++GPK +EN  N DYRK LPRFQ ENL+HNK  YEK
Sbjct  193  DIIPTCRELGIGIVAYSPLGRGFFAAGPKFIENMDNGDYRKGLPRFQQENLDHNKILYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AEKK CTP+QLALAWVH
Sbjct  253  VNAMAEKKSCTPAQLALAWVH  273



>ref|XP_010473254.1| PREDICTED: probable aldo-keto reductase 4 [Camelina sativa]
Length=344

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SGPKLVEN   DD+RK LPRFQ ENL++NK  YEK
Sbjct  192  EIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLDKDDFRKALPRFQEENLDNNKIVYEK  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  I+EKKGCTP+QLALAWVH
Sbjct  252  VCAISEKKGCTPAQLALAWVH  272



>ref|XP_010491924.1| PREDICTED: probable aldo-keto reductase 1 isoform X1 [Camelina 
sativa]
Length=345

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF ++GPK +EN  N DYRK LPRFQ ENL+HNK  YEK
Sbjct  194  DIIPTCRELGIGIVAYSPLGRGFFAAGPKFIENMDNGDYRKGLPRFQQENLDHNKILYEK  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AEKK CTP+QLALAWVH
Sbjct  254  VNAMAEKKSCTPAQLALAWVH  274



>ref|XP_010511057.1| PREDICTED: probable aldo-keto reductase 4 [Camelina sativa]
Length=344

 Score =   139 bits (351),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +VIPTCRELGIGIVAYSPLGRGF +SGPKLVEN   +D+RK LPRFQ ENL+HNK  YEK
Sbjct  192  EVIPTCRELGIGIVAYSPLGRGFFASGPKLVENLDKNDFRKALPRFQEENLDHNKIVYEK  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  I+E KGCTP+QLALAWVH
Sbjct  252  VCAISENKGCTPAQLALAWVH  272



>emb|CDP19924.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   139 bits (351),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKL EN +  D+RK +PRFQAENLEHNK  YE+
Sbjct  197  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLSENLAEGDFRKHMPRFQAENLEHNKNLYEQ  256

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTPSQLALAWVH
Sbjct  257  VNAIASRKGCTPSQLALAWVH  277



>emb|CDP10291.1| unnamed protein product [Coffea canephora]
Length=303

 Score =   138 bits (348),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKL+EN +  D RK +PRFQAENLEHNK  Y++
Sbjct  152  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLIENLAEGDLRKYMPRFQAENLEHNKNLYQQ  211

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTPSQLALAWVH
Sbjct  212  VNAIASRKGCTPSQLALAWVH  232



>emb|CAN80303.1| hypothetical protein VITISV_011600 [Vitis vinifera]
Length=353

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLS G K+ EN SNDDYRK LPRFQ EN+EHN   +E+
Sbjct  202  DIIPTCRELGIGIVAYSPLGRGFLSLGAKVAENLSNDDYRKTLPRFQPENIEHNNILFER  261

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCT SQLALAWVH
Sbjct  262  VKEIATRKGCTTSQLALAWVH  282



>ref|XP_010510914.1| PREDICTED: probable aldo-keto reductase 6 [Camelina sativa]
Length=347

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SGPKLVEN   DDYRK LPRFQ ENL++NK  YEK
Sbjct  195  DIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLDQDDYRKGLPRFQQENLDNNKVLYEK  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A KK CTP+QLALAWVH
Sbjct  255  VQAMATKKSCTPAQLALAWVH  275



>ref|XP_009113195.1| PREDICTED: probable aldo-keto reductase 4 [Brassica rapa]
Length=345

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF ++GPKLVE   NDD+RK LPRF+ ENL+HNK  Y+K
Sbjct  193  DIIPTCRELGIGIVAYSPLGRGFFAAGPKLVEKLDNDDFRKRLPRFKQENLDHNKILYDK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  253  VCAMSEKKGCTPAQLALAWVH  273



>emb|CDP10295.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   138 bits (347),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLG+GF SSGPKL+EN +  DYRK  PRFQAENLEHN   YE+
Sbjct  152  EIIPTCRELGIGIVAYSPLGQGFFSSGPKLIENLTEGDYRKYQPRFQAENLEHNTNLYER  211

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTPSQLALAWVH
Sbjct  212  VNAIASRKGCTPSQLALAWVH  232



>ref|XP_011000038.1| PREDICTED: probable aldo-keto reductase 2 [Populus euphratica]
Length=345

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSGPKLVE+F+  D+RK LPRFQ ENL+HNK+ +E+
Sbjct  193  EIVPTCRELGIGIVAYSPLGRGFLSSGPKLVESFTEGDFRKHLPRFQPENLDHNKQLFER  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +K CTPSQLALAWVH
Sbjct  253  VNEIAARKQCTPSQLALAWVH  273



>ref|XP_009794432.1| PREDICTED: auxin-induced protein PCNT115-like [Nicotiana sylvestris]
Length=346

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGP+L+E+ S++D+ K LPRFQA+NLEHNK  YE+
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFLSSGPELLEDLSSEDFPKHLPRFQADNLEHNKILYER  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I ++A KKGCTPSQLALAWVH
Sbjct  254  ICQMAAKKGCTPSQLALAWVH  274



>emb|CBI39434.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLS G K+ EN SNDDYRK LPRFQ EN+EHN   +E+
Sbjct  165  DIIPTCRELGIGIVAYSPLGRGFLSLGAKVAENLSNDDYRKTLPRFQPENIEHNNILFER  224

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCT SQLALAWVH
Sbjct  225  VKEIATRKGCTTSQLALAWVH  245



>ref|XP_009113187.1| PREDICTED: probable aldo-keto reductase 4 [Brassica rapa]
Length=391

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SGPKLVE    +D+RK LPRFQ ENL+HNK  YEK
Sbjct  239  DIIPTCRELGIGIVAYSPLGRGFFASGPKLVEKLDQNDFRKTLPRFQQENLDHNKIMYEK  298

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP QLALAWVH
Sbjct  299  VCAMSEKKGCTPGQLALAWVH  319



>emb|CDP10303.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKLVEN +  D RK +PRFQAENLEHNK+ YE+
Sbjct  195  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLVENLAEGDCRKDMPRFQAENLEHNKKLYER  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
               IA +KGCTPSQLALAWVH
Sbjct  255  ANAIASRKGCTPSQLALAWVH  275



>gb|KFK30952.1| hypothetical protein AALP_AA6G048900 [Arabis alpina]
Length=345

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELG GIVAYSPLGRGF +SGPKLVE   NDD+RK LPRFQ ENL+HNK  YEK
Sbjct  193  EIVPTCRELGSGIVAYSPLGRGFFASGPKLVEKLDNDDFRKTLPRFQQENLDHNKILYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  253  VCAMSEKKGCTPAQLALAWVH  273



>ref|XP_002266277.1| PREDICTED: probable aldo-keto reductase 2 [Vitis vinifera]
Length=341

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLS G K+ EN SNDDYRK LPRFQ EN+EHN   +E+
Sbjct  190  DIIPTCRELGIGIVAYSPLGRGFLSLGAKVAENLSNDDYRKTLPRFQPENIEHNNILFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCT SQLALAWVH
Sbjct  250  VKEIATRKGCTTSQLALAWVH  270



>ref|XP_010107237.1| hypothetical protein L484_021760 [Morus notabilis]
 gb|EXC14261.1| hypothetical protein L484_021760 [Morus notabilis]
Length=493

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF+SSGPK+VE  S+DDYRK LPRFQ ENL+HN++ +E+
Sbjct  191  EIIPTCRELGIGIVAYSPLGRGFMSSGPKIVEKMSDDDYRKTLPRFQPENLQHNQKIFEQ  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWV+
Sbjct  251  VNEIASRKGCTPSQLALAWVY  271



>gb|KFK30951.1| hypothetical protein AALP_AA6G048800 [Arabis alpina]
Length=350

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFL+SGPKLV+N   DDYRK LPRFQ ENL+HNK  YE 
Sbjct  197  EIIPTCRELGIGIVAYSPLGRGFLASGPKLVDNLDQDDYRKTLPRFQQENLDHNKIIYEN  256

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A KK CTP+QLALAWVH
Sbjct  257  VQAMATKKSCTPAQLALAWVH  277



>emb|CDP10302.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IP CR+LGIGIVAYSPLGRGF SSGPKL+EN +  D+RK +PRFQAENLEHNK  YE+
Sbjct  167  EIIPACRDLGIGIVAYSPLGRGFFSSGPKLIENLAEGDFRKYMPRFQAENLEHNKNLYEQ  226

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTPSQLALAWVH
Sbjct  227  VNAIASRKGCTPSQLALAWVH  247



>gb|KEH21873.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=160

 Score =   133 bits (335),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            DVIPTCRELGIGIVAYSPLGRGF SSG KL++N   DDYRK LPRFQ ENL+ N+  ++K
Sbjct  47   DVIPTCRELGIGIVAYSPLGRGFFSSGTKLLDNLQQDDYRKHLPRFQPENLQQNQTIFDK  106

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A KKGCTPSQLALAW+H
Sbjct  107  VNELAVKKGCTPSQLALAWLH  127



>ref|XP_009113191.1| PREDICTED: probable aldo-keto reductase 4 [Brassica rapa]
Length=344

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +VIPTCRELGIGIVAYSPLGRGF ++GPKL+EN  N+DYRK LPRFQ ENL HNK  YEK
Sbjct  192  EVIPTCRELGIGIVAYSPLGRGFFAAGPKLLENIENNDYRKTLPRFQPENLVHNKILYEK  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAW+H
Sbjct  252  VCAMSEKKGCTPAQLALAWLH  272



>gb|KGN53069.1| hypothetical protein Csa_4G015100 [Cucumis sativus]
Length=341

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLSSG   ++N + DDYRK LPRFQ ENLEHNK  +EK
Sbjct  190  DIIPTCRELGIGIVAYSPLGRGFLSSGATFIQNLTEDDYRKKLPRFQPENLEHNKSIFEK  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A +KGCT SQLALAWVH
Sbjct  250  VSELAARKGCTTSQLALAWVH  270



>ref|XP_004152112.1| PREDICTED: probable aldo-keto reductase 2-like [Cucumis sativus]
Length=342

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKLVE   ++D+RK LPRFQ ENLEHNK  +EK
Sbjct  191  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLVEGLEDNDFRKHLPRFQGENLEHNKTVFEK  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IAE+KGCT SQLALAWVH
Sbjct  251  VSAIAERKGCTTSQLALAWVH  271



>ref|XP_006392126.1| hypothetical protein EUTSA_v10024059mg [Eutrema salsugineum]
 gb|ESQ29412.1| hypothetical protein EUTSA_v10024059mg [Eutrema salsugineum]
Length=345

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCREL IGIVAYSPLGRGF +SGPKLVE   NDD+RK LPRFQ ENL+HNK  YEK
Sbjct  193  EIVPTCRELRIGIVAYSPLGRGFFASGPKLVEKLDNDDFRKTLPRFQQENLDHNKILYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  253  VCAMSEKKGCTPAQLALAWVH  273



>ref|XP_004156942.1| PREDICTED: probable aldo-keto reductase 4-like [Cucumis sativus]
 gb|KGN53050.1| hypothetical protein Csa_4G012460 [Cucumis sativus]
Length=342

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKLVE   ++D+RK LPRFQ ENLEHNK  +EK
Sbjct  191  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLVEGLEDNDFRKHLPRFQGENLEHNKTVFEK  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IAE+KGCT SQLALAWVH
Sbjct  251  VSAIAERKGCTTSQLALAWVH  271



>ref|XP_002886596.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62855.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SGP LVEN  N+D RK LPRFQ ENL HNK  +EK
Sbjct  193  DIIPTCRELGIGIVAYSPLGRGFFASGPNLVENLDNNDVRKTLPRFQQENLVHNKILFEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  253  VSAMSEKKGCTPAQLALAWVH  273



>gb|ABK95612.1| unknown [Populus trichocarpa]
Length=345

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSGPKLVE+F+  D+RK LPRFQ ENL+HN++ +E+
Sbjct  193  EIVPTCRELGIGIVAYSPLGRGFLSSGPKLVESFTEGDFRKHLPRFQPENLDHNRQLFER  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +K CTPSQLALAWVH
Sbjct  253  VNEIAARKQCTPSQLALAWVH  273



>ref|XP_007034102.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY05028.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=417

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSGPK+VE  SNDD+RK LPRFQ ENL+HN+R +E+
Sbjct  265  EIVPTCRELGIGIVAYSPLGRGFLSSGPKMVETLSNDDFRKYLPRFQPENLKHNERLFEQ  324

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + +IA +K CTPSQLALAW+H
Sbjct  325  VNKIAARKECTPSQLALAWIH  345



>ref|XP_008454010.1| PREDICTED: probable aldo-keto reductase 4 [Cucumis melo]
Length=342

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKL+E   ++D+RK LPRFQ ENLEHNK  +EK
Sbjct  191  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLIEGLQDNDFRKHLPRFQGENLEHNKTVFEK  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IAE+KGCT SQLALAWVH
Sbjct  251  VSAIAERKGCTSSQLALAWVH  271



>ref|XP_002266027.2| PREDICTED: probable aldo-keto reductase 4 [Vitis vinifera]
Length=534

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSG KL+EN SN+D+RK LPRFQ ENL HNK  YE+
Sbjct  190  EIVPTCRELGIGIVAYSPLGRGFFSSGTKLIENLSNNDFRKNLPRFQPENLGHNKILYER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  250  VSEIATRKGCTPSQLALAWVH  270


 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYS LGRGFLSSG K+VEN S++D RK LPRFQ ENLEHNK  YE+
Sbjct  383  DIVPTCRELGIGIVAYSSLGRGFLSSGAKMVENLSDNDLRKNLPRFQPENLEHNKILYER  442

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  443  VSEIATRKGCTPSQLALAWVH  463



>ref|XP_002886599.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62858.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIV+YSPLGRGF +SGPKLVEN  N+D+RK LPRFQ ENL+HNK  YEK
Sbjct  193  EIVPTCRELGIGIVSYSPLGRGFFASGPKLVENLVNNDFRKALPRFQQENLDHNKILYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  I++KKGC+P QLALAWVH
Sbjct  253  VCAISKKKGCSPGQLALAWVH  273



>ref|XP_002886597.1| hypothetical protein ARALYDRAFT_475260 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62856.1| hypothetical protein ARALYDRAFT_475260 [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SGPKLVEN   DD+RK LPRF  +NL+HNK  YEK
Sbjct  193  EIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLEKDDFRKALPRFLEKNLDHNKIVYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  I+EKKGCTP+QLALAWVH
Sbjct  253  VCAISEKKGCTPAQLALAWVH  273



>ref|XP_010251376.1| PREDICTED: probable aldo-keto reductase 2 [Nelumbo nucifera]
Length=342

 Score =   137 bits (346),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG K V+N ++DD+RK LPRFQ ENLEHN   +E+
Sbjct  190  DIIPTCRELGIGIVAYSPLGRGFFSSGKKFVDNLADDDFRKLLPRFQPENLEHNNSIFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A +KGCTPSQLALAWVH
Sbjct  250  VNELAARKGCTPSQLALAWVH  270



>ref|XP_010107226.1| hypothetical protein L484_021748 [Morus notabilis]
 gb|EXC14250.1| hypothetical protein L484_021748 [Morus notabilis]
Length=227

 Score =   134 bits (338),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGPKLVE  +++D+RK LPRFQ +NLEHNK  +E+
Sbjct  62   EIIPTCRELGIGIVAYSPLGRGFLSSGPKLVETLTDNDFRKKLPRFQGKNLEHNKTIFER  121

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KG TP+QLALAWVH
Sbjct  122  LNEIAARKGRTPAQLALAWVH  142



>ref|XP_010418018.1| PREDICTED: probable aldo-keto reductase 6 [Camelina sativa]
Length=347

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SGPK+VEN   DDYRK LPRFQ ENL++NK  YEK
Sbjct  195  DIIPTCRELGIGIVAYSPLGRGFFASGPKIVENLDQDDYRKILPRFQQENLDNNKILYEK  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +K CTP+QLALAWVH
Sbjct  255  VQAMATRKSCTPAQLALAWVH  275



>ref|XP_010673286.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=343

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLSSGPK+ ENF  +D+R+ LPRF+ ENLEHNK  +E+
Sbjct  191  DIIPTCRELGIGIVAYSPLGRGFLSSGPKMTENFVKEDFRQHLPRFKPENLEHNKLIFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTP+QLALAWVH
Sbjct  251  VSAIATRKGCTPAQLALAWVH  271



>ref|XP_008337505.1| PREDICTED: probable aldo-keto reductase 2 [Malus domestica]
Length=343

 Score =   137 bits (345),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIV YSPLGRGF SSG  LV+N +NDD+RK LPRFQAENLEHNK  + +
Sbjct  191  DIIPTCRELGIGIVXYSPLGRGFFSSGANLVDNLANDDFRKYLPRFQAENLEHNKTIFXR  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + + A +KGCTPSQLALAWVH
Sbjct  251  VSDXAARKGCTPSQLALAWVH  271



>ref|XP_010510923.1| PREDICTED: probable aldo-keto reductase 3 isoform X1 [Camelina 
sativa]
Length=334

 Score =   137 bits (344),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAY PLGRGF +SGPKLVEN   DD+RK LPRFQ ENL+HNK  +EK
Sbjct  182  EIVPTCRELGIGIVAYCPLGRGFFASGPKLVENLDKDDFRKALPRFQQENLDHNKILFEK  241

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP QLALAWVH
Sbjct  242  VFAMSEKKGCTPGQLALAWVH  262



>ref|XP_008367679.1| PREDICTED: LOW QUALITY PROTEIN: probable aldo-keto reductase 
2 [Malus domestica]
Length=344

 Score =   137 bits (345),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIV+YSPLGRGF SSG  +V+N +NDD+RK LPRFQAENLEHNK  + +
Sbjct  192  DIIPTCRELGIGIVSYSPLGRGFFSSGANIVDNLANDDFRKYLPRFQAENLEHNKTIFXR  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + + A +KGCTPSQLALAWVH
Sbjct  252  VSDXAARKGCTPSQLALAWVH  272



>gb|EYU24276.1| hypothetical protein MIMGU_mgv1a009306mg [Erythranthe guttata]
Length=346

 Score =   137 bits (345),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKLVE  S  D+RK LPRFQ ENLEHNK+ +E+
Sbjct  196  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLVETLSQGDFRKYLPRFQPENLEHNKKLFER  255

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQ+ALAW+H
Sbjct  256  VSDMANEKGCTPSQIALAWLH  276



>ref|XP_010510924.1| PREDICTED: probable aldo-keto reductase 3 isoform X2 [Camelina 
sativa]
Length=344

 Score =   137 bits (344),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAY PLGRGF +SGPKLVEN   DD+RK LPRFQ ENL+HNK  +EK
Sbjct  192  EIVPTCRELGIGIVAYCPLGRGFFASGPKLVENLDKDDFRKALPRFQQENLDHNKILFEK  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP QLALAWVH
Sbjct  252  VFAMSEKKGCTPGQLALAWVH  272



>gb|ABA26959.1| TO3-34 [Taraxacum officinale]
Length=110

 Score =   130 bits (328),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPK++EN  + D RK LPRFQ EN+EHN   ++K
Sbjct  3    EIIPTCRELGIGIVAYSPLGRGFFSSGPKVLENLEDGDLRKYLPRFQGENIEHNTIMFKK  62

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A KKGCTPSQL+LAWVH
Sbjct  63   VSDMAAKKGCTPSQLSLAWVH  83



>gb|EMT06430.1| Auxin-induced protein [Aegilops tauschii]
Length=283

 Score =   135 bits (340),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLS+GPKLV+    DD+RK LPRFQ EN+E N   +E+
Sbjct  127  DIIPTCRELGIGIVAYSPLGRGFLSTGPKLVDTLPEDDFRKNLPRFQPENMEKNATIFER  186

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A +KGCT SQLALAWVH
Sbjct  187  VSEMAARKGCTSSQLALAWVH  207



>ref|XP_002302899.2| hypothetical protein POPTR_0002s23510g [Populus trichocarpa]
 gb|EEE82172.2| hypothetical protein POPTR_0002s23510g [Populus trichocarpa]
Length=344

 Score =   137 bits (344),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSGPKLVE+F++ DYRK LPRFQ ENLEHN + +E+
Sbjct  192  EIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFTDGDYRKGLPRFQPENLEHNSQLFER  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +K CT SQLALAWVH
Sbjct  252  VKEIAARKQCTSSQLALAWVH  272



>gb|ABN08809.1| Aldo/keto reductase [Medicago truncatula]
Length=181

 Score =   132 bits (333),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            DVIPTCRELGIGIVAYSPLGRGF SSG KL++N   DDYRK LPRFQ ENL+ N+  ++K
Sbjct  68   DVIPTCRELGIGIVAYSPLGRGFFSSGTKLLDNLQQDDYRKHLPRFQPENLQQNQTIFDK  127

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A KKGCTPSQLALAW+H
Sbjct  128  VNELAVKKGCTPSQLALAWLH  148



>ref|XP_006423333.1| hypothetical protein CICLE_v10028780mg [Citrus clementina]
 gb|ESR36573.1| hypothetical protein CICLE_v10028780mg [Citrus clementina]
Length=275

 Score =   135 bits (340),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG KL E+ S  DYRK LPRFQ  NLEHN++ +E+
Sbjct  123  DIIPTCRELGIGIVAYSPLGRGFFSSGSKLAESLSEGDYRKHLPRFQPGNLEHNQKLFER  182

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA  KGCTPSQLALAWVH
Sbjct  183  VNEIAANKGCTPSQLALAWVH  203



>ref|XP_008453991.1| PREDICTED: probable aldo-keto reductase 2 [Cucumis melo]
Length=341

 Score =   136 bits (343),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLSSG   ++N + DDYRK LPRFQ ENLEHN   +EK
Sbjct  190  DIIPTCRELGIGIVAYSPLGRGFLSSGATFIQNLTQDDYRKKLPRFQPENLEHNNSIFEK  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A +KGCT SQLALAWVH
Sbjct  250  VSELAARKGCTTSQLALAWVH  270



>gb|AAB71980.1| Highly similar to auxin-induced protein (aldo/keto reductase 
family) [Arabidopsis thaliana]
Length=340

 Score =   136 bits (343),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 3/84 (4%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKC---LPRFQAENLEHNKRF  73
            D+IP CRELGIGIVAYSPLGRGFL++GPKL EN  NDD+RK    LPRFQ EN++HNK  
Sbjct  185  DIIPICRELGIGIVAYSPLGRGFLAAGPKLAENLENDDFRKATTTLPRFQQENVDHNKIL  244

Query  72   YEKIVEIAEKKGCTPSQLALAWVH  1
            +EK+  +AEKKGCTP+QLALAWVH
Sbjct  245  FEKVSAMAEKKGCTPAQLALAWVH  268



>gb|AAX84672.1| aldo/keto reductase AKR [Manihot esculenta]
Length=344

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSGPKLVE  S  D+RK LPRFQ ENLEHNK  +E+
Sbjct  192  EIVPTCRELGIGIVAYSPLGRGFFSSGPKLVETLSEGDFRKYLPRFQPENLEHNKHLFER  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +K CTPSQLALAWVH
Sbjct  252  VNEIAARKQCTPSQLALAWVH  272



>ref|XP_009378167.1| PREDICTED: probable aldo-keto reductase 2 [Pyrus x bretschneideri]
Length=345

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSG K VEN ++DD RK LPRFQ EN+EHNK  +E+
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFFSSGAKFVENLAHDDSRKSLPRFQPENVEHNKTLFER  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  254  VSDLATRKGCTPSQLALAWVH  274



>ref|XP_006487529.1| PREDICTED: probable aldo-keto reductase 2-like [Citrus sinensis]
Length=579

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSGPKLVE+ + DD R  LPRFQ ENLEHNK+ +E+
Sbjct  427  EIVPTCRELGIGIVAYSPLGRGFLSSGPKLVESIAPDDSRHHLPRFQPENLEHNKKLFER  486

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA KKGCTPSQLALAWVH
Sbjct  487  VNEIAVKKGCTPSQLALAWVH  507



>ref|XP_002321097.2| aldo/keto reductase family protein [Populus trichocarpa]
 gb|EEE99412.2| aldo/keto reductase family protein [Populus trichocarpa]
Length=345

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSGPKLVE+F+  D+RK LPRFQ ENL+HN++ +E+
Sbjct  193  EIVPTCRELGIGIVAYSPLGRGFLSSGPKLVESFTEGDFRKHLPRFQPENLDHNRQLFER  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EI+ +K CTPSQLALAWVH
Sbjct  253  VNEISARKQCTPSQLALAWVH  273



>ref|XP_009113189.1| PREDICTED: probable aldo-keto reductase 4 isoform X1 [Brassica 
rapa]
Length=345

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SGPKL+EN   +D+RK LPRFQ EN++HNK  YE 
Sbjct  193  DIIPTCRELGIGIVAYSPLGRGFFASGPKLLENLGQNDFRKALPRFQQENVDHNKIVYEN  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP QLALAWVH
Sbjct  253  VCAMSEKKGCTPGQLALAWVH  273



>ref|XP_010244068.1| PREDICTED: probable aldo-keto reductase 2 [Nelumbo nucifera]
Length=341

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPK+VENF + D+RK LPRFQ ENL+HN   +EK
Sbjct  190  EIIPTCRELGIGIVAYSPLGRGFFSSGPKVVENFGDKDFRKILPRFQPENLDHNNYVFEK  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + +IA +KGCTPSQLALAW+H
Sbjct  250  VNDIAVRKGCTPSQLALAWLH  270



>ref|XP_002460689.1| hypothetical protein SORBIDRAFT_02g033230 [Sorghum bicolor]
 gb|EER97210.1| hypothetical protein SORBIDRAFT_02g033230 [Sorghum bicolor]
Length=349

 Score =   136 bits (343),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLSSGPKLV+  S+ D+RK LPRFQ EN+E N   +EK
Sbjct  197  DIIPTCRELGIGIVAYSPLGRGFLSSGPKLVDTLSDQDFRKDLPRFQPENMEKNAVIFEK  256

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +KGCTPSQLALAWVH
Sbjct  257  VNAMAARKGCTPSQLALAWVH  277



>ref|XP_010069398.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Eucalyptus 
grandis]
Length=347

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF S G KL+ENFS DD+R+ LPRFQ ENL HN + +++
Sbjct  195  EIIPTCRELGIGIVAYSPLGRGFFSVGSKLLENFSEDDFRQKLPRFQPENLAHNAKLFDR  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  255  VNEIAQRKGCTPSQLALAWVH  275



>ref|XP_006302482.1| hypothetical protein CARUB_v10020576mg [Capsella rubella]
 gb|EOA35380.1| hypothetical protein CARUB_v10020576mg [Capsella rubella]
Length=347

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SGPK+VEN   DDYRK LPRFQ ENL++NK  YEK
Sbjct  195  DIIPTCRELGIGIVAYSPLGRGFFASGPKIVENLDQDDYRKGLPRFQQENLDNNKILYEK  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A KK C+P+QLALAWVH
Sbjct  255  VQAMATKKSCSPAQLALAWVH  275



>ref|XP_006392128.1| hypothetical protein EUTSA_v10023573mg [Eutrema salsugineum]
 gb|ESQ29414.1| hypothetical protein EUTSA_v10023573mg [Eutrema salsugineum]
Length=345

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLG+GF +SGPKLVE    DD+RK LPRFQ ENL+HNK  YEK
Sbjct  193  EIVPTCRELGIGIVAYSPLGKGFFASGPKLVETLDKDDFRKRLPRFQQENLDHNKILYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  253  VCVMSEKKGCTPAQLALAWVH  273



>emb|CDP10305.1| unnamed protein product [Coffea canephora]
Length=283

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF S GPKL+EN +  DYRK +PRFQ ENLEHNK+ YE+
Sbjct  195  EIIPTCRELGIGIVAYSPLGRGFFSLGPKLIENLAEGDYRKNMPRFQVENLEHNKKLYER  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +K CTPSQ ALAWVH
Sbjct  255  VNAIASRKSCTPSQQALAWVH  275



>ref|XP_006423748.1| hypothetical protein CICLE_v10028770mg [Citrus clementina]
 gb|ESR36988.1| hypothetical protein CICLE_v10028770mg [Citrus clementina]
Length=343

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSGPKLVE+ + DD R  LPRFQ ENLEHNK+ +E+
Sbjct  191  EIVPTCRELGIGIVAYSPLGRGFLSSGPKLVESIAQDDSRHLLPRFQPENLEHNKKLFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A KKGCT SQLALAWVH
Sbjct  251  VNELAVKKGCTRSQLALAWVH  271



>ref|XP_006301580.1| hypothetical protein CARUB_v10022018mg [Capsella rubella]
 gb|EOA34478.1| hypothetical protein CARUB_v10022018mg [Capsella rubella]
Length=711

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIV YSPLGRGF +SGPKLVEN  N+D+RK LPRFQ ENL+HNK  YEK
Sbjct  555  EIVPTCRELGIGIVVYSPLGRGFFASGPKLVENLDNNDFRKALPRFQQENLDHNKILYEK  614

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  615  VCAMSEKKGCTPAQLALAWVH  635



>ref|XP_010107228.1| hypothetical protein L484_021750 [Morus notabilis]
 gb|EXC14252.1| hypothetical protein L484_021750 [Morus notabilis]
Length=369

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLSSGPKLVE  +++D+RK LPRFQ +NLEHN   +E+
Sbjct  217  EIIPTCRELGIGIVAYSPLGRGFLSSGPKLVETLTDNDFRKQLPRFQGKNLEHNITIFER  276

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTP+QLALAWVH
Sbjct  277  VNEIAARKGCTPAQLALAWVH  297



>emb|CDP10287.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKL+EN ++ D+RK LPR Q EN+EHNK  +E+
Sbjct  165  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLMENLADGDFRKFLPRLQPENVEHNKSLFER  224

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + +IA +KGCTPSQLALAWVH
Sbjct  225  VNDIASRKGCTPSQLALAWVH  245



>gb|KCW57727.1| hypothetical protein EUGRSUZ_H00480 [Eucalyptus grandis]
Length=343

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF S G KL+ENFS DD+R+ LPRFQ ENL HN + +++
Sbjct  191  EIIPTCRELGIGIVAYSPLGRGFFSVGSKLLENFSEDDFRQKLPRFQPENLAHNAKLFDR  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  251  VNEIAQRKGCTPSQLALAWVH  271



>ref|XP_010089803.1| hypothetical protein L484_022319 [Morus notabilis]
 gb|EXB38419.1| hypothetical protein L484_022319 [Morus notabilis]
Length=344

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLS G KLVE  SNDDYRK LP F+ ENLEHN++  ++
Sbjct  194  DIIPTCRELGIGIVAYSPLGRGFLSYGAKLVETMSNDDYRKNLPWFRPENLEHNQKIIDR  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +KGCTPSQLALAWVH
Sbjct  254  LNEIAARKGCTPSQLALAWVH  274



>ref|XP_010510916.1| PREDICTED: probable aldo-keto reductase 4 [Camelina sativa]
Length=344

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SGPKLVE    +D+RK LPRFQ ENL++NK  YEK
Sbjct  192  EIIPTCRELGIGIVAYSPLGRGFFASGPKLVEKLDKNDFRKALPRFQEENLDNNKIVYEK  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  I+EKKGCTP+QLALAWVH
Sbjct  252  VCAISEKKGCTPAQLALAWVH  272



>ref|XP_008357878.1| PREDICTED: LOW QUALITY PROTEIN: probable aldo-keto reductase 
2, partial [Malus domestica]
Length=286

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SG K VEN ++DD RK LPRFQ EN+EHNK  +E+
Sbjct  135  EIIPTCRELGIGIVAYSPLGRGFFTSGAKFVENLAHDDSRKNLPRFQPENVEHNKTLFER  194

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  195  VSDLAARKGCTPSQLALAWVH  215



>ref|XP_010673287.1| PREDICTED: probable aldo-keto reductase 4 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=538

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLSSGPK+ ENF  +D+R+ LPRF+ ENLEHNK  +E+
Sbjct  386  DIIPTCRELGIGIVAYSPLGRGFLSSGPKMTENFVKEDFRQHLPRFKPENLEHNKLIFER  445

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA +KGCTP+QLALAWVH
Sbjct  446  VSAIATRKGCTPAQLALAWVH  466


 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  240  VIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEKI  61
            ++PTCRELGIGIV YSPLGRGFLSSGPKLVEN + +D R+  PR +AEN+EHN   +E++
Sbjct  194  IVPTCRELGIGIVTYSPLGRGFLSSGPKLVENLTKEDSRRFFPRLKAENIEHNAHIFERV  253

Query  60   VEIAEKKGCTPSQLALAWVH  1
             +IA KKGCTP+QLALAWVH
Sbjct  254  ADIATKKGCTPAQLALAWVH  273



>gb|EMT17499.1| Auxin-induced protein [Aegilops tauschii]
Length=203

 Score =   132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSGPKLV+  S  D+RK LPRFQAENLE N   +E+
Sbjct  52   DIIPTCRELGIGIVAYSPLGRGFFSSGPKLVDTLSEQDFRKDLPRFQAENLEKNTMVFER  111

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +KGCT SQLALAWVH
Sbjct  112  VSTMAARKGCTASQLALAWVH  132



>gb|KCW57713.1| hypothetical protein EUGRSUZ_H004702, partial [Eucalyptus grandis]
Length=300

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF S G KL ENFS DD+R+  PRFQ ENL HN + +++
Sbjct  194  DIVPTCRELGIGIVAYSPLGRGFFSVGSKLAENFSKDDFRQYHPRFQPENLAHNTKLFDR  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  254  VNEIAQRKGCTPSQLALAWVH  274



>ref|XP_008454009.1| PREDICTED: probable aldo-keto reductase 2 [Cucumis melo]
Length=344

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSGPKLV+   ++D+RK LPRFQ ENLEHNK  +EK
Sbjct  192  EIIPTCRELGIGIVAYSPLGRGFFSSGPKLVQALQDNDFRKELPRFQGENLEHNKTVFEK  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AE+KGCT SQLALAWVH
Sbjct  252  VSAMAERKGCTTSQLALAWVH  272



>ref|XP_003621701.1| Aldo/keto reductase [Medicago truncatula]
 gb|ABN08816.1| Aldo/keto reductase [Medicago truncatula]
 gb|AES77919.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=339

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSG K+VENF+ DDYR+ +PRFQ ENL+ N+  +E+
Sbjct  190  EIIPTCRELGIGIVAYSPLGRGFFSSGTKIVENFTKDDYRQYMPRFQPENLQQNQTIFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A KKGCTPSQLALAW+H
Sbjct  250  VNELAAKKGCTPSQLALAWLH  270



>gb|KCW57707.1| hypothetical protein EUGRSUZ_H00466 [Eucalyptus grandis]
Length=347

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLS G KLVEN S DD+R+ LPRF+ ENL HN + +++
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFLSVGSKLVENLSKDDFRQYLPRFRPENLAHNTKLFDR  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  254  VNEIAQRKGCTPSQLALAWVH  274



>ref|XP_011073936.1| PREDICTED: auxin-induced protein PCNT115-like [Sesamum indicum]
Length=353

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++P CRELGIGIV YSPLGRGFLSSGPKL++N S  D+RK  PRFQAENLEHNK  YE+
Sbjct  203  ELVPACRELGIGIVPYSPLGRGFLSSGPKLIQNLSEGDFRKIFPRFQAENLEHNKLVYER  262

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A +KGCT SQLALAWVH
Sbjct  263  ICEMAARKGCTSSQLALAWVH  283



>ref|XP_010069393.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Eucalyptus 
grandis]
Length=347

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF S G KLVEN S DD R+ LPRFQ ENL HN + +++
Sbjct  195  DIVPTCRELGIGIVAYSPLGRGFFSVGSKLVENISKDDVRQKLPRFQPENLAHNAKLFDR  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  255  VNEIAQRKGCTPSQLALAWVH  275



>ref|XP_010069397.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010040396.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
 gb|KCW45247.1| hypothetical protein EUGRSUZ_L01103 [Eucalyptus grandis]
 gb|KCW57726.1| hypothetical protein EUGRSUZ_H00479 [Eucalyptus grandis]
Length=347

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF S G KLVENFS DD+R+ LPR Q ENL HN + +++
Sbjct  195  EIIPTCRELGIGIVAYSPLGRGFFSVGSKLVENFSKDDFRQYLPRLQPENLAHNAKLFDR  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  255  VNEIAQRKGCTPSQLALAWVH  275



>gb|EYU32745.1| hypothetical protein MIMGU_mgv1a009439mg [Erythranthe guttata]
Length=342

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIV YSPLGRGFLS GP L+EN S DD+RK  PRFQ ENLE NK  YE+
Sbjct  191  EIVPTCRELGIGIVPYSPLGRGFLSVGPTLIENLSEDDFRKKFPRFQGENLEANKLVYER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A++KGCTPSQLALAWVH
Sbjct  251  ISEMAKEKGCTPSQLALAWVH  271



>ref|XP_010533925.1| PREDICTED: probable aldo-keto reductase 4 [Tarenaya hassleriana]
Length=340

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++P CRELGIGIVAYSPLGRGF +SGPKL+E     DYRK LPRFQAEN++HNK  YEK
Sbjct  193  DIVPACRELGIGIVAYSPLGRGFFASGPKLLEKLEQGDYRKDLPRFQAENVDHNKVMYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AEKK CTP QLALAWVH
Sbjct  253  VTSMAEKKQCTPGQLALAWVH  273



>dbj|BAD44104.1| putative auxin-induced protein [Arabidopsis thaliana]
 dbj|BAD44177.1| putative auxin-induced protein [Arabidopsis thaliana]
Length=344

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLG GF ++GPK +E+  N DYRK LPRFQ ENL+HNK  YEK
Sbjct  193  DIIPTCRELGIGIVAYSPLGLGFFAAGPKFIESMDNGDYRKGLPRFQQENLDHNKILYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AEKK CTP+QLALAWVH
Sbjct  253  VNAMAEKKSCTPAQLALAWVH  273



>ref|NP_172551.1| probable aldo-keto reductase 1 [Arabidopsis thaliana]
 sp|Q9C5B9.1|AKR1_ARATH RecName: Full=Probable aldo-keto reductase 1 [Arabidopsis thaliana]
 gb|AAK27238.1|AF361098_1 putative auxin-induced protein [Arabidopsis thaliana]
 gb|AEE28648.1| probable aldo-keto reductase 1 [Arabidopsis thaliana]
Length=344

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLG GF ++GPK +E+  N DYRK LPRFQ ENL+HNK  YEK
Sbjct  193  DIIPTCRELGIGIVAYSPLGLGFFAAGPKFIESMDNGDYRKGLPRFQQENLDHNKILYEK  252

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +AEKK CTP+QLALAWVH
Sbjct  253  VNAMAEKKSCTPAQLALAWVH  273



>ref|XP_006423334.1| hypothetical protein CICLE_v10028780mg [Citrus clementina]
 gb|ESR36574.1| hypothetical protein CICLE_v10028780mg [Citrus clementina]
Length=342

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG KL E+ S  DYRK LPRFQ  NLEHN++ +E+
Sbjct  190  DIIPTCRELGIGIVAYSPLGRGFFSSGSKLAESLSEGDYRKHLPRFQPGNLEHNQKLFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA  KGCTPSQLALAWVH
Sbjct  250  VNEIAANKGCTPSQLALAWVH  270



>ref|XP_010069386.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
Length=346

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLS G KLVEN S DD+R+ LPRF+ ENL HN + +++
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFLSVGSKLVENLSKDDFRQYLPRFRPENLAHNTKLFDR  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  254  VNEIAQRKGCTPSQLALAWVH  274



>gb|KCW57729.1| hypothetical protein EUGRSUZ_H004811, partial [Eucalyptus grandis]
Length=271

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF S G KL E+FS DD+R+ +PRFQ ENL HN + +++
Sbjct  119  EIVPTCRELGIGIVAYSPLGRGFFSVGSKLAESFSEDDFRRSIPRFQPENLAHNAKLFDQ  178

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  179  VNEIAQRKGCTPSQLALAWVH  199



>ref|XP_008379789.1| PREDICTED: probable aldo-keto reductase 2 [Malus domestica]
Length=325

 Score =   134 bits (338),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SG K VEN ++DD RK LPRFQ EN+EHNK  +E+
Sbjct  174  EIIPTCRELGIGIVAYSPLGRGFFTSGAKFVENLAHDDSRKNLPRFQPENVEHNKTLFER  233

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  234  VSDLAARKGCTPSQLALAWVH  254



>ref|XP_010069389.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Eucalyptus 
grandis]
Length=346

 Score =   134 bits (338),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF S G KLVEN S DD+R+ LPRFQ ENL HN + +++
Sbjct  194  EIVPTCRELGIGIVAYSPLGRGFFSVGSKLVENISKDDFRQYLPRFQPENLAHNTKLFDR  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  254  VNEIAQRKGCTPSQLALAWVH  274



>ref|XP_010040399.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
 gb|KCW45246.1| hypothetical protein EUGRSUZ_L01102 [Eucalyptus grandis]
Length=344

 Score =   134 bits (338),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF S G KL E+FS DD+R+ LPRFQ ENL HN + +++
Sbjct  192  EIVPTCRELGIGIVAYSPLGRGFFSVGSKLAESFSEDDFRRSLPRFQPENLAHNAKLFDQ  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  252  VNEIAQRKGCTPSQLALAWVH  272



>ref|XP_010069390.1| PREDICTED: probable aldo-keto reductase 2 isoform X3 [Eucalyptus 
grandis]
 gb|KCW57712.1| hypothetical protein EUGRSUZ_H004702 [Eucalyptus grandis]
Length=346

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF S G KL ENFS DD+R+  PRFQ ENL HN + +++
Sbjct  194  DIVPTCRELGIGIVAYSPLGRGFFSVGSKLAENFSKDDFRQYHPRFQPENLAHNTKLFDR  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  254  VNEIAQRKGCTPSQLALAWVH  274



>ref|XP_009334075.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Pyrus x 
bretschneideri]
Length=345

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SG K VEN ++DD RK LPRFQ EN+EHNK  +E+
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFFASGAKFVENLAHDDSRKNLPRFQPENVEHNKTLFER  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  254  VSDLAARKGCTPSQLALAWVH  274



>ref|XP_009334074.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Pyrus x 
bretschneideri]
Length=358

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SG K VEN ++DD RK LPRFQ EN+EHNK  +E+
Sbjct  207  EIIPTCRELGIGIVAYSPLGRGFFASGAKFVENLAHDDSRKNLPRFQPENVEHNKTLFER  266

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  267  VSDLAARKGCTPSQLALAWVH  287



>gb|KCW57720.1| hypothetical protein EUGRSUZ_H00474 [Eucalyptus grandis]
Length=304

 Score =   133 bits (335),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF S G KL ENFS DD+R+ LPR Q ENL HN + +++
Sbjct  152  EIIPTCRELGIGIVAYSPLGRGFFSVGSKLAENFSKDDFRQYLPRLQPENLAHNAKLFDR  211

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  212  VNEIAQRKGCTPSQLALAWVH  232



>ref|XP_003575317.1| PREDICTED: probable aldo-keto reductase 2 [Brachypodium distachyon]
Length=348

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSGPKLVE  S+ D+RK LPRFQAENLE N   +E+
Sbjct  196  DIIPTCRELGIGIVAYSPLGRGFFSSGPKLVETLSDQDFRKDLPRFQAENLEKNTMIFER  255

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +KGCT SQLALAWVH
Sbjct  256  VSAMASRKGCTASQLALAWVH  276



>ref|XP_004492046.1| PREDICTED: probable aldo-keto reductase 2-like [Cicer arietinum]
Length=339

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSG K+VENF+ DDYR+ +PRFQ ENLE N+  +++
Sbjct  190  EIIPTCRELGIGIVAYSPLGRGFFSSGAKMVENFTKDDYRQHMPRFQPENLEQNQTIFDR  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E++ KKGCTPSQLALAW+H
Sbjct  250  VNELSTKKGCTPSQLALAWLH  270



>dbj|BAK02817.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=344

 Score =   134 bits (336),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLS+GPKL++   +DD+RK LPRFQ ENL+ N   +E+
Sbjct  191  DIIPTCRELGIGIVAYSPLGRGFLSTGPKLMDTVRDDDFRKNLPRFQPENLKKNAAIFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A +KGCT SQLALAWVH
Sbjct  251  VSEMAARKGCTSSQLALAWVH  271



>gb|KDP37896.1| hypothetical protein JCGZ_05778 [Jatropha curcas]
Length=344

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF SS P LV+N +  D+RK LPRFQAENLEHNK+  E+
Sbjct  192  DIVPTCRELGIGIVAYSPLGRGFFSSEPNLVQNLAEGDFRKVLPRFQAENLEHNKKLLER  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +K CT SQLALAWVH
Sbjct  252  VSEIAARKQCTTSQLALAWVH  272



>gb|EMT06691.1| Auxin-induced protein [Aegilops tauschii]
Length=363

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF  SG K  +NFS  D RK LPRFQAENLEHN+R +E+
Sbjct  211  EIIPTCRELGIGIVAYSPLGRGFFGSGAKSADNFSERDIRKNLPRFQAENLEHNQRIFER  270

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A +KGCTPSQLALAWVH
Sbjct  271  VNEMATRKGCTPSQLALAWVH  291



>ref|XP_002461348.1| hypothetical protein SORBIDRAFT_02g001350 [Sorghum bicolor]
 gb|EER97869.1| hypothetical protein SORBIDRAFT_02g001350 [Sorghum bicolor]
Length=296

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG KLV +  NDD+RK +PRFQ EN+E N   +E+
Sbjct  143  DIIPTCRELGIGIVAYSPLGRGFFSSGAKLVTDLPNDDFRKNMPRFQPENMEKNALIFER  202

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  203  VSQVAARKGCTPSQLALAWVH  223



>ref|XP_010040397.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
Length=344

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF S G KL+ENFS DD+R+ LPRFQ ENL HN + +++
Sbjct  192  EIIPTCRELGIGIVAYSPLGRGFFSVGSKLLENFSEDDFRQKLPRFQPENLAHNAKLFDR  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTP QLALAWVH
Sbjct  252  VNEIAQRKGCTPLQLALAWVH  272



>ref|XP_010069396.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
Length=344

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF S G KL E+FS DD+R+ +PRFQ ENL HN + +++
Sbjct  192  EIVPTCRELGIGIVAYSPLGRGFFSVGSKLAESFSEDDFRRSIPRFQPENLAHNAKLFDQ  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  252  VNEIAQRKGCTPSQLALAWVH  272



>ref|XP_010069399.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
Length=346

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF S G KL+ENFS DD+R+ LPRFQ ENL HN + +++
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFFSVGSKLLENFSEDDFRQKLPRFQPENLAHNAKLFDR  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTP QLALAWVH
Sbjct  254  VNEIAQRKGCTPLQLALAWVH  274



>emb|CDP10289.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SG K+VEN S  D RK LPRF+ EN+EHNK  YE+
Sbjct  197  EIIPTCRELGIGIVAYSPLGRGFFTSGSKVVENLSEGDIRKNLPRFRTENMEHNKNLYER  256

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  IA KKGCTPSQLALAWVH
Sbjct  257  VNVIASKKGCTPSQLALAWVH  277



>ref|XP_010042438.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
Length=348

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF S G KLVEN S DD R+ LPR Q ENL HN + +++
Sbjct  196  DIVPTCRELGIGIVAYSPLGRGFFSVGSKLVENISKDDVRQYLPRLQPENLAHNTKLFDR  255

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  256  VNEIAQRKGCTPSQLALAWVH  276



>ref|XP_010069403.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
 gb|KCW57737.1| hypothetical protein EUGRSUZ_H00489 [Eucalyptus grandis]
Length=344

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF S G KL+EN S DD+R+ LPRFQ ENL HN + +++
Sbjct  192  EIVPTCRELGIGIVAYSPLGRGFFSVGSKLLENLSKDDFRQNLPRFQPENLAHNAKLFDR  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  252  VNEIAQRKGCTPSQLALAWVH  272



>gb|KCW57735.1| hypothetical protein EUGRSUZ_H00487 [Eucalyptus grandis]
Length=344

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF S G KL+EN S DD+R+ LPRFQ ENL HN + +++
Sbjct  192  EIVPTCRELGIGIVAYSPLGRGFFSVGSKLLENLSKDDFRQNLPRFQPENLAHNAKLFDR  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCTPSQLALAWVH
Sbjct  252  VNEIAQRKGCTPSQLALAWVH  272



>ref|XP_007222405.1| hypothetical protein PRUPE_ppa008144mg [Prunus persica]
 gb|EMJ23604.1| hypothetical protein PRUPE_ppa008144mg [Prunus persica]
Length=343

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSG K VEN S+DD RK  PRFQ EN+EHNK  +E+
Sbjct  191  EIVPTCRELGIGIVAYSPLGRGFFSSGAKFVENLSHDDSRKDHPRFQPENVEHNKALFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  251  VSDLAARKGCTPSQLALAWVH  271



>ref|NP_001169979.1| uncharacterized protein LOC100383880 [Zea mays]
 gb|ACN35424.1| unknown [Zea mays]
Length=350

 Score =   133 bits (334),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLSSGP +V+  S+ D+RK LPRFQ ENLE N   +E+
Sbjct  198  DIIPTCRELGIGIVAYSPLGRGFLSSGPTMVDKLSDQDFRKELPRFQPENLEKNAVIFER  257

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +KGCTPSQLALAWVH
Sbjct  258  VNAMAARKGCTPSQLALAWVH  278



>gb|ABK22508.1| unknown [Picea sitchensis]
Length=348

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIV YSPLGRGFLS+G KL+EN ++DD+RK +PRF AENLE NK  +E+
Sbjct  195  EIIPTCRELGIGIVPYSPLGRGFLSAGAKLIENLADDDFRKDMPRFSAENLEKNKVIFER  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I+EIA KK C+PSQLALAWVH
Sbjct  255  ILEIASKKRCSPSQLALAWVH  275



>ref|XP_006388520.1| hypothetical protein POPTR_0166s00210g, partial [Populus trichocarpa]
 gb|ERP47434.1| hypothetical protein POPTR_0166s00210g, partial [Populus trichocarpa]
Length=257

 Score =   131 bits (329),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSGPKLVE+F++ DYRK LPRF+ ENLEHN + +E+
Sbjct  121  EIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESFTDGDYRKGLPRFRPENLEHNTQLFER  180

Query  63   IVEIAEKKGCTPSQLALAWV  4
            + EIA +K CT SQLALAW+
Sbjct  181  VNEIAARKQCTSSQLALAWI  200



>dbj|BAJ95968.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score =   134 bits (336),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLS+GPKL++   +DD+RK LPRFQ ENL+ N   +E+
Sbjct  246  DIIPTCRELGIGIVAYSPLGRGFLSTGPKLMDTVRDDDFRKNLPRFQPENLKKNAAIFER  305

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A +KGCT SQLALAWVH
Sbjct  306  VSEMAARKGCTSSQLALAWVH  326



>ref|XP_010042782.1| PREDICTED: probable aldo-keto reductase 2, partial [Eucalyptus 
grandis]
Length=204

 Score =   129 bits (325),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            DV+PTCRELGIGIVAYSPLGRGF S G KLVEN S DD R+ LPRF  ENL HN + +++
Sbjct  52   DVVPTCRELGIGIVAYSPLGRGFFSVGSKLVENISKDDVRQYLPRFWPENLAHNTKLFDR  111

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCT SQLALAWVH
Sbjct  112  VNEIAQRKGCTTSQLALAWVH  132



>ref|XP_003527298.1| PREDICTED: probable aldo-keto reductase 2-like isoform 1 [Glycine 
max]
Length=344

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSG KL+EN + +DYR+ LPRFQ ENLE NK  +E+
Sbjct  190  EIVPTCRELGIGIVAYSPLGRGFLSSGTKLLENLTKEDYRQRLPRFQPENLEQNKTIFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A KK CTPSQLALAWVH
Sbjct  250  IDELAAKKRCTPSQLALAWVH  270



>gb|KHN06048.1| Putative aldo-keto reductase 2 [Glycine soja]
Length=344

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGFLSSG KL+EN + +DYR+ LPRFQ ENLE NK  +E+
Sbjct  190  EIVPTCRELGIGIVAYSPLGRGFLSSGTKLLENLTKEDYRQRLPRFQPENLEQNKTIFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A KK CTPSQLALAWVH
Sbjct  250  INELAAKKRCTPSQLALAWVH  270



>gb|ACJ85229.1| unknown [Medicago truncatula]
 gb|AFK47828.1| unknown [Medicago truncatula]
Length=339

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF SSG K+VENF+ DDYR+ +PRFQ ENL+ N+  +E+
Sbjct  190  EIIPTCRELGIGIVAYSPLGRGFFSSGTKIVENFTKDDYRQYMPRFQPENLQQNQTIFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A KKGCTP QLALAW+H
Sbjct  250  VNELAAKKGCTPFQLALAWLH  270



>ref|XP_008379790.1| PREDICTED: probable aldo-keto reductase 2 [Malus domestica]
Length=276

 Score =   131 bits (329),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF  SG K VEN ++ D RK LPRFQ EN+EHNK  +E+
Sbjct  125  EIIPTCRELGIGIVAYSPLGRGFFXSGAKFVENLAHXDSRKNLPRFQPENVEHNKTLFER  184

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  185  VSDLAARKGCTPSQLALAWVH  205



>ref|XP_006388518.1| hypothetical protein POPTR_0166s00200g [Populus trichocarpa]
 ref|XP_006388519.1| hypothetical protein POPTR_0166s00200g [Populus trichocarpa]
 gb|ERP47432.1| hypothetical protein POPTR_0166s00200g [Populus trichocarpa]
 gb|ERP47433.1| hypothetical protein POPTR_0166s00200g [Populus trichocarpa]
Length=343

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSGPKLVE+ ++ DYRK LPRF+ ENLEHN + +E+
Sbjct  191  EIVPTCRELGIGIVAYSPLGRGFFSSGPKLVESLTDGDYRKGLPRFRPENLEHNTQLFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +K CT SQLALAWVH
Sbjct  251  VNEIAARKQCTSSQLALAWVH  271



>ref|XP_006487220.1| PREDICTED: probable aldo-keto reductase 2-like isoform X1 [Citrus 
sinensis]
 gb|KDO47915.1| hypothetical protein CISIN_1g018998mg [Citrus sinensis]
Length=347

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG KL E+ S  DYRK LPRFQ  NLEHN++ +E 
Sbjct  190  DIIPTCRELGIGIVAYSPLGRGFFSSGSKLAESLSEGDYRKHLPRFQPGNLEHNQKLFEC  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA  KGCTPSQLALAWVH
Sbjct  250  VNEIAANKGCTPSQLALAWVH  270



>gb|AAB71982.1| Highly similar to auxin-induced protein (aldo/keto reductase 
family) [Arabidopsis thaliana]
Length=342

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SGPKLVEN  N+D    LPRFQ ENL+HNK  +EK
Sbjct  193  DIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLDNND---TLPRFQQENLDHNKILFEK  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAWVH
Sbjct  250  VSAMSEKKGCTPAQLALAWVH  270



>gb|KFK22426.1| hypothetical protein AALP_AAs39864U000400 [Arabis alpina]
Length=346

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAY PLGRGF ++GPKLVE F N+D RK  PRFQ ENL+HNK  YEK
Sbjct  194  EIVPTCRELGIGIVAYGPLGRGFFAAGPKLVEKFGNNDSRKAHPRFQPENLDHNKILYEK  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  ++EKKGCTP+QLALAW+H
Sbjct  254  VSAMSEKKGCTPAQLALAWLH  274



>ref|XP_007222406.1| hypothetical protein PRUPE_ppa008145mg [Prunus persica]
 gb|EMJ23605.1| hypothetical protein PRUPE_ppa008145mg [Prunus persica]
Length=343

 Score =   132 bits (331),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSG K VEN S +D RK  PRFQ EN+EHNK  +E+
Sbjct  191  EIVPTCRELGIGIVAYSPLGRGFFSSGAKFVENLSQNDSRKLHPRFQPENVEHNKTLFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  251  VSDLAARKGCTPSQLALAWVH  271



>gb|ABK21001.1| unknown [Picea sitchensis]
 gb|ABK23757.1| unknown [Picea sitchensis]
Length=348

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -2

Query  240  VIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEKI  61
            +IPTCRELGIGIV YSPLGRGFLS G KLV+N +++D+RK +PRF AENLE NK  +E+I
Sbjct  196  IIPTCRELGIGIVPYSPLGRGFLSIGAKLVDNLADNDFRKLMPRFSAENLEKNKVIFERI  255

Query  60   VEIAEKKGCTPSQLALAWVH  1
             EIA KKGC+PSQLALAWVH
Sbjct  256  CEIASKKGCSPSQLALAWVH  275



>ref|XP_003621699.1| Aldo-keto reductase yakc [Medicago truncatula]
Length=493

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            DVIPTCRELGIGIVAYSPLGRGF SSG KL++N   DDYRK LPRFQ ENL+ N+  ++K
Sbjct  380  DVIPTCRELGIGIVAYSPLGRGFFSSGTKLLDNLQQDDYRKHLPRFQPENLQQNQTIFDK  439

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A KKGCTPSQLALAW+H
Sbjct  440  VNELAVKKGCTPSQLALAWLH  460


 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF S+G KL++N   DDYRK LPRFQ ENL+ N+  ++K
Sbjct  189  DIIPTCRELGIGIVAYSPLGRGFFSTGTKLLDNLPQDDYRKHLPRFQTENLQQNQTIFDK  248

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A KKGCTP QLALAW+H
Sbjct  249  VNELATKKGCTPPQLALAWLH  269



>gb|ABN08782.1| Aldo/keto reductase [Medicago truncatula]
Length=277

 Score =   130 bits (327),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF S+G KL++N   DDYRK LPRFQ ENL+ N+  ++K
Sbjct  189  DIIPTCRELGIGIVAYSPLGRGFFSTGTKLLDNLPQDDYRKHLPRFQTENLQQNQTIFDK  248

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A KKGCTP QLALAW+H
Sbjct  249  VNELATKKGCTPPQLALAWLH  269



>ref|XP_008379248.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Malus domestica]
Length=341

 Score =   131 bits (330),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SG K VEN ++ D RK LPRFQ EN+EHNK  +E+
Sbjct  190  EIIPTCRELGIGIVAYSPLGRGFFASGAKFVENLAHGDSRKNLPRFQPENVEHNKTLFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  250  VSDLAARKGCTPSQLALAWVH  270



>ref|XP_008379247.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Malus domestica]
Length=351

 Score =   132 bits (331),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF +SG K VEN ++ D RK LPRFQ EN+EHNK  +E+
Sbjct  200  EIIPTCRELGIGIVAYSPLGRGFFASGAKFVENLAHGDSRKNLPRFQPENVEHNKTLFER  259

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  260  VSDLAARKGCTPSQLALAWVH  280



>gb|AAB84222.1| auxin-induced protein [Helianthus annuus]
Length=338

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF +SG K++E   + DYR   PRFQ ENLEHNK  YE+
Sbjct  189  DIIPTCRELGIGIVAYSPLGRGFFASGSKMMEKLEDGDYRPNFPRFQPENLEHNKILYER  248

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA KKGCT SQLALAWVH
Sbjct  249  VSEIASKKGCTTSQLALAWVH  269



>ref|XP_003621684.1| Aldo-keto reductase yakc [Medicago truncatula]
 gb|ABN08808.1| Aldo/keto reductase [Medicago truncatula]
 gb|ACJ84900.1| unknown [Medicago truncatula]
 gb|AES77902.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
 gb|AES77917.2| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=339

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF S+G KL++N   DDYRK LPRFQ ENL+ N+  ++K
Sbjct  189  DIIPTCRELGIGIVAYSPLGRGFFSTGTKLLDNLPQDDYRKHLPRFQTENLQQNQTIFDK  248

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A KKGCTP QLALAW+H
Sbjct  249  VNELATKKGCTPPQLALAWLH  269



>ref|XP_010069392.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW57724.1| hypothetical protein EUGRSUZ_H00477 [Eucalyptus grandis]
Length=347

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF S G KLVEN S DD R+  PRFQ ENL HN + +++
Sbjct  195  DIVPTCRELGIGIVAYSPLGRGFFSVGSKLVENISKDDVRQKQPRFQPENLAHNTKLFDR  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A +KGCTPSQLALAWVH
Sbjct  255  VNEVARRKGCTPSQLALAWVH  275



>ref|XP_008222724.1| PREDICTED: probable aldo-keto reductase 2 [Prunus mume]
 ref|XP_008222725.1| PREDICTED: probable aldo-keto reductase 2 [Prunus mume]
Length=343

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF SSG + V+N S+DD RK  PRFQ+EN+EHNK  +E+
Sbjct  191  EIVPTCRELGIGIVAYSPLGRGFFSSGAEFVKNLSHDDSRKDHPRFQSENVEHNKALFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + ++A +KGCTPSQLALAWVH
Sbjct  251  VSDLAARKGCTPSQLALAWVH  271



>gb|EPS71567.1| hypothetical protein M569_03191 [Genlisea aurea]
Length=344

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLS+GP L++N    D+RK  PRFQ ENLEHN+  YE 
Sbjct  192  ELIPTCRELGIGIVAYSPLGRGFLSAGPSLIQNLPEGDFRKIFPRFQGENLEHNRAVYEG  251

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+  +KGC+PSQ+ALAWVH
Sbjct  252  ICELGRRKGCSPSQIALAWVH  272



>ref|NP_001052497.1| Os04g0339400 [Oryza sativa Japonica Group]
 sp|Q7XQ45.2|AKR3_ORYSJ RecName: Full=Probable aldo-keto reductase 3 [Oryza sativa Japonica 
Group]
 emb|CAE03315.2| OSJNBa0032I19.9 [Oryza sativa Japonica Group]
 dbj|BAF14411.1| Os04g0339400 [Oryza sativa Japonica Group]
 emb|CAH66327.1| H0813E03.4 [Oryza sativa Indica Group]
 gb|EAZ30275.1| hypothetical protein OsJ_14323 [Oryza sativa Japonica Group]
 dbj|BAG96139.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   131 bits (329),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF SSG KLV+   +DD+RK LPRFQ ENLE N   +EK
Sbjct  201  DIVPTCRELGIGIVAYSPLGRGFFSSGAKLVDELPDDDFRKSLPRFQPENLEKNAAIFEK  260

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +KGCT SQLALAWVH
Sbjct  261  VNAMAARKGCTSSQLALAWVH  281



>sp|A2XRZ6.1|AKR3_ORYSI RecName: Full=Probable aldo-keto reductase 3 [Oryza sativa Indica 
Group]
 gb|EAY93606.1| hypothetical protein OsI_15393 [Oryza sativa Indica Group]
Length=355

 Score =   131 bits (329),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF SSG KLV+   +DD+RK LPRFQ ENLE N   +EK
Sbjct  201  DIVPTCRELGIGIVAYSPLGRGFFSSGAKLVDELPDDDFRKSLPRFQPENLEKNAAIFEK  260

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +KGCT SQLALAWVH
Sbjct  261  VNAMAARKGCTSSQLALAWVH  281



>gb|KCW57717.1| hypothetical protein EUGRSUZ_H004701, partial [Eucalyptus grandis]
Length=204

 Score =   127 bits (319),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF S G KLVEN S DD+R+ LPRF+ ENL HN + +++
Sbjct  52   EIVPTCRELGIGIVAYSPLGRGFFSVGSKLVENISKDDFRQYLPRFRPENLAHNTKLFDR  111

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCT SQLALAWV+
Sbjct  112  VNEIAQRKGCTTSQLALAWVY  132



>gb|ABR92332.1| putative aldo/keto reductase 2 [Salvia miltiorrhiza]
Length=342

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++P CRELGIGIV YSPLGRGFLS GPKL++N    D+RK  PRF+AENLE NK  YEK
Sbjct  191  ELVPACRELGIGIVTYSPLGRGFLSVGPKLIQNLPEGDFRKIFPRFKAENLEANKVVYEK  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A +KGCTPSQLALAWVH
Sbjct  251  ISEMATRKGCTPSQLALAWVH  271



>ref|XP_004975286.1| PREDICTED: probable aldo-keto reductase 2-like [Setaria italica]
Length=348

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG KL+++ S  D RK +PRFQAENL+ N + +E+
Sbjct  196  DIIPTCRELGIGIVAYSPLGRGFFSSGAKLIDSLSEQDIRKNMPRFQAENLDKNAQVFER  255

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A +KGCTPSQLALAWVH
Sbjct  256  VNEMARRKGCTPSQLALAWVH  276



>ref|XP_010673285.1| PREDICTED: probable aldo-keto reductase 2 [Beta vulgaris subsp. 
vulgaris]
Length=339

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF S GPK+VE+F+  DYRK +PRF  ENLEHNK  +E+
Sbjct  187  EIVPTCRELGIGIVAYSPLGRGFFSVGPKVVESFNEGDYRKNIPRFLPENLEHNKHVFER  246

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A +KGCT SQLALAWVH
Sbjct  247  VSEMAARKGCTASQLALAWVH  267



>gb|ABK22828.1| unknown [Picea sitchensis]
Length=349

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIV YSPLGRGFLSSG KLVEN  ++D+RK LP+F+AENLE N   +EK
Sbjct  194  EIIPTCRELGIGIVPYSPLGRGFLSSGAKLVENLKDNDFRKALPKFRAENLERNNVTFEK  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I EIA +KGC+P QLALAW+H
Sbjct  254  ICEIASRKGCSPGQLALAWIH  274



>ref|XP_006653275.1| PREDICTED: probable aldo-keto reductase 3-like, partial [Oryza 
brachyantha]
Length=349

 Score =   130 bits (326),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF SSG KL++   +DD+R+ LPRFQ ENLE N   +E+
Sbjct  195  DIVPTCRELGIGIVAYSPLGRGFFSSGAKLMDELPDDDFRRNLPRFQPENLEKNAAIFER  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +KGCTPSQLALAWVH
Sbjct  255  VSAMAARKGCTPSQLALAWVH  275



>ref|XP_010069388.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW57710.1| hypothetical protein EUGRSUZ_H00469 [Eucalyptus grandis]
Length=346

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF S G KLVEN S DD+R+ LPRF+ ENL HN + +++
Sbjct  194  EIVPTCRELGIGIVAYSPLGRGFFSVGSKLVENISKDDFRQYLPRFRPENLAHNTKLFDR  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCT SQLALAWVH
Sbjct  254  VNEIAQRKGCTTSQLALAWVH  274



>ref|XP_010673288.1| PREDICTED: probable aldo-keto reductase 5 [Beta vulgaris subsp. 
vulgaris]
Length=344

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIV YSPLGRGF S GPK+VE +   DYRK LPRFQ ENLEHNK  +E+
Sbjct  191  DIVPTCRELGIGIVPYSPLGRGFFSLGPKVVETYYEHDYRKDLPRFQPENLEHNKYIFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A +KGCT SQLALAW+H
Sbjct  251  VSEMAARKGCTTSQLALAWIH  271



>sp|A2XRZ0.1|AKR2_ORYSI RecName: Full=Probable aldo-keto reductase 2 [Oryza sativa Indica 
Group]
 emb|CAH66623.1| OSIGBa0115A19.4 [Oryza sativa Indica Group]
 gb|EAY93600.1| hypothetical protein OsI_15387 [Oryza sativa Indica Group]
Length=351

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF S+G KLVE+ S+ D+RK +PRFQ ENLE N   +E+
Sbjct  197  DIIPTCRELGIGIVAYSPLGRGFFSAGAKLVESLSDQDFRKHIPRFQQENLEKNAEIFER  256

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +KGCTPSQLALAWVH
Sbjct  257  VNAMAARKGCTPSQLALAWVH  277



>ref|XP_010069400.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Eucalyptus 
grandis]
Length=347

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF S G KL ENFS DD+R+  PRF+ ENL HN + +++
Sbjct  195  DIVPTCRELGIGIVAYSPLGRGFFSVGSKLAENFSKDDFRQYHPRFRPENLAHNTKLFDR  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCT SQLALAWVH
Sbjct  255  VNEIAQRKGCTTSQLALAWVH  275



>ref|XP_010069401.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW57719.1| hypothetical protein EUGRSUZ_H00473 [Eucalyptus grandis]
Length=346

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF S G KL ENFS DD+R+  PRF+ ENL HN + +++
Sbjct  194  DIVPTCRELGIGIVAYSPLGRGFFSVGSKLAENFSKDDFRQYHPRFRPENLAHNTKLFDR  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCT SQLALAWVH
Sbjct  254  VNEIAQRKGCTTSQLALAWVH  274



>ref|NP_001052494.1| Os04g0338000 [Oryza sativa Japonica Group]
 sp|Q7XT99.2|AKR2_ORYSJ RecName: Full=Probable aldo-keto reductase 2 [Oryza sativa Japonica 
Group]
 emb|CAE01603.2| OSJNBa0008A08.11 [Oryza sativa Japonica Group]
 emb|CAE03308.2| OSJNBa0032I19.2 [Oryza sativa Japonica Group]
 dbj|BAF14408.1| Os04g0338000 [Oryza sativa Japonica Group]
 gb|EAZ30267.1| hypothetical protein OsJ_14315 [Oryza sativa Japonica Group]
 dbj|BAG88057.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94289.1| unnamed protein product [Oryza sativa Japonica Group]
Length=351

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF S+G KLVE+ S+ D+RK +PRFQ ENLE N   +E+
Sbjct  197  DIIPTCRELGIGIVAYSPLGRGFFSAGAKLVESLSDQDFRKHIPRFQQENLEKNAEIFER  256

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +KGCTPSQLALAWVH
Sbjct  257  VNAMAARKGCTPSQLALAWVH  277



>emb|CDP10282.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  240  VIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEKI  61
            VIPTCRELGIGIV +SPLGRGF +SG KL EN +++D+RK  PRFQ EN+EHN + +E++
Sbjct  193  VIPTCRELGIGIVPFSPLGRGFFASGAKLTENLTSNDFRKSFPRFQKENVEHNNKLFEQV  252

Query  60   VEIAEKKGCTPSQLALAWVH  1
             ++A +KGCTPSQLALAWVH
Sbjct  253  TQLATRKGCTPSQLALAWVH  272



>emb|CDP10280.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -2

Query  240  VIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEKI  61
            VIPTCRELGIGIV++SPLGRGF +SG KL EN +++D+RK +PRFQ EN+EHN + +E++
Sbjct  193  VIPTCRELGIGIVSFSPLGRGFFASGAKLTENLTSNDFRKRIPRFQEENVEHNNKLFEQV  252

Query  60   VEIAEKKGCTPSQLALAWVH  1
             ++A +KGCTPSQLALAWVH
Sbjct  253  AQLATRKGCTPSQLALAWVH  272



>ref|XP_010037371.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
Length=347

 Score =   129 bits (325),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D++PTCRELGIGIVAYSPLGRGF S G KLVEN S DD R+  PRFQ ENL HN + +++
Sbjct  195  DIVPTCRELGIGIVAYSPLGRGFFSVGSKLVENISKDDVRQYHPRFQPENLAHNTKLFDR  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCT SQLALAWVH
Sbjct  255  VNEIAQRKGCTTSQLALAWVH  275



>ref|XP_011015381.1| PREDICTED: probable aldo-keto reductase 2 [Populus euphratica]
Length=343

 Score =   129 bits (324),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCR+LGIGIVAYSPLGRGF S+GPKLVE+FS  DYRK + RF+ ENL+HN+  +E+
Sbjct  191  EIVPTCRDLGIGIVAYSPLGRGFFSTGPKLVESFSEGDYRKDMSRFRPENLDHNRHLFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +K CTPSQLALAW+H
Sbjct  251  VNEIAARKQCTPSQLALAWLH  271



>ref|XP_010069391.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
 gb|KCW57708.1| hypothetical protein EUGRSUZ_H00467 [Eucalyptus grandis]
Length=346

 Score =   129 bits (324),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGF S G KLVEN S DD+R+  PRFQ ENL HN + +++
Sbjct  194  EIIPTCRELGIGIVAYSPLGRGFFSVGSKLVENLSKDDFRQNQPRFQPENLAHNMKLFDR  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA++KGCT SQLALAWVH
Sbjct  254  VNEIAQRKGCTTSQLALAWVH  274



>ref|XP_011042753.1| PREDICTED: probable aldo-keto reductase 2 [Populus euphratica]
Length=341

 Score =   129 bits (324),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIV YSPLGRGF S+GPKLVE+FS  DYRK + RF+ ENL+HN+  +E+
Sbjct  191  EIVPTCRELGIGIVVYSPLGRGFFSTGPKLVESFSEGDYRKDMSRFRPENLDHNRHLFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +K CTPSQLALAW+H
Sbjct  251  VNEIAARKQCTPSQLALAWLH  271



>ref|XP_011042752.1| PREDICTED: probable aldo-keto reductase 2 [Populus euphratica]
Length=343

 Score =   129 bits (323),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIV YSPLGRGF S+GPKLVE+FS  DYRK + RF+ ENL+HN+  +E+
Sbjct  191  EIVPTCRELGIGIVVYSPLGRGFFSTGPKLVESFSEGDYRKDMSRFRPENLDHNRHLFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +K CTPSQLALAW+H
Sbjct  251  VNEIAARKQCTPSQLALAWLH  271



>ref|XP_011042750.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Populus 
euphratica]
Length=303

 Score =   128 bits (321),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIVAYSPLGRGF S+GPKLVE+ ++ D+RK LPRF+ ENL+HN + +E+
Sbjct  191  EIVPTCRELGIGIVAYSPLGRGFFSTGPKLVESLTDGDFRKGLPRFRPENLKHNTQLFER  250

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA +K CT SQLALAWVH
Sbjct  251  VNEIAARKQCTSSQLALAWVH  271



>gb|EYU32744.1| hypothetical protein MIMGU_mgv11b007689mg [Erythranthe guttata]
Length=346

 Score =   129 bits (323),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            +++PTCRELGIGIV YSPLGRGFLS GP L+EN S  DYRK  PRFQ ENLE NK  Y++
Sbjct  195  EIVPTCRELGIGIVPYSPLGRGFLSVGPTLIENMSESDYRKKFPRFQGENLEANKLVYQR  254

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            I E+A+ KGCTPSQLALAWV 
Sbjct  255  ISEMAKVKGCTPSQLALAWVQ  275



>ref|NP_001141057.1| putative oxidoreductase, aldo/keto reductase family protein [Zea 
mays]
 gb|ACF85305.1| unknown [Zea mays]
 tpg|DAA48280.1| TPA: putative oxidoreductase, aldo/keto reductase family protein 
[Zea mays]
Length=346

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG KLV++ S  D+RK +PRFQ ENL+ N + +E+
Sbjct  194  DIIPTCRELGIGIVAYSPLGRGFFSSGAKLVDSLSEQDFRKHMPRFQPENLDKNAQIFER  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +KGCTPSQLALAWVH
Sbjct  254  VSAMAARKGCTPSQLALAWVH  274



>ref|XP_009113194.1| PREDICTED: probable aldo-keto reductase 6 [Brassica rapa]
Length=346

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCR   IGIVAYSPLGRGF +SGPKL ENF  DD RK LPRFQ ENL+HNK  +EK
Sbjct  195  DIIPTCRSW-IGIVAYSPLGRGFFASGPKLAENFEQDDIRKNLPRFQQENLDHNKIVFEK  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + EIA KK CTP+QLALAWVH
Sbjct  254  VQEIARKKRCTPAQLALAWVH  274



>ref|XP_004975287.1| PREDICTED: probable aldo-keto reductase 2-like [Setaria italica]
Length=346

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGFLSSG KLV++ +  D+RK +PRFQ ENL+ N + +E+
Sbjct  194  DIIPTCRELGIGIVAYSPLGRGFLSSGTKLVDSLTEQDFRKHMPRFQPENLDKNAQIFER  253

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            +  +A +KGCTPSQLALAWVH
Sbjct  254  VNAMAARKGCTPSQLALAWVH  274



>ref|XP_010673284.1| PREDICTED: auxin-induced protein PCNT115-like [Beta vulgaris 
subsp. vulgaris]
Length=350

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIVAYSPLGRGFLS G K+++N  + D+RK LPR Q EN+EHNK  +EK
Sbjct  199  EIIPTCRELGIGIVAYSPLGRGFLSLGAKVMDNLIDSDFRKTLPRLQPENMEHNKLLFEK  258

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + +IA KKGCT SQLALAWVH
Sbjct  259  MSKIASKKGCTTSQLALAWVH  279



>ref|XP_010929910.1| PREDICTED: probable aldo-keto reductase 2 [Elaeis guineensis]
Length=342

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF S+G K+  + S+ D+RK +PRFQ ENLE N   +E+
Sbjct  190  DIIPTCRELGIGIVAYSPLGRGFFSAGLKMANSLSDQDFRKSMPRFQPENLEQNAVIFER  249

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A++KGCTPSQLALAWVH
Sbjct  250  VNEMAKRKGCTPSQLALAWVH  270



>gb|ABR16883.1| unknown [Picea sitchensis]
Length=345

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            ++IPTCRELGIGIV YSPLGRGFLS+G KL+EN ++ D+RK +PRF AENLE NK  +E+
Sbjct  195  EIIPTCRELGIGIVPYSPLGRGFLSAGAKLIENLADGDFRKDMPRFSAENLEKNKVIFER  254

Query  63   IVEIAEKKGCTPSQLALAWV  4
            I+EIA KK CTPSQLALAWV
Sbjct  255  ILEIASKKRCTPSQLALAWV  274



>ref|XP_004975285.1| PREDICTED: probable aldo-keto reductase 2-like [Setaria italica]
Length=349

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  DVIPTCRELGIGIVAYSPLGRGFLSSGPKLVENFSNDDYRKCLPRFQAENLEHNKRFYEK  64
            D+IPTCRELGIGIVAYSPLGRGF SSG KL+++ S  D RK  PRFQ +NL+ NK+ +E+
Sbjct  197  DIIPTCRELGIGIVAYSPLGRGFFSSGAKLMDSLSEQDIRKNWPRFQPDNLDKNKQIFER  256

Query  63   IVEIAEKKGCTPSQLALAWVH  1
            + E+A++KGCTPSQLALAWVH
Sbjct  257  VSEMAKRKGCTPSQLALAWVH  277



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514220833636