BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c96085_g1_i1 len=261 path=[1:0-260]

Length=261
                                                                      Score     E

ref|XP_009357813.1|  PREDICTED: ribulose bisphosphate carboxylase...  98.2    1e-23   
ref|XP_008381263.1|  PREDICTED: ribulose bisphosphate carboxylase...  97.8    4e-23   
ref|XP_009357812.1|  PREDICTED: ribulose bisphosphate carboxylase...  97.8    4e-23   
ref|XP_010036887.1|  PREDICTED: ribulose bisphosphate carboxylase...  95.1    4e-22   
gb|AAA33036.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...  95.1    4e-22   Mesembryanthemum crystallinum
sp|Q04450.1|RBS2_MESCR  RecName: Full=Ribulose bisphosphate carbo...  95.1    4e-22   Mesembryanthemum crystallinum
dbj|BAI53119.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  95.1    4e-22   Eucalyptus globulus [blue gum]
ref|XP_008368661.1|  PREDICTED: ribulose bisphosphate carboxylase...  92.8    1e-21   
dbj|BAE46384.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  93.6    2e-21   Panax ginseng [Chinese ginseng]
ref|XP_008352922.1|  PREDICTED: ribulose bisphosphate carboxylase...  93.2    2e-21   
gb|AGE93838.1|  chloroplat ribulose bisphosphate carboxylase smal...  90.9    2e-21   
ref|XP_008339672.1|  PREDICTED: ribulose bisphosphate carboxylase...  92.8    3e-21   
ref|XP_009342656.1|  PREDICTED: ribulose bisphosphate carboxylase...  92.8    4e-21   
ref|XP_008368660.1|  PREDICTED: ribulose bisphosphate carboxylase...  92.8    4e-21   
gb|AAA33866.1|  ribulose 1,5-bisphosphate carboxylase small subunit   92.4    4e-21   Malus domestica x Pyrus communis
sp|Q9XGX4.1|RBS3_AMAHP  RecName: Full=Ribulose bisphosphate carbo...  92.4    4e-21   Amaranthus hypochondriacus [prince's feather]
gb|AAO25119.1|  ribulose-1,5-bisphosphate carboxylase small subunit   92.4    5e-21   Chrysanthemum x morifolium [florist's chrysanthemum]
sp|P24007.1|RBS_PYRPY  RecName: Full=Ribulose bisphosphate carbox...  92.4    5e-21   Pyrus pyrifolia [sha li]
gb|ABQ42089.1|  ribulose bisphosphate carboxylase small chain (Ru...  91.7    8e-21   Sonneratia alba
gb|ACS68693.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  91.7    8e-21   Sonneratia alba
gb|ABQ42090.1|  ribulose bisphosphate carboxylase small chain (Ru...  91.7    8e-21   Sonneratia apetala
ref|XP_008446602.1|  PREDICTED: ribulose bisphosphate carboxylase...  91.7    1e-20   
ref|XP_010693073.1|  PREDICTED: ribulose bisphosphate carboxylase...  91.3    1e-20   
ref|XP_010693059.1|  PREDICTED: ribulose bisphosphate carboxylase...  91.3    1e-20   
emb|CAD11990.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  91.3    1e-20   Coffea arabica [arabica coffee]
ref|XP_009356790.1|  PREDICTED: ribulose bisphosphate carboxylase...  90.5    2e-20   
sp|Q02980.1|RBS_MALSP  RecName: Full=Ribulose bisphosphate carbox...  90.5    3e-20   Malus sp.
sp|Q9XGX5.1|RBS2_AMAHP  RecName: Full=Ribulose bisphosphate carbo...  90.1    3e-20   Amaranthus hypochondriacus [prince's feather]
sp|O22077.1|RBS_FAGCR  RecName: Full=Ribulose bisphosphate carbox...  90.1    3e-20   Fagus crenata
gb|AIF75302.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  89.7    3e-20   
gb|AIF75301.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  89.7    3e-20   
sp|P16032.2|RBS1_MESCR  RecName: Full=Ribulose bisphosphate carbo...  90.1    4e-20   Mesembryanthemum crystallinum
gb|ABQ42164.1|  ribulose bisphosphate carboxylase small chain (Ru...  89.7    5e-20   Sonneratia ovata
gb|AFO67218.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...  89.7    5e-20   
gb|AIR75141.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  89.0    6e-20   
sp|P04715.1|RBS2_PETHY  RecName: Full=Ribulose bisphosphate carbo...  88.6    1e-19   Petunia x hybrida [garden petunia]
ref|XP_010669829.1|  PREDICTED: ribulose bisphosphate carboxylase...  88.6    1e-19   
ref|XP_009595081.1|  PREDICTED: ribulose bisphosphate carboxylase...  88.6    1e-19   
ref|XP_002532149.1|  Ribulose bisphosphate carboxylase small chai...  88.6    1e-19   Ricinus communis
ref|XP_009794476.1|  PREDICTED: ribulose bisphosphate carboxylase...  86.7    1e-19   
ref|XP_006430778.1|  hypothetical protein CICLE_v10012893mg           87.8    1e-19   
gb|AAU14862.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  88.6    1e-19   Fagus sylvatica
gb|AAA34116.1|  ribulose-1,5-bisphosphate carboxylase small subunit   86.7    1e-19   Nicotiana tabacum [American tobacco]
sp|P26576.1|RBSB_SOLTU  RecName: Full=Ribulose bisphosphate carbo...  88.6    1e-19   Solanum tuberosum [potatoes]
ref|XP_006363111.1|  PREDICTED: ribulose bisphosphate carboxylase...  88.6    1e-19   
ref|XP_010044264.1|  PREDICTED: ribulose bisphosphate carboxylase...  88.6    1e-19   
gb|AIF75300.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  87.8    1e-19   
gb|AAA33035.1|  ribulose-1-5-bisphosphate carboxylase                 88.6    1e-19   Mesembryanthemum crystallinum
gb|ABK96431.1|  unknown                                               88.2    2e-19   Populus trichocarpa x Populus deltoides
ref|XP_010693054.1|  PREDICTED: ribulose bisphosphate carboxylase...  88.2    2e-19   
sp|Q96542.1|RBS_BETPN  RecName: Full=Ribulose bisphosphate carbox...  88.2    2e-19   Betula pendula [white birch]
gb|EYU38175.1|  hypothetical protein MIMGU_mgv1a014707mg              87.8    2e-19   
ref|XP_004232356.1|  PREDICTED: ribulose bisphosphate carboxylase...  87.8    2e-19   
sp|P07180.1|RBS3A_SOLLC  RecName: Full=Ribulose bisphosphate carb...  87.8    2e-19   Solanum lycopersicum
ref|XP_011015710.1|  PREDICTED: ribulose bisphosphate carboxylase...  87.4    2e-19   
gb|EYU38174.1|  hypothetical protein MIMGU_mgv1a014707mg              87.8    3e-19   
ref|XP_010693099.1|  PREDICTED: ribulose bisphosphate carboxylase...  87.8    3e-19   
ref|XP_006482255.1|  PREDICTED: ribulose bisphosphate carboxylase...  86.7    3e-19   
gb|EYU38172.1|  hypothetical protein MIMGU_mgv1a014686mg              87.4    3e-19   
gb|AIR75140.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  87.4    3e-19   
gb|AIF75299.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  87.0    3e-19   
gb|ABK96567.1|  unknown                                               87.4    3e-19   Populus trichocarpa x Populus deltoides
ref|XP_006383456.1|  Ribulose bisphosphate carboxylase small chai...  87.4    3e-19   
ref|XP_011021244.1|  PREDICTED: ribulose bisphosphate carboxylase...  87.4    4e-19   
gb|ABK96590.1|  unknown                                               87.4    4e-19   Populus trichocarpa x Populus deltoides
sp|Q41351.1|RBS_STELP  RecName: Full=Ribulose bisphosphate carbox...  87.4    4e-19   Stellaria longipes
ref|XP_004299075.1|  PREDICTED: ribulose bisphosphate carboxylase...  87.4    4e-19   
gb|KCW52064.1|  hypothetical protein EUGRSUZ_J01502                   87.4    4e-19   
dbj|BAI53118.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  87.0    5e-19   Eucalyptus globulus [blue gum]
ref|XP_009800809.1|  PREDICTED: ribulose bisphosphate carboxylase...  87.0    5e-19   
gb|AIF75357.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  86.3    5e-19   
gb|KCW52065.1|  hypothetical protein EUGRSUZ_J01502                   87.0    5e-19   
gb|AGV08375.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  87.0    6e-19   
ref|XP_010032637.1|  PREDICTED: ribulose bisphosphate carboxylase...  87.0    6e-19   
gb|ACO35888.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  86.7    6e-19   Ageratina adenophora
ref|XP_011035062.1|  PREDICTED: ribulose bisphosphate carboxylase...  86.7    7e-19   
gb|AIB04188.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  86.7    7e-19   
sp|P26575.1|RBSA_SOLTU  RecName: Full=Ribulose bisphosphate carbo...  86.7    7e-19   Solanum tuberosum [potatoes]
gb|AIR75142.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  86.3    7e-19   
sp|Q39749.1|RBS7_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  86.3    8e-19   Flaveria pringlei
gb|AEX60836.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  86.3    8e-19   
gb|AIR75144.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  85.9    9e-19   
ref|XP_002305162.2|  Ribulose bisphosphate carboxylase small chai...  86.3    9e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006482254.1|  PREDICTED: ribulose bisphosphate carboxylase...  86.3    9e-19   
ref|XP_002521232.1|  Ribulose bisphosphate carboxylase small chai...  86.3    9e-19   Ricinus communis
ref|XP_010265136.1|  PREDICTED: ribulose bisphosphate carboxylase...  84.7    9e-19   
ref|XP_006430779.1|  hypothetical protein CICLE_v10012893mg           86.3    1e-18   
gb|AFS41724.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  86.3    1e-18   
gb|AFS41770.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  85.9    1e-18   
gb|AEX60841.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  86.3    1e-18   
gb|AFS41765.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  85.9    1e-18   
gb|AFS41744.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  86.3    1e-18   
gb|AFS41729.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  86.3    1e-18   
ref|XP_007033269.1|  Ribulose bisphosphate carboxylase (small cha...  86.3    1e-18   
ref|XP_007033270.1|  Ribulose bisphosphate carboxylase (small cha...  86.3    1e-18   
gb|AFK42721.1|  unknown                                               85.9    1e-18   
gb|AIF75353.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  85.1    1e-18   
gb|ABK55670.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  84.7    1e-18   Cucumis sativus [cucumbers]
gb|AIF75349.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  85.1    1e-18   
gb|AIF75298.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  85.5    1e-18   
ref|XP_009795055.1|  PREDICTED: ribulose bisphosphate carboxylase...  85.9    1e-18   
gb|AFB70994.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  85.9    2e-18   
ref|XP_008243231.1|  PREDICTED: ribulose bisphosphate carboxylase...  85.5    2e-18   
sp|P32764.1|RBS3_SOLTU  RecName: Full=Ribulose bisphosphate carbo...  85.5    2e-18   Solanum tuberosum [potatoes]
sp|P26573.1|RBS8_NICPL  RecName: Full=Ribulose bisphosphate carbo...  85.5    2e-18   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_007225932.1|  hypothetical protein PRUPE_ppa012174mg           85.5    2e-18   
ref|NP_001275244.1|  ribulose bisphosphate carboxylase small chai...  85.5    2e-18   
ref|XP_008244507.1|  PREDICTED: ribulose bisphosphate carboxylase...  84.3    2e-18   
sp|P08705.1|RBS_HELAN  RecName: Full=Ribulose bisphosphate carbox...  85.1    2e-18   Helianthus annuus
sp|O65194.1|RBS_MEDSA  RecName: Full=Ribulose bisphosphate carbox...  85.1    2e-18   Medicago sativa [alfalfa]
sp|Q08184.1|RBS4_MESCR  RecName: Full=Ribulose bisphosphate carbo...  85.1    2e-18   Mesembryanthemum crystallinum
ref|XP_004233493.1|  PREDICTED: ribulose bisphosphate carboxylase...  85.1    3e-18   
ref|XP_006391472.1|  hypothetical protein EUTSA_v10019202mg           85.1    3e-18   
gb|ABK95229.1|  unknown                                               84.7    3e-18   Populus trichocarpa [western balsam poplar]
gb|AAA34191.1|  ribulose-1,5-bisphosphate carboxylase, small subu...  84.7    3e-18   Solanum lycopersicum
emb|CCF55356.1|  ribulose-1,5-bisphosphate carboxylase small subunit  84.7    3e-18   
ref|XP_004135094.1|  PREDICTED: ribulose bisphosphate carboxylase...  84.7    4e-18   
gb|ABK15574.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  84.7    4e-18   Camellia sinensis [black tea]
gb|AIF75359.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  84.0    4e-18   
gb|ABS72189.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  84.7    4e-18   Corchorus olitorius
gb|AFS41772.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  84.3    4e-18   
emb|CBY05833.1|  Ribulose 1,5-bisphosphate carboxylase small subu...  84.3    4e-18   
gb|AFK48034.1|  unknown                                               84.3    5e-18   
ref|XP_010265138.1|  PREDICTED: ribulose bisphosphate carboxylase...  84.3    5e-18   
gb|AFK40375.1|  unknown                                               84.3    5e-18   
sp|Q39747.1|RBS5_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  84.3    5e-18   Flaveria pringlei
ref|XP_008244506.1|  PREDICTED: ribulose bisphosphate carboxylase...  84.3    5e-18   
ref|XP_003618736.1|  Ribulose bisphosphate carboxylase small chain    84.3    5e-18   
sp|Q39745.1|RBS3_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  84.0    5e-18   Flaveria pringlei
sp|Q39746.1|RBS4_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  84.0    6e-18   Flaveria pringlei
gb|AIF75355.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  83.6    6e-18   
gb|AIF75365.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  83.6    7e-18   
gb|AIF75367.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  83.2    7e-18   
gb|AIF75364.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  83.2    7e-18   
sp|Q39743.1|RBS1_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  84.0    7e-18   Flaveria pringlei
sp|P04714.1|RBS1_PETHY  RecName: Full=Ribulose bisphosphate carbo...  84.0    8e-18   Petunia x hybrida [garden petunia]
sp|Q08186.1|RBS6_MESCR  RecName: Full=Ribulose bisphosphate carbo...  84.0    8e-18   Mesembryanthemum crystallinum
gb|AEX60835.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  83.6    8e-18   
ref|XP_004234568.1|  PREDICTED: ribulose bisphosphate carboxylase...  84.0    8e-18   
gb|AAA34192.1|  ribulose-1,5-bisphosphate carboxylase, small subu...  84.0    8e-18   Solanum lycopersicum
gb|AFS41762.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  83.6    9e-18   
gb|AFS41727.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  83.6    9e-18   
gb|AIF75351.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  83.2    9e-18   
sp|P31333.2|RBS_GOSHI  RecName: Full=Ribulose bisphosphate carbox...  83.6    1e-17   Gossypium hirsutum [American cotton]
gb|AEX60840.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  83.2    1e-17   
gb|AEX60838.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  83.2    1e-17   
sp|Q08183.1|RBS3_MESCR  RecName: Full=Ribulose bisphosphate carbo...  83.6    1e-17   Mesembryanthemum crystallinum
gb|AAA33037.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...  83.6    1e-17   Mesembryanthemum crystallinum
gb|AFS41756.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  83.2    1e-17   
ref|XP_011099669.1|  PREDICTED: ribulose bisphosphate carboxylase...  83.2    1e-17   
gb|AIF75346.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  82.8    1e-17   
gb|KDP20120.1|  hypothetical protein JCGZ_05889                       83.2    1e-17   
gb|AFS41771.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  82.8    1e-17   
gb|AFS41763.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  82.8    1e-17   
gb|AFS41766.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  82.8    1e-17   
emb|CAA48415.1|  unnamed protein product                              80.9    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004303137.1|  PREDICTED: ribulose bisphosphate carboxylase...  83.2    1e-17   
gb|AAF19793.1|AF162210_1  ribulose-1,5-bisphosphate carboxylase/o...  82.8    2e-17   Lactuca sativa [cultivated lettuce]
ref|XP_010263805.1|  PREDICTED: ribulose bisphosphate carboxylase...  82.8    2e-17   
gb|AAF06098.1|  ribulose 1,5-bisphosphate carboxylase small chain...  82.8    2e-17   Manihot esculenta [manioc]
gb|AEX60842.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  82.8    2e-17   
ref|XP_009758143.1|  PREDICTED: ribulose bisphosphate carboxylase...  82.8    2e-17   
gb|AFS41754.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  82.8    2e-17   
gb|AFS41732.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  82.8    2e-17   
gb|AFS41725.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  82.8    2e-17   
gb|AFS41733.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  82.8    2e-17   
ref|XP_010435745.1|  PREDICTED: ribulose bisphosphate carboxylase...  82.8    2e-17   
ref|XP_010263795.1|  PREDICTED: ribulose bisphosphate carboxylase...  82.8    2e-17   
gb|AHI85721.1|  stress-induced protein 16                             82.8    2e-17   
ref|XP_007215051.1|  hypothetical protein PRUPE_ppa012123mg           82.4    2e-17   
ref|XP_010435743.1|  PREDICTED: ribulose bisphosphate carboxylase...  82.4    3e-17   
ref|XP_010450912.1|  PREDICTED: ribulose bisphosphate carboxylase...  82.4    3e-17   
ref|XP_010440948.1|  PREDICTED: ribulose bisphosphate carboxylase...  82.4    3e-17   
gb|AFK36660.1|  unknown                                               82.4    3e-17   
gb|AFK33868.1|  unknown                                               82.4    3e-17   
sp|P08474.1|RBS_CUCSA  RecName: Full=Ribulose bisphosphate carbox...  82.4    3e-17   Cucumis sativus [cucumbers]
gb|ADB85091.1|  ribulose 1,5-bisphosphate carboxylase small subunit   82.4    3e-17   
gb|EPS63610.1|  ribulose bisphosphate carboxylase small chain         82.0    3e-17   
ref|XP_009139780.1|  PREDICTED: ribulose bisphosphate carboxylase...  81.3    3e-17   
ref|XP_009140170.1|  PREDICTED: ribulose bisphosphate carboxylase...  82.0    3e-17   
gb|AIF75322.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  82.0    3e-17   
emb|CDY52468.1|  BnaA04g27920D                                        82.0    4e-17   
gb|AIF75321.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  82.0    4e-17   
ref|XP_010103758.1|  hypothetical protein L484_014647                 82.0    4e-17   
gb|ACQ90230.1|  virus-resistance protein                              82.8    4e-17   
ref|XP_009767108.1|  PREDICTED: ribulose bisphosphate carboxylase...  82.0    4e-17   
gb|AIF75323.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  82.0    4e-17   
gb|AIF75363.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  81.3    4e-17   
gb|AIF75361.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  81.3    4e-17   
gb|KHG18747.1|  Ribulose bisphosphate carboxylase small chain, ch...  81.6    4e-17   
gb|AIF75340.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  81.6    5e-17   
sp|Q39744.1|RBS2_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  81.6    5e-17   Flaveria pringlei
sp|P18960.1|RBS_SILPR  RecName: Full=Ribulose bisphosphate carbox...  81.6    5e-17   Silene latifolia subsp. alba [white campion]
ref|XP_009125072.1|  PREDICTED: ribulose bisphosphate carboxylase...  81.6    5e-17   
gb|AIR75143.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  80.9    5e-17   
emb|CAA53083.1|  ribulose-1,5-bisphosphate carboxylase /oxygenase...  81.6    5e-17   Brassica napus [oilseed rape]
gb|AEX60837.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  81.3    5e-17   
emb|CDX67402.1|  BnaA07g14420D                                        81.6    5e-17   
emb|CDX99682.1|  BnaC04g34390D                                        81.6    5e-17   
gb|AIF75324.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  81.6    5e-17   
gb|AAF03096.1|AF162195_1  ribulose-1,5-bisphosphate carboxylase/o...  81.6    5e-17   Lactuca sativa [cultivated lettuce]
ref|XP_010450911.1|  PREDICTED: ribulose bisphosphate carboxylase...  81.6    5e-17   
gb|AIF75291.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  81.3    5e-17   
gb|AIF75344.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  81.6    6e-17   
gb|AFS41753.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  81.6    6e-17   
sp|Q40250.1|RBS_LACSA  RecName: Full=Ribulose bisphosphate carbox...  81.6    6e-17   Lactuca sativa [cultivated lettuce]
ref|NP_001031981.1|  ribulose bisphosphate carboxylase small chai...  81.3    6e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75289.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  81.3    6e-17   
ref|XP_006405770.1|  hypothetical protein EUTSA_v10027955mg           81.3    6e-17   
ref|NP_198657.1|  ribulose bisphosphate carboxylase small chain 3B    81.3    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285820.1|  hypothetical protein CARUB_v10007296mg           81.3    7e-17   
ref|NP_001119331.1|  ribulose bisphosphate carboxylase small chai...  81.3    7e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AFW90575.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  81.3    7e-17   
gb|AEX60843.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  81.3    8e-17   
gb|AFS41748.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  81.3    8e-17   
gb|AEX60839.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  81.3    8e-17   
ref|NP_974098.1|  ribulose bisphosphate carboxylase small chain 1A    80.1    8e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440945.1|  PREDICTED: ribulose bisphosphate carboxylase...  80.9    9e-17   
ref|XP_002888576.1|  ribulose bisphosphate carboxylase small chai...  80.9    9e-17   
gb|AIF75285.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  80.5    9e-17   
ref|XP_009625434.1|  PREDICTED: ribulose bisphosphate carboxylase...  80.9    1e-16   
emb|CAA32701.1|  ribulose bisphosphate carboxylase                    80.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003637842.1|  Ribulose bisphosphate carboxylase small chai...  79.3    1e-16   
gb|ABB51649.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  80.9    1e-16   Brassica napus [oilseed rape]
ref|XP_009139778.1|  PREDICTED: ribulose bisphosphate carboxylase...  80.9    1e-16   
gb|AIF75317.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  80.9    1e-16   
ref|NP_198659.1|  ribulose bisphosphate carboxylase small chain 1B    80.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75296.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  80.5    1e-16   
ref|XP_010450913.1|  PREDICTED: ribulose bisphosphate carboxylase...  80.5    1e-16   
ref|NP_198658.1|  ribulose bisphosphate carboxylase small chain 2B    80.5    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AEB00556.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  80.5    1e-16   
emb|CDY01665.1|  BnaC04g30870D                                        80.5    2e-16   
gb|AIF75292.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  80.1    2e-16   
gb|AIF75337.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  80.5    2e-16   
sp|P08135.1|RBS_RAPSA  RecName: Full=Ribulose bisphosphate carbox...  80.5    2e-16   Raphanus sativus
gb|AIF75283.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  80.1    2e-16   
ref|XP_011099670.1|  PREDICTED: ribulose bisphosphate carboxylase...  80.5    2e-16   
ref|XP_010470604.1|  PREDICTED: ribulose bisphosphate carboxylase...  79.3    2e-16   
ref|XP_002868775.1|  ribulose bisphosphate carboxylase small chai...  80.1    2e-16   
gb|AAW31667.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  80.1    2e-16   Ammopiptanthus mongolicus
ref|WP_021036336.1|  Ribulose-1,5-bisphosphate carboxylase small ...  79.3    2e-16   
gb|AIF75342.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  80.1    2e-16   
ref|XP_002868776.1|  ribulose bisphosphate carboxylase                80.1    2e-16   
gb|AIR75139.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  79.7    2e-16   
emb|CDY67657.1|  BnaCnng55860D                                        80.1    2e-16   
ref|XP_009602965.1|  PREDICTED: ribulose bisphosphate carboxylase...  80.1    2e-16   
gb|ABA46911.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  79.7    2e-16   Musa acuminata [banana]
ref|XP_006285696.1|  hypothetical protein CARUB_v10007166mg           80.1    2e-16   
sp|Q39748.1|RBS6_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  79.7    2e-16   Flaveria pringlei
ref|XP_009602966.1|  PREDICTED: ribulose bisphosphate carboxylase...  78.6    2e-16   
gb|AAG40356.1|AF325004_1  At1g67090                                   80.1    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAP31053.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  79.7    2e-16   Flaveria bidentis
ref|NP_176880.1|  ribulose bisphosphate carboxylase small chain 1A    80.1    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001235314.1|  uncharacterized protein LOC100500504             79.7    2e-16   
ref|XP_010926041.1|  PREDICTED: ribulose bisphosphate carboxylase...  79.7    2e-16   
gb|AGT97045.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...  79.7    2e-16   
ref|XP_006284616.1|  hypothetical protein CARUB_v10005847mg           79.7    2e-16   
gb|AAR83879.1|  Cristal-Glass1 protein                                79.7    2e-16   Capsicum annuum
gb|ABQ42552.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  79.7    2e-16   Musa acuminata [banana]
sp|P00865.1|RBS1_SOYBN  RecName: Full=Ribulose bisphosphate carbo...  79.7    2e-16   Glycine max [soybeans]
gb|ADT78691.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  79.7    3e-16   
emb|CAA32702.1|  ribulose bisphosphate carboxylase                    79.7    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75332.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  79.7    3e-16   
gb|ABA46889.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  79.3    3e-16   Musa AAAB Group
gb|ABA46898.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  79.3    3e-16   Musa acuminata AAA Group [Cavendish banana]
gb|AAG24884.1|AF303941_1  ribulose-1,5-bisphosphate carboxylase s...  79.7    3e-16   Glycine max [soybeans]
gb|AGU28441.1|  ribulose bisphosphate carboxylase family protein      77.8    3e-16   
gb|AAF06100.1|  ribulose 1,5-bisphosphate carboxylase small chain...  79.7    3e-16   Manihot esculenta [manioc]
ref|NP_001241137.1|  ribulose bisphosphate carboxylase small chai...  79.3    3e-16   
ref|XP_003636960.1|  Ribulose bisphosphate carboxylase small chai...  77.8    3e-16   
ref|XP_008807113.1|  PREDICTED: ribulose bisphosphate carboxylase...  79.3    3e-16   
gb|AIF75294.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  79.0    3e-16   
gb|AAA82069.1|  ribulose 1,5-bisphosphate carboxylase small subun...  79.3    4e-16   Glycine soja [wild soybean]
ref|XP_003636956.1|  Ribulose bisphosphate carboxylase small chai...  79.3    4e-16   
gb|ABA46901.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  79.3    4e-16   Musa acuminata [banana]
gb|AIF75295.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  79.0    4e-16   
gb|AIR75138.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  79.0    4e-16   
sp|Q42915.1|RBS_MANES  RecName: Full=Ribulose bisphosphate carbox...  79.3    4e-16   Manihot esculenta [manioc]
gb|ABA46875.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  79.0    4e-16   Musa balbisiana [starchy banana]
ref|XP_010511625.1|  PREDICTED: ribulose bisphosphate carboxylase...  79.3    4e-16   
sp|P17673.1|RBS_TRIRP  RecName: Full=Ribulose bisphosphate carbox...  79.0    4e-16   
gb|AAF06097.1|  ribulose 1,5-bisphosphate carboxylase small chain...  79.0    4e-16   
ref|XP_003600302.1|  Ribulose bisphosphate carboxylase small chai...  79.0    4e-16   
gb|KEH21537.1|  ribulose bisphosphate carboxylase small chain         79.3    5e-16   
gb|KEH21538.1|  ribulose bisphosphate carboxylase small chain         79.0    5e-16   
ref|XP_003637843.1|  Ribulose bisphosphate carboxylase small chai...  79.0    5e-16   
gb|AIL82451.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  79.0    5e-16   
gb|ABA46900.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  79.0    5e-16   
gb|ACJ85905.1|  unknown                                               79.0    5e-16   
gb|AIR75136.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  78.6    5e-16   
ref|XP_006358055.1|  PREDICTED: ribulose-1,5-bisphosphate carboxy...  79.0    5e-16   
gb|ABA46878.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  78.6    5e-16   
gb|AAB81105.1|  ribulose 1,5-bisphosphate carboxylase small subunit   79.0    5e-16   
sp|Q43832.1|RBS2_SPIOL  RecName: Full=Ribulose bisphosphate carbo...  79.0    5e-16   
ref|XP_009390221.1|  PREDICTED: ribulose bisphosphate carboxylase...  79.0    5e-16   
gb|ABC86738.1|  ribulose-1,5-bisphophate carboxylase/oxygenase sm...  78.6    6e-16   
ref|XP_010916368.1|  PREDICTED: ribulose bisphosphate carboxylase...  78.6    6e-16   
ref|XP_003636970.1|  Ribulose bisphosphate carboxylase small chai...  78.6    6e-16   
gb|KEH21536.1|  ribulose bisphosphate carboxylase small chain         78.6    6e-16   
sp|P26574.1|RBS1_SOLTU  RecName: Full=Ribulose bisphosphate carbo...  78.6    7e-16   
ref|XP_006391132.1|  hypothetical protein EUTSA_v10019199mg           78.6    7e-16   
gb|ABA46879.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  78.2    7e-16   
ref|XP_006302885.1|  hypothetical protein CARUB_v10021016mg           78.6    7e-16   
gb|ABA46892.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  78.2    7e-16   
gb|ABA46888.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  78.2    7e-16   
gb|ABY21253.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  78.6    7e-16   
gb|ABA46891.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  78.2    7e-16   
gb|AIF75288.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  78.2    7e-16   
gb|ABA46899.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  78.6    8e-16   
gb|ABA46882.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  78.2    8e-16   
gb|ABA46910.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  78.2    8e-16   
gb|ABL97962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  78.6    8e-16   
sp|Q08185.1|RBS5_MESCR  RecName: Full=Ribulose bisphosphate carbo...  78.6    8e-16   
ref|XP_002531624.1|  Ribulose bisphosphate carboxylase small chai...  78.2    9e-16   
sp|O24045.1|RBS_MUSAC  RecName: Full=Ribulose bisphosphate carbox...  78.2    9e-16   
sp|O65349.1|RBS_CAPAN  RecName: Full=Ribulose bisphosphate carbox...  78.6    9e-16   
sp|P05346.2|RBS1_BRANA  RecName: Full=Ribulose bisphosphate carbo...  78.2    9e-16   
dbj|BAJ08160.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase      78.2    9e-16   
gb|ABA46877.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  77.8    1e-15   
gb|AIF75313.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  78.2    1e-15   
sp|Q42516.1|RBS1_AMAHP  RecName: Full=Ribulose bisphosphate carbo...  78.2    1e-15   
ref|XP_009380302.1|  PREDICTED: ribulose bisphosphate carboxylase...  78.2    1e-15   
gb|ABA46887.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  77.8    1e-15   
ref|XP_002276967.1|  PREDICTED: ribulose bisphosphate carboxylase...  77.8    1e-15   
gb|KEH21531.1|  ribulose bisphosphate carboxylase small chain         77.8    1e-15   
sp|P12468.1|RBS4_SOYBN  RecName: Full=Ribulose bisphosphate carbo...  77.8    1e-15   
gb|AEA48975.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  77.8    2e-15   
gb|KEH21530.1|  ribulose bisphosphate carboxylase small chain         77.8    2e-15   
gb|KEH21539.1|  ribulose bisphosphate carboxylase small chain         77.8    2e-15   
emb|CAA10290.1|  ribulose 1,5-bisphosphate carboxylase small subunit  77.4    2e-15   
ref|XP_010521010.1|  PREDICTED: ribulose bisphosphate carboxylase...  77.4    2e-15   
gb|EYU45444.1|  hypothetical protein MIMGU_mgv1a014737mg              77.4    2e-15   
ref|XP_003618735.1|  Ribulose bisphosphate carboxylase small chain    77.0    2e-15   
ref|XP_009774104.1|  PREDICTED: ribulose bisphosphate carboxylase...  77.4    2e-15   
gb|ABY21255.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  77.4    2e-15   
gb|ABA46883.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  77.0    2e-15   
gb|ABY21254.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  77.0    3e-15   
ref|XP_011089882.1|  PREDICTED: ribulose bisphosphate carboxylase...  77.0    3e-15   
sp|P19311.1|RBS5_LEMGI  RecName: Full=Ribulose bisphosphate carbo...  77.0    3e-15   
ref|XP_010551266.1|  PREDICTED: ribulose bisphosphate carboxylase...  77.0    3e-15   
gb|AEJ33935.1|  chloroplast putative ribulose-1,5-bisphosphate ca...  76.6    3e-15   
sp|O48550.1|RBS_ZANAE  RecName: Full=Ribulose bisphosphate carbox...  76.6    3e-15   
ref|NP_001235266.1|  ribulose-1,5-bisphosphate carboxylase small ...  76.6    4e-15   
emb|CAA30290.1|  rubisco ssu precursor                                76.3    5e-15   
gb|ACU13285.1|  unknown                                               76.3    5e-15   
ref|WP_033351873.1|  hypothetical protein                             73.9    6e-15   
gb|ABA46909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  75.5    7e-15   
emb|CDP20139.1|  unnamed protein product                              75.5    8e-15   
ref|XP_009403968.1|  PREDICTED: ribulose bisphosphate carboxylase...  75.5    1e-14   
ref|XP_008797838.1|  PREDICTED: ribulose bisphosphate carboxylase...  75.5    1e-14   
gb|AAB95214.1|  ribulose 1,5 bisphosphate carboxylase small subunit   74.7    1e-14   
gb|AAB95215.1|  ribulose 1,5 bisphosphate carboxylase small subunit   74.3    1e-14   
ref|XP_009357814.1|  PREDICTED: ribulose bisphosphate carboxylase...  75.1    1e-14   
emb|CAA31948.1|  ribulose bisphosphate carboxylase                    75.1    2e-14   
gb|AAD27881.1|AF139469_1  ribulose-1,5-bisphosphate carboxylase s...  74.7    2e-14   
sp|P07689.1|RBS3_PEA  RecName: Full=Ribulose bisphosphate carboxy...  74.7    2e-14   
ref|XP_003636929.1|  Ribulose bisphosphate carboxylase small chai...  77.8    2e-14   
gb|AAP31054.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  74.3    2e-14   
sp|P07089.1|RBS_FLATR  RecName: Full=Ribulose bisphosphate carbox...  74.3    2e-14   
sp|P00869.1|RBS2_PEA  RecName: Full=Ribulose bisphosphate carboxy...  74.3    2e-14   
gb|ABL97974.1|  ribulose bisphosphate carboxylase                     73.9    2e-14   
sp|P19312.1|RBS6_LEMGI  RecName: Full=Ribulose bisphosphate carbo...  73.6    4e-14   
ref|XP_003555148.2|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...  73.6    4e-14   
gb|AAB97165.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...  72.0    5e-14   
dbj|BAB13745.1|  ribulose 1,5 bisphosphate carboxylase small subunit  71.6    8e-14   
emb|CAD21856.1|  putative ribulose 1,5 biphosphate carboxylase sm...  72.8    1e-13   
sp|P19308.1|RBS2_LEMGI  RecName: Full=Ribulose bisphosphate carbo...  72.4    1e-13   
gb|AIF75328.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  72.4    1e-13   
emb|CDY42338.1|  BnaC02g17150D                                        72.4    1e-13   
ref|XP_007151650.1|  hypothetical protein PHAVU_004G064800g           72.0    2e-13   
gb|AGV54682.1|  ribulose bisphosphate carboxylase                     72.0    2e-13   
emb|CAA42618.1|  ribulose bisphosphate carboxylase                    72.0    2e-13   
gb|KDP29409.1|  hypothetical protein JCGZ_18330                       71.2    2e-13   
emb|CAA29358.1|  unnamed protein product                              69.7    3e-13   
gb|AAB95212.1|  ribulose 1,5 bisphosphate carboxylase small subunit   70.9    3e-13   
gb|AAB95210.1|  ribulose 1,5 bisphosphate carboxylase small subunit   70.9    3e-13   
gb|ACA42439.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  71.2    4e-13   
ref|XP_009127519.1|  PREDICTED: ribulose bisphosphate carboxylase...  70.9    4e-13   
gb|ACN22611.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  68.6    5e-13   
ref|XP_009127518.1|  PREDICTED: ribulose bisphosphate carboxylase...  70.9    5e-13   
sp|Q42823.1|RBS_GLYTA  RecName: Full=Ribulose bisphosphate carbox...  70.9    5e-13   
sp|P29684.1|RBS_HEVBR  RecName: Full=Ribulose bisphosphate carbox...  70.9    5e-13   
sp|Q42822.1|RBS_GLYTO  RecName: Full=Ribulose bisphosphate carbox...  70.9    5e-13   
sp|O22572.1|RBS2_FRIAG  RecName: Full=Ribulose bisphosphate carbo...  70.9    5e-13   
ref|XP_009127523.1|  PREDICTED: ribulose bisphosphate carboxylase...  70.5    6e-13   
gb|AIF75311.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  70.5    6e-13   
emb|CDY12616.1|  BnaA02g12840D                                        70.5    6e-13   
emb|CDY42337.1|  BnaC02g17140D                                        70.5    7e-13   
gb|AIF75326.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  70.1    7e-13   
sp|O24634.1|RBS1_FRIAG  RecName: Full=Ribulose bisphosphate carbo...  69.7    1e-12   
emb|CBI15452.3|  unnamed protein product                              68.6    2e-12   
sp|O22645.1|RBS5_FRIAG  RecName: Full=Ribulose bisphosphate carbo...  68.9    3e-12   
gb|AAB95217.1|  ribulose 1,5 bisphosphate carboxylase small subunit   68.2    3e-12   
gb|AIF75330.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  68.6    3e-12   
ref|XP_010528479.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...  68.9    3e-12   
gb|AAB95211.1|  ribulose 1,5 bisphosphate carboxylase small subunit   68.2    3e-12   
gb|ABZ04129.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  66.2    4e-12   
gb|AFO59569.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  67.8    5e-12   
sp|O22573.1|RBS3_FRIAG  RecName: Full=Ribulose bisphosphate carbo...  67.8    5e-12   
ref|NP_001105294.1|  ribulose bisphosphate carboxylase small chai...  67.8    5e-12   
emb|CAA68419.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase      67.8    5e-12   
emb|CAP09638.1|  acetolactate-synthase-C-DnaE intein C fusion pro...  69.3    6e-12   
emb|CAH59401.1|  Rubisco SSU                                          67.8    6e-12   
gb|AAF17589.1|AF202645_1  ribulose-1,5-bisphosphate carboxylase s...  67.4    7e-12   
gb|AAF07946.1|AF192777_1  ribulose-1,5-bisphosphate carboxylase s...  67.4    8e-12   
gb|AAF17590.1|AF202646_1  ribulose-1,5-bisphosphate carboxylase s...  67.4    9e-12   
ref|XP_002450304.1|  hypothetical protein SORBIDRAFT_05g003480        66.6    1e-11   
gb|EMT09369.1|  Ribulose bisphosphate carboxylase small chain PWS...  66.2    1e-11   
ref|XP_006842277.1|  hypothetical protein AMTR_s00079p00061090        66.6    1e-11   
ref|XP_007044344.1|  Ribulose bisphosphate carboxylase small chai...  65.9    2e-11   
dbj|BAB19811.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  66.2    2e-11   
dbj|BAA35158.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  66.2    2e-11   
dbj|BAA35161.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  66.2    2e-11   
dbj|BAA35156.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  66.2    2e-11   
ref|XP_006485852.1|  PREDICTED: ribulose bisphosphate carboxylase...  66.6    2e-11   
sp|Q41373.1|RBS_SACHY  RecName: Full=Ribulose bisphosphate carbox...  66.2    2e-11   
dbj|BAA35166.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  65.9    3e-11   
dbj|BAJ40065.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  65.9    3e-11   
dbj|BAA35165.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  65.9    3e-11   
dbj|BAA35153.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  65.9    3e-11   
gb|AAC83374.1|  ribulose-1,5-bisphosphate carboxylase small subunit   65.9    3e-11   
dbj|BAA35162.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  65.5    3e-11   
dbj|BAJ90202.1|  predicted protein                                    65.5    3e-11   
gb|ABY66908.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  65.5    4e-11   
emb|CAA70416.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  65.5    4e-11   
sp|P00871.2|RBS1_WHEAT  RecName: Full=Ribulose bisphosphate carbo...  65.5    4e-11   
dbj|BAA35167.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  65.5    4e-11   
dbj|BAA35164.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  65.5    4e-11   
ref|XP_003577109.1|  PREDICTED: ribulose bisphosphate carboxylase...  65.5    4e-11   
gb|AAC78643.1|  ribulose-1,5-bisphosphate carboxylase small subunit   64.7    6e-11   
gb|AAF07949.1|AF192780_1  ribulose-1,5-bisphosphate carboxylase s...  64.7    7e-11   
gb|AAF17591.1|AF202647_1  ribulose-1,5-bisphosphate carboxylase s...  64.7    7e-11   
dbj|BAA35148.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  64.7    7e-11   
gb|AAC67588.1|  ribulose-1,5-bisphosphate carboxylase small subunit   64.7    7e-11   
gb|AAF07947.1|AF192778_1  ribulose-1,5-bisphosphate carboxylase s...  64.7    7e-11   
gb|AAF07942.1|AF192773_1  ribulose-1,5-bisphosphate carboxylase s...  64.7    7e-11   
gb|AAF07943.1|AF192774_1  ribulose-1,5-bisphosphate carboxylase s...  64.7    7e-11   
gb|AAC83373.1|  ribulose-1,5-bisphosphate carboxylase small subunit   64.7    8e-11   
dbj|BAA35145.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  64.3    8e-11   
dbj|BAA35147.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  64.3    9e-11   
sp|P00872.2|RBS1_LEMGI  RecName: Full=Ribulose bisphosphate carbo...  64.3    9e-11   
dbj|BAA35150.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  64.3    9e-11   
gb|ABY66909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  64.3    1e-10   
gb|AIZ66139.1|  red-type rubisco activase                             66.2    1e-10   
gb|AAA33686.1|  ribulose 1,5-bisphosphate carboxylase small subun...  63.9    1e-10   
gb|ABR26034.1|  ribulose bisphosphate carboxylase small chain c       62.8    1e-10   
gb|AAA84592.1|  ribulose 1,5-bisphosphate carboxylase                 63.9    1e-10   
dbj|BAA35179.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  63.9    1e-10   
dbj|BAA35170.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  63.9    1e-10   
gb|EMT21846.1|  Ribulose bisphosphate carboxylase small chain PW9...  63.5    2e-10   
dbj|BAJ86022.1|  predicted protein                                    63.5    2e-10   
dbj|BAJ90404.1|  predicted protein                                    63.5    2e-10   
gb|ABG21958.1|  Ribulose bisphosphate carboxylase small chain C, ...  63.2    2e-10   
gb|ACI13662.1|  chEPO                                                 63.5    3e-10   
gb|ABR25985.1|  ribulose bisphosphate carboxylase small chain c       62.8    3e-10   
ref|XP_006663954.1|  PREDICTED: ribulose bisphosphate carboxylase...  63.2    3e-10   
ref|XP_004962302.1|  PREDICTED: ribulose bisphosphate carboxylase...  63.2    3e-10   
dbj|BAK23964.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  62.8    3e-10   
ref|NP_001066605.1|  Os12g0291200                                     62.4    3e-10   
gb|AAB70543.1|  ribulose 1,5-bisphosphate carboxylase small subunit   62.8    3e-10   
ref|NP_001066604.1|  Os12g0291100                                     62.8    4e-10   
dbj|BAK23963.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  62.8    4e-10   
dbj|BAK23962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  62.8    4e-10   
gb|AAC14064.1|  ribulose 1,5-bisphosphate carboxylase small subunit   62.8    4e-10   
dbj|BAB19812.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  62.8    4e-10   
ref|NP_001066559.1|  Os12g0274700                                     62.8    4e-10   
gb|EAY97115.1|  hypothetical protein OsI_19041                        62.8    4e-10   
emb|CAA10496.1|  hypothetical protein                                 62.8    4e-10   
gb|EMT06085.1|  hypothetical protein F775_43781                       62.4    4e-10   
ref|XP_003576920.1|  PREDICTED: ribulose bisphosphate carboxylase...  62.4    4e-10   
emb|CAA10497.1|  hypothetical protein                                 62.4    4e-10   
dbj|BAJ89884.1|  predicted protein                                    62.4    4e-10   
gb|EMT21850.1|  Ribulose bisphosphate carboxylase small chain PW9...  62.4    5e-10   
sp|Q38793.1|RBS_AEGTA  RecName: Full=Ribulose bisphosphate carbox...  62.4    5e-10   
gb|AHB17669.1|  STDBxb1                                               64.7    6e-10   
ref|NP_001066606.1|  Os12g0291400                                     62.0    7e-10   
dbj|BAH57175.1|  AT1G67090                                            60.8    7e-10   
dbj|BAB19813.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  62.0    7e-10   
gb|AAF07945.1|AF192776_1  ribulose-1,5-bisphosphate carboxylase s...  61.6    9e-10   
gb|AAF07985.1|AF200303_1  ribulose-1,5-bisphosphate carboxylase s...  61.6    9e-10   
gb|EMS44970.1|  Ribulose bisphosphate carboxylase small chain PWS...  61.6    1e-09   
dbj|BAA35169.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  61.2    1e-09   
dbj|BAJ90550.1|  predicted protein                                    61.2    1e-09   
ref|XP_003581511.1|  PREDICTED: ribulose bisphosphate carboxylase...  61.2    1e-09   
gb|EMS44969.1|  Ribulose bisphosphate carboxylase small chain PW9...  60.8    2e-09   
pir||A05005  ribulose-bisphosphate carboxylase (EC 4.1.1.39) smal...  60.5    2e-09
gb|EMS50268.1|  Ribulose bisphosphate carboxylase small chain PWS...  60.8    2e-09   
dbj|BAA35172.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  60.5    2e-09   
gb|AAC83372.1|  ribulose-1,5-bisphosphate carboxylase small subunit   60.5    2e-09   
ref|XP_004962301.1|  PREDICTED: ribulose bisphosphate carboxylase...  60.5    2e-09   
dbj|BAA35151.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  60.1    3e-09   
dbj|BAA35173.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  60.1    3e-09   
ref|XP_003573910.1|  PREDICTED: ribulose bisphosphate carboxylase...  60.1    3e-09   
gb|ABD77414.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  59.7    3e-09   
emb|CAA25058.1|  ribulosebisphosphate carboxylase                     60.1    3e-09   
dbj|BAA35178.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  60.1    3e-09   
sp|P19310.1|RBS4_LEMGI  RecName: Full=Ribulose bisphosphate carbo...  60.1    3e-09   
gb|EMT25898.1|  Ribulose bisphosphate carboxylase small chain PWS...  60.1    4e-09   
sp|P26667.1|RBS2_WHEAT  RecName: Full=Ribulose bisphosphate carbo...  59.7    4e-09   
ref|NP_001066607.1|  Os12g0292400                                     59.7    5e-09   



>ref|XP_009357813.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=141

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA  A+ASMVAPFTGLKS+++FPVTRKS D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   RAAPAQASMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFE  73



>ref|XP_008381263.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Malus domestica]
Length=183

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA  A+ASMVAPFTGLKS+++FPVTRKS D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   RAAPAQASMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFE  73



>ref|XP_009357812.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=183

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA  A+ASMVAPFTGLKS+++FPVTRKS D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   RAAPAQASMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFE  73



>ref|XP_010036887.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW48548.1| hypothetical protein EUGRSUZ_K02223 [Eucalyptus grandis]
Length=181

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             RA+ A+ASMVAPFTGLKS ++FPVTRKSAD TS+A+NG RVQCMQVWPP G KKFE
Sbjct  15   NRASPAQASMVAPFTGLKSASAFPVTRKSADITSLASNGGRVQCMQVWPPIGKKKFE  71



>gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            GR T A+ASMVAPFTGLKS ++FPVT+KS D TSIA+NG RVQCMQVWPP G KKFE
Sbjct  12   GRTTPAQASMVAPFTGLKSVSAFPVTKKSNDITSIASNGGRVQCMQVWPPLGKKKFE  68



>sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03694.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            GR T A+ASMVAPFTGLKS ++FPVT+KS D TSIA+NG RVQCMQVWPP G KKFE
Sbjct  12   GRTTPAQASMVAPFTGLKSVSAFPVTKKSNDITSIASNGGRVQCMQVWPPLGKKKFE  68



>dbj|BAI53119.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             RA+ A+ASMVAPFTGLKS ++FPVTRKSAD TS+A+NG RVQCMQVWPP G KKFE
Sbjct  15   NRASPAQASMVAPFTGLKSASAFPVTRKSADITSLASNGGRVQCMQVWPPIGKKKFE  71



>ref|XP_008368661.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X2 [Malus domestica]
Length=137

 Score = 92.8 bits (229),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A MVAPFTGLKS+++FPVTRKS D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   AQARMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFE  69



>dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Panax ginseng]
Length=183

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA  A+ASMVAPFTGLKSTA+FPVTRK  D TS+ +NG RVQCM+VWPP GLKKFE
Sbjct  16   RAVPAQASMVAPFTGLKSTAAFPVTRKVNDITSLPSNGGRVQCMKVWPPLGLKKFE  71



>ref|XP_008352922.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+ASMVAPFTGLKS+++FPVTRK+ D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   SSPAQASMVAPFTGLKSSSAFPVTRKANDITSIASNGGRVQCMQVWPPIGLKKFE  72



>gb|AGE93838.1| chloroplat ribulose bisphosphate carboxylase small chain SSU5B, 
partial [Posidonia oceanica]
Length=84

 Score = 90.9 bits (224),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             RAT A+ASMVAPFTGLKS+A+FPV+RK +AD +S+ +NG RVQCMQVWPP GLKKFE
Sbjct  14   ARATPAQASMVAPFTGLKSSAAFPVSRKPNADLSSLPSNGGRVQCMQVWPPEGLKKFE  71



>ref|XP_008339672.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score = 92.8 bits (229),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ASMVAPFTGLKS+++FPVTRK+ D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  21   AQASMVAPFTGLKSSSAFPVTRKANDITSIASNGGRVQCMQVWPPIGLKKFE  72



>ref|XP_009342656.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Pyrus x bretschneideri]
Length=183

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R   ++A MVAPFTGLKS+++FPVTRKS D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   RPAPSQARMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFE  73



>ref|XP_008368660.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Malus domestica]
Length=179

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A MVAPFTGLKS+++FPVTRKS D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   AQARMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFE  69



>gb|AAA33866.1| ribulose 1,5-bisphosphate carboxylase small subunit [Malus domestica 
x Pyrus communis]
Length=179

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A MVAPFTGLKS+++FPVTRKS D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   AQARMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFE  69



>sp|Q9XGX4.1|RBS3_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37440.1|AF150667_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=180

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPF GLKS ASFPVTRKS D TSIA+NG RVQCMQVWPP G KKFE
Sbjct  16   ASGAQANMVAPFNGLKSIASFPVTRKSNDITSIASNGGRVQCMQVWPPVGKKKFE  70



>gb|AAO25119.1| ribulose-1,5-bisphosphate carboxylase small subunit [Chrysanthemum 
x morifolium]
Length=179

 Score = 92.4 bits (228),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R T+A+ASMVAPFTGLKS  +FPVT+KS DF+S+ +NG RVQCM+VWPP GLKK+E
Sbjct  13   NRTTSAQASMVAPFTGLKSNVAFPVTKKSNDFSSLPSNGGRVQCMKVWPPLGLKKYE  69



>sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00450.1| RuBisCO small subunit [Pyrus pyrifolia var. culta]
Length=183

 Score = 92.4 bits (228),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R   A+A MVAPF GLKS+++FPVTRKS D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   RPAPAQARMVAPFNGLKSSSAFPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFE  73



>gb|ABQ42089.1| ribulose bisphosphate carboxylase small chain (RuBisCO small 
subunit) [Sonneratia alba]
Length=178

 Score = 91.7 bits (226),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R   A+ASMVAPFTGLKS+++FP TRK+AD TS+A+NG RVQCMQVWPP GLKKFE
Sbjct  9    NRTAPAQASMVAPFTGLKSSSAFPTTRKTADITSLASNGGRVQCMQVWPPEGLKKFE  65



>gb|ACS68693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Sonneratia alba]
 gb|ACS68764.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Sonneratia alba]
Length=173

 Score = 91.7 bits (226),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R   A+ASMVAPFTGLKS+++FP TRK+AD TS+A+NG RVQCMQVWPP GLKKFE
Sbjct  8    NRTAPAQASMVAPFTGLKSSSAFPTTRKTADITSLASNGGRVQCMQVWPPEGLKKFE  64



>gb|ABQ42090.1| ribulose bisphosphate carboxylase small chain (RuBisCO small 
subunit) [Sonneratia apetala]
Length=178

 Score = 91.7 bits (226),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R   A+ASMVAPFTGLKS+++FP TRK+AD TS+A+NG RVQCMQVWPP GLKKFE
Sbjct  9    NRTAPAQASMVAPFTGLKSSSAFPTTRKTADITSLASNGGRVQCMQVWPPEGLKKFE  65



>ref|XP_008446602.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Cucumis melo]
Length=185

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+ASMVAPFTGLKS A+FPVTRK+ D T++A+NG RVQCM+VWPP GLKKFE
Sbjct  17   ASPAQASMVAPFTGLKSAAAFPVTRKNNDITTLASNGGRVQCMKVWPPLGLKKFE  71



>ref|XP_010693073.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=180

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+ASMVAPF GLKST +FPVT+K+ D TS+A+NG RVQCMQVWPP GLKKFE
Sbjct  17   TPAQASMVAPFNGLKSTVAFPVTKKNDDITSLASNGGRVQCMQVWPPLGLKKFE  70



>ref|XP_010693059.1| PREDICTED: ribulose bisphosphate carboxylase small chain [Beta 
vulgaris subsp. vulgaris]
Length=180

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+ASMVAPF GLKST +FPVT+K+ D TS+A+NG RVQCMQVWPP GLKKFE
Sbjct  17   TPAQASMVAPFNGLKSTVAFPVTKKNDDITSLASNGGRVQCMQVWPPLGLKKFE  70



>emb|CAD11990.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
 emb|CAD11991.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
Length=181

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+ASMVAPF GLK+ +SFP+++KS D TS+ATNG RVQCMQVWPP GLKK+E
Sbjct  16   RASPAQASMVAPFNGLKAASSFPISKKSVDITSLATNGGRVQCMQVWPPRGLKKYE  71



>ref|XP_009356790.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Pyrus x bretschneideri]
Length=182

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+ASMVAPFTGLKS ++FPVTRK+ D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   SSPAQASMVAPFTGLKSFSAFPVTRKANDITSIASNGGRVQCMQVWPPTGLKKFE  72



>sp|Q02980.1|RBS_MALSP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Malus sp.]
 emb|CAA46475.1| ribulose bisphosphate carboxylase [Malus sp.]
Length=183

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R   A+A MVAPFTGLKS+++ PVTRKS D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   RPAPAQARMVAPFTGLKSSSASPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFE  73



>sp|Q9XGX5.1|RBS2_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37439.1|AF150666_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=184

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  103  AAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             A+A+MVAPF GLKS ASFPVTRKS D TSIA+NG RVQCMQVWPP G KKFE
Sbjct  21   GAQANMVAPFNGLKSIASFPVTRKSNDITSIASNGGRVQCMQVWPPVGKKKFE  73



>sp|O22077.1|RBS_FAGCR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Fagus crenata]
 dbj|BAA23214.1| small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase 
[Fagus crenata]
Length=182

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSA-DFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RAT A+A+MVAPFTGLKSTA+FP TRKS  D TS+A+NG RVQCM+VWPP GL+KFE
Sbjct  16   RATPAQATMVAPFTGLKSTAAFPATRKSNNDITSLASNGGRVQCMKVWPPLGLQKFE  72



>gb|AIF75302.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis duranensis]
 gb|AIF75308.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis ipaensis]
 gb|AIF75309.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=159

 Score = 89.7 bits (221),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+A+MVAPF+GLKS   FPVTRK+ D TS+A NG RVQCMQVWPP G KKFE
Sbjct  8    RASPAQANMVAPFSGLKSLGGFPVTRKTNDITSVANNGGRVQCMQVWPPLGKKKFE  63



>gb|AIF75301.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
 gb|AIF75303.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
 gb|AIF75306.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis ipaensis]
 gb|AIF75307.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=159

 Score = 89.7 bits (221),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+A+MVAPF+GLKS   FPVTRK+ D TS+A NG RVQCMQVWPP G KKFE
Sbjct  8    RASPAQANMVAPFSGLKSLGGFPVTRKTNDITSVANNGGRVQCMQVWPPLGKKKFE  63



>sp|P16032.2|RBS1_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 prf||1802403A RuBisCO:SUBUNIT=small
Length=182

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+ASMVAPF GLKS A+FPVT+K+ D TS+ATNG RVQCMQVWPP G KKFE
Sbjct  17   TPAQASMVAPFNGLKSVAAFPVTKKNNDITSVATNGGRVQCMQVWPPLGKKKFE  70



>gb|ABQ42164.1| ribulose bisphosphate carboxylase small chain (RuBisCO small 
subunit) [Sonneratia ovata]
Length=178

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R   A+ASM APFTGLKS+++FP TRK+AD TS+A+NG RVQCMQVWPP GLKKFE
Sbjct  9    NRTAPAQASMAAPFTGLKSSSAFPTTRKTADITSLASNGGRVQCMQVWPPEGLKKFE  65



>gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Aralia elata]
Length=183

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ASMVAPFTGLKSTA+FPVTRK  D TS+ +NG RVQCM+VWPP GLKKFE
Sbjct  20   AQASMVAPFTGLKSTAAFPVTRKVNDITSLPSNGGRVQCMKVWPPLGLKKFE  71



>gb|AIR75141.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score = 89.0 bits (219),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+ASMVAPF GLKST +FPVT+K+ D TS+A+NG RVQCMQVWPP G+KK+E
Sbjct  9    TPAQASMVAPFNGLKSTVAFPVTKKNDDITSLASNGGRVQCMQVWPPIGMKKYE  62



>sp|P04715.1|RBS2_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU11A, 
chloroplastic; Short=RuBisCO small subunit SSU11A; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS1 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu11A) precursor - garden petunia
 emb|CAA27445.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASMVAPFTGLKS ASFPV+RK + D TSIA+NG RVQCMQVWPP+G KK+E
Sbjct  16   NAAQASMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYE  70



>ref|XP_010669829.1| PREDICTED: ribulose bisphosphate carboxylase small chain 6, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=183

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R T A+ASMVAPFTGLKS A+FPVT+ S D +S+ +NG RVQCMQVWPP G KKFE
Sbjct  18   RNTGAQASMVAPFTGLKSIAAFPVTKSSNDLSSLPSNGGRVQCMQVWPPLGKKKFE  73



>ref|XP_009595081.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009609566.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 gb|AAP03874.1| putative ribulose bisphosphate carboxylase small subunit protein 
precursor [Nicotiana tabacum]
Length=180

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R   A+A+MVAPFTGLKS ASFPV+RK + D TSIA+NG RVQCMQVWPP+G KK+E
Sbjct  14   RTNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYE  70



>ref|XP_002532149.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30223.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=185

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             RA+ A+ASMVAPFTGLKST++FPVTRK + D T++A NG RVQCMQVWPP G KKFE
Sbjct  15   NRASPAQASMVAPFTGLKSTSAFPVTRKTNTDITTLANNGGRVQCMQVWPPLGKKKFE  72



>ref|XP_009794476.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like, 
partial [Nicotiana sylvestris]
Length=104

 Score = 86.7 bits (213),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+  A+A+MVAPFTGLKS ASFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  14   RSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  70



>ref|XP_006430778.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
 gb|ESR44018.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
Length=142

 Score = 87.8 bits (216),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             RA+ A+ASMVAPFTGLKS+++FP T+K + D TSIA+NG RVQCM+VWPP GLKKFE
Sbjct  15   NRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFE  72



>gb|AAU14862.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Fagus sylvatica]
Length=181

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSA-DFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RAT A+A+MVAPFTGLKSTA+FP T+KS  D TS+A+NG RVQCM+VWPP GL+KFE
Sbjct  16   RATPAQATMVAPFTGLKSTAAFPATQKSNNDITSLASNGGRVQCMKVWPPLGLQKFE  72



>gb|AAA34116.1| ribulose-1,5-bisphosphate carboxylase small subunit, partial 
[Nicotiana tabacum]
Length=101

 Score = 86.7 bits (213),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+  A+A+MVAPFTGLKS ASFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  14   RSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  70



>sp|P26576.1|RBSB_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49415.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA  A+ASMV PFTGLKSTASFPV+RK + D TSIA+NG RV+CMQVWPP  +KK+E
Sbjct  14   RANGAQASMVGPFTGLKSTASFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYE  70



>ref|XP_006363111.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 ref|XP_006363112.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 sp|P26577.1|RBSC_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic; Short=RuBisCO small subunit 2C; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49416.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R   A+ASMVAPFTGLKSTASFPV+RK + D TSIA+NG RV+CMQVWPP  +KK+E
Sbjct  14   RGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYE  70



>ref|XP_010044264.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic-like [Eucalyptus grandis]
 dbj|BAI53120.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
 gb|KCW86324.1| hypothetical protein EUGRSUZ_B03013 [Eucalyptus grandis]
Length=179

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSA-DFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RAT A+A+MVAPFTGLKS ++FPVTRKS+ D TS+++NG RVQCMQVWPP G KKFE
Sbjct  13   RATPAQATMVAPFTGLKSASAFPVTRKSSEDITSLSSNGGRVQCMQVWPPIGKKKFE  69



>gb|AIF75300.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis duranensis]
 gb|AIF75310.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=159

 Score = 87.8 bits (216),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+A+MVAPF+GLKS   FPVTRK+ D TS+  NG RVQCMQVWPP G KKFE
Sbjct  8    RASPAQANMVAPFSGLKSLGGFPVTRKTNDITSVTNNGGRVQCMQVWPPLGKKKFE  63



>gb|AAA33035.1| ribulose-1-5-bisphosphate carboxylase [Mesembryanthemum crystallinum]
Length=182

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+ASMV PF GLKS A+FPVT+K+ D TS+ATNG RVQCMQVWPP G KKFE
Sbjct  17   TPAQASMVVPFNGLKSVAAFPVTKKNNDITSVATNGGRVQCMQVWPPLGKKKFE  70



>gb|ABK96431.1| unknown [Populus trichocarpa x Populus deltoides]
Length=182

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPV-TRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPF GLKSTA+FPV TRK+ D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   TPAQANMVAPFNGLKSTAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFE  72



>ref|XP_010693054.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=179

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  115  SMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +MVAPF GLKS ++FPVTRKS D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  21   NMVAPFNGLKSASAFPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFE  69



>sp|Q96542.1|RBS_BETPN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Betula pendula]
 emb|CAA69102.1| ribulose-bisphosphate carboxylase [Betula pendula]
Length=182

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A++SMVAPFT LKST++FPVT+K + D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  16   RASPAQSSMVAPFTCLKSTSAFPVTQKTNNDITSIASNGGRVQCMQVWPPLGLKKFE  72



>gb|EYU38175.1| hypothetical protein MIMGU_mgv1a014707mg [Erythranthe guttata]
Length=174

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RATAA+ASMVAPFTGLKST++FP TRK+AD T+IATNG RV CM+VWP    KK+E
Sbjct  16   RATAAQASMVAPFTGLKSTSAFPATRKTADITTIATNGGRVSCMKVWPTVNNKKYE  71



>ref|XP_004232356.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic [Solanum lycopersicum]
 sp|P05349.1|RBS3B_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA29403.1| ribulose 1,5-bisphosphate carboxylase/oxyenase [Solanum lycopersicum]
 dbj|BAA01888.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R   A+ASMVAPFTGLKSTASFPV+RK + D TSIA+NG RV CMQVWPP  +KK+E
Sbjct  14   RGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQVWPPINMKKYE  70



>sp|P07180.1|RBS3A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3A/3C, 
chloroplastic; Short=RuBisCO small subunit 3A/3C; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA29402.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 emb|CAA29404.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 gb|AAA34190.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R   A+ASMVAPFTGLKSTASFPV+RK + D TSIA+NG RV CMQVWPP  +KK+E
Sbjct  14   RGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQVWPPINMKKYE  70



>ref|XP_011015710.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like, 
partial [Populus euphratica]
Length=167

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPF GLKST++FPVTRK + D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  17   TPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQVWPPTGLKKFE  71



>gb|EYU38174.1| hypothetical protein MIMGU_mgv1a014707mg [Erythranthe guttata]
Length=181

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RATAA+ASMVAPFTGLKST++FP TRK+AD T+IATNG RV CM+VWP    KK+E
Sbjct  16   RATAAQASMVAPFTGLKSTSAFPATRKTADITTIATNGGRVSCMKVWPTVNNKKYE  71



>ref|XP_010693099.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRKSA-DFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +  +A+MVAPF GLKST++FPVTRKS  D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  17   SGVQANMVAPFNGLKSTSAFPVTRKSNNDITSIASNGGRVQCMQVWPPLGLKKFE  71



>ref|XP_006482255.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=140

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+ASMVAPFTGLKS+++FP T+K + D TSIA+NG RVQCM+VWPP GLKKFE
Sbjct  16   RASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFE  72



>gb|EYU38172.1| hypothetical protein MIMGU_mgv1a014686mg [Erythranthe guttata]
Length=181

 Score = 87.4 bits (215),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RATAA+ASMVAPFTGLKST++FP TRK+AD T+IATNG RV CM+VWP    KK+E
Sbjct  16   RATAAQASMVAPFTGLKSTSAFPATRKTADITTIATNGGRVSCMKVWPTVNNKKYE  71



>gb|AIR75140.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score = 87.4 bits (215),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+ASMVAPF GLKST +FPVT+K+ D TS+A+NG RVQCMQ WPP G+KK+E
Sbjct  9    TPAQASMVAPFNGLKSTVAFPVTKKNDDITSLASNGGRVQCMQAWPPIGMKKYE  62



>gb|AIF75299.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
 gb|AIF75304.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis ipaensis]
 gb|AIF75305.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=160

 Score = 87.0 bits (214),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+A+MVAPFTGLKS A FPVTRK + D TS+A NG RVQCMQVWPP G KKFE
Sbjct  8    RASPAQANMVAPFTGLKSLAGFPVTRKANNDITSVANNGGRVQCMQVWPPVGKKKFE  64



>gb|ABK96567.1| unknown [Populus trichocarpa x Populus deltoides]
Length=181

 Score = 87.4 bits (215),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPF GLKST++FPVTRK + D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  17   TPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQVWPPTGLKKFE  71



>ref|XP_006383456.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95904.1| unknown [Populus trichocarpa]
 gb|ABK96181.1| unknown [Populus trichocarpa]
 gb|ERP61253.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=181

 Score = 87.4 bits (215),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPF GLKST++FPVTRK + D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  17   TPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQVWPPTGLKKFE  71



>ref|XP_011021244.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Populus euphratica]
Length=181

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPF GLKST++FPVTRK + D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  17   TPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQVWPPTGLKKFE  71



>gb|ABK96590.1| unknown [Populus trichocarpa x Populus deltoides]
Length=189

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPF GLKST++FPVTRK + D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  17   TPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQVWPPTGLKKFE  71



>sp|Q41351.1|RBS_STELP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Stellaria longipes]
 gb|AAA69018.1| ribulose 1,5-bisphosphate carboxylase small subunit [Stellaria 
longipes]
Length=180

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+  A+ASMVAPFTGLKS ASFPV+RK + D TSIA+NG RV+CMQVWPP  +KK+E
Sbjct  14   RSNGAQASMVAPFTGLKSNASFPVSRKTNLDITSIASNGGRVRCMQVWPPINMKKYE  70



>ref|XP_004299075.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=180

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +ASMVAPF GLKS ++FPVTRK+ D T++A+NG RVQCMQVWPP GLKKFE
Sbjct  20   QASMVAPFNGLKSASAFPVTRKANDITTLASNGGRVQCMQVWPPVGLKKFE  70



>gb|KCW52064.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=192

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +A+MVAPFTGLKS ++FPVTRKS D TS+ +NG RVQCMQVWPP GLKKFE
Sbjct  21   QAAMVAPFTGLKSASAFPVTRKSNDITSLPSNGGRVQCMQVWPPVGLKKFE  71



>dbj|BAI53118.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +A+MVAPFTGLKS ++FPVTRKS D TS+ +NG RVQCMQVWPP GLKKFE
Sbjct  21   QAAMVAPFTGLKSASAFPVTRKSNDITSLPSNGGRVQCMQVWPPVGLKKFE  71



>ref|XP_009800809.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A AA+ASMVAPFTGLKS +SFPVTRK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  16   ANAAQASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  71



>gb|AIF75357.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75358.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
              A+A+MVAPFTGLKS ASFPV+RK + D TSIA+NG RVQCMQVWPP+G KK+E
Sbjct  1    NVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYE  55



>gb|KCW52065.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=180

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +A+MVAPFTGLKS ++FPVTRKS D TS+ +NG RVQCMQVWPP GLKKFE
Sbjct  21   QAAMVAPFTGLKSASAFPVTRKSNDITSLPSNGGRVQCMQVWPPVGLKKFE  71



>gb|AGV08375.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Arachis hypogaea]
Length=182

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+A+MVAPFTGLKS A FPVTRK + D TS+A NG RVQCMQVWPP G KKFE
Sbjct  16   RASPAQANMVAPFTGLKSLAGFPVTRKANNDITSVANNGGRVQCMQVWPPVGKKKFE  72



>ref|XP_010032637.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Eucalyptus grandis]
Length=181

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +A+MVAPFTGLKS ++FPVTRKS D TS+ +NG RVQCMQVWPP GLKKFE
Sbjct  21   QAAMVAPFTGLKSASAFPVTRKSNDITSLPSNGGRVQCMQVWPPVGLKKFE  71



>gb|ACO35888.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ageratina adenophora]
Length=178

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA  A+A+MVAPFTGLKS A+FP T+K+ DF+++  NG RVQCM+VWPP GLKK+E
Sbjct  13   RAAPAQANMVAPFTGLKSNAAFPATKKANDFSTLPNNGGRVQCMKVWPPLGLKKYE  68



>ref|XP_011035062.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Populus euphratica]
Length=181

 Score = 86.7 bits (213),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPV-TRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPF GLKS A+FPV TRK+ D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  17   TPAQANMVAPFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFE  71



>gb|AIB04188.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia oleifera]
Length=176

 Score = 86.7 bits (213),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ASMVAPFTGLKST++FPVTRK   D TS+A+NG RVQCM+VWPP GLKKFE
Sbjct  14   AQASMVAPFTGLKSTSAFPVTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFE  66



>sp|P26575.1|RBSA_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49414.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score = 86.7 bits (213),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R   A+ASMVAPFTGLKS ASFPV+RK + D TSIA+NG RV+CMQVWPP  +KK+E
Sbjct  14   RGNGAQASMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYE  70



>gb|AIR75142.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Chenopodium album]
Length=164

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ASMVAPF GLKST +FPVT+K+ D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  10   AQASMVAPFNGLKSTVAFPVTKKNDDITSLASNGGRVQCMQVWPPVGKKKFE  61



>sp|Q39749.1|RBS7_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 7, 
chloroplastic; Short=RuBisCO small subunit 7; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67851.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score = 86.3 bits (212),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            AT A+A+MVAPFTGLKS A+FPVT+K  DF+++A+NG RVQCM+VWPP G K++E
Sbjct  9    ATVAQANMVAPFTGLKSNAAFPVTKKVNDFSTLASNGGRVQCMKVWPPLGKKRYE  63



>gb|AEX60836.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium raimondii]
Length=168

 Score = 86.3 bits (212),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  15   NRSSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  72



>gb|AIR75144.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum bonus-henricus]
Length=150

 Score = 85.9 bits (211),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+ASMVAPF GLKST +FPVT+K+ D TS+A+NG RVQCMQVWPP  +KK+E
Sbjct  9    TPAQASMVAPFNGLKSTVAFPVTKKNDDITSLASNGGRVQCMQVWPPTNMKKYE  62



>ref|XP_002305162.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95372.1| unknown [Populus trichocarpa]
 gb|ABK95841.1| unknown [Populus trichocarpa]
 gb|EEE85673.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=182

 Score = 86.3 bits (212),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPV-TRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPF GLKS A+FPV TRK+ D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   TPAQANMVAPFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFE  72



>ref|XP_006482254.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=182

 Score = 86.3 bits (212),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+ASMVAPFTGLKS+++FP T+K + D TSIA+NG RVQCM+VWPP GLKKFE
Sbjct  16   RASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFE  72



>ref|XP_002521232.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF41184.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
Length=181

 Score = 86.3 bits (212),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS ASFPVTRK + D TSIA+NG RVQCMQVWPP G KKFE
Sbjct  17   AQATMVAPFTGLKSAASFPVTRKANNDITSIASNGGRVQCMQVWPPLGKKKFE  69



>ref|XP_010265136.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=113

 Score = 84.7 bits (208),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RAT A+ASMVAPF+GLKS  +FPVTRK + D +S+ +NG RVQCMQVWPP G KKFE
Sbjct  16   RATPAQASMVAPFSGLKSAXAFPVTRKANNDISSLPSNGGRVQCMQVWPPLGKKKFE  72



>ref|XP_006430779.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
 gb|ESR44019.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
Length=182

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+ASMVAPFTGLKS+++FP T+K + D TSIA+NG RVQCM+VWPP GLKKFE
Sbjct  16   RASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFE  72



>gb|AFS41724.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
Length=182

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  15   NRSSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  72



>gb|AFS41770.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium gossypioides]
Length=168

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  7    NRSSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  64



>gb|AEX60841.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41728.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41735.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41743.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41750.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41757.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=182

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  15   NRSSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  72



>gb|AFS41765.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium armourianum]
 gb|AFS41767.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium davidsonii]
Length=168

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  7    NRSSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  64



>gb|AFS41744.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  15   NRSSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  72



>gb|AFS41729.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41736.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41751.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=182

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  15   NRSSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  72



>ref|XP_007033269.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 1 [Theobroma cacao]
 gb|EOY04195.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 1 [Theobroma cacao]
Length=189

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             RA+ A+ASMVAPFTGLKST++ PV RK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  15   NRASPAQASMVAPFTGLKSTSALPVARKANNDITSLASNGGRVQCMQVWPPLGKKKFE  72



>ref|XP_007033270.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 2 [Theobroma cacao]
 gb|EOY04196.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 2 [Theobroma cacao]
Length=184

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             RA+ A+ASMVAPFTGLKST++ PV RK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  15   NRASPAQASMVAPFTGLKSTSALPVARKANNDITSLASNGGRVQCMQVWPPLGKKKFE  72



>gb|AFK42721.1| unknown [Lotus japonicus]
Length=182

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+ASMVAPFTGLKS A FPV + + D TSIA+NG RVQCMQVWPP G KKFE
Sbjct  18   ASPAQASMVAPFTGLKSMAGFPVRKANNDITSIASNGGRVQCMQVWPPIGKKKFE  72



>gb|AIF75353.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75354.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASMVAPFTGLKS +SFPVTRK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  1    NAAQASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  55



>gb|ABK55670.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Cucumis sativus]
Length=125

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+ASMVAPFTGLKS+A FP+TRK+  D T++A+NG +VQCM+VWPP GL+KFE
Sbjct  8    ASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNGGKVQCMKVWPPLGLRKFE  63



>gb|AIF75349.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75350.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASMVAPFTGLKS +SFPVTRK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  1    NAAQASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  55



>gb|AIF75298.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis duranensis]
Length=160

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+A+MVAPFTGLKS A FPVTRK + D TS+  NG RVQCMQVWPP G KKFE
Sbjct  8    RASPAQANMVAPFTGLKSLAGFPVTRKANNDITSVTNNGGRVQCMQVWPPVGKKKFE  64



>ref|XP_009795055.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009795056.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009772497.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 sp|P69249.1|RBS_TOBAC RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; AltName: Full=TSSU3-8; 
Flags: Precursor [Nicotiana tabacum]
 sp|P69250.1|RBS1_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA25862.1| unnamed protein product [Nicotiana sylvestris]
 emb|CAA26208.1| small subunit ribulose 1,5-bisphosphate carboxylase [Nicotiana 
tabacum]
 prf||1103193A carboxylase,RBP
Length=180

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+  A+A+MVAPFTGLKS ASFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  14   RSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  70



>gb|AFB70994.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Nicotiana attenuata]
Length=180

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+  A+A+MVAPFTGLKS ASFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  14   RSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  70



>ref|XP_008243231.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Prunus mume]
Length=181

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+ASMVAPFTGLKS ++FPVTR  + D TSI++NG RVQCMQVWPP GLKKFE
Sbjct  16   SSPAQASMVAPFTGLKSASAFPVTRNANKDITSISSNGGRVQCMQVWPPIGLKKFE  71



>sp|P32764.1|RBS3_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49417.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKS--ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+  A+ASMVAPFTGLKS ASFPVT+K+   D TS+A+NG RV+CMQVWPP  +KK+E
Sbjct  14   RSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYE  71



>sp|P26573.1|RBS8_NICPL RecName: Full=Ribulose bisphosphate carboxylase small chain 8B, 
chloroplastic; Short=RuBisCO small subunit 8B; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA31994.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
 gb|AAA34110.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
Length=180

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+  A+A+MVAPFTGLKS ASFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  14   RSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  70



>ref|XP_007225932.1| hypothetical protein PRUPE_ppa012174mg [Prunus persica]
 gb|EMJ27131.1| hypothetical protein PRUPE_ppa012174mg [Prunus persica]
Length=181

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+ASMVAPFTGLKS ++FPVTRK + D TSI++NG RVQCM+VWPP GLKKFE
Sbjct  16   SSPAQASMVAPFTGLKSASAFPVTRKANNDITSISSNGGRVQCMRVWPPIGLKKFE  71



>ref|NP_001275244.1| ribulose bisphosphate carboxylase small chain C, chloroplastic 
[Solanum tuberosum]
 sp|P10647.1|RBS0_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain C, 
chloroplastic; Short=RuBisCO small subunit C; Flags: Precursor 
[Solanum tuberosum]
 gb|AAA33838.1| ribulose bisphosphate carboxylase (EC 4.1.1.39) [Solanum tuberosum]
Length=181

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKS--ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+  A+ASMVAPFTGLKS ASFPVT+K+   D TS+A+NG RV+CMQVWPP  +KK+E
Sbjct  14   RSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYE  71



>ref|XP_008244507.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X2 [Prunus mume]
Length=140

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA  A+AS+VAPFTGLKS ++FP T+K+ D TSIA+NG RVQCM+VWP  GLKKFE
Sbjct  17   RAAPAQASLVAPFTGLKSASAFPGTKKTNDITSIASNGGRVQCMKVWPTVGLKKFE  72



>sp|P08705.1|RBS_HELAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Helianthus annuus]
 emb|CAA68490.1| ribulose bisphosphate carboxylase [Helianthus annuus]
 emb|CAA28737.1| RuBisCO (SSU) [Helianthus annuus]
Length=178

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R   A+A+MVAPFTGLKS A+FP T+K+ DF+++ +NG RVQCM+VWPP GLKK+E
Sbjct  13   RTAPAQANMVAPFTGLKSNAAFPTTKKANDFSTLPSNGGRVQCMKVWPPLGLKKYE  68



>sp|O65194.1|RBS_MEDSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Medicago sativa]
 gb|AAC13293.1| ribulose-1,5-bisphosphate carboxylase small subunit [Medicago 
sativa]
Length=180

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             RA++A+A++VAPFTGLKS+A FPVT+K + D TSIA+NG RV CMQVWPP G KKFE
Sbjct  13   NRASSAQANLVAPFTGLKSSAGFPVTKKTNNDITSIASNGGRVNCMQVWPPVGKKKFE  70



>sp|Q08184.1|RBS4_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA33038.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 gb|AAA03696.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  115  SMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +MVAPF GLKS ++FPVTRK+ D TS+A+NG RVQCMQVWPP G+KKFE
Sbjct  23   NMVAPFNGLKSISAFPVTRKNNDITSVASNGGRVQCMQVWPPLGMKKFE  71



>ref|XP_004233493.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Solanum lycopersicum]
 sp|P08706.2|RBS1_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; AltName: Full=LESS 
17; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34188.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
 emb|CAA29400.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=181

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKS--ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+  A+ASMVAPFTGLKS ASFPVT+K+   D TS+A+NG RV+CMQVWPP  +KK+E
Sbjct  14   RSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYE  71



>ref|XP_006391472.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
 gb|ESQ28758.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
Length=181

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CMQVWPP G KKFE
Sbjct  13   ASPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFE  68



>gb|ABK95229.1| unknown [Populus trichocarpa]
 gb|ABK95250.1| unknown [Populus trichocarpa]
Length=182

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPV-TRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T  +A+MVAPF GLKS A+FPV TRK+ D TSIA+NG RVQCMQVWPP GLKKFE
Sbjct  18   TPVQANMVAPFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFE  72



>gb|AAA34191.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=181

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKS--ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+  A+ASMVAPFTGLKS ASFPVT+K+   D TS+A+NG RV+CMQVWPP  +KK+E
Sbjct  14   RSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYE  71



>emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subunit [Cucumis 
sativus]
Length=185

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+ASMVAPFTGLKS+A FP+TRK+  D T++A+NG +VQCM+VWPP GL+KFE
Sbjct  17   ASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNGGKVQCMKVWPPLGLRKFE  72



>ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164158.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 gb|KGN52085.1| hypothetical protein Csa_5G609710 [Cucumis sativus]
Length=185

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+ASMVAPFTGLKS+A FP+TRK+  D T++A+NG +VQCM+VWPP GL+KFE
Sbjct  17   ASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNGGKVQCMKVWPPLGLRKFE  72



>gb|ABK15574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia sinensis]
Length=176

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ASM APFTGLKST++FPVTRK   D TS+A+NG RVQCM+VWPP GLKKFE
Sbjct  14   AQASMAAPFTGLKSTSAFPVTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFE  66



>gb|AIF75359.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75360.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 84.0 bits (206),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASMVAPFTGLKS +SFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  1    NAAQASMVAPFTGLKSASSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  55



>gb|ABS72189.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
1A [Corchorus olitorius]
Length=183

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRKSA-DFTSIATNGTRVQCMQVWPPFGLKKFE  261
             RA+ A+A++VAPFTGLKS ++FP TRK+  D TSIA+NG RVQCMQVWPP G KKFE
Sbjct  13   NRASPAQATLVAPFTGLKSASAFPTTRKNNRDITSIASNGGRVQCMQVWPPLGKKKFE  70



>gb|AFS41772.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypioides kirkii]
 gb|AFS41773.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypioides kirkii]
Length=168

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  7    NRSSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  64



>emb|CBY05833.1| Ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
 emb|CBY89197.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
Length=181

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+ASMVAPFTGLK+ +SFP+++KS D TS+ATNG RVQCMQVWPP G  K E
Sbjct  16   RASPAQASMVAPFTGLKAASSFPISKKSVDITSLATNGGRVQCMQVWPPTGKLKNE  71



>gb|AFK48034.1| unknown [Lotus japonicus]
Length=181

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS A FPV + + D TSIA NG RVQCMQVWPP G KKFE
Sbjct  17   ASPAQANMVAPFTGLKSMAGFPVRKVNNDITSIANNGGRVQCMQVWPPIGKKKFE  71



>ref|XP_010265138.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RAT A+ASMVAPF+GLKS  +FPVTRK + D +S+ +NG RVQCMQVWPP G KKFE
Sbjct  16   RATPAQASMVAPFSGLKSAXAFPVTRKANNDISSLPSNGGRVQCMQVWPPLGKKKFE  72



>gb|AFK40375.1| unknown [Medicago truncatula]
Length=180

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA++ +A++VAPFTGLKS+A+FPVT+K + D TSIA+NG RV CMQVWPP G KKFE
Sbjct  14   RASSTQANLVAPFTGLKSSAAFPVTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFE  70



>sp|Q39747.1|RBS5_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67849.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            AT A+A+MVAPFTGLKS A+FPVT+K  DF+++ +NG RVQCM+VWPP G K++E
Sbjct  9    ATVAQANMVAPFTGLKSNAAFPVTKKVNDFSTLPSNGGRVQCMKVWPPLGKKRYE  63



>ref|XP_008244506.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Prunus mume]
Length=182

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA  A+AS+VAPFTGLKS ++FP T+K+ D TSIA+NG RVQCM+VWP  GLKKFE
Sbjct  17   RAAPAQASLVAPFTGLKSASAFPGTKKTNDITSIASNGGRVQCMKVWPTVGLKKFE  72



>ref|XP_003618736.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|ACJ84141.1| unknown [Medicago truncatula]
 gb|AES74954.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=180

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA++ +A++VAPFTGLKS+A+FPVT+K + D TSIA+NG RV CMQVWPP G KKFE
Sbjct  14   RASSTQANLVAPFTGLKSSAAFPVTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFE  70



>sp|Q39745.1|RBS3_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67847.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score = 84.0 bits (206),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            AT A+A+MVAPFTGLKS A+FPVT+K  DF+++ +NG RVQCM+VWPP G K++E
Sbjct  9    ATVAQANMVAPFTGLKSNAAFPVTKKVNDFSTLPSNGGRVQCMKVWPPLGKKRYE  63



>sp|Q39746.1|RBS4_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67848.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score = 84.0 bits (206),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA  A+A+MVAPFTGLKS A+FP T+K+ DF+++ +NG RVQCM+VWPP G KK+E
Sbjct  13   RAAPAQANMVAPFTGLKSNAAFPATKKANDFSTLPSNGGRVQCMKVWPPLGKKKYE  68



>gb|AIF75355.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75356.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 83.6 bits (205),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASMVAPFTGLKS  SFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  1    NAAQASMVAPFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  55



>gb|AIF75365.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 83.6 bits (205),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASMVAPFTGLKS  SFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  1    NAAQASMVAPFTGLKSAYSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  55



>gb|AIF75367.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75368.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 83.2 bits (204),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASMVAPFTGLKS  SFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  1    NAAQASMVAPFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  55



>gb|AIF75364.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75366.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 83.2 bits (204),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASMVAPFTGLKS  SFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  1    NAAQASMVAPFTGLKSAYSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  55



>sp|Q39743.1|RBS1_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67845.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score = 84.0 bits (206),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            AT A+A+MVAPFTGLK+ A+FPVT+K  DF+++ +NG RVQCM+VWPP G KK+E
Sbjct  9    ATVAQANMVAPFTGLKANAAFPVTKKVNDFSTLPSNGGRVQCMKVWPPLGKKKYE  63



>sp|P04714.1|RBS1_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU8, 
chloroplastic; Short=RuBisCO small subunit SSU8; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS8 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu8) precursor - garden petunia
 emb|CAA27444.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVT-RKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R   A+ASMVAPF GLKS  SFPV+ +++ D TSIA+NG RVQCMQVWPP+G KK+E
Sbjct  14   RTNVAQASMVAPFNGLKSAVSFPVSSKQNLDITSIASNGGRVQCMQVWPPYGKKKYE  70



>sp|Q08186.1|RBS6_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03698.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=186

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSA-DFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+  A+ASMVAPFTGLKS ++FPVTRKS+ D +++ +NG +VQCMQVWPP G KKFE
Sbjct  18   RSAGAQASMVAPFTGLKSVSAFPVTRKSSNDLSTVPSNGGKVQCMQVWPPLGKKKFE  74



>gb|AEX60835.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=171

 Score = 83.6 bits (205),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  17   SSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  72



>ref|XP_004234568.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic [Solanum lycopersicum]
 sp|P07179.2|RBS2A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; AltName: Full=LESS 
5; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34189.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
(EC 4.1.1.39) [Solanum lycopersicum]
 emb|CAA29401.2| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=180

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+   +ASMVAPFTGLKS+A+FPVT+K + D TSIA+NG RV CMQVWPP  +KK+E
Sbjct  14   RSNVTQASMVAPFTGLKSSATFPVTKKQNLDITSIASNGGRVSCMQVWPPINMKKYE  70



>gb|AAA34192.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=180

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R+   +ASMVAPFTGLKS+A+FPVT+K + D TSIA+NG RV CMQVWPP  +KK+E
Sbjct  14   RSNVTQASMVAPFTGLKSSATFPVTKKQNLDITSIASNGGRVSCMQVWPPINMKKYE  70



>gb|AFS41762.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=168

 Score = 83.6 bits (205),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  9    SSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  64



>gb|AFS41727.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41734.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41742.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score = 83.6 bits (205),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  17   SSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  72



>gb|AIF75351.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75352.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 83.2 bits (204),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASM+APFTGLKS  SFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  1    NAAQASMIAPFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  55



>sp|P31333.2|RBS_GOSHI RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Gossypium hirsutum]
 emb|CAA38026.1| ribulose bisphosphate carboxylase [Gossypium hirsutum]
 gb|AEX60834.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41721.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41726.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41741.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41749.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41755.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG14838.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  17   SSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  72



>gb|AEX60840.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=165

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>gb|AEX60838.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium raimondii]
Length=165

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>sp|Q08183.1|RBS3_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03695.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  115  SMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +MVAPF GLKS ++FPVTRK+ D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  23   NMVAPFNGLKSVSAFPVTRKNNDITSVASNGGRVQCMQVWPPLGKKKFE  71



>gb|AAA33037.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  115  SMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +MVAPF GLKS ++FPVTRK+ D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  23   NMVAPFNGLKSVSAFPVTRKNNDITSVASNGGRVQCMQVWPPLGKKKFE  71



>gb|AFS41756.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=182

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  17   SSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFE  72



>ref|XP_011099669.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Sesamum indicum]
Length=180

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+ASMVAPFTGLKST+  PV RKS D TS+ +NG RVQC+QVWP  G KKFE
Sbjct  15   RASPAQASMVAPFTGLKSTSGLPVARKSNDITSLTSNGGRVQCIQVWPTQGKKKFE  70



>gb|AIF75346.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75347.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
 gb|AIF75348.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
              A+A+MVAPFTGLKS ASFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  1    NVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  55



>gb|KDP20120.1| hypothetical protein JCGZ_05889 [Jatropha curcas]
Length=181

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+A+MVAPFTGLKSTA FP  + + D TSIA+NG RVQCM+VWP  GLKKFE
Sbjct  16   RASPAQATMVAPFTGLKSTAGFPARKTTNDITSIASNGGRVQCMKVWPTQGLKKFE  71



>gb|AFS41771.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium gossypioides]
Length=165

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  6    ASPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  61



>gb|AFS41763.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
 gb|AFS41764.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=165

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  6    ASPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  61



>gb|AFS41766.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium armourianum]
 gb|AFS41768.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium davidsonii]
 gb|AFS41769.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium davidsonii]
Length=165

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  6    ASPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  61



>emb|CAA48415.1| unnamed protein product [synthetic construct]
Length=89

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPF GLKS+A+FP TRK + D TSI +NG RV CMQVWPP G KKFE
Sbjct  13   ASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFE  68



>ref|XP_004303137.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +ASMVAPFTGLKS ++FP+TRK ++D TS+ +NG RVQCMQVWPP GLKKFE
Sbjct  21   QASMVAPFTGLKSASAFPITRKTNSDITSLPSNGGRVQCMQVWPPVGLKKFE  72



>gb|AAF19793.1|AF162210_1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Lactuca sativa]
Length=181

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R+T A+AS+ APFTGLKS  +FPVT+K + DF+S+ +NG RVQCM+VWPP GLKK+E
Sbjct  13   NRSTPAQASLAAPFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYE  70



>ref|XP_010263805.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R + A+ASMVAPFTGLKS ++FPVTRK + D TS+++NG RVQCMQVWPP   KKFE
Sbjct  15   NRVSPAQASMVAPFTGLKSVSAFPVTRKTNNDITSLSSNGGRVQCMQVWPPIAKKKFE  72



>gb|AAF06098.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
 gb|AAF06101.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
Length=184

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+ASMVAPFTGLKST++FP T K SAD TS+A+NG RVQCMQVWP  G KKFE
Sbjct  16   RASPAQASMVAPFTGLKSTSAFPATTKTSADITSLASNGGRVQCMQVWPTRGKKKFE  72



>gb|AEX60842.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41722.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41723.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41730.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41731.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41737.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41745.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41752.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41759.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG00063.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
 gb|KHG20485.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=179

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>ref|XP_009758143.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana sylvestris]
 sp|P22433.1|RBS2_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain S41, 
chloroplastic; Short=RuBisCO small subunit S41; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA37516.1| NySS41 [Nicotiana sylvestris]
Length=181

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASM+APFTGLKS  SFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  17   NAAQASMIAPFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  71



>gb|AFS41754.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>gb|AFS41732.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41740.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41761.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>gb|AFS41725.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
Length=179

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>gb|AFS41733.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
Length=179

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>ref|XP_010435745.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +T A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  13   STPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFE  68



>ref|XP_010263795.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=184

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 3/60 (5%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTS--IATNGTRVQCMQVWPPFGLKKFE  261
            GRAT A+ASMVAPFTGLKS ++FPVTRK + D TS  + +NG RVQCMQVWPP G KKFE
Sbjct  15   GRATPAQASMVAPFTGLKSASAFPVTRKANNDITSLPLPSNGGRVQCMQVWPPTGKKKFE  74



>gb|AHI85721.1| stress-induced protein 16 [Capsicum annuum]
Length=180

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R    +ASMVAPFTGLKS ASFPVTRK+  D TSIA+NG RVQCM VWPP   KK+E
Sbjct  14   RTNVTQASMVAPFTGLKSAASFPVTRKNNLDITSIASNGGRVQCMLVWPPINKKKYE  70



>ref|XP_007215051.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
 gb|EMJ16250.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
Length=183

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA  A+AS+VAPFTGLKS ++FP  +K+ D TSIA+NG RVQCM+VWP  GLKKFE
Sbjct  18   RAAPAQASLVAPFTGLKSASAFPGAKKTNDITSIASNGGRVQCMKVWPTVGLKKFE  73



>ref|XP_010435743.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X1 [Camelina sativa]
 ref|XP_010435744.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X2 [Camelina sativa]
Length=181

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  14   TPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFE  68



>ref|XP_010450912.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic [Camelina sativa]
Length=181

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  14   TPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFE  68



>ref|XP_010440948.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  14   TPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFE  68



>gb|AFK36660.1| unknown [Lotus japonicus]
 gb|AFK45650.1| unknown [Lotus japonicus]
Length=177

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T   A+MVAPFTGLKS A FPVTRK + D TSIA+NG RV CMQVWPP G KKFE
Sbjct  13   TVNHANMVAPFTGLKSMAGFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFE  67



>gb|AFK33868.1| unknown [Lotus japonicus]
Length=177

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T   A+MVAPFTGLKS A FPVTRK + D TSIA+NG RV CMQVWPP G KKFE
Sbjct  13   TVNHANMVAPFTGLKSMAGFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFE  67



>sp|P08474.1|RBS_CUCSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Cucumis sativus]
 gb|AAA33131.1| ribulose bisphosphate carboxylase/oxygenase precursor peptide 
[Cucumis sativus]
Length=189

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+ASMVAPFTGLKS+A FP+TRK+  D T++A+N  +VQCM+VWPP GL+KFE
Sbjct  17   ASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNAGKVQCMKVWPPLGLRKFE  72



>gb|ADB85091.1| ribulose 1,5-bisphosphate carboxylase small subunit [Jatropha 
curcas]
Length=181

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A+A+MVAPFTGLKSTA FP  + + D TSIA NG RVQCM+VWP  GLKKFE
Sbjct  16   RASPAQATMVAPFTGLKSTAGFPARKTTNDITSIAGNGGRVQCMKVWPTQGLKKFE  71



>gb|EPS63610.1| ribulose bisphosphate carboxylase small chain, partial [Genlisea 
aurea]
Length=173

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            + SMVAP+TGLKS A FPV++KS D TS+A NG RVQCMQVWP  G+KKFE
Sbjct  17   RTSMVAPYTGLKSAAGFPVSKKSNDITSVANNGGRVQCMQVWPTVGVKKFE  67



>ref|XP_009139780.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic isoform X2 [Brassica rapa]
Length=136

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFE  68



>ref|XP_009140170.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRKS  D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFE  68



>gb|AIF75322.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRKS  D TSIA+NG RV CM+VWPP G KKFE
Sbjct  12   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFE  64



>emb|CDY52468.1| BnaA04g27920D [Brassica napus]
Length=181

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRKS  D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFE  68



>gb|AIF75321.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
Length=177

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRKS  D TSIA+NG RV CM+VWPP G KKFE
Sbjct  12   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFE  64



>ref|XP_010103758.1| hypothetical protein L484_014647 [Morus notabilis]
 gb|EXB97036.1| hypothetical protein L484_014647 [Morus notabilis]
Length=182

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R    +A+MVAPF+GLKSTASFP+ +K+ D T++A+NG RVQCMQVWPP G  KFE
Sbjct  17   RTAPVQANMVAPFSGLKSTASFPINQKTNDITALASNGGRVQCMQVWPPRGKLKFE  72



>gb|ACQ90230.1| virus-resistance protein [Brassica rapa subsp. chinensis]
Length=249

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRKS  D TSIA+NG RV CM+VWPP G KKFE
Sbjct  84   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFE  136



>ref|XP_009767108.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +ASMVAPFTGLKS +SFPVTRK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  20   QASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  71



>gb|AIF75323.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRKS  D TSIA+NG RV CM+VWPP G KKFE
Sbjct  12   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFE  64



>gb|AIF75363.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASMVAPFTGLKS + FPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  1    NAAQASMVAPFTGLKSASFFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  55



>gb|AIF75361.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75362.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             AA+ASMVAPFTGLKS + FPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  1    NAAQASMVAPFTGLKSASFFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  55



>gb|KHG18747.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  17   SSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  72



>gb|AIF75340.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75341.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRKS  D TSIA NG RV CM+VWPP G KKFE
Sbjct  12   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIANNGGRVSCMKVWPPVGKKKFE  64



>sp|Q39744.1|RBS2_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67846.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA  A+A+MVAPFTGLKS  +FP T+K+ DF+++ +NG RVQCM+VWPP G K++E
Sbjct  13   RAAPAQANMVAPFTGLKSNVAFPATKKANDFSTLPSNGGRVQCMKVWPPLGKKRYE  68



>sp|P18960.1|RBS_SILPR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Silene latifolia subsp. alba]
 gb|AAB39037.1| ribulose bisphosphate carboxylase precursor [Silene latifolia 
subsp. alba]
Length=177

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +A+MVAPF+GLKST++FPV+RKS  D TS+ATNG RV CMQVWPP  LKKFE
Sbjct  18   QANMVAPFSGLKSTSAFPVSRKSNVDITSLATNGGRVNCMQVWPPRNLKKFE  69



>ref|XP_009125072.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  13   SSPAQAAMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFE  68



>gb|AIR75143.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum virgatum]
Length=139

 Score = 80.9 bits (198),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  115  SMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            SMVAPF GLKST +FPVT+K+ D TS+A+NG RVQCMQVWPP  +KK+E
Sbjct  1    SMVAPFNGLKSTVAFPVTKKNDDITSLASNGGRVQCMQVWPPTNMKKYE  49



>emb|CAA53083.1| ribulose-1,5-bisphosphate carboxylase /oxygenase, small subunit 
[Brassica napus]
Length=181

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  13   SSPAQAAMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFE  68



>gb|AEX60837.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=165

 Score = 81.3 bits (199),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPV RK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPAQANMVAPFTGLKSASAFPVARKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>emb|CDX67402.1| BnaA07g14420D [Brassica napus]
Length=181

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  13   SSPAQAAMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFE  68



>emb|CDX99682.1| BnaC04g34390D [Brassica napus]
Length=189

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRKS  D TSIA NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKSNTDITSIANNGGRVSCMKVWPPVGKKKFE  68



>gb|AIF75324.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75325.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  9    SSPAQAAMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFE  64



>gb|AAF03096.1|AF162195_1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Lactuca sativa]
Length=174

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R T+ +AS+ APFTGLKS  +FPVT+K + DF+S+ +NG RVQCM+VWPP GLKK+E
Sbjct  13   NRTTSTQASLAAPFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYE  70



>ref|XP_010450911.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  13   SSPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFE  68



>gb|AIF75291.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75293.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
Length=163

 Score = 81.3 bits (199),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  4    AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFE  56



>gb|AIF75344.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75345.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS+A+FPVTRK+  D TSIA+NG RV CM+VWPP G KKFE
Sbjct  9    SSPAQAAMVAPFTGLKSSAAFPVTRKTDTDITSIASNGGRVNCMKVWPPVGKKKFE  64



>gb|AFS41753.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MV PFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPARANMVTPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>sp|Q40250.1|RBS_LACSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Lactuca sativa]
 dbj|BAA03103.1| riburose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Lactuca sativa]
Length=181

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +1

Query  91   GRATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             R T+ +AS+ APFTGLKS  +FPVT+K + DF+S+ +NG RVQCM+VWPP GLKK+E
Sbjct  13   NRTTSTQASLAAPFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYE  70



>ref|NP_001031981.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 gb|AED94312.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=174

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFE  68



>gb|AIF75289.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75290.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  4    AQATMVAPFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFE  56



>ref|XP_006405770.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
 gb|ESQ47223.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
Length=181

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFE  68



>ref|NP_198657.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 sp|P10798.2|RBS3B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK25834.1|AF360124_1 putative ribulose bisphosphate carboxylase small chain 3b precursor 
[Arabidopsis thaliana]
 gb|AAK95300.1|AF410314_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAL58912.1|AF462822_1 At5g38410/F1O19.10 [Arabidopsis thaliana]
 dbj|BAB09353.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAK93702.1| putative RuBisCO small 3b subunit precursor [Arabidopsis thaliana]
 gb|AAK96743.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAL47390.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAM19980.1| At5g38410/F1O19.10 [Arabidopsis thaliana]
 gb|AAN31863.1| putative ribulose bisphosphate carboxylase small chain 3b precursor 
(RuBisCO small subunit 3b) [Arabidopsis thaliana]
 gb|AED94311.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=181

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFE  68



>ref|XP_006285820.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
 gb|EOA18718.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
Length=181

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFE  68



>ref|NP_001119331.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 gb|AED94313.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=186

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFE  68



>gb|AFW90575.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Solanum tuberosum]
Length=181

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +1

Query  112  ASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +SMVAPFTGLKSTA+FPV+RK + D TSIA+NG RV+CMQVWPP  +KK+E
Sbjct  21   SSMVAPFTGLKSTATFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYE  71



>gb|AEX60843.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41739.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41747.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41760.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score = 81.3 bits (199),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPV RK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPAQANMVAPFTGLKSASAFPVIRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>gb|AFS41748.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=179

 Score = 81.3 bits (199),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS ++FPV RK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPAQANMVAPFTGLKSASAFPVIRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>gb|AEX60839.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41738.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41746.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41758.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score = 81.3 bits (199),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MV PFTGLKS ++FPVTRK + D TS+A+NG RVQCMQVWPP G KKFE
Sbjct  14   ASPAQANMVTPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFE  69



>ref|NP_974098.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
 gb|AEE34595.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
Length=136

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPF GLKS+A+FP TRK + D TSI +NG RV CMQVWPP G KKFE
Sbjct  13   ASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFE  68



>ref|XP_010440945.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440946.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440947.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score = 80.9 bits (198),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPF GLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  14   TPAQATMVAPFNGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFE  68



>ref|XP_002888576.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64835.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
Length=180

 Score = 80.9 bits (198),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS+A+FP TRK + D TSI +NG RV CMQVWPP G KKFE
Sbjct  13   ASPAQATMVAPFTGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPVGKKKFE  68



>gb|AIF75285.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75286.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
 gb|AIF75287.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
Length=163

 Score = 80.5 bits (197),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+ASFPVTRK + D TSI +NG RV CM+VWPP G KKFE
Sbjct  4    AQATMVAPFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFE  56



>ref|XP_009625434.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana tomentosiformis]
Length=181

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +ASMVAPFTGLKS +SFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  20   QASMVAPFTGLKSASSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  71



>emb|CAA32701.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+ASFPVTRK + D TSI +NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFE  68



>ref|XP_003637842.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=106

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA++ ++  VAPF GLKS A FPVT+ + D TSI +NG RV CMQVWPP G KKFE
Sbjct  16   RASSVQSGAVAPFVGLKSMAGFPVTKVNKDITSITSNGGRVNCMQVWPPIGKKKFE  71



>gb|ABB51649.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit precursor [Brassica napus]
Length=181

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFE  68



>ref|XP_009139778.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic isoform X1 [Brassica rapa]
 sp|P27985.1|RBS2_BRANA RecName: Full=Ribulose bisphosphate carboxylase small chain F1, 
chloroplastic; Short=RuBisCO small subunit F1; Flags: Precursor 
[Brassica napus]
 emb|CAA39402.1| ribulose bisphosphate carboxylase /oxygenase small subunit [Brassica 
napus]
 emb|CDY71122.1| BnaAnng36210D [Brassica napus]
Length=181

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFE  68



>gb|AIF75317.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75318.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75319.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75320.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75334.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75335.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75336.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  12   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFE  64



>ref|NP_198659.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
 sp|P10796.1|RBS1B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic; Short=RuBisCO small subunit 1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95269.1|AF410283_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 emb|CAA32700.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
 dbj|BAB09355.1| ribulose bisphosphate carboxylase small chain 1b precursor (RuBisCO 
small subunit 1b) [Arabidopsis thaliana]
 gb|AAN28753.1| At5g38430/F1O19.10 [Arabidopsis thaliana]
 gb|AED94315.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
Length=181

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+ASFPVTRK + D TSI +NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFE  68



>gb|AIF75296.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75297.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS+ASFP TRK + D TSI +NG RV CM+VWPP G KKFE
Sbjct  1    ASPAQATMVAPFTGLKSSASFPATRKANNDITSITSNGGRVNCMKVWPPVGKKKFE  56



>ref|XP_010450913.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T A+A+MVAPFTGLKS+A+FPVTRK + D TSI +NG RV CM+VWPP G KKFE
Sbjct  14   TPAQATMVAPFTGLKSSAAFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFE  68



>ref|NP_198658.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
 sp|P10797.2|RBS2B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB09354.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL24421.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32515.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32536.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32621.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAM13287.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAN72105.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO00914.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO29974.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AED94314.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
Length=181

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+ASFPVTRK + D TSI +NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFE  68



>gb|AEB00556.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Brassica juncea]
Length=181

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFE  68



>emb|CDY01665.1| BnaC04g30870D [Brassica napus]
Length=181

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+++FPVTRK + D TSI +NG RV CMQVWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSSAFPVTRKANNDITSIVSNGGRVSCMQVWPPIGKKKFE  68



>gb|AIF75292.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSI++NG RV CM+VWPP G KKFE
Sbjct  4    AQATMVAPFTGLKSSAAFPVTRKANNDITSISSNGGRVSCMKVWPPIGKKKFE  56



>gb|AIF75337.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75338.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+++FPVTRK + D TSI +NG RV CMQVWPP G KKFE
Sbjct  12   AQATMVAPFTGLKSSSAFPVTRKANNDITSIVSNGGRVSCMQVWPPIGKKKFE  64



>sp|P08135.1|RBS_RAPSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Raphanus sativus]
 emb|CAA29801.1| carboxylase [Raphanus sativus]
 prf||1405335A ribulose bisphosphate carboxylase S
Length=181

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +A+MVAPFTGLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  17   QATMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFE  68



>gb|AIF75283.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75284.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPF GLKS+A+FP TRK + D TSI +NG RV CMQVWPP G KKFE
Sbjct  1    ASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFE  56



>ref|XP_011099670.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Sesamum indicum]
Length=180

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +ASMVAPFTGLKST+  PV RKS D TS+A+NG RVQC+QVWP  G KKFE
Sbjct  20   QASMVAPFTGLKSTSGLPVARKSNDITSVASNGGRVQCIQVWPTQGKKKFE  70



>ref|XP_010470604.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic isoform X2 [Camelina sativa]
Length=136

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+ A+A+MVAPFTGLKS+A+FP TRK + D TSI +NG RV CM+VWPP G KKFE
Sbjct  13   ASPAQATMVAPFTGLKSSAAFPATRKANNDITSITSNGGRVSCMKVWPPIGKKKFE  68



>ref|XP_002868775.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45034.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
Length=181

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPFTGLKS+A+FPVTRK + D TSI++NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFTGLKSSATFPVTRKANNDITSISSNGGRVSCMKVWPPIGKKKFE  68



>gb|AAW31667.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ammopiptanthus mongolicus]
Length=174

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
             T  KASM APFTGLKS ASFPV RK ++D T+IA NG RVQCM VWPP G KKFE
Sbjct  7    VTTVKASMGAPFTGLKSMASFPVPRKVNSDITTIANNGGRVQCMLVWPPLGRKKFE  62



>ref|WP_021036336.1| Ribulose-1,5-bisphosphate carboxylase small subunit [Bacillus 
thuringiensis]
 gb|ERH96370.1| Ribulose-1,5-bisphosphate carboxylase small subunit [Bacillus 
thuringiensis T01-328]
Length=142

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            R T A+ASMVAP+TGLKS+A+FPVTRK + DF+S+ +NG RVQCM +WP  G KKFE
Sbjct  16   RTTPAQASMVAPYTGLKSSAAFPVTRKPNNDFSSLPSNGGRVQCMLIWPTTGKKKFE  72



>gb|AIF75342.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75343.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS+A+FPVTRK+  D TS+A+NG RV CM+VWPP G KKFE
Sbjct  9    SSPAQAAMVAPFTGLKSSAAFPVTRKTDTDITSMASNGGRVNCMKVWPPVGKKKFE  64



>ref|XP_002868776.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45035.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPF+GLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFSGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFE  68



>gb|AIR75139.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia turkestanica]
Length=165

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  100  TAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            T+A+ASMVAPFTGLKST  FP T+K+ D TS+A+NG RVQCM+VWP   +K++E
Sbjct  9    TSAQASMVAPFTGLKSTVGFPATKKNDDITSLASNGGRVQCMKVWPTQNMKRYE  62



>emb|CDY67657.1| BnaCnng55860D [Brassica napus]
Length=181

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKS-ADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            ++ A+A+MVAPFTGLKS+A+FPVTRK+  D TS+A+NG RV CM+VWPP G KKFE
Sbjct  13   SSPAQAAMVAPFTGLKSSAAFPVTRKTDTDITSMASNGGRVNCMKVWPPVGKKKFE  68



>ref|XP_009602965.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=179

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +ASMVAPFTGLKS  SFPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  20   QASMVAPFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  71



>gb|ABA46911.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Musa acuminata]
Length=161

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +1

Query  94   RATAAKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            RA+ A++SMVAPFTGLKST++FPVTRK +AD + + +NG RVQCM+VWP  G KKFE
Sbjct  13   RASPAQSSMVAPFTGLKSTSAFPVTRKANADLSHLPSNGGRVQCMEVWPIEGKKKFE  69



>ref|XP_006285696.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
 gb|EOA18594.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
Length=181

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +1

Query  106  AKASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            A+A+MVAPF+GLKS+A+FPVTRK + D TSIA+NG RV CM+VWPP G KKFE
Sbjct  16   AQATMVAPFSGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFE  68



>sp|Q39748.1|RBS6_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67850.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  97   ATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVWPPFGLKKF  258
            A  A+A+MVAPFTGLK+ A+FPVT+K  DF+++ +NG RVQCM+VWPP G KK+
Sbjct  9    AAVAQANMVAPFTGLKANAAFPVTKKVNDFSTLPSNGGRVQCMKVWPPLGKKKY  62



>ref|XP_009602966.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=110

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = +1

Query  109  KASMVAPFTGLKSTASFPVTRK-SADFTSIATNGTRVQCMQVWPPFGLKKFE  261
            +ASMVAPFTGLKS + FPV+RK + D TSIA+NG RVQCMQVWPP   KK+E
Sbjct  20   QASMVAPFTGLKSASFFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYE  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 536317840650