BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9568_g1_i1 len=1336 path=[1314:0-470 2683:471-1335]

Length=1336
                                                                      Score     E

ref|XP_006344196.1|  PREDICTED: origin recognition complex subuni...    601   0.0      
ref|XP_004238875.1|  PREDICTED: origin recognition complex subunit 4    595   0.0      
ref|XP_009615037.1|  PREDICTED: origin recognition complex subunit 4    597   0.0      
ref|XP_009766229.1|  PREDICTED: origin recognition complex subuni...    595   0.0      
emb|CDP00706.1|  unnamed protein product                                577   0.0      
ref|XP_011070733.1|  PREDICTED: origin recognition complex subuni...    574   0.0      
ref|XP_010661643.1|  PREDICTED: origin recognition complex subuni...    566   0.0      
gb|EYU30029.1|  hypothetical protein MIMGU_mgv1a007096mg                566   0.0      
ref|XP_010661594.1|  PREDICTED: origin recognition complex subuni...    561   0.0      
gb|KDO64778.1|  hypothetical protein CISIN_1g014789mg                   561   0.0      
ref|XP_006468787.1|  PREDICTED: origin recognition complex subuni...    561   0.0      
ref|XP_006468788.1|  PREDICTED: origin recognition complex subuni...    560   0.0      
ref|XP_008339604.1|  PREDICTED: origin recognition complex subunit 4    557   0.0      
ref|XP_006448332.1|  hypothetical protein CICLE_v10015376mg             556   0.0      
ref|XP_009357467.1|  PREDICTED: origin recognition complex subunit 4    552   0.0      
ref|XP_008243436.1|  PREDICTED: origin recognition complex subunit 4    552   0.0      
emb|CBI26946.3|  unnamed protein product                                549   0.0      
ref|XP_007227710.1|  hypothetical protein PRUPE_ppa006384mg             545   0.0      
ref|XP_011022846.1|  PREDICTED: origin recognition complex subuni...    545   0.0      
ref|XP_007028452.1|  Origin recognition complex subunit 4 isoform 1     541   0.0      
ref|XP_011022840.1|  PREDICTED: origin recognition complex subuni...    539   0.0      
ref|XP_004299027.1|  PREDICTED: origin recognition complex subuni...    539   0.0      
ref|XP_002312422.1|  origin recognition complex subunit 4 family ...    538   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007028453.1|  Origin recognition complex subunit 4 isoform 2     537   0.0      
gb|EPS72050.1|  hypothetical protein M569_02708                         535   0.0      
ref|XP_010279414.1|  PREDICTED: origin recognition complex subunit 4    535   0.0      
gb|KDP44455.1|  hypothetical protein JCGZ_16288                         534   0.0      
ref|XP_002526317.1|  origin recognition complex subunit, putative       528   0.0      Ricinus communis
gb|KHG28385.1|  Origin recognition complex subunit 4                    530   0.0      
ref|XP_004158973.1|  PREDICTED: origin recognition complex subuni...    526   0.0      
ref|XP_004497011.1|  PREDICTED: origin recognition complex subuni...    523   1e-180   
ref|XP_010681707.1|  PREDICTED: origin recognition complex subuni...    523   2e-180   
ref|XP_006468789.1|  PREDICTED: origin recognition complex subuni...    521   4e-180   
ref|XP_008787657.1|  PREDICTED: origin recognition complex subunit 4    521   8e-180   
ref|XP_008456888.1|  PREDICTED: origin recognition complex subunit 4    520   2e-179   
gb|KEH44148.1|  origin recognition complex subunit 4                    519   5e-179   
ref|XP_010681709.1|  PREDICTED: origin recognition complex subuni...    519   8e-179   
ref|XP_010069004.1|  PREDICTED: origin recognition complex subuni...    516   1e-177   
ref|XP_006293033.1|  hypothetical protein CARUB_v10019313mg             515   2e-177   
ref|XP_008367071.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    514   2e-177   
ref|XP_009101367.1|  PREDICTED: origin recognition complex subunit 4    514   3e-177   
ref|XP_010424849.1|  PREDICTED: origin recognition complex subuni...    513   8e-177   
ref|XP_010502063.1|  PREDICTED: origin recognition complex subuni...    513   2e-176   
gb|KFK33333.1|  hypothetical protein AALP_AA5G000700                    512   2e-176   
ref|XP_010513816.1|  PREDICTED: origin recognition complex subuni...    511   1e-175   
ref|XP_006398497.1|  hypothetical protein EUTSA_v10000894mg             508   2e-174   
ref|XP_004969562.1|  PREDICTED: origin recognition complex subuni...    508   2e-174   
sp|Q6EWX1.1|ORC4_ARATH  RecName: Full=Origin of replication compl...    506   4e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010924342.1|  PREDICTED: origin recognition complex subuni...    506   5e-174   
ref|XP_002456156.1|  hypothetical protein SORBIDRAFT_03g031370          506   1e-173   Sorghum bicolor [broomcorn]
ref|XP_010506870.1|  PREDICTED: origin recognition complex subuni...    505   2e-173   
emb|CDY57511.1|  BnaC07g48740D                                          504   3e-173   
ref|XP_007142987.1|  hypothetical protein PHAVU_007G034200g             503   1e-172   
ref|XP_010527756.1|  PREDICTED: origin recognition complex subuni...    503   2e-172   
ref|XP_011070734.1|  PREDICTED: origin recognition complex subuni...    499   4e-172   
ref|NP_001105072.1|  origin recognition complex subunit 4               501   9e-172   Zea mays [maize]
ref|XP_004969563.1|  PREDICTED: origin recognition complex subuni...    501   1e-171   
ref|NP_178222.4|  origin recognition complex subunit 4                  500   2e-171   Arabidopsis thaliana [mouse-ear cress]
gb|EEE55188.1|  hypothetical protein OsJ_03032                          499   6e-171   Oryza sativa Japonica Group [Japonica rice]
emb|CAE52912.1|  putative origin recognition complex subunit 4          499   8e-171   Arabidopsis thaliana [mouse-ear cress]
gb|ACR36393.1|  unknown                                                 497   3e-170   Zea mays [maize]
ref|XP_006646209.1|  PREDICTED: origin recognition complex subuni...    496   1e-169   
dbj|BAK06637.1|  predicted protein                                      495   2e-169   
ref|XP_002875061.1|  hypothetical protein ARALYDRAFT_322461             495   5e-169   
ref|NP_001189493.1|  origin recognition complex subunit 4               493   8e-169   
dbj|BAC77041.1|  origin recognition complex 4                           493   2e-168   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010527758.1|  PREDICTED: origin recognition complex subuni...    489   1e-167   
ref|XP_009418848.1|  PREDICTED: origin recognition complex subunit 4    486   9e-166   
ref|XP_010527757.1|  PREDICTED: origin recognition complex subuni...    484   2e-165   
ref|XP_003536655.1|  PREDICTED: origin recognition complex subuni...    483   6e-165   
ref|XP_006605946.1|  PREDICTED: origin recognition complex subuni...    481   3e-164   
ref|XP_010681710.1|  PREDICTED: origin recognition complex subuni...    481   4e-164   
gb|KHN42409.1|  Origin recognition complex subunit 4                    479   3e-163   
ref|XP_003569575.1|  PREDICTED: origin recognition complex subuni...    478   8e-163   
ref|XP_004146481.1|  PREDICTED: origin recognition complex subuni...    465   3e-158   
ref|XP_006843984.1|  hypothetical protein AMTR_s00006p00149820          466   5e-158   
ref|NP_001043888.1|  Os01g0683400                                       466   2e-157   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151847.1|  origin recognition complex subunit 4               457   5e-155   Zea mays [maize]
gb|KFK40712.1|  hypothetical protein AALP_AA2G031400                    456   1e-154   
emb|CDY17695.1|  BnaA06g35140D                                          451   1e-152   
ref|XP_008351001.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    441   1e-149   
ref|XP_010232145.1|  PREDICTED: origin recognition complex subuni...    444   6e-149   
ref|XP_010924349.1|  PREDICTED: origin recognition complex subuni...    440   3e-148   
gb|EEC71281.1|  hypothetical protein OsI_03294                          437   2e-147   Oryza sativa Indica Group [Indian rice]
ref|XP_011070735.1|  PREDICTED: origin recognition complex subuni...    433   2e-146   
gb|AAT37464.2|  origin recognition complex protein 4                    432   2e-145   Arabidopsis thaliana [mouse-ear cress]
gb|ACU18384.1|  unknown                                                 421   3e-141   Glycine max [soybeans]
emb|CDY37347.1|  BnaC02g33650D                                          419   4e-140   
ref|XP_010096736.1|  Origin recognition complex subunit 4               402   7e-134   
ref|XP_010496938.1|  PREDICTED: origin recognition complex subuni...    398   1e-132   
gb|KHN06716.1|  Origin recognition complex subunit 4                    397   8e-132   
ref|XP_010527759.1|  PREDICTED: origin recognition complex subuni...    393   2e-130   
ref|XP_010232147.1|  PREDICTED: origin recognition complex subuni...    389   2e-128   
tpg|DAA58087.1|  TPA: origin recognition complex subunit 4              384   4e-128   
ref|XP_001768790.1|  predicted protein                                  377   4e-123   
emb|CDY40401.1|  BnaA02g27150D                                          375   3e-122   
ref|XP_007028454.1|  Origin recognition complex subunit 4 isoform 3     342   1e-111   
ref|XP_007028455.1|  Origin recognition complex subunit 4 isoform 4     334   2e-108   
tpg|DAA58086.1|  TPA: hypothetical protein ZEAMMB73_713792              322   2e-104   
tpg|DAA58085.1|  TPA: hypothetical protein ZEAMMB73_713792              294   2e-93    
ref|XP_010069005.1|  PREDICTED: origin recognition complex subuni...    275   2e-86    
gb|EMS52251.1|  Origin recognition complex subunit 4                    241   2e-71    
ref|XP_008389997.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    239   5e-71    
ref|XP_009356187.1|  PREDICTED: origin recognition complex subuni...    228   1e-67    
ref|XP_002314828.1|  origin recognition complex subunit 4 family ...    213   3e-62    Populus trichocarpa [western balsam poplar]
tpg|DAA58084.1|  TPA: hypothetical protein ZEAMMB73_713792              183   3e-52    
ref|XP_002968373.1|  hypothetical protein SELMODRAFT_409152             186   1e-50    
gb|EPB82706.1|  hypothetical protein HMPREF1544_10552                   187   4e-50    
gb|ELU16403.1|  hypothetical protein CAPTEDRAFT_227802                  186   6e-50    
ref|XP_002965944.1|  hypothetical protein SELMODRAFT_407107             181   5e-49    
ref|XP_001634993.1|  predicted protein                                  182   1e-48    Nematostella vectensis
ref|XP_006820848.1|  PREDICTED: origin recognition complex subuni...    176   5e-46    
gb|AAF18660.1|  unknown protein                                         164   3e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005069007.1|  PREDICTED: origin recognition complex subunit 4    172   8e-45    
ref|XP_422152.3|  PREDICTED: origin recognition complex subunit 4...    172   1e-44    Gallus gallus [bantam]
ref|XP_007422692.1|  PREDICTED: origin recognition complex subuni...    171   2e-44    
ref|XP_005650673.1|  hypothetical protein COCSUDRAFT_40278              173   3e-44    
ref|NP_001258354.1|  origin recognition complex subunit 4               171   4e-44    
ref|XP_004943072.1|  PREDICTED: origin recognition complex subuni...    171   4e-44    
ref|XP_010712299.1|  PREDICTED: origin recognition complex subuni...    169   6e-44    
ref|XP_002164229.2|  PREDICTED: origin recognition complex subuni...    170   6e-44    
ref|XP_007646936.1|  PREDICTED: origin recognition complex subuni...    170   6e-44    
ref|XP_007646935.1|  PREDICTED: origin recognition complex subuni...    170   8e-44    
ref|XP_004651881.1|  PREDICTED: origin recognition complex subuni...    169   8e-44    
ref|XP_007646934.1|  PREDICTED: origin recognition complex subuni...    171   9e-44    
emb|CAN69810.1|  hypothetical protein VITISV_043106                     174   1e-43    Vitis vinifera
ref|XP_970921.1|  PREDICTED: origin recognition complex subunit 4       169   1e-43    Tribolium castaneum [rust-red flour beetle]
ref|XP_005153803.1|  PREDICTED: origin recognition complex subunit 4    169   2e-43    
ref|XP_002121287.2|  PREDICTED: origin recognition complex subunit 4    168   2e-43    Ciona intestinalis [sea vase]
ref|XP_009907739.1|  PREDICTED: origin recognition complex subunit 4    169   2e-43    
gb|EPZ36810.1|  Origin recognition complex, subunit 4 domain-cont...    167   2e-43    
ref|XP_004577234.1|  PREDICTED: origin recognition complex subunit 4    168   3e-43    
ref|XP_005168754.1|  PREDICTED: origin recognition complex subuni...    167   4e-43    
ref|NP_998348.1|  origin recognition complex subunit 4                  167   6e-43    Danio rerio [leopard danio]
ref|XP_006636292.1|  PREDICTED: origin recognition complex subuni...    167   7e-43    
ref|NP_001081561.1|  origin recognition complex subunit 4               166   1e-42    Xenopus laevis [clawed frog]
ref|XP_005956059.1|  PREDICTED: origin recognition complex subunit 4    166   2e-42    
ref|XP_005315878.1|  PREDICTED: origin recognition complex subunit 4    166   2e-42    
ref|XP_004375422.1|  PREDICTED: origin recognition complex subunit 4    166   3e-42    
ref|XP_008115329.1|  PREDICTED: origin recognition complex subuni...    165   3e-42    
ref|XP_005025038.1|  PREDICTED: origin recognition complex subunit 4    165   3e-42    
ref|XP_003225025.2|  PREDICTED: origin recognition complex subuni...    165   5e-42    
sp|O93479.1|ORC4_XENLA  RecName: Full=Origin recognition complex ...    164   6e-42    Xenopus laevis [clawed frog]
ref|XP_004757924.1|  PREDICTED: origin recognition complex subuni...    164   8e-42    
ref|XP_007183093.1|  PREDICTED: origin recognition complex subuni...    164   1e-41    
ref|XP_533348.2|  PREDICTED: origin recognition complex subunit 4...    164   1e-41    Canis lupus familiaris [dogs]
ref|XP_004674728.1|  PREDICTED: origin recognition complex subunit 4    164   1e-41    
ref|XP_004268286.1|  PREDICTED: origin recognition complex subunit 4    164   1e-41    
ref|NP_001005654.1|  origin recognition complex, subunit 4              164   1e-41    Xenopus tropicalis [western clawed frog]
ref|XP_006974352.1|  PREDICTED: origin recognition complex subunit 4    164   1e-41    
ref|XP_007108106.1|  PREDICTED: origin recognition complex subuni...    164   1e-41    
dbj|BAC36300.1|  unnamed protein product                                164   1e-41    Mus musculus [mouse]
ref|XP_007454613.1|  PREDICTED: origin recognition complex subunit 4    164   1e-41    
ref|XP_005676229.1|  PREDICTED: origin recognition complex subunit 4    163   1e-41    
ref|XP_009884654.1|  PREDICTED: origin recognition complex subunit 4    163   2e-41    
ref|XP_004004765.1|  PREDICTED: origin recognition complex subunit 4    163   2e-41    
ref|XP_006078706.1|  PREDICTED: origin recognition complex subunit 4    163   2e-41    
ref|XP_003133297.1|  PREDICTED: origin recognition complex subuni...    163   2e-41    
ref|XP_004032673.1|  PREDICTED: origin recognition complex subuni...    162   3e-41    
ref|XP_010889373.1|  PREDICTED: origin recognition complex subunit 4    162   3e-41    
ref|XP_006935334.1|  PREDICTED: origin recognition complex subuni...    162   3e-41    
ref|XP_007078613.1|  PREDICTED: origin recognition complex subuni...    162   3e-41    
ref|XP_010073343.1|  PREDICTED: origin recognition complex subunit 4    162   4e-41    
ref|XP_008395811.1|  PREDICTED: origin recognition complex subuni...    162   4e-41    
ref|XP_004888471.1|  PREDICTED: origin recognition complex subuni...    162   4e-41    
ref|XP_001487939.1|  PREDICTED: origin recognition complex subuni...    162   4e-41    Equus caballus [domestic horse]
ref|XP_002509047.1|  predicted protein                                  159   4e-41    Micromonas commoda
ref|XP_003763894.1|  PREDICTED: origin recognition complex subunit 4    162   5e-41    
ref|XP_008823396.1|  PREDICTED: origin recognition complex subuni...    162   5e-41    
gb|ELR49163.1|  Origin recognition complex subunit 4                    161   5e-41    
emb|CDS05825.1|  hypothetical protein LRAMOSA08353                      163   6e-41    
ref|XP_004870041.1|  PREDICTED: origin recognition complex subuni...    162   6e-41    
ref|XP_007078610.1|  PREDICTED: origin recognition complex subuni...    162   6e-41    
ref|XP_005601532.1|  PREDICTED: origin recognition complex subuni...    162   6e-41    
ref|XP_003990798.1|  PREDICTED: origin recognition complex subuni...    162   6e-41    
ref|XP_005390847.1|  PREDICTED: origin recognition complex subuni...    162   6e-41    
ref|XP_002092897.1|  GE11410                                            162   6e-41    Drosophila yakuba
ref|XP_008572806.1|  PREDICTED: origin recognition complex subuni...    162   7e-41    
emb|CAA76188.1|  origin recognition complex subunit 4                   161   7e-41    Mus musculus [mouse]
ref|XP_007568725.1|  PREDICTED: origin recognition complex subunit 4    161   7e-41    
ref|NP_001039766.1|  origin recognition complex subunit 4               161   7e-41    Bos taurus [bovine]
ref|XP_003267675.1|  PREDICTED: origin recognition complex subuni...    161   7e-41    
ref|XP_006187660.1|  PREDICTED: origin recognition complex subunit 4    161   8e-41    
ref|XP_004423904.1|  PREDICTED: origin recognition complex subunit 4    161   8e-41    
ref|XP_004943073.1|  PREDICTED: origin recognition complex subuni...    162   8e-41    
gb|AAC01957.1|  putative replication initiator origin recognition...    161   8e-41    Homo sapiens [man]
ref|XP_007933136.1|  PREDICTED: origin recognition complex subunit 4    161   8e-41    
ref|NP_036088.3|  origin recognition complex subunit 4 isoform 1        161   9e-41    Mus musculus [mouse]
ref|XP_006880822.1|  PREDICTED: origin recognition complex subunit 4    161   9e-41    
dbj|BAF84678.1|  unnamed protein product                                161   9e-41    Homo sapiens [man]
ref|XP_004401591.1|  PREDICTED: origin recognition complex subunit 4    161   9e-41    
ref|NP_859525.1|  origin recognition complex subunit 4 isoform 1        161   9e-41    Homo sapiens [man]
ref|XP_008572805.1|  PREDICTED: origin recognition complex subuni...    162   9e-41    
ref|XP_006727739.1|  PREDICTED: origin recognition complex subuni...    161   1e-40    
ref|XP_008572804.1|  PREDICTED: origin recognition complex subuni...    162   1e-40    
gb|ENN72970.1|  hypothetical protein YQE_10401                          160   1e-40    
ref|XP_004636702.1|  PREDICTED: origin recognition complex subunit 4    161   1e-40    
ref|XP_004614144.1|  PREDICTED: origin recognition complex subunit 4    161   1e-40    
ref|XP_010291314.1|  PREDICTED: origin recognition complex subunit 4    161   1e-40    
ref|XP_010353215.1|  PREDICTED: origin recognition complex subuni...    160   1e-40    
ref|XP_010948559.1|  PREDICTED: origin recognition complex subunit 4    160   1e-40    
ref|XP_006196205.1|  PREDICTED: origin recognition complex subunit 4    160   1e-40    
ref|XP_001364856.1|  PREDICTED: origin recognition complex subuni...    160   1e-40    Monodelphis domestica
ref|NP_001126452.1|  origin recognition complex subunit 4               160   1e-40    Pongo abelii [orang utan]
ref|XP_005099548.1|  PREDICTED: origin recognition complex subuni...    161   1e-40    
ref|XP_002712193.1|  PREDICTED: origin recognition complex subuni...    160   1e-40    Oryctolagus cuniculus [domestic rabbit]
ref|XP_006135736.1|  PREDICTED: origin recognition complex subuni...    160   1e-40    
ref|XP_009914303.1|  PREDICTED: origin recognition complex subunit 4    160   2e-40    
ref|XP_010619269.1|  PREDICTED: origin recognition complex subuni...    160   2e-40    
ref|XP_008694107.1|  PREDICTED: origin recognition complex subuni...    160   2e-40    
ref|XP_003793056.1|  PREDICTED: origin recognition complex subunit 4    160   2e-40    
ref|XP_008694106.1|  PREDICTED: origin recognition complex subuni...    160   2e-40    
ref|XP_008136928.1|  PREDICTED: origin recognition complex subunit 4    160   2e-40    
ref|XP_010738339.1|  PREDICTED: origin recognition complex subunit 4    160   2e-40    
ref|XP_008058063.1|  PREDICTED: origin recognition complex subuni...    160   2e-40    
ref|XP_007963132.1|  PREDICTED: origin recognition complex subuni...    160   2e-40    
emb|CEI88521.1|  hypothetical protein RMCBS344292_02908                 160   2e-40    
ref|XP_005296479.1|  PREDICTED: origin recognition complex subuni...    160   2e-40    
ref|XP_005346446.1|  PREDICTED: origin recognition complex subuni...    160   3e-40    
ref|XP_010353213.1|  PREDICTED: origin recognition complex subuni...    160   3e-40    
ref|XP_007963129.1|  PREDICTED: origin recognition complex subuni...    160   3e-40    
ref|NP_001272749.1|  origin recognition complex, subunit 4              160   3e-40    
ref|XP_006753653.1|  PREDICTED: origin recognition complex subuni...    160   3e-40    
ref|XP_002004621.1|  GI19505                                            160   3e-40    Drosophila mojavensis
ref|XP_006140566.1|  PREDICTED: origin recognition complex subuni...    159   3e-40    
ref|XP_006921113.1|  PREDICTED: origin recognition complex subuni...    159   4e-40    
ref|XP_002043133.1|  GM11786                                            160   4e-40    Drosophila sechellia
ref|XP_005179312.1|  PREDICTED: origin recognition complex subuni...    160   4e-40    
ref|XP_005859344.1|  PREDICTED: origin recognition complex subuni...    159   4e-40    
ref|XP_003907506.1|  PREDICTED: origin recognition complex subunit 4    159   4e-40    
ref|XP_009441712.1|  PREDICTED: origin recognition complex subuni...    159   4e-40    
gb|ERL92166.1|  hypothetical protein D910_09486                         159   5e-40    
ref|XP_010003894.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    159   5e-40    
ref|XP_001159230.1|  PREDICTED: origin recognition complex subuni...    159   5e-40    Pan troglodytes
ref|XP_005859343.1|  PREDICTED: origin recognition complex subuni...    159   5e-40    
ref|XP_006086932.1|  PREDICTED: origin recognition complex subunit 4    159   6e-40    
ref|XP_009868984.1|  PREDICTED: origin recognition complex subunit 4    159   6e-40    
ref|XP_006234214.1|  PREDICTED: origin recognition complex subuni...    159   6e-40    
ref|NP_954523.1|  origin recognition complex subunit 4                  159   7e-40    Rattus norvegicus [brown rat]
ref|XP_006234212.1|  PREDICTED: origin recognition complex subuni...    159   7e-40    
ref|XP_001361211.1|  GA15517                                            159   7e-40    Drosophila pseudoobscura pseudoobscura
ref|XP_008256776.1|  PREDICTED: origin recognition complex subuni...    160   7e-40    
ref|XP_007061850.1|  PREDICTED: origin recognition complex subunit 4    159   7e-40    
ref|XP_005807425.1|  PREDICTED: origin recognition complex subuni...    159   8e-40    
gb|EFB29484.1|  hypothetical protein PANDA_012343                       158   8e-40    Ailuropoda melanoleuca
ref|XP_009976777.1|  PREDICTED: origin recognition complex subunit 4    159   8e-40    
ref|XP_002923238.1|  PREDICTED: origin recognition complex subuni...    158   9e-40    
gb|KDR12067.1|  Origin recognition complex subunit 4                    158   9e-40    
ref|XP_007522293.1|  PREDICTED: origin recognition complex subunit 4    158   1e-39    
ref|NP_477320.1|  origin recognition complex subunit 4                  159   1e-39    Drosophila melanogaster
ref|XP_009283541.1|  PREDICTED: origin recognition complex subuni...    158   1e-39    
ref|XP_001960395.1|  GF11538                                            159   1e-39    Drosophila ananassae
gb|AAD39473.1|AF139063_1  origin recognition complex subunit 4          158   1e-39    Drosophila melanogaster
ref|XP_003400682.1|  PREDICTED: origin recognition complex subuni...    158   1e-39    
ref|XP_007894542.1|  PREDICTED: origin recognition complex subuni...    158   2e-39    
ref|XP_001976676.1|  GG19886                                            158   2e-39    Drosophila erecta
ref|XP_003388168.1|  PREDICTED: origin recognition complex subuni...    157   2e-39    
ref|XP_009070722.1|  PREDICTED: origin recognition complex subunit 4    157   2e-39    
ref|XP_006611084.1|  PREDICTED: origin recognition complex subuni...    158   2e-39    
ref|XP_003922038.1|  PREDICTED: origin recognition complex subuni...    157   2e-39    
ref|XP_006753652.1|  PREDICTED: origin recognition complex subuni...    159   2e-39    
ref|XP_010308035.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    157   2e-39    
ref|XP_008945440.1|  PREDICTED: origin recognition complex subunit 4    157   2e-39    
ref|XP_010584631.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    157   2e-39    
ref|XP_002018414.1|  GL17693                                            157   2e-39    Drosophila persimilis
ref|XP_009935394.1|  PREDICTED: origin recognition complex subunit 4    157   2e-39    
ref|XP_001511605.1|  PREDICTED: origin recognition complex subuni...    157   3e-39    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_004703892.1|  PREDICTED: origin recognition complex subunit 4    157   3e-39    
ref|XP_009807536.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    155   5e-39    
ref|XP_003061717.1|  predicted protein                                  159   5e-39    
ref|XP_005499161.1|  PREDICTED: origin recognition complex subunit 4    156   5e-39    
ref|XP_625030.1|  PREDICTED: origin recognition complex subunit 4...    156   6e-39    Apis mellifera [bee]
ref|XP_005049741.1|  PREDICTED: origin recognition complex subuni...    156   6e-39    
gb|KFH62916.1|  hypothetical protein MVEG_11440                         156   7e-39    
ref|XP_005049738.1|  PREDICTED: origin recognition complex subuni...    156   8e-39    
dbj|BAC39161.1|  unnamed protein product                                155   1e-38    Mus musculus [mouse]
ref|XP_010405485.1|  PREDICTED: origin recognition complex subunit 4    155   1e-38    
gb|EOA97413.1|  Origin recognition complex subunit 4                    154   1e-38    
ref|XP_003446634.1|  PREDICTED: origin recognition complex subuni...    155   1e-38    
ref|XP_008923915.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    155   1e-38    
ref|XP_003484945.1|  PREDICTED: origin recognition complex subuni...    155   2e-38    
gb|ETE72166.1|  Origin recognition complex subunit 4                    154   2e-38    
ref|XP_005519647.1|  PREDICTED: origin recognition complex subunit 4    155   2e-38    
ref|XP_010786517.1|  PREDICTED: origin recognition complex subunit 4    154   3e-38    
ref|XP_003966726.1|  PREDICTED: origin recognition complex subuni...    155   3e-38    
ref|XP_008823397.1|  PREDICTED: origin recognition complex subuni...    153   4e-38    
gb|EFN77500.1|  Origin recognition complex subunit 4                    153   4e-38    
ref|XP_001653985.1|  origin recognition complex subunit                 154   4e-38    
ref|XP_008058064.1|  PREDICTED: origin recognition complex subuni...    153   4e-38    
ref|XP_001846465.1|  origin recognition complex subunit 4               154   4e-38    
ref|XP_004535926.1|  PREDICTED: origin recognition complex subuni...    154   5e-38    
ref|XP_009641728.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    153   5e-38    
ref|XP_003695008.1|  PREDICTED: origin recognition complex subuni...    154   5e-38    
ref|XP_003702800.1|  PREDICTED: origin recognition complex subuni...    154   5e-38    
emb|CEI92308.1|  hypothetical protein RMCBS344292_06573                 153   6e-38    
ref|XP_009086019.1|  PREDICTED: origin recognition complex subunit 4    154   6e-38    
gb|EFX77018.1|  hypothetical protein DAPPUDRAFT_54689                   152   7e-38    
ref|XP_005242408.1|  PREDICTED: origin recognition complex subunit 4    153   8e-38    
ref|XP_005433226.1|  PREDICTED: origin recognition complex subunit 4    153   8e-38    
ref|XP_002598107.1|  hypothetical protein BRAFLDRAFT_124289             152   8e-38    
ref|XP_002198616.1|  PREDICTED: origin recognition complex subunit 4    153   8e-38    
ref|XP_004346747.1|  predicted protein                                  152   9e-38    
gb|KFB50453.1|  AGAP007063-PA-like protein                              153   9e-38    
ref|XP_001600474.2|  PREDICTED: origin recognition complex subunit 4    153   9e-38    
ref|XP_006034459.1|  PREDICTED: origin recognition complex subunit 4    153   1e-37    
ref|XP_006277189.1|  PREDICTED: origin recognition complex subunit 4    153   1e-37    
ref|XP_005738722.1|  PREDICTED: origin recognition complex subuni...    152   1e-37    
ref|XP_001986744.1|  GH21533                                            153   1e-37    
ref|XP_008115331.1|  PREDICTED: origin recognition complex subuni...    150   1e-37    
ref|XP_006792908.1|  PREDICTED: origin recognition complex subuni...    152   1e-37    
ref|XP_010193405.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    152   2e-37    
ref|XP_004480481.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    152   2e-37    
ref|XP_005920008.1|  PREDICTED: origin recognition complex subuni...    152   2e-37    
ref|XP_002048871.1|  GJ21075                                            152   2e-37    
ref|XP_008323339.1|  PREDICTED: origin recognition complex subunit 4    152   2e-37    
ref|XP_004563388.1|  PREDICTED: origin recognition complex subuni...    151   3e-37    
gb|EFW47118.2|  hypothetical protein CAOG_05062                         151   3e-37    
ref|XP_006005569.1|  PREDICTED: origin recognition complex subuni...    150   3e-37    
gb|KFV09579.1|  Origin recognition complex subunit 4                    151   3e-37    
ref|XP_009557295.1|  PREDICTED: origin recognition complex subunit 4    150   4e-37    
ref|XP_008501406.1|  PREDICTED: origin recognition complex subunit 4    151   4e-37    
ref|XP_011065912.1|  PREDICTED: origin recognition complex subunit 4    151   5e-37    
ref|XP_010712300.1|  PREDICTED: origin recognition complex subuni...    149   5e-37    
gb|KFQ36282.1|  Origin recognition complex subunit 4                    150   8e-37    
ref|XP_009317225.1|  PREDICTED: origin recognition complex subuni...    150   1e-36    
ref|XP_008633216.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    149   1e-36    
gb|EMC85230.1|  Origin recognition complex subunit 4                    150   1e-36    
ref|XP_004032676.1|  PREDICTED: origin recognition complex subuni...    147   2e-36    
ref|XP_008395828.1|  PREDICTED: origin recognition complex subuni...    147   2e-36    
gb|KFP89564.1|  Origin recognition complex subunit 4                    149   2e-36    
ref|XP_007422696.1|  PREDICTED: origin recognition complex subuni...    148   2e-36    
ref|XP_005671663.1|  PREDICTED: origin recognition complex subuni...    147   2e-36    
ref|XP_007494195.1|  PREDICTED: origin recognition complex subuni...    147   2e-36    
ref|XP_004032675.1|  PREDICTED: origin recognition complex subuni...    147   3e-36    
ref|XP_008516909.1|  PREDICTED: origin recognition complex subuni...    147   3e-36    
ref|XP_008823398.1|  PREDICTED: origin recognition complex subuni...    147   3e-36    
gb|EIE75394.1|  hypothetical protein RO3G_00098                         148   3e-36    
ref|XP_003478636.1|  PREDICTED: origin recognition complex subunit 4    148   3e-36    
ref|XP_007494194.1|  PREDICTED: origin recognition complex subuni...    147   4e-36    
ref|NP_001177810.1|  origin recognition complex subunit 4 isoform 2     146   5e-36    
ref|XP_308701.2|  AGAP007063-PA                                         148   5e-36    
ref|XP_003267678.1|  PREDICTED: origin recognition complex subuni...    146   6e-36    
gb|EFN62895.1|  Origin recognition complex subunit 4                    148   6e-36    
gb|AAH16177.1|  Unknown (protein for IMAGE:3906697)                     146   6e-36    
ref|XP_003267677.1|  PREDICTED: origin recognition complex subuni...    146   6e-36    
ref|XP_006935335.1|  PREDICTED: origin recognition complex subuni...    146   6e-36    
ref|XP_006834620.1|  PREDICTED: origin recognition complex subuni...    146   7e-36    
ref|XP_002062956.1|  GK21644                                            148   7e-36    
ref|NP_001177811.1|  origin recognition complex subunit 4 isoform 3     146   8e-36    
ref|XP_009584678.1|  PREDICTED: origin recognition complex subunit 4    145   8e-36    
gb|EAX11559.1|  origin recognition complex, subunit 4-like (yeast...    146   9e-36    
ref|XP_005859345.1|  PREDICTED: origin recognition complex subuni...    145   9e-36    
ref|XP_002083036.1|  GD24914                                            148   1e-35    
ref|XP_006753654.1|  PREDICTED: origin recognition complex subuni...    145   1e-35    
ref|XP_010619272.1|  PREDICTED: origin recognition complex subuni...    145   1e-35    
ref|XP_008058065.1|  PREDICTED: origin recognition complex subuni...    145   1e-35    
ref|XP_008694112.1|  PREDICTED: origin recognition complex subuni...    145   2e-35    
ref|XP_010353216.1|  PREDICTED: origin recognition complex subuni...    145   2e-35    
ref|XP_002798915.1|  PREDICTED: origin recognition complex subuni...    144   2e-35    
ref|XP_004066435.1|  PREDICTED: origin recognition complex subuni...    145   2e-35    
ref|XP_009675625.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    145   3e-35    
ref|XP_001159132.2|  PREDICTED: origin recognition complex subuni...    144   4e-35    
ref|XP_009283557.1|  PREDICTED: origin recognition complex subuni...    144   4e-35    
ref|XP_003082001.1|  origin recognition complex, subunit 4-like (...    147   4e-35    
ref|XP_007663799.1|  PREDICTED: origin recognition complex subuni...    144   4e-35    
ref|XP_003309304.1|  PREDICTED: origin recognition complex subuni...    144   4e-35    
ref|XP_009766225.1|  PREDICTED: uncharacterized protein LOC104217629    135   4e-35    
dbj|BAH12887.1|  unnamed protein product                                144   5e-35    
gb|EFZ21642.1|  hypothetical protein SINV_09824                         145   5e-35    
ref|XP_009046136.1|  hypothetical protein LOTGIDRAFT_171698             142   7e-35    
gb|EPQ03381.1|  Origin recognition complex subunit 4                    145   9e-35    
ref|XP_010328650.1|  PREDICTED: origin recognition complex subuni...    142   1e-34    
gb|EHJ73291.1|  origin recognition complex subunit 4                    144   1e-34    
gb|KFP43725.1|  Origin recognition complex subunit 4                    142   1e-34    
emb|CEG66092.1|  hypothetical protein RMATCC62417_02736                 142   2e-34    
ref|XP_008557964.1|  PREDICTED: origin recognition complex subunit 4    144   2e-34    
ref|XP_005415778.1|  PREDICTED: origin recognition complex subunit 4    143   3e-34    
emb|CEF99646.1|  P-loop containing nucleoside triphosphate hydrolase    145   4e-34    
ref|XP_008997173.1|  PREDICTED: origin recognition complex subunit 4    140   6e-34    
gb|ETN66574.1|  origin recognition complex subunit 4                    142   8e-34    
ref|XP_001943001.1|  PREDICTED: origin recognition complex subunit 4    140   1e-33    
ref|NP_595825.1|  origin recognition complex subunit Orc4               145   1e-33    
ref|XP_009974012.1|  PREDICTED: origin recognition complex subuni...    141   1e-33    
ref|XP_007894546.1|  PREDICTED: origin recognition complex subuni...    139   4e-33    
ref|XP_010122388.1|  PREDICTED: origin recognition complex subunit 4    138   4e-33    
ref|XP_002173600.1|  origin recognition complex subunit Orc4            143   4e-33    
ref|XP_009974013.1|  PREDICTED: origin recognition complex subuni...    139   6e-33    
ref|XP_005920012.1|  PREDICTED: origin recognition complex subuni...    137   7e-33    
ref|XP_005846200.1|  hypothetical protein CHLNCDRAFT_136232             142   7e-33    
ref|XP_004563386.1|  PREDICTED: origin recognition complex subuni...    138   1e-32    
ref|XP_009974014.1|  PREDICTED: origin recognition complex subuni...    137   2e-32    
ref|XP_002407057.1|  origin recognition complex subunit, putative       135   3e-32    
gb|KFM66073.1|  Origin recognition complex subunit 4                    137   3e-32    
ref|XP_009317227.1|  PREDICTED: origin recognition complex subuni...    136   3e-32    
ref|XP_002116609.1|  hypothetical protein TRIADDRAFT_31116              136   4e-32    
ref|XP_003747820.1|  PREDICTED: origin recognition complex subuni...    135   1e-31    
ref|XP_008169650.1|  PREDICTED: origin recognition complex subuni...    134   1e-31    
ref|XP_010204885.1|  PREDICTED: origin recognition complex subunit 4    132   5e-31    
ref|XP_005390850.1|  PREDICTED: origin recognition complex subuni...    132   7e-31    
ref|XP_005049742.1|  PREDICTED: origin recognition complex subuni...    131   9e-31    
ref|XP_005390848.1|  PREDICTED: origin recognition complex subuni...    132   1e-30    
gb|ADD10140.1|  origin recognition complex subunit 4                    132   1e-30    
ref|XP_003726846.1|  PREDICTED: origin recognition complex subuni...    130   2e-30    
dbj|BAH11910.1|  unnamed protein product                                130   2e-30    
gb|EZA59679.1|  Origin recognition complex subunit                      130   5e-30    
gb|KFV43982.1|  Origin recognition complex subunit 4                    129   9e-30    
gb|EHH21366.1|  hypothetical protein EGK_04409                          129   2e-29    
ref|XP_009490929.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    128   2e-29    
gb|ACO09133.1|  Origin recognition complex subunit 4                    127   2e-29    
ref|XP_006135737.1|  PREDICTED: origin recognition complex subuni...    127   3e-29    
gb|ESZ92933.1|  hypothetical protein SBOR_6706                          131   3e-29    
ref|XP_004330150.1|  PREDICTED: origin recognition complex subuni...    124   6e-29    
ref|XP_010176023.1|  PREDICTED: origin recognition complex subunit 4    124   7e-29    
ref|XP_004999136.1|  hypothetical protein PTSG_00592                    129   8e-29    
ref|XP_009460087.1|  PREDICTED: origin recognition complex subunit 4    127   9e-29    
ref|XP_006005571.1|  PREDICTED: origin recognition complex subuni...    124   1e-28    
gb|ERE71839.1|  origin recognition complex subunit 4                    125   1e-28    
gb|EPX74497.1|  origin recognition complex subunit Orc4                 128   3e-28    
ref|XP_008572808.1|  PREDICTED: origin recognition complex subuni...    125   3e-28    
emb|CCD79696.1|  putative origin recognition complex subunit            125   4e-28    
ref|XP_009502277.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    122   6e-28    
ref|XP_010015650.1|  PREDICTED: LOW QUALITY PROTEIN: origin recog...    121   8e-28    
gb|KFQ52191.1|  Origin recognition complex subunit 4                    120   1e-27    
gb|KGL80350.1|  Origin recognition complex subunit 4                    119   1e-27    
ref|XP_006961533.1|  predicted protein                                  125   1e-27    
gb|KGB34649.1|  Origin recognition complex subunit 4                    123   1e-27    
gb|AIC59140.1|  ORC4                                                    120   1e-27    
emb|CCD52932.1|  hypothetical protein BofuT4_P138560.1                  125   2e-27    
ref|XP_005346447.1|  PREDICTED: origin recognition complex subuni...    122   2e-27    
ref|XP_004933344.1|  PREDICTED: origin recognition complex subuni...    123   2e-27    
gb|EMR85685.1|  putative origin recognition complex subunit protein     125   2e-27    
gb|EHK48172.1|  hypothetical protein TRIATDRAFT_172772                  124   2e-27    
ref|XP_001589293.1|  hypothetical protein SS1G_09927                    125   2e-27    
ref|XP_010217413.1|  PREDICTED: origin recognition complex subunit 4    120   2e-27    
ref|XP_004337859.1|  origin recognition complex subunit                 122   3e-27    
gb|EMT28169.1|  hypothetical protein F775_05425                         119   3e-27    
ref|XP_009696723.1|  PREDICTED: origin recognition complex subunit 4    118   1e-26    
dbj|BAC25339.1|  unnamed protein product                                118   1e-26    
ref|XP_006498130.1|  PREDICTED: origin recognition complex subuni...    118   1e-26    
ref|XP_011109328.1|  hypothetical protein H072_3348                     123   1e-26    
gb|EDL26872.1|  origin recognition complex, subunit 4-like (S. ce...    117   2e-26    
gb|EDL26873.1|  origin recognition complex, subunit 4-like (S. ce...    117   2e-26    
gb|AAX93051.1|  unknown                                                 117   2e-26    
ref|XP_002379414.1|  origin recognition complex subunit  Orc4, pu...    121   3e-26    
ref|XP_011128021.1|  hypothetical protein AOL_s00215g517                122   3e-26    
emb|CCU75956.1|  origin recognition complex subunit Orc4,putative       122   3e-26    
dbj|BAE59968.1|  unnamed protein product                                121   4e-26    
gb|EIT78085.1|  origin recognition complex, subunit 4                   121   5e-26    
ref|XP_003714457.1|  origin recognition complex subunit 4               121   5e-26    
ref|XP_007289644.1|  PHD-finger domain-containing protein               120   8e-26    
gb|EMT60581.1|  Origin recognition complex subunit 4                    121   8e-26    
gb|EXM00142.1|  origin recognition complex subunit 4                    120   1e-25    
emb|CCT63911.1|  related to origin recognition complex subunit 4        120   1e-25    
gb|EPQ65389.1|  Subunit of the origin recognition complex               120   1e-25    
gb|EXK92708.1|  origin recognition complex subunit 4                    119   1e-25    
gb|EXA48262.1|  origin recognition complex subunit 4                    119   1e-25    
gb|EWY96694.1|  origin recognition complex subunit 4                    119   1e-25    
gb|EGU85680.1|  hypothetical protein FOXB_03826                         119   2e-25    
gb|EXK32116.1|  origin recognition complex subunit 4                    119   2e-25    
gb|ELQ45053.1|  origin recognition complex subunit 4                    119   2e-25    
gb|EPY54137.1|  origin recognition complex subunit Orc4                 119   2e-25    
gb|EXM29629.1|  origin recognition complex subunit 4                    119   2e-25    
gb|EMF10812.1|  hypothetical protein SEPMUDRAFT_150797                  119   2e-25    
gb|KGO64499.1|  hypothetical protein PITC_099590                        119   2e-25    
gb|EKV19100.1|  Origin recognition complex subunit Orc4, putative       119   2e-25    
ref|XP_009252338.1|  hypothetical protein FPSE_00943                    119   2e-25    
gb|KFY19505.1|  hypothetical protein V491_04397                         119   2e-25    
gb|EWG45384.1|  origin recognition complex subunit 4                    119   2e-25    
ref|XP_386407.1|  hypothetical protein FG06231.1                        119   3e-25    
emb|CCF39608.1|  origin recognition complex subunit 4                   119   3e-25    
gb|KDB17301.1|  putative origin recognition complex subunit Orc4        119   3e-25    
gb|EHK24880.1|  hypothetical protein TRIVIDRAFT_178439                  118   3e-25    
emb|CEJ87905.1|  Putative PHD-finger domain-containing protein          118   4e-25    
gb|EQK99287.1|  zinc finger domain-containing protein                   118   5e-25    
gb|KFM27936.1|  Origin recognition complex subunit 4                    114   6e-25    
ref|XP_009224570.1|  origin recognition complex subunit 4               118   6e-25    
gb|KFY24023.1|  hypothetical protein V493_05492                         117   6e-25    
gb|ELR07505.1|  hypothetical protein GMDG_02597                         117   7e-25    
ref|XP_003046488.1|  predicted protein                                  117   1e-24    
gb|EXA01429.1|  origin recognition complex subunit 4                    117   1e-24    
gb|EWZ41475.1|  origin recognition complex subunit 4                    117   1e-24    
gb|KEQ57751.1|  origin recognition complex, subunit 4                   115   1e-24    
ref|XP_001275408.1|  origin recognition complex subunit  Orc4, pu...    116   1e-24    
ref|XP_001399450.1|  origin recognition complex subunit Orc4            116   1e-24    
gb|ENH69090.1|  Origin recognition complex subunit 4                    116   1e-24    
emb|CCJ31199.1|  unnamed protein product                                116   1e-24    
ref|XP_010138560.1|  PREDICTED: origin recognition complex subunit 4    110   1e-24    
ref|XP_001821970.2|  origin recognition complex subunit Orc4            116   2e-24    
gb|KFX97545.1|  hypothetical protein V490_02734                         117   2e-24    
ref|XP_001537527.1|  predicted protein                                  116   2e-24    
emb|CCE34554.1|  related to origin recognition complex subunit 4        116   2e-24    
ref|XP_007108107.1|  PREDICTED: origin recognition complex subuni...    112   3e-24    
gb|EEH35374.2|  hypothetical protein PAAG_06421                         115   3e-24    
gb|KFY34864.1|  hypothetical protein V494_06407                         115   3e-24    
ref|XP_002542746.1|  predicted protein                                  115   3e-24    
ref|XP_002791682.1|  conserved hypothetical protein                     115   3e-24    
gb|KFY93864.1|  hypothetical protein V498_04201                         115   3e-24    
ref|XP_010800285.1|  PREDICTED: origin recognition complex subuni...    112   3e-24    
gb|KIE02277.1|  Zinc finger, FYVE/PHD-type                              115   3e-24    
gb|EPS28142.1|  hypothetical protein PDE_03088                          115   3e-24    



>ref|XP_006344196.1| PREDICTED: origin recognition complex subunit 4-like [Solanum 
tuberosum]
Length=419

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/366 (80%), Positives = 336/366 (92%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS LLLGPRGCGK A+LE+V++ LL+E+PD I VIKLNGLLHS+DNCALKEI RQLC
Sbjct  50    ACNNSALLLGPRGCGKVAILEMVIKDLLQEYPDTICVIKLNGLLHSEDNCALKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              E+QLVFSKMASFDDNSQF+IAMLRECGLAHKT+IFVLDEFDLFTQGKQRLLYSLLDAMQ
Sbjct  110   IENQLVFSKMASFDDNSQFVIAMLRECGLAHKTIIFVLDEFDLFTQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+GVSCRLDADQLLEKRVRSRFSHRKL+FLPPS+EDL++IL+H LLLP +  L
Sbjct  170   SVTSQAVVVGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSREDLQKILQHALLLPTESSL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P +YV A+N KLL+ LSDDKFKDI++SLC +D+TFNHLLRFLF++VC MD K+GFLSLDN
Sbjct  230   PPQYVAAYNKKLLNTLSDDKFKDIIDSLCNFDATFNHLLRFLFTSVCHMDTKAGFLSLDN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALS+ QRQPKLE L+DCSILELYILVCLRRLE  EQET NFNS+MKEYK VH+SF+T
Sbjct  290   FKTALSSIQRQPKLEALQDCSILELYILVCLRRLEGKEQETTNFNSVMKEYKDVHNSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             +DYYAR+VCLRAFEHLLQR+LIS V+NRGH+QS+EFRPV+LLIS HEL QGL+++  CP 
Sbjct  350   TDYYARNVCLRAFEHLLQRQLISLVDNRGHSQSVEFRPVRLLISSHELHQGLRAYRSCPA  409

Query  1081  ILHKLI  1098
             ILHKL+
Sbjct  410   ILHKLL  415



>ref|XP_004238875.1| PREDICTED: origin recognition complex subunit 4 [Solanum lycopersicum]
Length=419

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/366 (80%), Positives = 334/366 (91%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS LLLGPRGCGK A+LE+V++ LL+E+PD I VIKLNGLLHS+DNCALKEI RQLC
Sbjct  50    ACNNSALLLGPRGCGKVAILEMVIKDLLQEYPDTICVIKLNGLLHSEDNCALKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              E+QLVFSKMASFDDNSQF+IAMLRECGLAHKT+IFVLDEFDLFTQGKQRLLYSLLDAMQ
Sbjct  110   IENQLVFSKMASFDDNSQFVIAMLRECGLAHKTIIFVLDEFDLFTQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+GVSCRLDADQLLEKRVRSRFSHRKL+FLPPS+EDL++IL+H LLLP +  L
Sbjct  170   SVTSQAVVVGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSQEDLQKILQHALLLPTESSL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
               +YV A+N KLL+ LSDDKFKDI++SLC +D+TFNHLLRFLF++V  MD KSGFLSLDN
Sbjct  230   SPQYVAAYNKKLLNTLSDDKFKDIIDSLCNFDATFNHLLRFLFASVSHMDTKSGFLSLDN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+T+LS+ QRQPKLE L+DC+ILELYILVCLRRLE  EQET NFNS+MKEYK VH+SF+T
Sbjct  290   FKTSLSSIQRQPKLEALQDCTILELYILVCLRRLEGKEQETTNFNSVMKEYKDVHNSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR+VCLRAFEHLLQR+LIS V+NRGH+QS+EFRPV+LLIS HEL QGLK++  CP 
Sbjct  350   SDYYARNVCLRAFEHLLQRQLISLVDNRGHSQSLEFRPVKLLISSHELHQGLKAYRSCPA  409

Query  1081  ILHKLI  1098
             ILHKL+
Sbjct  410   ILHKLL  415



>ref|XP_009615037.1| PREDICTED: origin recognition complex subunit 4 [Nicotiana tomentosiformis]
Length=513

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/360 (82%), Positives = 327/360 (91%), Gaps = 0/360 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK  +LELV++ LL+E+PD I VIKLNGLLHSDDNCALKEI RQLC
Sbjct  50    ACNNSVLLLGPRGCGKVPILELVIKDLLQEYPDTICVIKLNGLLHSDDNCALKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFDDNSQF+++MLRECGLAHKT+IFVLDEFDLFTQGKQRLLYSLLDAMQ
Sbjct  110   MEHHLMFSKMASFDDNSQFVLSMLRECGLAHKTIIFVLDEFDLFTQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+FLPPS+EDL++IL++ LLLP +  L
Sbjct  170   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSQEDLQKILQYALLLPTESEL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P +YV A+NTKLL+ LSDDKFKDI+ SLC  DST NHLLRFLF+AVC MD KSGFLSLDN
Sbjct  230   PPQYVTAYNTKLLNTLSDDKFKDIITSLCDSDSTLNHLLRFLFAAVCHMDAKSGFLSLDN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALS+ QRQPKLE LKDCSILELYILVCLRRLE  EQET NFNS+MKEYK VHDSF+T
Sbjct  290   FKTALSSIQRQPKLEALKDCSILELYILVCLRRLEVKEQETTNFNSVMKEYKSVHDSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR+VCLRAFEHLLQR+LIS V+NRGH QS+EFRPV+LLIS +EL QGLKS+  CPV
Sbjct  350   SDYYARNVCLRAFEHLLQRQLISLVDNRGHGQSVEFRPVRLLISSYELHQGLKSYRSCPV  409



>ref|XP_009766229.1| PREDICTED: origin recognition complex subunit 4-like [Nicotiana 
sylvestris]
Length=487

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/360 (81%), Positives = 327/360 (91%), Gaps = 0/360 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK  +LELV++ LL+E+PDMI V+KLNGLLHSDDNCALKEI RQLC
Sbjct  50    ACNNSVLLLGPRGCGKVPILELVIKDLLQEYPDMICVVKLNGLLHSDDNCALKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFDDNSQF+++MLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ
Sbjct  110   MEHHLMFSKMASFDDNSQFVLSMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+FLPPS+EDL++IL+H LLLP +  L
Sbjct  170   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSQEDLQKILQHALLLPTESEL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P++YV  +NTKLL+ LSDDKFKDI+ SLC  DST NHLLRFLF+AVC MD K GFLSL+N
Sbjct  230   PSQYVATYNTKLLNTLSDDKFKDIITSLCECDSTLNHLLRFLFAAVCHMDTKPGFLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALS+ QRQPKLE LKDCSILELYILVCLRRLE  EQET NFNS+MKEYK VHDSF+T
Sbjct  290   FKTALSSIQRQPKLEALKDCSILELYILVCLRRLEVKEQETTNFNSLMKEYKSVHDSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR+VCLRAFEHLLQR+LIS V+NRGH QS+EFRPV+LLIS +EL QGLKS+  CPV
Sbjct  350   SDYYARNVCLRAFEHLLQRQLISLVDNRGHGQSVEFRPVRLLISSYELHQGLKSYRSCPV  409



>emb|CDP00706.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/366 (79%), Positives = 326/366 (89%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +CNNSVLLLGPRGCGK AVLELVLE LL+EFPDMISVIKLNGLLHSDDNCALKEI RQLC
Sbjct  50    SCNNSVLLLGPRGCGKLAVLELVLEDLLREFPDMISVIKLNGLLHSDDNCALKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL FSKMAS D+NSQFLIAMLRECGLAHKTV+FVLDEFDLF QGKQRLLYSLLDAMQ
Sbjct  110   LEHQLAFSKMASSDENSQFLIAMLRECGLAHKTVLFVLDEFDLFAQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+FLPPS+EDL+R+L+H LLLP    L
Sbjct  170   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSREDLQRLLEHALLLPSGSDL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P ++V  FN+ LL+I +D KFKDI++++   DSTF  +L FLFSA+C +D+K GFLS++N
Sbjct  230   PHEFVANFNSNLLNIFADKKFKDIMDTVFNTDSTFKQVLTFLFSALCHLDLKCGFLSVEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALSN QRQPKLECLKDCSILELYILVC++RLE  E ETCNFNSIMKEYK +HDSF+T
Sbjct  290   FKDALSNIQRQPKLECLKDCSILELYILVCMKRLEVREHETCNFNSIMKEYKSIHDSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             +DYYARDVC RAFEHLLQRELISF++NRGH  SIEFRPV+LLIS  EL QGLKS+G CP 
Sbjct  350   TDYYARDVCRRAFEHLLQRELISFLDNRGHGHSIEFRPVKLLISWQELYQGLKSYGSCPA  409

Query  1081  ILHKLI  1098
             IL+KL+
Sbjct  410   ILYKLV  415



>ref|XP_011070733.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Sesamum 
indicum]
Length=419

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/366 (77%), Positives = 324/366 (89%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AVLE+VLE LLKE PDMISVI+LNGLLH D+NCALKEI RQLC
Sbjct  50    ACNNSVLLLGPRGCGKVAVLEIVLEELLKEHPDMISVIRLNGLLHCDNNCALKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMAS+DDNSQFL++MLRECGLAHKT++FVLDEFDLFTQGKQRLLYSLLDAMQ
Sbjct  110   LEHHLMFSKMASYDDNSQFLLSMLRECGLAHKTIVFVLDEFDLFTQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVV+GVSCRLDADQLLEKRVRSRFSHRKL+FLPPS+ED +R+++HILLLP D  L
Sbjct  170   SITSQAVVVGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSREDCQRLVEHILLLPTDSSL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y  AFN KLL+IL+D+KFK I+++LC  DS+  HLLRFLFSA+C MDM SGFLS+ N
Sbjct  230   PNDYTAAFNAKLLNILADEKFKGIIDTLCYSDSSVGHLLRFLFSAICHMDMNSGFLSVKN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F++AL + QRQPKLE LKDCS+LELYILVC++RLE  E E CNFNSIMKEYK +HD+F+T
Sbjct  290   FKSALRSMQRQPKLEALKDCSVLELYILVCMKRLEVKELELCNFNSIMKEYKSIHDTFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR+VCLRAFEHLL+R LISF +N+GH QS EFRPV+L+IS HEL QGLKS   CP 
Sbjct  350   SDYYARNVCLRAFEHLLERALISFEDNKGHGQSAEFRPVKLVISWHELHQGLKSHRSCPA  409

Query  1081  ILHKLI  1098
             ILHKL+
Sbjct  410   ILHKLM  415



>ref|XP_010661643.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Vitis 
vinifera]
Length=418

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/366 (77%), Positives = 321/366 (88%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELV+  LL E  DMISVI+LNGLLHSDDNCA+KEI RQLC
Sbjct  51    ACNNSILLLGPRGSGKTAVLELVIRDLLAEHADMISVIRLNGLLHSDDNCAVKEIARQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMASFDDNSQF+IAMLRECGLAHKT+IFVLDEFD FTQGKQRLLYSLLDAMQ
Sbjct  111   VEHQLLFSKMASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDFFTQGKQRLLYSLLDAMQ  170

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRK++FLPPSKEDL+R+L+HI  LP D  L
Sbjct  171   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKVLFLPPSKEDLQRLLEHIFSLPVDTSL  230

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN KL  IL+D++FK+I+ +L   DST  HLLRFLF AVC MD++SGFLSLDN
Sbjct  231   PNDYAVEFNMKLHHILADERFKEIINTLLNSDSTVKHLLRFLFYAVCHMDLESGFLSLDN  290

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             FRTA+S+ QRQPK+E L+DCSILELYILVC++RLE  EQ + NFNS+MKEYK +HD+++T
Sbjct  291   FRTAMSSIQRQPKMEYLQDCSILELYILVCMKRLEVKEQNSYNFNSVMKEYKGIHDAYQT  350

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR+VCLRAFEHL+QRELI F++NRG+NQSIEFR V+LLIS HEL QGLKS+  CPV
Sbjct  351   SDYYARNVCLRAFEHLVQRELICFMDNRGNNQSIEFRAVKLLISSHELYQGLKSYRSCPV  410

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  411   ILRKLV  416



>gb|EYU30029.1| hypothetical protein MIMGU_mgv1a007096mg [Erythranthe guttata]
Length=419

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/366 (77%), Positives = 324/366 (89%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AVLE+VLE LLKE P MISVIKLNGLLHSD+NCALKEI RQLC
Sbjct  50    ACNNSVLLLGPRGCGKIAVLEIVLEELLKEHPAMISVIKLNGLLHSDNNCALKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMASFDDNSQFL++MLRECGLAHKT++FVL+EFDLFTQGKQRLLYSLLDAMQ
Sbjct  110   LEHQLLFSKMASFDDNSQFLLSMLRECGLAHKTIVFVLEEFDLFTQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+GVSCRLDADQLLEKRVRSRFSHRKL+FLPPS +DL+R+++HILLLP D GL
Sbjct  170   SVTSQAVVVGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSGQDLKRLVEHILLLPADSGL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P +Y+ AFN+KLL+IL+D+KF  I ++LC  DST +HL +FLFSAVC MD+ S  LSL+N
Sbjct  230   PNEYIAAFNSKLLNILADEKFNAITDTLCYSDSTVSHLSKFLFSAVCHMDLNSDSLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F++AL + QRQPKLE LKDCS LELYILVC++RLE  E E CNF+SIMKEYK +HD+F+T
Sbjct  290   FKSALPSIQRQPKLEALKDCSTLELYILVCMKRLEVKELEMCNFSSIMKEYKSIHDTFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR+VCLRAFEHLL+R LISF +NRG  +S EFRPV+LLIS HEL QGLKS   CP 
Sbjct  350   SDYYARNVCLRAFEHLLERSLISFEDNRGQGRSTEFRPVKLLISGHELHQGLKSHSSCPA  409

Query  1081  ILHKLI  1098
             +LHKL+
Sbjct  410   MLHKLM  415



>ref|XP_010661594.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Vitis 
vinifera]
Length=419

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/367 (77%), Positives = 321/367 (87%), Gaps = 1/367 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELV+  LL E  DMISVI+LNGLLHSDDNCA+KEI RQLC
Sbjct  51    ACNNSILLLGPRGSGKTAVLELVIRDLLAEHADMISVIRLNGLLHSDDNCAVKEIARQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMASFDDNSQF+IAMLRECGLAHKT+IFVLDEFD FTQGKQRLLYSLLDAMQ
Sbjct  111   VEHQLLFSKMASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDFFTQGKQRLLYSLLDAMQ  170

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRK++FLPPSKEDL+R+L+HI  LP D  L
Sbjct  171   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKVLFLPPSKEDLQRLLEHIFSLPVDTSL  230

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN KL  IL+D++FK+I+ +L   DST  HLLRFLF AVC MD++SGFLSLDN
Sbjct  231   PNDYAVEFNMKLHHILADERFKEIINTLLNSDSTVKHLLRFLFYAVCHMDLESGFLSLDN  290

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMK-EYKIVHDSFK  897
             FRTA+S+ QRQPK+E L+DCSILELYILVC++RLE  EQ + NFNS+MK EYK +HD+++
Sbjct  291   FRTAMSSIQRQPKMEYLQDCSILELYILVCMKRLEVKEQNSYNFNSVMKAEYKGIHDAYQ  350

Query  898   TSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCP  1077
             TSDYYAR+VCLRAFEHL+QRELI F++NRG+NQSIEFR V+LLIS HEL QGLKS+  CP
Sbjct  351   TSDYYARNVCLRAFEHLVQRELICFMDNRGNNQSIEFRAVKLLISSHELYQGLKSYRSCP  410

Query  1078  VILHKLI  1098
             VIL KL+
Sbjct  411   VILRKLV  417



>gb|KDO64778.1| hypothetical protein CISIN_1g014789mg [Citrus sinensis]
Length=418

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/366 (77%), Positives = 319/366 (87%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLEL+L  LL E+PD ISVIKLNGLLHSDD CA KEI RQLC
Sbjct  51    ACNNSILLLGPRGSGKIAVLELILTDLLLEYPDTISVIKLNGLLHSDDCCAFKEIARQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMASFDDNSQF+I MLRECGLAHKT+IFVLDEFDLF QGKQRLLYSLLDAMQ
Sbjct  111   MEHQLLFSKMASFDDNSQFMIEMLRECGLAHKTIIFVLDEFDLFAQGKQRLLYSLLDAMQ  170

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+FLPPSKED++R+L+HIL LP D  L
Sbjct  171   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSKEDMQRLLEHILSLPVDSSL  230

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN K+ +IL+D +FK+IV +L   DST NHLLRFLF AV  MD++SGFLS +N
Sbjct  231   PHAYAVEFNKKIKNILADGRFKEIVNTLVNLDSTVNHLLRFLFLAVSYMDLESGFLSFEN  290

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALSN+ RQPKLEC+KDCSILELYILVCL+RLE  EQ + NFNS+MKEYK +HDSF+T
Sbjct  291   FKTALSNSHRQPKLECIKDCSILELYILVCLKRLEVKEQNSYNFNSVMKEYKSIHDSFQT  350

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYY+R+VCLRAFEHLLQRELI F +NRG++QS+EFRPV+LLIS  EL QGLKS+  CPV
Sbjct  351   SDYYSRNVCLRAFEHLLQRELICFTDNRGYSQSVEFRPVKLLISSIELHQGLKSYCSCPV  410

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  411   ILLKLV  416



>ref|XP_006468787.1| PREDICTED: origin recognition complex subunit 4-like isoform 
X1 [Citrus sinensis]
Length=418

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/366 (77%), Positives = 319/366 (87%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLEL+L  LL E+PD ISVIKLNGLLHSDD CA KEI RQLC
Sbjct  51    ACNNSILLLGPRGSGKIAVLELILTDLLLEYPDTISVIKLNGLLHSDDCCAFKEIARQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMASFDDNSQF+I MLRECGLAHKT+IFVLDEFDLF QGKQRLLYSLLDAMQ
Sbjct  111   MEHQLLFSKMASFDDNSQFMIEMLRECGLAHKTIIFVLDEFDLFAQGKQRLLYSLLDAMQ  170

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+FLPPSKED++R+L+HIL LP D  L
Sbjct  171   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSKEDMQRLLEHILSLPVDSSL  230

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN K+ +IL+D +FK+IV +L   DST NHLLRFLF AV  MD++SGFLS +N
Sbjct  231   PHAYAVEFNKKIKNILADGRFKEIVNTLVNLDSTVNHLLRFLFLAVSYMDLESGFLSFEN  290

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALSN+ RQPKLEC+KDCSILELYILVC++RLE  EQ + NFNS+MKEYK +HDSF+T
Sbjct  291   FKTALSNSHRQPKLECIKDCSILELYILVCMKRLEVKEQNSYNFNSVMKEYKSIHDSFQT  350

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYY+R+VCLRAFEHLLQRELI F +NRG++QS+EFRPV+LLIS  EL QGLKS+  CPV
Sbjct  351   SDYYSRNVCLRAFEHLLQRELICFTDNRGYSQSVEFRPVKLLISSIELHQGLKSYCSCPV  410

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  411   ILLKLV  416



>ref|XP_006468788.1| PREDICTED: origin recognition complex subunit 4-like isoform 
X2 [Citrus sinensis]
Length=410

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/366 (77%), Positives = 319/366 (87%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLEL+L  LL E+PD ISVIKLNGLLHSDD CA KEI RQLC
Sbjct  43    ACNNSILLLGPRGSGKIAVLELILTDLLLEYPDTISVIKLNGLLHSDDCCAFKEIARQLC  102

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMASFDDNSQF+I MLRECGLAHKT+IFVLDEFDLF QGKQRLLYSLLDAMQ
Sbjct  103   MEHQLLFSKMASFDDNSQFMIEMLRECGLAHKTIIFVLDEFDLFAQGKQRLLYSLLDAMQ  162

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+FLPPSKED++R+L+HIL LP D  L
Sbjct  163   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSKEDMQRLLEHILSLPVDSSL  222

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN K+ +IL+D +FK+IV +L   DST NHLLRFLF AV  MD++SGFLS +N
Sbjct  223   PHAYAVEFNKKIKNILADGRFKEIVNTLVNLDSTVNHLLRFLFLAVSYMDLESGFLSFEN  282

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALSN+ RQPKLEC+KDCSILELYILVC++RLE  EQ + NFNS+MKEYK +HDSF+T
Sbjct  283   FKTALSNSHRQPKLECIKDCSILELYILVCMKRLEVKEQNSYNFNSVMKEYKSIHDSFQT  342

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYY+R+VCLRAFEHLLQRELI F +NRG++QS+EFRPV+LLIS  EL QGLKS+  CPV
Sbjct  343   SDYYSRNVCLRAFEHLLQRELICFTDNRGYSQSVEFRPVKLLISSIELHQGLKSYCSCPV  402

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  403   ILLKLV  408



>ref|XP_008339604.1| PREDICTED: origin recognition complex subunit 4 [Malus domestica]
Length=419

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/366 (75%), Positives = 316/366 (86%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL  LL+EFPDMISVI+L+GLLHS DNCA KEI RQLC
Sbjct  50    ACNNSILLLGPRGSGKIAVLELVLSDLLQEFPDMISVIRLSGLLHSSDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQLVFS+MASFDDNSQF+IAMLRECGLAHKT+IFVLDEFDLF  GKQRLLYSLLDAMQ
Sbjct  110   VEHQLVFSRMASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDLFALGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVS RLDAD LL+KRVRSRFSHRKL+FLPP+ ED++R+L+HILLLP D   
Sbjct  170   SVTSQAVVIGVSSRLDADMLLDKRVRSRFSHRKLLFLPPAYEDIQRLLEHILLLPTDSSF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  YV AFN KL +IL+D++FK+I+ +    DST  HLLR+LF AV  MD++SG LSL+N
Sbjct  230   PPDYVIAFNAKLQTILADERFKEIINTYLNLDSTVKHLLRYLFRAVSDMDLESGMLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALSN QR PKLEC+KDCS+LELYILVC++RLE  EQ + NFN++MKEYK +HDS KT
Sbjct  290   FKTALSNIQRHPKLECIKDCSVLELYILVCMKRLEVKEQNSYNFNAVMKEYKSIHDSVKT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             +DY+AR+VCLRAFEHLLQRELI F +NRG NQSIEF PV+LLIS HEL QG+KS+G CP 
Sbjct  350   ADYFARNVCLRAFEHLLQRELIGFADNRGQNQSIEFSPVKLLISSHELHQGMKSYGSCPA  409

Query  1081  ILHKLI  1098
             IL +L+
Sbjct  410   ILQQLM  415



>ref|XP_006448332.1| hypothetical protein CICLE_v10015376mg [Citrus clementina]
 gb|ESR61572.1| hypothetical protein CICLE_v10015376mg [Citrus clementina]
Length=419

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/367 (77%), Positives = 319/367 (87%), Gaps = 1/367 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLEL+L  LL E+PD ISVIKLNGLLHSDD CA KEI RQLC
Sbjct  51    ACNNSILLLGPRGSGKIAVLELILTDLLLEYPDTISVIKLNGLLHSDDCCAFKEIARQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMASFDDNSQF+I MLRECGLAHKT+IFVLDEFDLF QGKQRLLYSLLDAMQ
Sbjct  111   MEHQLLFSKMASFDDNSQFMIEMLRECGLAHKTIIFVLDEFDLFAQGKQRLLYSLLDAMQ  170

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+FLPPSKED++R+L+HIL LP D  L
Sbjct  171   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSKEDMQRLLEHILSLPVDSSL  230

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN K+ +IL+D +FK+IV +L   DST NHLLRFLF AV  MD++SGFLS +N
Sbjct  231   PHAYAVEFNKKIKNILADGRFKEIVNTLVNLDSTVNHLLRFLFLAVSYMDLESGFLSFEN  290

Query  721   FRTALSNTQRQPKLECLK-DCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFK  897
             F+TALSN+ RQPKLEC+K DCSILELYILVC++RLE  EQ + NFNS+MKEYK +HDSF+
Sbjct  291   FKTALSNSHRQPKLECIKADCSILELYILVCMKRLEVKEQNSYNFNSVMKEYKSIHDSFQ  350

Query  898   TSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCP  1077
             TSDYY+R+VCLRAFEHLLQRELI F +NRG++QS+EFRPV+LLIS  EL QGLKS+  CP
Sbjct  351   TSDYYSRNVCLRAFEHLLQRELICFTDNRGYSQSVEFRPVKLLISSIELHQGLKSYCSCP  410

Query  1078  VILHKLI  1098
             VIL KL+
Sbjct  411   VILLKLV  417



>ref|XP_009357467.1| PREDICTED: origin recognition complex subunit 4 [Pyrus x bretschneideri]
Length=419

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/366 (74%), Positives = 315/366 (86%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL  LL++FPDMISVI+L+GLLHS DNCA KEI RQLC
Sbjct  50    ACNNSILLLGPRGSGKIAVLELVLSDLLQDFPDMISVIRLSGLLHSSDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQLVFS+MASFDDNSQF+IAMLRECGLAHKT+IFVLDEFDLF  GKQRLLYSLLDAMQ
Sbjct  110   VEHQLVFSRMASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDLFALGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVS RLDAD LL+KRVRSRFSHRKL+FLPP+ ED++R+L+HILLLP D   
Sbjct  170   SVTSQAVVIGVSSRLDADMLLDKRVRSRFSHRKLLFLPPAYEDIQRLLEHILLLPTDSSF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y  AFN KL +IL+D++FK+I+ +    DST  HLLR+LF AV  MD++SG LSL+N
Sbjct  230   PPDYAIAFNAKLQTILADERFKEIINTYLNLDSTVKHLLRYLFRAVSDMDLESGMLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALSN QR PKLEC+KDCS+LELYILVC++RLE  EQ + NFN++MKEYK +HDS KT
Sbjct  290   FKTALSNIQRHPKLECIKDCSVLELYILVCMKRLEVKEQNSYNFNAVMKEYKSIHDSVKT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             +DY+AR+VCLRAFEHLL+RELI F +NRG NQSIEF PV+LLIS HEL QG+KS+G CP 
Sbjct  350   ADYFARNVCLRAFEHLLRRELIGFADNRGQNQSIEFSPVKLLISSHELHQGMKSYGSCPA  409

Query  1081  ILHKLI  1098
             IL +L+
Sbjct  410   ILQQLM  415



>ref|XP_008243436.1| PREDICTED: origin recognition complex subunit 4 [Prunus mume]
Length=419

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/366 (73%), Positives = 314/366 (86%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL  LL+E+PDMISVI+L+GLLHS DNCA KEI RQLC
Sbjct  50    ACNNSILLLGPRGSGKIAVLELVLSDLLQEYPDMISVIRLSGLLHSSDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQLVFS+MASFDDNSQF+IAMLRECGLAHKT+IFVLDEFDLF  GKQ+LLYSLLDAMQ
Sbjct  110   MEHQLVFSRMASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDLFALGKQKLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDAD LL+KRVRSRFSHRKL+FLPP+ +D++R+L+HIL LP D   
Sbjct  170   SVTSQAVVIGVSCRLDADMLLDKRVRSRFSHRKLLFLPPANDDIQRLLEHILSLPTDSSF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y  AFN KL +IL+D++FK+I+ +   +DST  HLLR+LF AV  MD++SG LSL+N
Sbjct  230   PPDYAVAFNAKLQNILADERFKEIISTYLNFDSTVKHLLRYLFRAVSYMDLESGMLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALSN QR PKLEC+KDCSILELYILVC++RLE  EQ + NFNS+MKEYK +HDS KT
Sbjct  290   FKAALSNIQRHPKLECIKDCSILELYILVCMKRLEVKEQNSYNFNSVMKEYKSIHDSVKT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDY+AR+VCLRAFEHLLQRELI + +NRG N S+EF PV+LL+S HEL QGLKS+G CP 
Sbjct  350   SDYFARNVCLRAFEHLLQRELIGYTDNRGQNHSVEFSPVKLLVSFHELHQGLKSYGSCPA  409

Query  1081  ILHKLI  1098
             IL +L+
Sbjct  410   ILQQLM  415



>emb|CBI26946.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/372 (75%), Positives = 318/372 (85%), Gaps = 8/372 (2%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELV+  LL E  DMISVI+LNGLLHSDDNCA+KEI RQLC
Sbjct  51    ACNNSILLLGPRGSGKTAVLELVIRDLLAEHADMISVIRLNGLLHSDDNCAVKEIARQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQ-------GKQRLLY  339
              EHQL+FSKMASFDDNSQF+IAMLRECGLAHKT+IFVLDEFD FTQ       GKQRLLY
Sbjct  111   VEHQLLFSKMASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDFFTQARLPLSHGKQRLLY  170

Query  340   SLLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILL  519
             SLLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRK++FLPPSKEDL+R+L+HI  
Sbjct  171   SLLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKVLFLPPSKEDLQRLLEHIFS  230

Query  520   LPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKS  699
             LP D  LP  Y   FN KL  IL+D++FK+I+ +L   DST  HLLRFLF AVC MD++S
Sbjct  231   LPVDTSLPNDYAVEFNMKLHHILADERFKEIINTLLNSDSTVKHLLRFLFYAVCHMDLES  290

Query  700   GFLSLDNFRTALSNTQRQPKLECLK-DCSILELYILVCLRRLEANEQETCNFNSIMKEYK  876
             GFLSLDNFRTA+S+ QRQPK+E L+ DCSILELYILVC++RLE  EQ + NFNS+MKEYK
Sbjct  291   GFLSLDNFRTAMSSIQRQPKMEYLQADCSILELYILVCMKRLEVKEQNSYNFNSVMKEYK  350

Query  877   IVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGL  1056
              +HD+++TSDYYAR+VCLRAFEHL+QRELI F++NRG+NQSIEFR V+LLIS HEL QGL
Sbjct  351   GIHDAYQTSDYYARNVCLRAFEHLVQRELICFMDNRGNNQSIEFRAVKLLISSHELYQGL  410

Query  1057  KSWGCCPVILHK  1092
             KS+  CPV  +K
Sbjct  411   KSYRSCPVSSYK  422



>ref|XP_007227710.1| hypothetical protein PRUPE_ppa006384mg [Prunus persica]
 gb|EMJ28909.1| hypothetical protein PRUPE_ppa006384mg [Prunus persica]
Length=414

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/361 (74%), Positives = 309/361 (86%), Gaps = 1/361 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLE+VL  LL+E+PDMISVI+L+GLLH  DNCA KEI RQLC
Sbjct  50    ACNNSILLLGPRGSGKIAVLEVVLSDLLQEYPDMISVIRLSGLLHGSDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQLVFS+MASFDDNSQF+IAMLRECGLAHKT+IFVLDEFDLF  GKQ+LLYSLLDAMQ
Sbjct  110   MEHQLVFSRMASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDLFALGKQKLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDAD LL+KRVRSRFSHRKL+FLPP+ ED++R+L+HIL LP D   
Sbjct  170   SVTSQAVVIGVSCRLDADMLLDKRVRSRFSHRKLLFLPPANEDIQRLLEHILSLPTDSSF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y  AFN KL +IL+D++FK+I+ +   +DST  HLLR+LF AV  MD++SG LSL+N
Sbjct  230   PPDYAVAFNAKLQNILADERFKEIISTYLNFDSTVKHLLRYLFRAVSYMDLESGMLSLEN  289

Query  721   FRTALSNTQRQPKLECLK-DCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFK  897
             F+ ALSN QR PKLEC+K DCSILELYILVC++RLE  EQ + NFNS+MKEYK +HDS K
Sbjct  290   FKAALSNIQRHPKLECIKADCSILELYILVCMKRLEVKEQNSYNFNSVMKEYKSIHDSVK  349

Query  898   TSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCP  1077
             TSDY+AR+VCLRAFEHLLQRELI F +NRG N SIEF PV+LL+S HEL QGLKS+G CP
Sbjct  350   TSDYFARNVCLRAFEHLLQRELIGFTDNRGQNHSIEFSPVKLLVSFHELHQGLKSYGSCP  409

Query  1078  V  1080
             V
Sbjct  410   V  410



>ref|XP_011022846.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Populus 
euphratica]
Length=417

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/366 (74%), Positives = 315/366 (86%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL  LL+E+PD I+VI+LNGLLHS+DNCA KEI RQLC
Sbjct  50    ACNNSILLLGPRGSGKVAVLELVLSDLLEEYPDTITVIRLNGLLHSEDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFDDNSQF+IAMLRECGLAHKTVIF LDEFDLF QGKQRLLYSLLDAMQ
Sbjct  110   MEHHLLFSKMASFDDNSQFMIAMLRECGLAHKTVIFSLDEFDLFAQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+GVSCRLDADQLLEKRVRSRFSHRKL+FLPPSKED++R+L+HIL LP D  L
Sbjct  170   SVTSQAVVVGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSKEDVQRLLEHILSLPMDSSL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
                Y   FN KL SIL+D++FK+I+ +     ST NHLLRFLF A+  M++KSGFLSL+N
Sbjct  230   AHDYAAEFNEKLQSILADERFKEIISNYLNSYSTTNHLLRFLFIAISNMELKSGFLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPK EC+KDCSILELYILVC++RLE  EQ + NF+S+MKEYK +HDSF T
Sbjct  290   FKAALSSIQRQPKQECIKDCSILELYILVCMKRLEIREQNSYNFSSVMKEYKSIHDSFPT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLRAFEHLLQR+LI F +NRGH+QSIEFR V+L++S  ELQ+GLKS+  CP 
Sbjct  350   SDYYAQNVCLRAFEHLLQRQLICFTDNRGHSQSIEFRQVKLVVSYAELQEGLKSYRSCPA  409

Query  1081  ILHKLI  1098
             IL KLI
Sbjct  410   ILLKLI  415



>ref|XP_007028452.1| Origin recognition complex subunit 4 isoform 1 [Theobroma cacao]
 gb|EOY08954.1| Origin recognition complex subunit 4 isoform 1 [Theobroma cacao]
Length=420

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/366 (74%), Positives = 313/366 (86%), Gaps = 1/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL  LL+++P+ ISVI+LNGLLH DDNCALKEI RQLC
Sbjct  54    ACNNSILLLGPRGSGKVAVLELVLSDLLQQYPEAISVIRLNGLLHGDDNCALKEIARQLC  113

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSK+ASFDDNSQFLIAMLRECGLAHKT+IFVLDEFDLF Q KQRLLYSLLDAMQ
Sbjct  114   MEHQLLFSKVASFDDNSQFLIAMLRECGLAHKTIIFVLDEFDLFAQAKQRLLYSLLDAMQ  173

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLD DQLLEKRVRSRFSHRKL+FLPPSKED ER L+HIL LPKD  L
Sbjct  174   SVTSQAVVIGVSCRLDVDQLLEKRVRSRFSHRKLLFLPPSKEDTERFLEHILSLPKDSSL  233

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN +L ++L+D++FK+++ +  +++ST   L+RFLF AV  MD+  GFLSL+N
Sbjct  234   PHSYTVEFNGRLKNVLADERFKELINTYLSFNSTIGQLMRFLFQAVSYMDLDVGFLSLEN  293

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALS+TQRQPK EC+KDCSILELY+LVC++RLE  EQ + NFNS+M EYK +HD F+T
Sbjct  294   FKTALSSTQRQPKSECIKDCSILELYLLVCMKRLEVKEQNSYNFNSVMTEYKSIHD-FQT  352

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA +VCLRAFEHLLQRELISF +NRGHNQS+EFRPV+LLIS  EL  GLKS+  CP 
Sbjct  353   SDNYAGNVCLRAFEHLLQRELISFTDNRGHNQSVEFRPVKLLISPAELYHGLKSYRSCPA  412

Query  1081  ILHKLI  1098
             IL KLI
Sbjct  413   ILLKLI  418



>ref|XP_011022840.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Populus 
euphratica]
Length=418

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/360 (74%), Positives = 311/360 (86%), Gaps = 0/360 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL  LL+E+PD I+VI+LNGLLHS+DNCA KEI RQLC
Sbjct  50    ACNNSILLLGPRGSGKVAVLELVLSDLLEEYPDTITVIRLNGLLHSEDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFDDNSQF+IAMLRECGLAHKTVIF LDEFDLF QGKQRLLYSLLDAMQ
Sbjct  110   MEHHLLFSKMASFDDNSQFMIAMLRECGLAHKTVIFSLDEFDLFAQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+GVSCRLDADQLLEKRVRSRFSHRKL+FLPPSKED++R+L+HIL LP D  L
Sbjct  170   SVTSQAVVVGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSKEDVQRLLEHILSLPMDSSL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
                Y   FN KL SIL+D++FK+I+ +     ST NHLLRFLF A+  M++KSGFLSL+N
Sbjct  230   AHDYAAEFNEKLQSILADERFKEIISNYLNSYSTTNHLLRFLFIAISNMELKSGFLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPK EC+KDCSILELYILVC++RLE  EQ + NF+S+MKEYK +HDSF T
Sbjct  290   FKAALSSIQRQPKQECIKDCSILELYILVCMKRLEIREQNSYNFSSVMKEYKSIHDSFPT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLRAFEHLLQR+LI F +NRGH+QSIEFR V+L++S  ELQ+GLKS+  CPV
Sbjct  350   SDYYAQNVCLRAFEHLLQRQLICFTDNRGHSQSIEFRQVKLVVSYAELQEGLKSYRSCPV  409



>ref|XP_004299027.1| PREDICTED: origin recognition complex subunit 4-like [Fragaria 
vesca subsp. vesca]
Length=419

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/366 (72%), Positives = 318/366 (87%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  LL+E+PD I+VI+L+GLLHSD+NCALKEI+RQLC
Sbjct  50    GCNNSILLLGPRGSGKIAVLDLVIGDLLQEYPDSITVIRLSGLLHSDENCALKEISRQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             +EHQL+FSKMASFD+NSQFL+AMLRECGLAHKT+IFVLDEFDLF  GKQRLLY+LLDA+Q
Sbjct  110   TEHQLLFSKMASFDENSQFLVAMLRECGLAHKTIIFVLDEFDLFALGKQRLLYNLLDALQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRV SRFS+RKL+FLPPSKED++R+L++ILLLP D  L
Sbjct  170   SVTSQAVVIGVSCRLDADQLLEKRVISRFSNRKLLFLPPSKEDIQRLLEYILLLPTDSSL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             PT YV  FN KL +IL+D+KFK+I+ +   +DST    LR+LF AV  MD++SG LSL+N
Sbjct  230   PTDYVVEFNAKLQNILADEKFKEIINTYLNFDSTVKDFLRYLFRAVSNMDLQSGMLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALSN QR PK+E +KDCSILELY+LVC++RLE  EQ + NF ++MKEYK VHDSF+T
Sbjct  290   FKTALSNIQRHPKMESIKDCSILELYLLVCMKRLEVKEQNSYNFTAVMKEYKCVHDSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLRAFEHLLQR LI F++NRG NQS+E+RPV+LLIS  +L QGLKS+  CP 
Sbjct  350   SDYYAKNVCLRAFEHLLQRGLIEFMDNRGQNQSVEYRPVKLLISFQQLHQGLKSYRSCPA  409

Query  1081  ILHKLI  1098
             IL K++
Sbjct  410   ILQKIM  415



>ref|XP_002312422.1| origin recognition complex subunit 4 family protein [Populus 
trichocarpa]
 gb|EEE89789.1| origin recognition complex subunit 4 family protein [Populus 
trichocarpa]
Length=431

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/360 (74%), Positives = 311/360 (86%), Gaps = 0/360 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL  LL+E+PD I+VI+LNGLLHS+DN A KEI RQLC
Sbjct  50    ACNNSILLLGPRGSGKVAVLELVLSDLLEEYPDTITVIRLNGLLHSEDNSAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFDDNSQF+IAMLRECGLAHKTVIF LDEFDLF QGKQRLLYSLLDAMQ
Sbjct  110   MEHHLLFSKMASFDDNSQFMIAMLRECGLAHKTVIFALDEFDLFAQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+GVSCRLDADQLLEKRVRSRFSHRKL+FLPPSKED++R+L+HIL LP D  L
Sbjct  170   SVTSQAVVVGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSKEDVQRLLEHILSLPMDSSL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
                Y   FN KL SIL+D++FK+I+ +    +ST NHLLRFLF A+  M++KSGFLSL+N
Sbjct  230   AHDYAAEFNEKLQSILADERFKEIISNYLNSNSTTNHLLRFLFIAISNMELKSGFLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPK EC+KDCSILELYILVC++RLE  EQ + NF+S+MKEYK +HDSF T
Sbjct  290   FKAALSSIQRQPKQECIKDCSILELYILVCMKRLEIREQNSYNFSSVMKEYKSIHDSFPT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLRAFEHLLQRELI F +NRGH+QSIEFR V+L++S  ELQ+GLKS+  CPV
Sbjct  350   SDYYAQNVCLRAFEHLLQRELICFTDNRGHSQSIEFRQVKLVVSYAELQEGLKSYRSCPV  409



>ref|XP_007028453.1| Origin recognition complex subunit 4 isoform 2 [Theobroma cacao]
 gb|EOY08955.1| Origin recognition complex subunit 4 isoform 2 [Theobroma cacao]
Length=421

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/367 (74%), Positives = 313/367 (85%), Gaps = 2/367 (1%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL  LL+++P+ ISVI+LNGLLH DDNCALKEI RQLC
Sbjct  54    ACNNSILLLGPRGSGKVAVLELVLSDLLQQYPEAISVIRLNGLLHGDDNCALKEIARQLC  113

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSK+ASFDDNSQFLIAMLRECGLAHKT+IFVLDEFDLF Q KQRLLYSLLDAMQ
Sbjct  114   MEHQLLFSKVASFDDNSQFLIAMLRECGLAHKTIIFVLDEFDLFAQAKQRLLYSLLDAMQ  173

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLD DQLLEKRVRSRFSHRKL+FLPPSKED ER L+HIL LPKD  L
Sbjct  174   SVTSQAVVIGVSCRLDVDQLLEKRVRSRFSHRKLLFLPPSKEDTERFLEHILSLPKDSSL  233

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN +L ++L+D++FK+++ +  +++ST   L+RFLF AV  MD+  GFLSL+N
Sbjct  234   PHSYTVEFNGRLKNVLADERFKELINTYLSFNSTIGQLMRFLFQAVSYMDLDVGFLSLEN  293

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIM-KEYKIVHDSFK  897
             F+TALS+TQRQPK EC+KDCSILELY+LVC++RLE  EQ + NFNS+M  EYK +HD F+
Sbjct  294   FKTALSSTQRQPKSECIKDCSILELYLLVCMKRLEVKEQNSYNFNSVMTAEYKSIHD-FQ  352

Query  898   TSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCP  1077
             TSD YA +VCLRAFEHLLQRELISF +NRGHNQS+EFRPV+LLIS  EL  GLKS+  CP
Sbjct  353   TSDNYAGNVCLRAFEHLLQRELISFTDNRGHNQSVEFRPVKLLISPAELYHGLKSYRSCP  412

Query  1078  VILHKLI  1098
              IL KLI
Sbjct  413   AILLKLI  419



>gb|EPS72050.1| hypothetical protein M569_02708, partial [Genlisea aurea]
Length=409

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/360 (72%), Positives = 310/360 (86%), Gaps = 1/360 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             AC+NS LLLGPRGCGK  +L++VL+ LLKEFPDMISVIKLNGLLH D  CA+KEI RQLC
Sbjct  50    ACSNSALLLGPRGCGKIEILQIVLDELLKEFPDMISVIKLNGLLHGDSKCAMKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLR-ECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAM  357
              EHQL+FS+MAS+DDNSQFL++MLR ECGLAHKT++FVL+EFDLFTQGKQ+LLYSLLDA+
Sbjct  110   VEHQLLFSRMASYDDNSQFLMSMLRRECGLAHKTIVFVLEEFDLFTQGKQQLLYSLLDAL  169

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFG  537
             QSVTSQAVVIG+SCRLDADQLLEKRVRSRFSHRKL+F PPS E+L+R+++HIL LP +  
Sbjct  170   QSVTSQAVVIGISCRLDADQLLEKRVRSRFSHRKLLFPPPSSEELQRVIEHILKLPTESS  229

Query  538   LPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLD  717
             LP  Y  A+N KLLSIL   KFK IVE+L   DST +HLL+FLF AV  +D+++GFLSL+
Sbjct  230   LPNDYTVAYNAKLLSILEGSKFKSIVEALSYSDSTISHLLKFLFCAVSHIDLRTGFLSLE  289

Query  718   NFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFK  897
             NF+TAL   QRQPKLE LKDCS+LELYI+VC++R+E  E ETCNFNSIMKEYK VHD+F+
Sbjct  290   NFKTALQKVQRQPKLEFLKDCSVLELYIVVCMKRMELKEVETCNFNSIMKEYKTVHDTFQ  349

Query  898   TSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCP  1077
             T+DYYAR+VCLRAF+HL+ R+L+SF + +GH QSIEFRPV+LL+S HELQ  LKS   CP
Sbjct  350   TTDYYARNVCLRAFQHLVDRQLVSFEDGKGHGQSIEFRPVKLLVSRHELQLALKSHASCP  409



>ref|XP_010279414.1| PREDICTED: origin recognition complex subunit 4 [Nelumbo nucifera]
Length=419

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/366 (73%), Positives = 310/366 (85%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRGCGK AVLELVL+ L  E PDMISV++LNGLLHSDD CALKEI RQLC
Sbjct  50    TCNNSILLLGPRGCGKIAVLELVLKDLQVEHPDMISVVRLNGLLHSDDTCALKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMAS DDN+QF+IAMLRECGLAHKT+I VLDEFDLFTQGKQRLLYSLLDAMQ
Sbjct  110   LEHQLLFSKMASSDDNAQFMIAMLRECGLAHKTIIIVLDEFDLFTQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+FLPPS  D++R+L+ ILLLP D   
Sbjct  170   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSNRDVQRLLEDILLLPTDSKF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  YV  FN +L +IL D +F +I+ +L   D + N+LLRF+F AVC MD+++GFLSL+N
Sbjct  230   PNDYVTEFNARLHNILGDQQFIEILTTLSNTDPSVNYLLRFIFQAVCYMDLETGFLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ A+S+ QRQPK+E L+DCS+LELYILVC+RR E  EQ + NFNS+MKEYK +HDSF+T
Sbjct  290   FKNAISSIQRQPKIESLQDCSVLELYILVCMRRQEVKEQTSYNFNSVMKEYKSIHDSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA +VCLRAFEHLLQRELI F +NR H+QS+EFRPV+LLIS  EL QGLK    CPV
Sbjct  350   SDYYAHNVCLRAFEHLLQRELICFTDNRVHSQSVEFRPVKLLISAQELHQGLKLNCSCPV  409

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  410   ILQKLM  415



>gb|KDP44455.1| hypothetical protein JCGZ_16288 [Jatropha curcas]
Length=417

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/366 (72%), Positives = 312/366 (85%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LL+GP G GKNAVLELVL  LL+E PDMIS+I+LNGLLHS++NCA KEI RQLC
Sbjct  50    ACNNSILLVGPCGSGKNAVLELVLNDLLQEHPDMISMIRLNGLLHSEENCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFDDNSQF+IAMLRECGLAH+T+IF+LDEFDLF QGKQRLLYSLLDAM 
Sbjct  110   LEHHLLFSKMASFDDNSQFMIAMLRECGLAHRTIIFILDEFDLFAQGKQRLLYSLLDAMH  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLD DQLLEKRVRSRFSHRKL+FLPPS+ED++R+L+H+L LP D   
Sbjct  170   SVTSQAVVIGVSCRLDVDQLLEKRVRSRFSHRKLLFLPPSEEDVQRLLEHVLNLPMDSSF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN KL +IL+D++F+ I+ S      T NHLLRFLF+ +   + KSGFLSL+N
Sbjct  230   PHDYAAQFNGKLQNILADERFRGIITSYLNSHPTVNHLLRFLFTVISFWESKSGFLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALS+ QRQPK EC+KDCSILELYILVC++RLE  EQ + NFNS+MKEYK +HDSF+T
Sbjct  290   FKTALSSIQRQPKQECIKDCSILELYILVCMKRLEVKEQNSYNFNSVMKEYKSIHDSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR+VCLRAFE L+QRELI F++NR HNQS+EFRPV+LL+S  ELQ+GLKS+  CP 
Sbjct  350   SDYYARNVCLRAFERLIQRELICFMDNRAHNQSLEFRPVKLLVSYAELQEGLKSYRSCPS  409

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  410   ILQKLM  415



>ref|XP_002526317.1| origin recognition complex subunit, putative [Ricinus communis]
 gb|EEF36106.1| origin recognition complex subunit, putative [Ricinus communis]
Length=370

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/366 (72%), Positives = 312/366 (85%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL  LL+E PD IS++KLNGLLHSD+ CA KEI RQLC
Sbjct  3     ACNNSILLLGPRGSGKIAVLELVLNDLLQEHPDTISIVKLNGLLHSDEICAFKEIARQLC  62

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSK ASFDDNSQF+IA+L+ECGLAHKT+IF+LDEFDLF QGKQRLLYSLLDAMQ
Sbjct  63    MEHHLLFSKTASFDDNSQFMIAVLQECGLAHKTIIFILDEFDLFAQGKQRLLYSLLDAMQ  122

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQA+VIGVSCRLDADQLLEKRVRSRFSHRKL+FLPPS  D+ER+L+H+L LP D   
Sbjct  123   SVTSQAIVIGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSMVDVERLLEHLLSLPMDSSF  182

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN KL +IL+D++FK+IV +    + T NHLL+FLF A+ + ++KSGF SL+N
Sbjct  183   PHDYTTQFNGKLHNILADERFKEIVATYLNSNYTVNHLLKFLFVAISKWELKSGFPSLEN  242

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F++ALS+ +RQPK EC++DCSILELY+LVC++RLE  EQ + NFNS+MKEYK +HDSF+T
Sbjct  243   FKSALSSMRRQPKQECIRDCSILELYLLVCMKRLEVKEQSSYNFNSVMKEYKSIHDSFQT  302

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR+VCLRAFE LLQRELI F++NRG NQS+EFRPV+LLIS  ELQ+GLKS+  CP 
Sbjct  303   SDYYARNVCLRAFERLLQRELICFMDNRGQNQSVEFRPVKLLISYAELQEGLKSYRSCPT  362

Query  1081  ILHKLI  1098
             IL KLI
Sbjct  363   ILQKLI  368



>gb|KHG28385.1| Origin recognition complex subunit 4 [Gossypium arboreum]
Length=421

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/366 (72%), Positives = 311/366 (85%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL  LL+++P+ ISVI+LNGLLHSDDNCALKEI RQLC
Sbjct  54    ACNNSILLLGPRGSGKVAVLELVLSDLLQQYPEAISVIRLNGLLHSDDNCALKEIARQLC  113

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSK+ASFDDNSQF+IAMLRECGLAHKT+IFVLDEFD F QGKQRLLYSLLDAMQ
Sbjct  114   MEHQLLFSKVASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDFFAQGKQRLLYSLLDAMQ  173

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SV SQAVVIGVSCRLD DQLLEKRVRSRFSHRKL+FL PSKED ER ++HIL LP D  L
Sbjct  174   SVNSQAVVIGVSCRLDVDQLLEKRVRSRFSHRKLLFLSPSKEDTERFMEHILSLPMDSSL  233

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN +L  ILSD++FK+++++  +++ T  HL+RFLF AV  MD+ +GFLSL N
Sbjct  234   PHNYAAEFNGRLKKILSDERFKELIDTYLSFNFTIGHLVRFLFQAVSYMDLNAGFLSLGN  293

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALS+ QRQ KLE ++DCS+LELY++VC++RLE  EQ + NF S+M EYK +HDSF+T
Sbjct  294   FKTALSSNQRQLKLESIRDCSVLELYMMVCMKRLEVKEQTSYNFYSVMTEYKSIHDSFQT  353

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA +VCLRAFEHLLQ +LISF++N+GHNQS+EFRPV+LLIS  EL QGLKS+  CP 
Sbjct  354   SDYYAANVCLRAFEHLLQCQLISFIDNKGHNQSVEFRPVKLLISSAELHQGLKSYQQCPA  413

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  414   ILLKLM  419



>ref|XP_004158973.1| PREDICTED: origin recognition complex subunit 4-like [Cucumis 
sativus]
 gb|KGN50701.1| hypothetical protein Csa_5G218180 [Cucumis sativus]
Length=418

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/366 (70%), Positives = 313/366 (86%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL+ LL E+PDMI+VI+L+GLLH DDN A KEI RQLC
Sbjct  52    ACNNSILLLGPRGSGKMAVLELVLQDLLLEYPDMITVIRLSGLLHCDDNGAFKEIARQLC  111

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             SE+QL+FSKMASFDDNSQF++AMLRECGLAHKT++FVLDEFDLF QGKQRLLYSLLDAMQ
Sbjct  112   SEYQLLFSKMASFDDNSQFMVAMLRECGLAHKTIVFVLDEFDLFAQGKQRLLYSLLDAMQ  171

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SV+SQA+VIG+SCRLDADQLLEKRVRSRFSHRKL+FLPP KE++ER+L+HIL LP D  L
Sbjct  172   SVSSQAIVIGISCRLDADQLLEKRVRSRFSHRKLLFLPPCKENVERLLEHILSLPIDSDL  231

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y+  FN KL ++L++++FK ++ +    DST    +R+LF A+ ++++KSG L+++N
Sbjct  232   PHDYIIKFNAKLHNMLANERFKKVISTYLDSDSTVKQFVRYLFCAISKLNLKSGLLTVEN  291

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+TQRQPK E +KDCSILELYILVC++RLE  EQ + NFNS+MKEYK +HDSF+T
Sbjct  292   FEHALSDTQRQPKQEYIKDCSILELYILVCMKRLEVKEQNSYNFNSVMKEYKSIHDSFRT  351

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYY+R VCLRAFEHLLQRELI F +NRGHNQSIEFRP +LLI+ HEL  GLK++  CP 
Sbjct  352   SDYYSRSVCLRAFEHLLQRELICFADNRGHNQSIEFRPAKLLITAHELHHGLKAYRSCPS  411

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  412   ILQKLM  417



>ref|XP_004497011.1| PREDICTED: origin recognition complex subunit 4-like [Cicer arietinum]
Length=420

 Score =   523 bits (1348),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 258/366 (70%), Positives = 308/366 (84%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVL+LV++ LL +FPD ISV++L+GLLHSDD  A KEI RQLC
Sbjct  51    ACNNSILLLGPRGSGKIAVLDLVIQDLLIQFPDSISVVRLSGLLHSDDISAFKEIARQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSK AS DDNSQF++A+L+ECGLAHKTVIF+LDEFDLF QGKQRLLYSLLDAMQ
Sbjct  111   MEHQLLFSKAASSDDNSQFMVAVLKECGLAHKTVIFILDEFDLFAQGKQRLLYSLLDAMQ  170

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SV+SQAVV+G+SCRLDADQLLEKRVRSRFSHRKL+FLPPS ED +R+L H+L LP D  L
Sbjct  171   SVSSQAVVLGISCRLDADQLLEKRVRSRFSHRKLLFLPPSVEDSQRLLVHMLTLPIDSSL  230

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+ Y   FN K+ +I+ D +FK+I +   +YDS+  HLLRFL+ AV  MD++ GFLS +N
Sbjct  231   PSDYAVEFNRKVQNIIDDRRFKEIFDKYLSYDSSVKHLLRFLYCAVSHMDLQIGFLSREN  290

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F TA S+ QRQPKLECL++CSILELYILVC++RLE  EQ  CNFN++MKEYKI+HDSF+T
Sbjct  291   FETAFSSIQRQPKLECLRNCSILELYILVCMKRLEVKEQNLCNFNTVMKEYKIIHDSFQT  350

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR+VCLRAFEHL+ RELI F +NRGH+ S EFRPV+LLIS  EL QGLK++  CP 
Sbjct  351   SDYYARNVCLRAFEHLIHRELICFTDNRGHSLSAEFRPVKLLISSAELHQGLKAYQSCPA  410

Query  1081  ILHKLI  1098
             IL KLI
Sbjct  411   ILQKLI  416



>ref|XP_010681707.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=421

 Score =   523 bits (1346),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 258/366 (70%), Positives = 309/366 (84%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AVL+LVL  LL E+PDMISVI+LNGLLHSDDNCALKEI RQLC
Sbjct  49    ACNNSVLLLGPRGCGKTAVLQLVLNNLLAEYPDMISVIRLNGLLHSDDNCALKEIARQLC  108

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             +EHQL+FSKMASFDDN+QF+I MLRECGLAHKT++F+LDEFDLF QGKQRLLYSLLDAMQ
Sbjct  109   AEHQLLFSKMASFDDNTQFVIGMLRECGLAHKTIVFILDEFDLFAQGKQRLLYSLLDAMQ  168

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIG+SC+LDADQLLEKRVRSR SHRKL+F PPS ++++R+L+ +L LP++  L
Sbjct  169   SVTSQAVVIGISCKLDADQLLEKRVRSRLSHRKLLFCPPSIDEMDRLLECVLSLPENSSL  228

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  YV  +N +L  IL+D KFKD + +L + DST + +LRFLF +V  MDMK G LS++N
Sbjct  229   PQSYVVEYNNELRKILADKKFKDTMTTLLSSDSTVDQILRFLFLSVSTMDMKRGILSVEN  288

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  A+    RQPKLE LKDCS+LELYILVC++RLE  EQ + NFNS+MKEYK +HDSF+T
Sbjct  289   FNMAVVKLNRQPKLEFLKDCSVLELYILVCMKRLEVKEQNSYNFNSVMKEYKAIHDSFQT  348

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
              DYYAR VCLRAF+HL+Q ELI F++NRG+NQSIE+RPV++LIS +EL QGLK    CP 
Sbjct  349   PDYYARKVCLRAFQHLIQCELICFMDNRGYNQSIEYRPVKILISSYELHQGLKLNQKCPS  408

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  409   ILQKLM  414



>ref|XP_006468789.1| PREDICTED: origin recognition complex subunit 4-like isoform 
X3 [Citrus sinensis]
Length=401

 Score =   521 bits (1342),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 267/366 (73%), Positives = 304/366 (83%), Gaps = 17/366 (5%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLEL+L  LL E+PD ISVIKLNGLLHSDD CA K       
Sbjct  51    ACNNSILLLGPRGSGKIAVLELILTDLLLEYPDTISVIKLNGLLHSDDCCAFK-------  103

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
                       ASFDDNSQF+I MLRECGLAHKT+IFVLDEFDLF QGKQRLLYSLLDAMQ
Sbjct  104   ----------ASFDDNSQFMIEMLRECGLAHKTIIFVLDEFDLFAQGKQRLLYSLLDAMQ  153

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+FLPPSKED++R+L+HIL LP D  L
Sbjct  154   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSKEDMQRLLEHILSLPVDSSL  213

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN K+ +IL+D +FK+IV +L   DST NHLLRFLF AV  MD++SGFLS +N
Sbjct  214   PHAYAVEFNKKIKNILADGRFKEIVNTLVNLDSTVNHLLRFLFLAVSYMDLESGFLSFEN  273

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALSN+ RQPKLEC+KDCSILELYILVC++RLE  EQ + NFNS+MKEYK +HDSF+T
Sbjct  274   FKTALSNSHRQPKLECIKDCSILELYILVCMKRLEVKEQNSYNFNSVMKEYKSIHDSFQT  333

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYY+R+VCLRAFEHLLQRELI F +NRG++QS+EFRPV+LLIS  EL QGLKS+  CPV
Sbjct  334   SDYYSRNVCLRAFEHLLQRELICFTDNRGYSQSVEFRPVKLLISSIELHQGLKSYCSCPV  393

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  394   ILLKLV  399



>ref|XP_008787657.1| PREDICTED: origin recognition complex subunit 4 [Phoenix dactylifera]
Length=418

 Score =   521 bits (1342),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 265/365 (73%), Positives = 306/365 (84%), Gaps = 0/365 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRG GK AV+ELVLE L  E PD ISVI+LNGLLHSD NCALKEI RQLC
Sbjct  47    ACNNSVLLLGPRGSGKIAVVELVLEDLKAEHPDAISVIRLNGLLHSDGNCALKEIARQLC  106

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMAS DDNSQF+I MLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ
Sbjct  107   VEHQLLFSKMASSDDNSQFMIDMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  166

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             ++ SQAVVIGVSCRLDADQLLEKR+RSRFSHRKL+F+PPSKED++R+L+++L LPKD   
Sbjct  167   TLNSQAVVIGVSCRLDADQLLEKRIRSRFSHRKLLFVPPSKEDIQRLLEYLLHLPKDSSF  226

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+KYV  FN +L +ILSD KFK+IV+SL   D + ++LLR LF AV  MDM+SG LSL+N
Sbjct  227   PSKYVTEFNARLSNILSDKKFKEIVDSLLDVDGSVSNLLRLLFRAVSYMDMESGLLSLEN  286

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F++A   T RQPK++ LKD SILELYILVC+ RLE  EQ + NFNSIMKEYK +HD++KT
Sbjct  287   FKSAYLCTYRQPKIDNLKDASILELYILVCMNRLETKEQNSYNFNSIMKEYKAIHDAYKT  346

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA +VCLRAFEHLL++ELI F +++G   SIEFRPV+LLIS  EL QGLKS   CP 
Sbjct  347   SDNYANNVCLRAFEHLLEQELIGFTDSKGRTPSIEFRPVKLLISSRELYQGLKSNSSCPA  406

Query  1081  ILHKL  1095
             IL KL
Sbjct  407   ILQKL  411



>ref|XP_008456888.1| PREDICTED: origin recognition complex subunit 4 [Cucumis melo]
 ref|XP_008456889.1| PREDICTED: origin recognition complex subunit 4 [Cucumis melo]
 ref|XP_008456890.1| PREDICTED: origin recognition complex subunit 4 [Cucumis melo]
Length=419

 Score =   520 bits (1340),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 260/367 (71%), Positives = 311/367 (85%), Gaps = 1/367 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELVL+ LL E+PDMI+VI+L+GLLH DDN A KEI RQLC
Sbjct  52    ACNNSILLLGPRGSGKMAVLELVLQDLLLEYPDMITVIRLSGLLHCDDNGAFKEIARQLC  111

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             SE+QL+FSKMASFDDNS+F+IAMLRECGLAHKT++FVLDEFDLF QGKQRLLYSLLDAMQ
Sbjct  112   SEYQLLFSKMASFDDNSKFMIAMLRECGLAHKTIVFVLDEFDLFAQGKQRLLYSLLDAMQ  171

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SV+SQA+VIG+SCRLDADQLLEKRVRSRFSHRKL+FLPP KED+ER+L+ IL LP D  L
Sbjct  172   SVSSQAIVIGISCRLDADQLLEKRVRSRFSHRKLLFLPPCKEDVERLLEDILSLPIDSDL  231

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y+  FN KL ++L++++FK I+ +    DST    +R+LF A+ +MD+KSG L+++N
Sbjct  232   PHDYIIKFNAKLHNMLANERFKKIINTYLDSDSTVKQFVRYLFCAISKMDLKSGLLTVEN  291

Query  721   FRTALSNTQRQPKLECLK-DCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFK  897
             F  ALS+ QRQPK E +K DCSILELYILVC++RLE  EQ + NFNS+MKEYK +HDSF+
Sbjct  292   FEHALSDIQRQPKQEYIKADCSILELYILVCMKRLEVKEQNSYNFNSVMKEYKSIHDSFR  351

Query  898   TSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCP  1077
             TSDYY+R VCLRAFEHLLQRELI F +NRGH QSIEFRP +LLI+ HEL  GLK++  CP
Sbjct  352   TSDYYSRSVCLRAFEHLLQRELICFADNRGHTQSIEFRPAKLLITSHELHHGLKAYRSCP  411

Query  1078  VILHKLI  1098
             VIL KL+
Sbjct  412   VILQKLM  418



>gb|KEH44148.1| origin recognition complex subunit 4 [Medicago truncatula]
Length=412

 Score =   519 bits (1336),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 255/366 (70%), Positives = 306/366 (84%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVL+LVL+ LL ++PD ISV++LNGLLH DD  A KEI RQLC
Sbjct  43    ACNNSILLLGPRGSGKLAVLDLVLQDLLIQYPDSISVVRLNGLLHCDDISAFKEIARQLC  102

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSK ASFDDNSQF++A+L+ECGLAHKTVIF+LDEFDLF QGKQRLLYSLLDAMQ
Sbjct  103   MEHQLLFSKAASFDDNSQFMVAVLKECGLAHKTVIFILDEFDLFAQGKQRLLYSLLDAMQ  162

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SV+SQAVV+G+SCRLDADQLLEKRVRSRFSHRKL+FLPPS ED +R+L H+L LP D  L
Sbjct  163   SVSSQAVVLGISCRLDADQLLEKRVRSRFSHRKLLFLPPSIEDSQRLLVHMLTLPIDSSL  222

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN K+ +I+ D +FK+I   L  +DS+  HLL+FLF AV  MD+++GFLS +N
Sbjct  223   PYDYAVEFNKKVQNIIEDKRFKEIFNKLLNFDSSVKHLLKFLFYAVSHMDLQTGFLSREN  282

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F TA +N QRQPKLECLK+CS+LELYILV ++RLE  E+  CNFN++MKEYK +HDSF+T
Sbjct  283   FETAFTNIQRQPKLECLKNCSVLELYILVSMKRLEVKEKSLCNFNAVMKEYKNIHDSFQT  342

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR+VCLRAFEHLL REL+ F +NRGH+ S+EFRPV+LLIS  EL QGLK++  CP 
Sbjct  343   SDYYARNVCLRAFEHLLHRELLCFTDNRGHSLSVEFRPVKLLISSAELHQGLKAYQSCPA  402

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  403   ILQKLV  408



>ref|XP_010681709.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=420

 Score =   519 bits (1336),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 258/366 (70%), Positives = 309/366 (84%), Gaps = 1/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AVL+LVL  LL E+PDMISVI+LNGLLHSDDNCALKEI RQLC
Sbjct  49    ACNNSVLLLGPRGCGKTAVLQLVLNNLLAEYPDMISVIRLNGLLHSDDNCALKEIARQLC  108

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             +EHQL+FSKMASFDDN+QF+I MLRECGLAHKT++F+LDEFDLF QGKQRLLYSLLDAMQ
Sbjct  109   AEHQLLFSKMASFDDNTQFVIGMLRECGLAHKTIVFILDEFDLFAQGKQRLLYSLLDAMQ  168

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIG+SC+LDADQLLEKRVRSR SHRKL+F PPS ++++R+L+ +L LP++  L
Sbjct  169   SVTSQAVVIGISCKLDADQLLEKRVRSRLSHRKLLFCPPSIDEMDRLLECVLSLPENSSL  228

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  YV  +N + L IL+D KFKD + +L + DST + +LRFLF +V  MDMK G LS++N
Sbjct  229   PQSYVVEYNNE-LRILADKKFKDTMTTLLSSDSTVDQILRFLFLSVSTMDMKRGILSVEN  287

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  A+    RQPKLE LKDCS+LELYILVC++RLE  EQ + NFNS+MKEYK +HDSF+T
Sbjct  288   FNMAVVKLNRQPKLEFLKDCSVLELYILVCMKRLEVKEQNSYNFNSVMKEYKAIHDSFQT  347

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
              DYYAR VCLRAF+HL+Q ELI F++NRG+NQSIE+RPV++LIS +EL QGLK    CP 
Sbjct  348   PDYYARKVCLRAFQHLIQCELICFMDNRGYNQSIEYRPVKILISSYELHQGLKLNQKCPS  407

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  408   ILQKLM  413



>ref|XP_010069004.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Eucalyptus 
grandis]
 gb|KCW57228.1| hypothetical protein EUGRSUZ_H00037 [Eucalyptus grandis]
Length=416

 Score =   516 bits (1328),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 253/365 (69%), Positives = 306/365 (84%), Gaps = 0/365 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRG GK AVL+LVLE LL E+PDMI++I+LNGLLHSDDN A+KEI RQLC
Sbjct  50    ACNNSVLLLGPRGSGKVAVLDLVLEDLLLEYPDMITLIRLNGLLHSDDNSAVKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMASFDDNS+F+IAMLRECGLAHKT++FVLDEFDLFTQGKQRLLY+LLDAMQ
Sbjct  110   VEHQLLFSKMASFDDNSEFMIAMLRECGLAHKTIVFVLDEFDLFTQGKQRLLYALLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIGVSCRLDADQLLEKRV+SRFSHRKL+FLPPS+ED+ R+L H+L LP D  L
Sbjct  170   SVTSQAVVIGVSCRLDADQLLEKRVKSRFSHRKLLFLPPSEEDIYRLLDHVLSLPVDSSL  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN KL S+ SD++F+ ++ S   +     HL++FLF A   MD+K G+LS +N
Sbjct  230   PHDYAIEFNAKLHSMFSDERFRQVINSYMNFSPAVRHLVKFLFRAASDMDLKLGYLSFEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F++A+S+ QRQPK+ECL+DCSILELYILVC++RLE  EQ + +F+++MKEYK +HDSF+T
Sbjct  290   FKSAISSLQRQPKMECLRDCSILELYILVCMKRLEVKEQNSYSFSAVMKEYKSIHDSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYY++DVCLRAFEH+LQR L+ F + RG  QS EFRPV+LLIS  E+ QGLK+   CP 
Sbjct  350   SDYYSQDVCLRAFEHVLQRGLVCFADGRGRIQSTEFRPVKLLISFAEISQGLKAHHSCPA  409

Query  1081  ILHKL  1095
              L KL
Sbjct  410   FLQKL  414



>ref|XP_006293033.1| hypothetical protein CARUB_v10019313mg [Capsella rubella]
 gb|EOA25931.1| hypothetical protein CARUB_v10019313mg [Capsella rubella]
Length=417

 Score =   515 bits (1326),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 249/366 (68%), Positives = 306/366 (84%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  LL+EFPD +SVI+LNGLLHSDDNCA KEI RQLC
Sbjct  50    GCNNSILLLGPRGSGKAAVLDLVVGDLLQEFPDSVSVIRLNGLLHSDDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMAS D+NSQF++AMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  110   MEHHLLFSKMASLDENSQFIVAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIG+S RLDADQLLEKRVRSRFSHRK++FLPPS+E+ + +L+H+L LP D   
Sbjct  170   SVTSQAVVIGISSRLDADQLLEKRVRSRFSHRKILFLPPSREEFDGLLEHLLSLPADSSF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+ YV  FN K+ +I SD +FKDI+ +L   +ST N LL+F+F AV  M+++SG LSL+N
Sbjct  230   PSGYVSRFNEKIKNIKSDTRFKDILRTLFNANSTMNSLLKFIFRAVSLMNLESGLLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPKLE ++DCSILELY+LVC+RRLE  EQ + NF S+MKEYK +HDSF+T
Sbjct  290   FKAALSSMQRQPKLEAVRDCSILELYLLVCMRRLEVKEQRSYNFISVMKEYKTIHDSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLRAFEHL +R++  + ENRG  Q+ E+RP++LLIS  EL QG++S  CCP 
Sbjct  350   SDYYAQNVCLRAFEHLRERQVTCYAENRGQTQTGEYRPMKLLISASELHQGMRSHACCPA  409

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  410   ILLKLL  415



>ref|XP_008367071.1| PREDICTED: LOW QUALITY PROTEIN: origin recognition complex subunit 
4-like, partial [Malus domestica]
Length=386

 Score =   514 bits (1323),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 302/368 (82%), Gaps = 2/368 (1%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACN+S+LLLGPRG GK A+LELVL  LL+EFPD +SVI+L+GLLHS DNCA KEI RQLC
Sbjct  15    ACNSSILLLGPRGSGKTAMLELVLSDLLQEFPDTVSVIRLSGLLHSSDNCAFKEIARQLC  74

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQLVFS+MASFDDNSQF+IAMLRECGLAHKT+IFVLDEFDLF  GKQRLLY LLDAMQ
Sbjct  75    MEHQLVFSRMASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDLFALGKQRLLYXLLDAMQ  134

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SV SQAVVIGVS RLDAD LL+KRVRSRFSHRK +FLPP+ ED++R+L+HILLLP D   
Sbjct  135   SVXSQAVVIGVSXRLDADMLLDKRVRSRFSHRKPLFLPPAYEDIQRLLEHILLLPTDSSF  194

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN KL +IL+D +FK+IV +    DST  HLLR+LF AV  MD++SG LSL+N
Sbjct  195   PPDYAIVFNAKLXTILADXRFKEIVNTYLNLDSTVKHLLRYLFPAVSDMDLESGMLSLEN  254

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+T LSN Q QPKLEC+KDCS+LELYILVC++RLE  E  +  FN++MKEYK +HDS KT
Sbjct  255   FKTTLSNIQLQPKLECIKDCSVLELYILVCMKRLEVKEXNSYXFNAVMKEYKSIHDSVKT  314

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLIS--LHELQQGLKSWGCC  1074
             + ++AR+VCLR FEHLLQRELI F +NRG NQ +EF PV+LLIS   +EL QG+KS+  C
Sbjct  315   AYHFARNVCLRGFEHLLQRELIGFADNRGQNQPVEFNPVKLLISSPCNELHQGMKSYRSC  374

Query  1075  PVILHKLI  1098
             P IL +L+
Sbjct  375   PAILQQLM  382



>ref|XP_009101367.1| PREDICTED: origin recognition complex subunit 4 [Brassica rapa]
Length=417

 Score =   514 bits (1325),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 244/366 (67%), Positives = 310/366 (85%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  L++E+PD +++I+LNGLLHS+DNCA KEI RQLC
Sbjct  50    GCNNSILLLGPRGSGKAAVLDLVVGDLMEEYPDSVTLIRLNGLLHSEDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFD+NSQF+IAMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  110   MEHHLLFSKMASFDENSQFIIAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+G+S RLDADQLLEKRVRSRFSHRK++FLPPS+E+++ +L+H+L LP D   
Sbjct  170   SVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKILFLPPSREEIDSLLEHLLSLPADSSF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+ YV  FN K+ +I SD +FKD++++    +ST N LL+F+F AV  M+++SG LSL+N
Sbjct  230   PSGYVSQFNEKIKNITSDTRFKDMLKTFLNANSTVNSLLKFIFRAVSSMNLESGLLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+TALS+ QRQPKLE ++DCSILELY+LVC+RRLE  EQ + NF S+MKEYK +HDSF+T
Sbjct  290   FKTALSSMQRQPKLEAVRDCSILELYLLVCMRRLEVKEQSSYNFISVMKEYKTIHDSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD+YA++VCLRAFEHL +RE+I + ENRG +Q+ E+R ++LLIS  EL QG++S  CCP 
Sbjct  350   SDFYAQNVCLRAFEHLREREVICYAENRGQSQAGEYRSMKLLISASELHQGMRSHACCPA  409

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  410   ILLKLL  415



>ref|XP_010424849.1| PREDICTED: origin recognition complex subunit 4-like [Camelina 
sativa]
Length=419

 Score =   513 bits (1322),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 248/366 (68%), Positives = 304/366 (83%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV   LL+EFPD +S+I+LNGLLHSDDNCA KEI RQLC
Sbjct  52    GCNNSILLLGPRGSGKAAVLDLVAGDLLEEFPDSVSLIRLNGLLHSDDNCAFKEIARQLC  111

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMAS D+NSQF++AMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  112   MEHHLLFSKMASLDENSQFIVAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  171

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIG+S RLDADQLLEKRVRSRFSHRK++FLPPS+E+ + +L+H+L LP D   
Sbjct  172   SVTSQAVVIGISSRLDADQLLEKRVRSRFSHRKILFLPPSREEFDGLLEHLLSLPADSSF  231

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  YV  FN K+ +I SD +FKDI+ +L   +ST N LL+F+F AV  M+++SG LSL+N
Sbjct  232   PNGYVSRFNEKIKNITSDTRFKDILRTLFNANSTVNSLLKFIFRAVSLMNLESGLLSLEN  291

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPKLE ++DCSILELY+LVC+RRLE  EQ   N  S+MKEYK +HDSF+T
Sbjct  292   FKAALSSMQRQPKLEAVRDCSILELYLLVCMRRLEVKEQSAYNIISVMKEYKTIHDSFQT  351

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLRAFEHL +R++I + ENRG +Q+ E+RP++LLIS  EL QG++S  CCP 
Sbjct  352   SDYYAQNVCLRAFEHLRERQVICYTENRGQSQTGEYRPMKLLISASELHQGMRSHACCPA  411

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  412   ILLKLL  417



>ref|XP_010502063.1| PREDICTED: origin recognition complex subunit 4-like [Camelina 
sativa]
Length=419

 Score =   513 bits (1320),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 248/366 (68%), Positives = 305/366 (83%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  LL+EFPD +S+I+LNGLLHSDDNCA KEI RQLC
Sbjct  52    GCNNSILLLGPRGSGKAAVLDLVVGDLLEEFPDSVSLIRLNGLLHSDDNCAFKEIARQLC  111

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMAS D+NSQF++AMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  112   MEHHLLFSKMASLDENSQFIVAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  171

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIG+S RLDADQLLEKRVRSRFSHRK++FLPPS+E+ + +L+H+L LP D   
Sbjct  172   SVTSQAVVIGLSSRLDADQLLEKRVRSRFSHRKILFLPPSREEFDGLLEHLLSLPADSSF  231

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  YV  FN K+ +I SD +FKDI+ +L   +ST N LL+F+F AV  M+++SG LSL+N
Sbjct  232   PNGYVSRFNEKIKNITSDTRFKDILRTLFNANSTVNSLLKFIFRAVSLMNLESGLLSLEN  291

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPKLE ++DCSILELY+LVC+RRLE  EQ   N  S+MKEYK +HDSF+T
Sbjct  292   FKAALSSMQRQPKLEAVRDCSILELYLLVCMRRLEVKEQSAYNIISVMKEYKTIHDSFQT  351

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLRAFEHL +R++I + ENRG +Q+ E+RP++LLIS  EL QG++S  CCP 
Sbjct  352   SDYYAQNVCLRAFEHLRERQVICYTENRGQSQTGEYRPMKLLISASELHQGMRSHACCPA  411

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  412   ILLKLL  417



>gb|KFK33333.1| hypothetical protein AALP_AA5G000700 [Arabis alpina]
Length=418

 Score =   512 bits (1319),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 246/366 (67%), Positives = 306/366 (84%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK+AVL+LV+  LL+E+PD +S+I+LNGLLHSDDNCA KEI RQLC
Sbjct  51    GCNNSILLLGPRGSGKSAVLDLVVADLLEEYPDSVSLIRLNGLLHSDDNCAFKEIARQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFDDNS F+IAMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  111   MEHHLLFSKMASFDDNSHFIIAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  170

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQA+V+G+S RLDADQLLEKRVRSRFSHRK++FLPP +E+L+ +L+H+L LP D   
Sbjct  171   SVTSQAIVVGISSRLDADQLLEKRVRSRFSHRKILFLPPLREELDSLLEHLLSLPADSSF  230

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+ YV  FN K+ SI SD +FKDI+ +    + T N L++F+F AV  M+++SG LSL+N
Sbjct  231   PSGYVSQFNEKIKSITSDTRFKDILRTFFNANYTVNSLVKFIFRAVSLMNLESGLLSLEN  290

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPKLE ++DCSILE Y+LVC+RRLE  EQ + NF S+MKEYK +HDSF+T
Sbjct  291   FKAALSSMQRQPKLEAIRDCSILEQYLLVCMRRLEVKEQSSYNFISVMKEYKTIHDSFQT  350

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLRAFEHL +RE+I + ENRG +Q+ E+RP++LLIS  EL QG++S  CCP 
Sbjct  351   SDYYAQNVCLRAFEHLREREVICYAENRGQSQTGEYRPMKLLISASELLQGMRSHACCPA  410

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  411   ILVKLL  416



>ref|XP_010513816.1| PREDICTED: origin recognition complex subunit 4-like [Camelina 
sativa]
Length=419

 Score =   511 bits (1315),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 247/366 (67%), Positives = 305/366 (83%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  LL+EFPD +S+I+LNGLLHSDDNCA KEI RQLC
Sbjct  52    GCNNSILLLGPRGSGKAAVLDLVVGDLLEEFPDSVSLIRLNGLLHSDDNCAFKEIARQLC  111

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMAS D+NSQF++AMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  112   MEHHLLFSKMASLDENSQFIVAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  171

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIG+S RLDADQLLEKRVRSRFSHRK++FLPPS+E+ + +L+H+L LP D   
Sbjct  172   SVTSQAVVIGLSSRLDADQLLEKRVRSRFSHRKILFLPPSREEFDGLLEHLLSLPADSSF  231

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  YV  FN K+ +I SD +FKDI+ +L   +ST N LL+F+F AV  M+++SG LSL+N
Sbjct  232   PNGYVSRFNEKIKNITSDTRFKDILRTLFNANSTVNSLLKFIFRAVSLMNLESGLLSLEN  291

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPKLE ++DCSILELY+LVC+RRLE  EQ +    S+MKEYK +HDSF+T
Sbjct  292   FKAALSSMQRQPKLEAVRDCSILELYLLVCMRRLEVKEQSSYKIISVMKEYKTIHDSFQT  351

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLRAFEHL +R++I + ENRG +Q+ E+RP++LLIS  EL QG++S  CCP 
Sbjct  352   SDYYAQNVCLRAFEHLRERQVICYTENRGQSQTGEYRPMKLLISASELHQGMRSHACCPA  411

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  412   ILLKLL  417



>ref|XP_006398497.1| hypothetical protein EUTSA_v10000894mg [Eutrema salsugineum]
 gb|ESQ39950.1| hypothetical protein EUTSA_v10000894mg [Eutrema salsugineum]
Length=423

 Score =   508 bits (1307),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/372 (66%), Positives = 308/372 (83%), Gaps = 6/372 (2%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  LL+E+PD +SVI+LNGLLHSDDNCA KEI RQLC
Sbjct  50    GCNNSILLLGPRGSGKAAVLDLVIGDLLEEYPDSVSVIRLNGLLHSDDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFD+NSQF+IAMLRECGLAHKTVIFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  110   MEHHLLFSKMASFDENSQFIIAMLRECGLAHKTVIFVLDEFDMFAQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+G+S RLDADQLLEKRVRSRFSHRK++FLPPS+E+ + +L+H+L LP D   
Sbjct  170   SVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKILFLPPSREEFDSLLEHLLSLPSDSSF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFL------FSAVCQMDMKSG  702
             P+ YV  FN K+ SI+SD +FK+++++    +ST N LL+++      F AV  M+++SG
Sbjct  230   PSGYVSQFNEKIKSIISDTRFKNMLKTFFNANSTVNSLLKYMLSLDVRFRAVSLMNLESG  289

Query  703   FLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIV  882
              LSL+NF+ ALS+ QRQPKLE +KDCSI+ELY+LVC+RRLE  EQ + NF S+MKEYK +
Sbjct  290   LLSLENFKAALSSLQRQPKLEAVKDCSIVELYLLVCMRRLEVKEQSSYNFISVMKEYKTI  349

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
             HDSF+TSDYYA++VCLRAFEHL +R +I + ENRG  Q+ E+RP++LLIS  EL QG++S
Sbjct  350   HDSFQTSDYYAQNVCLRAFEHLKERAVICYAENRGQFQTGEYRPMKLLISASELHQGMRS  409

Query  1063  WGCCPVILHKLI  1098
               CCP +L KL+
Sbjct  410   HACCPAMLLKLL  421



>ref|XP_004969562.1| PREDICTED: origin recognition complex subunit 4-like isoform 
X1 [Setaria italica]
Length=424

 Score =   508 bits (1307),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 252/365 (69%), Positives = 303/365 (83%), Gaps = 0/365 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AV+++VLE L KE PD ISVI+LNG+LHSDDNCA KEI RQLC
Sbjct  53    ACNNSVLLLGPRGCGKAAVVDMVLEDLKKEHPDAISVIRLNGMLHSDDNCATKEIARQLC  112

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL FSKMAS DDN++F+I MLRECGLAHKT++F+L+EFDLF QGKQRLLYSLLDAMQ
Sbjct  113   LEHQLSFSKMASSDDNTEFIIDMLRECGLAHKTILFILEEFDLFAQGKQRLLYSLLDAMQ  172

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+F+P S ED +R+++H+L+L KD GL
Sbjct  173   SLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFVPSSLEDTQRLVEHLLILAKDSGL  232

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P KY+  +N++L +I SD KFK I+ SL   D+T +++LRFLF AV  MDM+SGFLS+++
Sbjct  233   PAKYITDYNSRLTNIFSDKKFKGILNSLMDADATTSNILRFLFRAVSYMDMESGFLSMES  292

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+ QRQPK++ L+D SILELYILVC+ RLE  EQ + NF SIMKEY+ + D++KT
Sbjct  293   FLKALSSLQRQPKMDSLQDLSILELYILVCMHRLEDKEQSSYNFTSIMKEYRSIQDAYKT  352

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA  VC RAFEHLL RELISF +NRG NQ++E+RPV+LLIS  EL Q LK    CP 
Sbjct  353   SDKYASTVCFRAFEHLLDRELISFGDNRGRNQALEYRPVKLLISSRELAQSLKLNTTCPA  412

Query  1081  ILHKL  1095
             +L KL
Sbjct  413   LLQKL  417



>sp|Q6EWX1.1|ORC4_ARATH RecName: Full=Origin of replication complex subunit 4; Short=AtORC4 
[Arabidopsis thaliana]
 emb|CAE01428.1| origin recognition complex 4 subunit [Arabidopsis thaliana]
Length=417

 Score =   506 bits (1304),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 245/366 (67%), Positives = 303/366 (83%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+L +  LL++FPD +SVI+LNGLLHSDDNCA KEI +QLC
Sbjct  50    GCNNSMLLLGPRGSGKAAVLDLGVGDLLEQFPDSVSVIRLNGLLHSDDNCAFKEIAKQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFDDNSQF+IAMLR CGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  110   MEHHLLFSKMASFDDNSQFIIAMLRACGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+G+S RLDADQLLEKRVRSRFSHRK +FLPPS+E+L+ +  H+L LP D G 
Sbjct  170   SVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKFLFLPPSREELDGLFVHLLSLPADSGF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+ YV  FN K+ ++ SD +FKDI+++L   +ST N  L+F+F AV  M+++SG LSL+N
Sbjct  230   PSGYVSRFNDKIKNLTSDTRFKDILKTLFNANSTVNSFLKFIFCAVSLMNLESGLLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPKLE ++DCS+LELY+LVC+RRLE  EQ + NF S+MKEYK +HDSF T
Sbjct  290   FKAALSSMQRQPKLEAVRDCSVLELYLLVCMRRLEVKEQSSYNFISVMKEYKAIHDSFHT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLRAFEHL +R++I + ENRG +Q+ E+R  +LLIS  EL QG++S  CCP 
Sbjct  350   SDYYAQNVCLRAFEHLRERQVICYAENRGQSQTGEYRLQKLLISASELHQGMRSHACCPA  409

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  410   ILLKLL  415



>ref|XP_010924342.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Elaeis 
guineensis]
Length=418

 Score =   506 bits (1304),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 257/365 (70%), Positives = 303/365 (83%), Gaps = 0/365 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRG GK AV+ELVLE L  E PD ISVI+LNGLLHSDDNCALKEI RQLC
Sbjct  47    ACNNSVLLLGPRGSGKIAVVELVLEDLKAEHPDAISVIRLNGLLHSDDNCALKEIARQLC  106

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMAS DDNSQF++ MLRECGLAHKT+I +LDEFDLFTQGKQRLLYSLLDAMQ
Sbjct  107   VEHQLLFSKMASSDDNSQFVMDMLRECGLAHKTIIVILDEFDLFTQGKQRLLYSLLDAMQ  166

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             ++ SQAVVIGVSCRLDADQLLEKR+RSRFSHRKL+F+PPSKED++R+L+ +L LPKD   
Sbjct  167   TLISQAVVIGVSCRLDADQLLEKRIRSRFSHRKLLFVPPSKEDVQRLLECLLHLPKDSSF  226

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+KYV  FN +L +ILSD KFK++++SL   D + ++LLR LF AV  MDM+SG LSL+N
Sbjct  227   PSKYVTEFNRRLSNILSDKKFKEVLDSLLDVDGSVSNLLRLLFRAVSYMDMESGLLSLEN  286

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F++A   T RQPK++ L+D SILELYILVC+ RLE  EQ + NFNSIMKEYK +HD++KT
Sbjct  287   FKSAYLCTYRQPKIDNLEDASILELYILVCMNRLETKEQNSYNFNSIMKEYKAIHDAYKT  346

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA +VCLRAFEHLL++ELI F +++G   SIEF PV+LLIS  EL QGL S   CP 
Sbjct  347   SDNYANNVCLRAFEHLLEQELIGFTDSKGRTPSIEFHPVKLLISSRELYQGLTSNSSCPA  406

Query  1081  ILHKL  1095
             IL KL
Sbjct  407   ILQKL  411



>ref|XP_002456156.1| hypothetical protein SORBIDRAFT_03g031370 [Sorghum bicolor]
 gb|EES01276.1| hypothetical protein SORBIDRAFT_03g031370 [Sorghum bicolor]
Length=422

 Score =   506 bits (1302),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 249/365 (68%), Positives = 303/365 (83%), Gaps = 0/365 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AV+++VL+ L KE PD ISVI+LNG+LHSDDNCA+KEI RQLC
Sbjct  51    ACNNSVLLLGPRGCGKAAVVDMVLDDLNKEHPDAISVIRLNGMLHSDDNCAMKEIARQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL FSKMAS DDN++F+I MLRECGLAHKT++FVL+EFDLF QGKQRLLYSLLDAMQ
Sbjct  111   LEHQLSFSKMASSDDNTEFMIDMLRECGLAHKTILFVLEEFDLFAQGKQRLLYSLLDAMQ  170

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+F+ PS +D++R+++H+L+L KD GL
Sbjct  171   SLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFISPSLDDIQRLVEHLLILAKDSGL  230

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P KY+  +N++L SI SD KFK  + SL   D+T +++LRFLF AV  MDM+SGFL +++
Sbjct  231   PEKYITDYNSRLTSIFSDKKFKGCLNSLMDADATTSNILRFLFRAVSYMDMESGFLPIES  290

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+ QRQPK++ L+D SILELYILVC+ RLE  EQ + NF SIMKEY+ + D++KT
Sbjct  291   FLKALSSMQRQPKMDSLQDLSILELYILVCMHRLEDKEQSSYNFTSIMKEYRSIQDAYKT  350

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA  VC RAFEHLL RELISF +NRG NQ++E+RPV+LL+S  EL Q LK    CP 
Sbjct  351   SDKYASTVCFRAFEHLLDRELISFGDNRGRNQALEYRPVKLLVSSRELAQSLKLNTTCPA  410

Query  1081  ILHKL  1095
             +L KL
Sbjct  411   VLQKL  415



>ref|XP_010506870.1| PREDICTED: origin recognition complex subunit 4-like [Camelina 
sativa]
Length=421

 Score =   505 bits (1300),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 244/362 (67%), Positives = 301/362 (83%), Gaps = 0/362 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  LL+EFPD +S+I+LNGLLHSDDNCA KEI RQLC
Sbjct  52    GCNNSILLLGPRGSGKAAVLDLVVGDLLEEFPDSVSLIRLNGLLHSDDNCAFKEIARQLC  111

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMAS D+NSQF++AMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  112   MEHHLLFSKMASLDENSQFIVAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  171

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIG+S RLDADQLLEKRVRSRFSHRK++FLPPS+E+ + +L+H+L LP D   
Sbjct  172   SVTSQAVVIGLSSRLDADQLLEKRVRSRFSHRKILFLPPSREEFDGLLEHLLSLPADSSF  231

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  YV  FN K+ +I SD +FKDI+ +L   +ST N LL+F+F AV  M+++SG LSL+N
Sbjct  232   PNGYVSRFNEKIKNITSDTRFKDILRTLFNANSTVNSLLKFIFRAVSLMNLESGLLSLEN  291

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPKLE ++DCSILELY+LVC+RRLE  EQ   N  S+MKEYK +H+SF+T
Sbjct  292   FKAALSSMQRQPKLEAVRDCSILELYLLVCMRRLEVKEQSAYNIISVMKEYKTIHESFQT  351

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLRAFEHL +R++I + ENR  +Q+ E+RP++LLIS  EL QG++S  CCPV
Sbjct  352   SDYYAQNVCLRAFEHLRERQVIRYTENRVQSQTGEYRPMKLLISASELHQGMRSHACCPV  411

Query  1081  IL  1086
              L
Sbjct  412   SL  413



>emb|CDY57511.1| BnaC07g48740D [Brassica napus]
Length=420

 Score =   504 bits (1299),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 244/369 (66%), Positives = 310/369 (84%), Gaps = 3/369 (1%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  L++E+PD +++I+LNGLLHS+DNCA KEI RQLC
Sbjct  50    GCNNSILLLGPRGSGKAAVLDLVVGDLMEEYPDSVTLIRLNGLLHSEDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQ--GKQRLLYSLLDA  354
              EH L+FSKMASFD+NSQF+IAMLRECGLAHKT+IFVLDEFD+F Q  GKQRLLYSLLDA
Sbjct  110   MEHHLLFSKMASFDENSQFIIAMLRECGLAHKTIIFVLDEFDMFAQASGKQRLLYSLLDA  169

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDF  534
             MQSVTSQAVV+G+S RLDADQLLEKRVRSRFSHRK++FLPPS+E+++ +L+H+L LP D 
Sbjct  170   MQSVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKILFLPPSREEIDSLLEHLLSLPADS  229

Query  535   GLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSL  714
               P+ YV  FN K+ +I SD +FKD++++    +ST N LL+F+F AV  M+++SG LSL
Sbjct  230   SFPSGYVTQFNEKIKNITSDTRFKDMLKTFLNANSTVNSLLKFIFRAVSSMNLESGLLSL  289

Query  715   DNFRTALSNTQRQPKLECLK-DCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDS  891
             +NF+TALS+  RQPKLE ++ DCSILELY+LVC+RRLE  EQ + NF S+MKEYK +HDS
Sbjct  290   ENFKTALSSMLRQPKLEAVRADCSILELYLLVCMRRLEVKEQSSYNFISVMKEYKTIHDS  349

Query  892   FKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGC  1071
             F+TSD+YA++VCLRAFEHL +RE+I + ENRG +Q+ E+RP++LLIS  EL QG++S  C
Sbjct  350   FQTSDFYAQNVCLRAFEHLREREVICYAENRGQSQAGEYRPMKLLISASELHQGMRSHAC  409

Query  1072  CPVILHKLI  1098
             CP IL KL+
Sbjct  410   CPAILLKLL  418



>ref|XP_007142987.1| hypothetical protein PHAVU_007G034200g [Phaseolus vulgaris]
 gb|ESW14981.1| hypothetical protein PHAVU_007G034200g [Phaseolus vulgaris]
Length=417

 Score =   503 bits (1295),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 247/366 (67%), Positives = 302/366 (83%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK+AVLE+V++ LL+E+PD ISVI+LNGLLH DD  A KEI RQLC
Sbjct  48    ACNNSILLLGPRGSGKSAVLEVVIQDLLQEYPDSISVIRLNGLLHCDDISAFKEIARQLC  107

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSK ASFDDNSQF++A+L+ECGLAHKT+IFVL+EFDLF +GKQRLLYSLLDAMQ
Sbjct  108   MEHQLLFSKAASFDDNSQFMVAILKECGLAHKTIIFVLEEFDLFARGKQRLLYSLLDAMQ  167

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVV+G+SCRLDADQLLEKRVRSRFSHRKL+FLPPS ED +++L H+L LP D   
Sbjct  168   SITSQAVVLGISCRLDADQLLEKRVRSRFSHRKLLFLPPSMEDSQKLLIHMLTLPIDSSF  227

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN K+ +I+ D KFK+ ++     DS   HLLRFLF AV  MDM++GFLS +N
Sbjct  228   PHDYAVEFNRKVQNIIEDRKFKETIKKYLNVDSCIKHLLRFLFCAVSHMDMQTGFLSQEN  287

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  A S+ QRQPKLECL++CS LEL+ILVC++RLE  EQ  CNFNS+MKEYK +HDSF+T
Sbjct  288   FEIAFSSIQRQPKLECLRNCSNLELHILVCMKRLEVKEQSLCNFNSVMKEYKSMHDSFRT  347

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             S+YY+R+VCLRAFEHL+ RE+I F +NRG + ++EFRPV+LLIS  EL QGLK++  CP 
Sbjct  348   SEYYSRNVCLRAFEHLIHREMICFTDNRGQSLTVEFRPVKLLISSAELHQGLKAYSSCPA  407

Query  1081  ILHKLI  1098
              L KL+
Sbjct  408   YLLKLM  413



>ref|XP_010527756.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Tarenaya 
hassleriana]
Length=418

 Score =   503 bits (1294),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 251/366 (69%), Positives = 302/366 (83%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNN++LLLGPRG GK AV +LV+  LL+EFPD +SVI+LNGLLHSDDNCA KEI RQLC
Sbjct  50    GCNNTILLLGPRGSGKAAVFDLVVGDLLQEFPDSVSVIRLNGLLHSDDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             +EH L+FSKMASFD+N QF+IAMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  110   TEHHLLFSKMASFDENLQFMIAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+G+S RLDADQLLEKRVRSRFS+RKL+FLPPSKE+L+ +L H+L L  D   
Sbjct  170   SVTSQAVVVGISSRLDADQLLEKRVRSRFSNRKLLFLPPSKEELDSLLVHLLSLHTDSSF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
               +YV  FN ++  I +D +FKDI+E+    +ST N LL+ LFSAV  MD+ SG LSL+N
Sbjct  230   SNEYVTQFNERIKKITADARFKDILETFFNANSTVNSLLKLLFSAVSSMDLNSGLLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F++ALS  QRQ KLE ++DCS+LELYILVC++RLEA EQ + NFNS+MKEYK +HDSF+T
Sbjct  290   FKSALSIMQRQTKLEAVRDCSVLELYILVCMKRLEAKEQSSYNFNSVMKEYKAIHDSFQT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR VCLRAFEHLLQRELI + +NRG  Q++E+RP  LLIS  EL  G++S  CCP 
Sbjct  350   SDYYARTVCLRAFEHLLQRELICYADNRGQAQTVEYRPANLLISAFELHHGMRSHKCCPA  409

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  410   ILLKLL  415



>ref|XP_011070734.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Sesamum 
indicum]
Length=371

 Score =   499 bits (1286),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 248/321 (77%), Positives = 285/321 (89%), Gaps = 1/321 (0%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            ACNNSVLLLGPRGCGK AVLE+VLE LLKE PDMISVI+LNGLLH D+NCALKEI RQLC
Sbjct  50   ACNNSVLLLGPRGCGKVAVLEIVLEELLKEHPDMISVIRLNGLLHCDNNCALKEIARQLC  109

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             EH L+FSKMAS+DDNSQFL++MLRECGLAHKT++FVLDEFDLFTQGKQRLLYSLLDAMQ
Sbjct  110  LEHHLMFSKMASYDDNSQFLLSMLRECGLAHKTIVFVLDEFDLFTQGKQRLLYSLLDAMQ  169

Query  361  SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
            S+TSQAVV+GVSCRLDADQLLEKRVRSRFSHRKL+FLPPS+ED +R+++HILLLP D  L
Sbjct  170  SITSQAVVVGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSREDCQRLVEHILLLPTDSSL  229

Query  541  PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
            P  Y  AFN KLL+IL+D+KFK I+++LC  DS+  HLLRFLFSA+C MDM SGFLS+ N
Sbjct  230  PNDYTAAFNAKLLNILADEKFKGIIDTLCYSDSSVGHLLRFLFSAICHMDMNSGFLSVKN  289

Query  721  FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
            F++AL + QRQPKLE LKDCS+LELYILVC++RLE  E E CNFNSIMKEYK +HD+F+T
Sbjct  290  FKSALRSMQRQPKLEALKDCSVLELYILVCMKRLEVKELELCNFNSIMKEYKSIHDTFQT  349

Query  901  SDYYARDVCLRAFEH-LLQRE  960
            SDYYAR+VCLRA  H L+ RE
Sbjct  350  SDYYARNVCLRAILHKLMDRE  370



>ref|NP_001105072.1| origin recognition complex subunit 4 [Zea mays]
 gb|AAL10455.1|AF417484_1 origin recognition complex subunit 4 [Zea mays]
Length=422

 Score =   501 bits (1289),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 245/365 (67%), Positives = 304/365 (83%), Gaps = 0/365 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AV+++VL+ L +E PD ISVI+LNG+LH+DDNCA+KEI RQLC
Sbjct  51    ACNNSVLLLGPRGCGKAAVVDMVLDDLKEEHPDAISVIRLNGMLHNDDNCAMKEIARQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             SEHQL FSKMAS DDN++F+I MLRECGLAHKT++F+L+EFDLF QGKQRLLYSLLDAMQ
Sbjct  111   SEHQLSFSKMASSDDNTEFMIDMLRECGLAHKTILFILEEFDLFAQGKQRLLYSLLDAMQ  170

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+F+ PS +D++R+++H+L+L KD GL
Sbjct  171   SLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFISPSLDDMQRLVEHLLILAKDSGL  230

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+KY+  +N++L SI SD KFK  + SL   D+T +++ RFLF AV  MDM+SGFLS+++
Sbjct  231   PSKYIADYNSRLTSIFSDKKFKGCLNSLMDADATTSNIQRFLFRAVSYMDMESGFLSVES  290

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+ QRQPK++ L+D SILELYILVC+ RLE+ EQ + NF  IMKEY+ + D++KT
Sbjct  291   FLKALSSMQRQPKMDSLQDLSILELYILVCMHRLESKEQTSYNFTRIMKEYRSIQDAYKT  350

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA  VC RAFEHLL RELISF +NR  NQ++E+RPV+LLIS  EL + LK    CP 
Sbjct  351   SDKYASTVCFRAFEHLLDRELISFGDNRWRNQALEYRPVKLLISSRELAESLKLNTTCPA  410

Query  1081  ILHKL  1095
             +L KL
Sbjct  411   VLQKL  415



>ref|XP_004969563.1| PREDICTED: origin recognition complex subunit 4-like isoform 
X2 [Setaria italica]
Length=422

 Score =   501 bits (1289),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 251/365 (69%), Positives = 302/365 (83%), Gaps = 2/365 (1%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AV+++VLE L KE PD ISVI+LNG+LHSDDNCA KEI RQLC
Sbjct  53    ACNNSVLLLGPRGCGKAAVVDMVLEDLKKEHPDAISVIRLNGMLHSDDNCATKEIARQLC  112

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL FSKMAS DDN++F+I MLRECGLAHKT++F+L+EFDLF QGKQRLLYSLLDAMQ
Sbjct  113   LEHQLSFSKMASSDDNTEFIIDMLRECGLAHKTILFILEEFDLFAQGKQRLLYSLLDAMQ  172

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+F+P S ED +R+++H+L+L KD GL
Sbjct  173   SLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFVPSSLEDTQRLVEHLLILAKDSGL  232

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P KY+  +N++L +I SD KFK I+ SL   D+T +++LRFL  AV  MDM+SGFLS+++
Sbjct  233   PAKYITDYNSRLTNIFSDKKFKGILNSLMDADATTSNILRFL--AVSYMDMESGFLSMES  290

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+ QRQPK++ L+D SILELYILVC+ RLE  EQ + NF SIMKEY+ + D++KT
Sbjct  291   FLKALSSLQRQPKMDSLQDLSILELYILVCMHRLEDKEQSSYNFTSIMKEYRSIQDAYKT  350

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA  VC RAFEHLL RELISF +NRG NQ++E+RPV+LLIS  EL Q LK    CP 
Sbjct  351   SDKYASTVCFRAFEHLLDRELISFGDNRGRNQALEYRPVKLLISSRELAQSLKLNTTCPA  410

Query  1081  ILHKL  1095
             +L KL
Sbjct  411   LLQKL  415



>ref|NP_178222.4| origin recognition complex subunit 4 [Arabidopsis thaliana]
 gb|AEC05403.1| origin recognition complex subunit 4 [Arabidopsis thaliana]
Length=418

 Score =   500 bits (1287),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 244/367 (66%), Positives = 301/367 (82%), Gaps = 1/367 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+L    LL++FPD +SVI+LNGLLHSDDNCA KEI +QLC
Sbjct  50    GCNNSMLLLGPRGSGKAAVLDLXXGXLLEQFPDSVSVIRLNGLLHSDDNCAFKEIAKQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLD-AM  357
              EH L+FSKMASFDDNSQF+IAMLR CGLAHKT+IFVLDEFD+F QGKQRLLYS LD AM
Sbjct  110   MEHHLLFSKMASFDDNSQFIIAMLRACGLAHKTIIFVLDEFDMFAQGKQRLLYSXLDDAM  169

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFG  537
             QSVTSQAVV+G+S RLDADQLLEKRVRSRFSHRK +FLPPS+E+L+ +  H+L LP D G
Sbjct  170   QSVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKFLFLPPSREELDGLFVHLLSLPADSG  229

Query  538   LPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLD  717
              P+ YV  FN K+ ++ SD +FKDI+++L   +ST N  L+F+F AV  M+++SG LSL+
Sbjct  230   FPSGYVSRFNDKIKNLTSDTRFKDILKTLFNANSTVNSFLKFIFCAVSLMNLESGLLSLE  289

Query  718   NFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFK  897
             NF+ ALS+ QRQPKLE ++DCS+LELY+LVC+RRLE  EQ + NF S+MKEYK +HDSF 
Sbjct  290   NFKAALSSMQRQPKLEAVRDCSVLELYLLVCMRRLEVKEQSSYNFISVMKEYKAIHDSFH  349

Query  898   TSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCP  1077
             TSDYYA++VCLRAFEHL +R++I + ENRG +Q+ E+R  +LLIS  EL QG++S  CCP
Sbjct  350   TSDYYAQNVCLRAFEHLRERQVICYAENRGQSQTGEYRLQKLLISASELHQGMRSHACCP  409

Query  1078  VILHKLI  1098
              IL KL+
Sbjct  410   AILLKLL  416



>gb|EEE55188.1| hypothetical protein OsJ_03032 [Oryza sativa Japonica Group]
Length=425

 Score =   499 bits (1284),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 246/366 (67%), Positives = 299/366 (82%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AV+++VL+ L K+ PD ISVI+LNG+LHSDDNCA KEI RQLC
Sbjct  54    ACNNSVLLLGPRGCGKAAVVDMVLDDLKKDHPDAISVIRLNGMLHSDDNCATKEIARQLC  113

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL FSKMAS DDN++F+I MLRECGLAHKT+IFVL+EFDLF QGKQRLLYSLLDAMQ
Sbjct  114   LEHQLSFSKMASSDDNTEFMIDMLRECGLAHKTIIFVLEEFDLFAQGKQRLLYSLLDAMQ  173

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+F+P S + L+R+++H+L LP+D  L
Sbjct  174   SLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFVPSSVDSLQRLMEHLLALPEDSPL  233

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             PTKYV  +N ++ SI +D KFK I+ SL   D+T +H+LRFLF  V  MD+ SG LS+ +
Sbjct  234   PTKYVREYNARITSIFNDKKFKGILSSLTDADATTSHILRFLFRVVSYMDIDSGLLSMQS  293

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+ QRQPK++ L+D SILELYILVC+ RLE  E+ + NF +IMKEYK V D++KT
Sbjct  294   FMNALSSMQRQPKMDSLQDLSILELYILVCMNRLEDKEKSSYNFITIMKEYKSVQDAYKT  353

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD Y+  VC RAFEHLL RELISF +N+G NQ++E+RPV+LLIS  EL + LK    CP 
Sbjct  354   SDKYSHTVCFRAFEHLLDRELISFADNKGRNQALEYRPVKLLISSRELAESLKLNTTCPA  413

Query  1081  ILHKLI  1098
             +L KL+
Sbjct  414   VLQKLL  419



>emb|CAE52912.1| putative origin recognition complex subunit 4 [Arabidopsis thaliana]
Length=442

 Score =   499 bits (1285),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 242/359 (67%), Positives = 299/359 (83%), Gaps = 0/359 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  LL++FPD +SVI+LNGLLHSDDNCA KEI RQLC
Sbjct  50    GCNNSMLLLGPRGSGKAAVLDLVVGDLLEQFPDSVSVIRLNGLLHSDDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFDDNSQF+IAMLR CGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  110   MEHHLLFSKMASFDDNSQFIIAMLRACGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+G+S RLDADQLLEKRVRSRFSHRK +FLPPS+E+L+ +  H+L LP D G 
Sbjct  170   SVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKFLFLPPSREELDGLFVHLLSLPADSGF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+ YV  FN K+ ++ SD +FKDI+++L   ++T N  L+F+F AV  M+++SG LSL+N
Sbjct  230   PSGYVSRFNDKIKNLTSDTRFKDILKTLFNANTTVNSFLKFIFCAVSLMNLESGLLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPKLE ++DCS+LELY+LVC+RRLE  EQ + NF S+MKEYK +HDSF T
Sbjct  290   FKAALSSMQRQPKLEAVRDCSVLELYLLVCMRRLEVKEQSSYNFISVMKEYKAIHDSFHT  349

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCP  1077
             SDYYA++VCLRAFEHL +R++I + ENRG +Q+ E+R  +LLIS  EL QG++S  CCP
Sbjct  350   SDYYAQNVCLRAFEHLRERQVICYAENRGQSQTGEYRLQKLLISASELHQGMRSHACCP  408



>gb|ACR36393.1| unknown [Zea mays]
Length=422

 Score =   497 bits (1280),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 244/365 (67%), Positives = 303/365 (83%), Gaps = 0/365 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AV+++VL+ L +E PD ISVI+LNG+LH+DDNCA+KEI RQLC
Sbjct  51    ACNNSVLLLGPRGCGKAAVVDMVLDDLKEEHPDAISVIRLNGMLHNDDNCAMKEIARQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL FSKMAS DDN++F+I MLRECGLAHKT++F+L+EFDLF QGKQRLLYSLLDAMQ
Sbjct  111   LEHQLSFSKMASSDDNTEFMIDMLRECGLAHKTILFILEEFDLFAQGKQRLLYSLLDAMQ  170

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+F+ PS +D++R+++H+L+L KD GL
Sbjct  171   SLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFISPSLDDIQRLVEHLLILAKDSGL  230

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+KY+  +N++L SI SD KFK  + SL   D+T +++ RFLF AV  MDM+SGFLS+++
Sbjct  231   PSKYIADYNSRLTSIFSDKKFKGCLNSLMDADATTSNIQRFLFRAVSYMDMESGFLSVES  290

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+ QRQPK++ L+D SILELYILVC+ RLE+ EQ + NF SIMKEY+ + D++KT
Sbjct  291   FLKALSSMQRQPKMDSLQDLSILELYILVCMHRLESKEQTSYNFTSIMKEYRSIQDAYKT  350

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA  VC RAFEHL  RELISF +NR  NQ++E+RPV+LLIS  EL + LK    CP 
Sbjct  351   SDKYASTVCFRAFEHLSDRELISFGDNRWRNQALEYRPVKLLISSRELAESLKLNTTCPA  410

Query  1081  ILHKL  1095
             +L KL
Sbjct  411   VLQKL  415



>ref|XP_006646209.1| PREDICTED: origin recognition complex subunit 4-like [Oryza brachyantha]
Length=422

 Score =   496 bits (1276),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 244/366 (67%), Positives = 297/366 (81%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AV+++VL+ L KE PD ISVI+LNG+LH+DDNCA+KEI RQLC
Sbjct  51    ACNNSVLLLGPRGCGKAAVVDMVLDDLRKEHPDAISVIRLNGMLHTDDNCAMKEIVRQLC  110

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL FSKMAS DDN++F+I MLRECGLAHKT+IFVL+EFDLF QGKQRLLYSLLDAMQ
Sbjct  111   LEHQLSFSKMASSDDNTEFMIDMLRECGLAHKTIIFVLEEFDLFAQGKQRLLYSLLDAMQ  170

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+F+P S + L R+++ +L LP+D  L
Sbjct  171   SLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFVPSSVDSLRRLMEQLLTLPEDSPL  230

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
              TKY+  +N ++ SI +D KFK ++ SL   D+T +H+LRFLF  V  MDM SG LS+ +
Sbjct  231   LTKYIMEYNARVTSIFNDKKFKGVLNSLTDADATTSHILRFLFRVVSYMDMDSGLLSMQS  290

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+ QRQPK++ L+D SILELYILVC+ RLE  E  + NF +IMKEYK V D++KT
Sbjct  291   FMNALSSMQRQPKMDSLQDLSILELYILVCMNRLEDKEHSSYNFINIMKEYKSVQDAYKT  350

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD Y+  VC RAFEHLL RELISFV+N+G NQ++E+RPV+LL+S  EL Q LK    CP 
Sbjct  351   SDKYSHTVCFRAFEHLLDRELISFVDNKGRNQTLEYRPVKLLVSSRELAQSLKLNTTCPA  410

Query  1081  ILHKLI  1098
             +L KL+
Sbjct  411   VLQKLL  416



>dbj|BAK06637.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=424

 Score =   495 bits (1274),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 246/366 (67%), Positives = 301/366 (82%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AVL++VLE L KE PD ISVI+LNG+LHSDDNCA KEI RQLC
Sbjct  53    ACNNSVLLLGPRGCGKGAVLDMVLEDLRKEHPDAISVIRLNGMLHSDDNCATKEIARQLC  112

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL FSKMAS DDN++F+I MLRECGLAHKTVIFVL+EFDLF QGKQRLLYSLLDAMQ
Sbjct  113   LEHQLSFSKMASSDDNTEFMIDMLRECGLAHKTVIFVLEEFDLFAQGKQRLLYSLLDAMQ  172

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIG+SCRLDADQLLEKRVRSRFSHRKL+F+P S +D++R+++H+L+L KD  L
Sbjct  173   SLTSQAVVIGMSCRLDADQLLEKRVRSRFSHRKLLFVPSSLDDIQRLMEHLLMLEKDSSL  232

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             PT YV  +N++L SI S+ KFK +++SL   D+T +++LRFLF  V  MDM+SG LS++ 
Sbjct  233   PTNYVTEYNSRLTSIFSNKKFKGVLDSLTDTDATTSNILRFLFRVVSYMDMESGLLSMEC  292

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+ QRQPK++ L+D SILELYILVC+ RLE  EQ++ NFN+I+KEYK + D++KT
Sbjct  293   FTDALSSMQRQPKMDSLQDLSILELYILVCMNRLEDKEQKSYNFNTIIKEYKSIQDAYKT  352

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA  VC RAFEHLL RELI+F + +G N ++E+RPV+LLIS  EL Q L     CP 
Sbjct  353   SDKYATTVCFRAFEHLLDRELITFADTKGRNVALEYRPVKLLISSRELAQSLNLNTTCPA  412

Query  1081  ILHKLI  1098
             +L KL+
Sbjct  413   VLQKLL  418



>ref|XP_002875061.1| hypothetical protein ARALYDRAFT_322461 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51320.1| hypothetical protein ARALYDRAFT_322461 [Arabidopsis lyrata subsp. 
lyrata]
Length=454

 Score =   495 bits (1274),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 242/371 (65%), Positives = 301/371 (81%), Gaps = 11/371 (3%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  LL++FPD +SVI+LNGLLHSDDNCA KEI RQLC
Sbjct  50    GCNNSILLLGPRGSGKAAVLDLVVGDLLEQFPDSVSVIRLNGLLHSDDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQ-----------GKQ  327
              EH L+FSKMASFD+NS F+IAMLRECGLAHKT+IFVLDEFD+F Q           GKQ
Sbjct  110   MEHHLLFSKMASFDENSHFIIAMLRECGLAHKTIIFVLDEFDMFAQARILISFNLLIGKQ  169

Query  328   RLLYSLLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILK  507
             RLLYSLLDAMQSVTSQAVVIG+S RLDADQLLEKRVRSRFSHRK++FLPPS+++L+ +L+
Sbjct  170   RLLYSLLDAMQSVTSQAVVIGISSRLDADQLLEKRVRSRFSHRKILFLPPSRDELDGLLE  229

Query  508   HILLLPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQM  687
             H+L LP D   P+ YV  FN K+ +I SD +FKDI+++     ST N  L+F+F AV  M
Sbjct  230   HLLSLPADSSFPSGYVSRFNDKIKNITSDRRFKDILKTFFNAHSTVNSFLKFIFCAVSLM  289

Query  688   DMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMK  867
             +++SG LSL+NF+ ALS  QRQPKLE ++DCS+LELY+LVC+RRLE  EQ + NF S+MK
Sbjct  290   NLESGLLSLENFKAALSRMQRQPKLEAVRDCSVLELYLLVCMRRLEVKEQNSYNFISVMK  349

Query  868   EYKIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQ  1047
             EYK +HDSF+TSDYYA++VC+R FEHL +R++I + ENRG +Q+ E+RP++LLIS  EL 
Sbjct  350   EYKAIHDSFQTSDYYAQNVCIRGFEHLRERQVICYAENRGQSQTGEYRPMKLLISASELH  409

Query  1048  QGLKSWGCCPV  1080
             QG++S  CCPV
Sbjct  410   QGMRSHACCPV  420



>ref|NP_001189493.1| origin recognition complex subunit 4 [Arabidopsis thaliana]
 gb|AEC05404.1| origin recognition complex subunit 4 [Arabidopsis thaliana]
Length=424

 Score =   493 bits (1270),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 244/373 (65%), Positives = 301/373 (81%), Gaps = 7/373 (2%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+L    LL++FPD +SVI+LNGLLHSDDNCA KEI +QLC
Sbjct  50    GCNNSMLLLGPRGSGKAAVLDLXXGXLLEQFPDSVSVIRLNGLLHSDDNCAFKEIAKQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLD-AM  357
              EH L+FSKMASFDDNSQF+IAMLR CGLAHKT+IFVLDEFD+F QGKQRLLYS LD AM
Sbjct  110   MEHHLLFSKMASFDDNSQFIIAMLRACGLAHKTIIFVLDEFDMFAQGKQRLLYSXLDDAM  169

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFG  537
             QSVTSQAVV+G+S RLDADQLLEKRVRSRFSHRK +FLPPS+E+L+ +  H+L LP D G
Sbjct  170   QSVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKFLFLPPSREELDGLFVHLLSLPADSG  229

Query  538   LPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFL------FSAVCQMDMKS  699
              P+ YV  FN K+ ++ SD +FKDI+++L   +ST N  L+F+      F AV  M+++S
Sbjct  230   FPSGYVSRFNDKIKNLTSDTRFKDILKTLFNANSTVNSFLKFILSLDVRFCAVSLMNLES  289

Query  700   GFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKI  879
             G LSL+NF+ ALS+ QRQPKLE ++DCS+LELY+LVC+RRLE  EQ + NF S+MKEYK 
Sbjct  290   GLLSLENFKAALSSMQRQPKLEAVRDCSVLELYLLVCMRRLEVKEQSSYNFISVMKEYKA  349

Query  880   VHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLK  1059
             +HDSF TSDYYA++VCLRAFEHL +R++I + ENRG +Q+ E+R  +LLIS  EL QG++
Sbjct  350   IHDSFHTSDYYAQNVCLRAFEHLRERQVICYAENRGQSQTGEYRLQKLLISASELHQGMR  409

Query  1060  SWGCCPVILHKLI  1098
             S  CCP IL KL+
Sbjct  410   SHACCPAILLKLL  422



>dbj|BAC77041.1| origin recognition complex 4 [Oryza sativa Japonica Group]
Length=425

 Score =   493 bits (1268),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 243/366 (66%), Positives = 295/366 (81%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AV+++VL+   K+ PD ISVI+LNG+LHSDDNCA KEI RQLC
Sbjct  54    ACNNSVLLLGPRGCGKAAVVDMVLDDPKKDHPDAISVIRLNGMLHSDDNCATKEIARQLC  113

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL FSKMAS DDN++F+I MLRECGLAHKT+IFVL+EFDLF QGKQRLLYSLLDAMQ
Sbjct  114   LEHQLSFSKMASSDDNTEFMIDMLRECGLAHKTIIFVLEEFDLFAQGKQRLLYSLLDAMQ  173

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+F+P S + L+R+++H+L LP+D  L
Sbjct  174   SLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFVPSSVDSLQRLMEHLLALPEDSPL  233

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             PTKYV  +N ++ SI +D KFK I+ SL   D+T +H+LRFLF  V  MD+ SG LS+ +
Sbjct  234   PTKYVREYNARITSIFNDKKFKGILSSLTDADATTSHILRFLFRVVSYMDIDSGLLSMQS  293

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+ QRQPK++ L+D SILELYILVC+ RLE  E+ + NF +IMKEYK V D++KT
Sbjct  294   FMNALSSMQRQPKMDGLQDLSILELYILVCMNRLEDKEKSSYNFITIMKEYKSVQDAYKT  353

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD Y+  VC RAFEHLL RELISF +N+G NQ++E+RPV+LLIS  EL   L     CP 
Sbjct  354   SDKYSHTVCFRAFEHLLDRELISFADNKGRNQALEYRPVKLLISSLELADSLNLNTTCPA  413

Query  1081  ILHKLI  1098
             +  KL+
Sbjct  414   VFQKLL  419



>ref|XP_010527758.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Tarenaya 
hassleriana]
Length=393

 Score =   489 bits (1259),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 244/366 (67%), Positives = 291/366 (80%), Gaps = 25/366 (7%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNN++LLLGPRG GK AV +LV+  LL+EFPD +SVI+LNGLLHSDDNCA KEI RQLC
Sbjct  50    GCNNTILLLGPRGSGKAAVFDLVVGDLLQEFPDSVSVIRLNGLLHSDDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             +EH L+FSKMASFD+N QF+IAMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  110   TEHHLLFSKMASFDENLQFMIAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+G+S RLDADQLLEKRVRSRFS+RKL+FLPPSKE+L+ +LK           
Sbjct  170   SVTSQAVVVGISSRLDADQLLEKRVRSRFSNRKLLFLPPSKEELDSLLK-----------  218

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
                           I +D +FKDI+E+    +ST N LL+ LFSAV  MD+ SG LSL+N
Sbjct  219   --------------ITADARFKDILETFFNANSTVNSLLKLLFSAVSSMDLNSGLLSLEN  264

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F++ALS  QRQ KLE ++DCS+LELYILVC++RLEA EQ + NFNS+MKEYK +HDSF+T
Sbjct  265   FKSALSIMQRQTKLEAVRDCSVLELYILVCMKRLEAKEQSSYNFNSVMKEYKAIHDSFQT  324

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR VCLRAFEHLLQRELI + +NRG  Q++E+RP  LLIS  EL  G++S  CCP 
Sbjct  325   SDYYARTVCLRAFEHLLQRELICYADNRGQAQTVEYRPANLLISAFELHHGMRSHKCCPA  384

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  385   ILLKLL  390



>ref|XP_009418848.1| PREDICTED: origin recognition complex subunit 4 [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   486 bits (1250),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 249/371 (67%), Positives = 301/371 (81%), Gaps = 2/371 (1%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             A NNS LLLGPRG GK AV++LVLE L  E PD ISVI+L+GLLH DDNCA KEI RQLC
Sbjct  46    AYNNSALLLGPRGSGKIAVVDLVLEDLKAEHPDTISVIRLSGLLHHDDNCAHKEIARQLC  105

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMAS DDNSQF+I M+RECGLAHK+++FVLDEFDLF QGKQRLLYSLLDAMQ
Sbjct  106   LEHQLLFSKMASSDDNSQFMIDMMRECGLAHKSIVFVLDEFDLFAQGKQRLLYSLLDAMQ  165

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             ++TSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+F+PPS+E+++R+L++IL LP+D GL
Sbjct  166   TLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFVPPSREEIKRLLEYILYLPQDSGL  225

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+KY+  FN+++ +IL+D  F  I++SL   D T ++L++FLF AV  ++++SG LSLDN
Sbjct  226   PSKYITEFNSRVQNILNDKNFDKILDSLLDVDGTVSNLVQFLFRAVSFINLESGLLSLDN  285

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ A    QRQPK + L D SILELYILVC+ RLE  EQ+  NFNS+MKEYK +HD++KT
Sbjct  286   FKNAQICNQRQPKTDSLHDVSILELYILVCMNRLERKEQDLYNFNSVMKEYKAIHDAYKT  345

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD Y   VCLRAFEHLL+RELISFVE +G N SIEFRPV+LLIS  EL  GLKS   CPV
Sbjct  346   SDSYELSVCLRAFEHLLERELISFVEYKGRNLSIEFRPVKLLISPRELYLGLKSNSSCPV  405

Query  1081  ILHKLI*SQPC  1113
                  + + PC
Sbjct  406   --SYFVVTHPC  414



>ref|XP_010527757.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Tarenaya 
hassleriana]
Length=399

 Score =   484 bits (1246),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 239/366 (65%), Positives = 287/366 (78%), Gaps = 19/366 (5%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNN++LLLGPRG GK                   + I+LNGLLHSDDNCA KEI RQLC
Sbjct  50    GCNNTILLLGPRGSGK-------------------AAIRLNGLLHSDDNCAFKEIARQLC  90

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             +EH L+FSKMASFD+N QF+IAMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  91    TEHHLLFSKMASFDENLQFMIAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  150

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+G+S RLDADQLLEKRVRSRFS+RKL+FLPPSKE+L+ +L H+L L  D   
Sbjct  151   SVTSQAVVVGISSRLDADQLLEKRVRSRFSNRKLLFLPPSKEELDSLLVHLLSLHTDSSF  210

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
               +YV  FN ++  I +D +FKDI+E+    +ST N LL+ LFSAV  MD+ SG LSL+N
Sbjct  211   SNEYVTQFNERIKKITADARFKDILETFFNANSTVNSLLKLLFSAVSSMDLNSGLLSLEN  270

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F++ALS  QRQ KLE ++DCS+LELYILVC++RLEA EQ + NFNS+MKEYK +HDSF+T
Sbjct  271   FKSALSIMQRQTKLEAVRDCSVLELYILVCMKRLEAKEQSSYNFNSVMKEYKAIHDSFQT  330

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYAR VCLRAFEHLLQRELI + +NRG  Q++E+RP  LLIS  EL  G++S  CCP 
Sbjct  331   SDYYARTVCLRAFEHLLQRELICYADNRGQAQTVEYRPANLLISAFELHHGMRSHKCCPA  390

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  391   ILLKLL  396



>ref|XP_003536655.1| PREDICTED: origin recognition complex subunit 4-like [Glycine 
max]
Length=413

 Score =   483 bits (1243),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 247/366 (67%), Positives = 293/366 (80%), Gaps = 4/366 (1%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GKNAVLELV++ LL+E+PD +SVI+LNGLLHSDD  A KEI RQLC
Sbjct  48    ACNNSILLLGPRGSGKNAVLELVIQDLLQEYPDSVSVIRLNGLLHSDDISAFKEIARQLC  107

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSK ASFDDNSQF++A+L+ECGLAHKTVIFVLDEF LF QGKQRLLYSLLDAMQ
Sbjct  108   MEHQLLFSKAASFDDNSQFMVAILKECGLAHKTVIFVLDEFHLFAQGKQRLLYSLLDAMQ  167

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVV+G+SCRLDADQLLEKRVRSRFSHRKL+FLPPS ED +++L HIL LP D   
Sbjct  168   SITSQAVVLGISCRLDADQLLEKRVRSRFSHRKLLFLPPSIEDSQKLLMHILTLPIDSSF  227

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN K+ +I+ D +FK+ +      DS+  HLLRFLF AV  MD+++GFLS +N
Sbjct  228   PHAYAVEFNRKVQNIIEDRRFKETLNKYLNVDSSVKHLLRFLFCAVSHMDLQTGFLSREN  287

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  A ++ QRQPKLECL++CSILEL ILVC++RLE  EQ  CNFNS+MKEY     S  T
Sbjct  288   FEIAFTSIQRQPKLECLRNCSILELQILVCMKRLEVKEQSLCNFNSVMKEYI----STLT  343

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             S+ YAR VCLRAFEHL+ RELI F +NRG + S+EFRPV+LLIS  EL QGL++   CP 
Sbjct  344   SERYARHVCLRAFEHLIHRELICFTDNRGQSLSVEFRPVKLLISSAELHQGLRANTSCPP  403

Query  1081  ILHKLI  1098
              L KL+
Sbjct  404   KLLKLM  409



>ref|XP_006605946.1| PREDICTED: origin recognition complex subunit 4-like [Glycine 
max]
Length=413

 Score =   481 bits (1239),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 246/366 (67%), Positives = 293/366 (80%), Gaps = 4/366 (1%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GKNAVLELV++ LL+E+PD ISV++LNGLLHSDD  A KEI RQLC
Sbjct  48    ACNNSILLLGPRGSGKNAVLELVIQDLLQEYPDSISVMRLNGLLHSDDISAFKEIARQLC  107

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSK ASFDDNSQF++AML+ECGLAHKT+IFVLDEFDLF QGKQRLLYSLLDAMQ
Sbjct  108   MEHQLLFSKAASFDDNSQFMVAMLKECGLAHKTIIFVLDEFDLFAQGKQRLLYSLLDAMQ  167

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVV+G+SCRLDADQLLEKRVRSRFSHRKL+FLPPS ED +++L H+L LP D   
Sbjct  168   SITSQAVVLGISCRLDADQLLEKRVRSRFSHRKLLFLPPSIEDSQKLLMHMLTLPIDPSF  227

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN K+ +I+ D  F + +      DS+  HLLRFLF AV +M++++GFLS +N
Sbjct  228   PQDYAVEFNRKVQNIIEDRGFLETLNKYLNVDSSVKHLLRFLFCAVSRMELQTGFLSREN  287

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  A S+ QRQPKLECL++CSILEL ILVC++RLE  EQ  CNFNS+MKEYK    S  T
Sbjct  288   FEIAFSSIQRQPKLECLRNCSILELQILVCMKRLEVKEQNLCNFNSVMKEYK----STLT  343

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             S+ YAR VCLRAFEHL+ RELI F +NRG + S+EFRPV+LLIS  EL QGL++   CP 
Sbjct  344   SERYARHVCLRAFEHLIHRELICFTDNRGQSLSVEFRPVKLLISSAELHQGLRANNSCPP  403

Query  1081  ILHKLI  1098
              L  L+
Sbjct  404   KLLNLM  409



>ref|XP_010681710.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=405

 Score =   481 bits (1237),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 243/366 (66%), Positives = 293/366 (80%), Gaps = 16/366 (4%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AVL+LVL  LL E+PDMISV                EI RQLC
Sbjct  49    ACNNSVLLLGPRGCGKTAVLQLVLNNLLAEYPDMISV----------------EIARQLC  92

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             +EHQL+FSKMASFDDN+QF+I MLRECGLAHKT++F+LDEFDLF QGKQRLLYSLLDAMQ
Sbjct  93    AEHQLLFSKMASFDDNTQFVIGMLRECGLAHKTIVFILDEFDLFAQGKQRLLYSLLDAMQ  152

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVVIG+SC+LDADQLLEKRVRSR SHRKL+F PPS ++++R+L+ +L LP++  L
Sbjct  153   SVTSQAVVIGISCKLDADQLLEKRVRSRLSHRKLLFCPPSIDEMDRLLECVLSLPENSSL  212

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  YV  +N +L  IL+D KFKD + +L + DST + +LRFLF +V  MDMK G LS++N
Sbjct  213   PQSYVVEYNNELRKILADKKFKDTMTTLLSSDSTVDQILRFLFLSVSTMDMKRGILSVEN  272

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  A+    RQPKLE LKDCS+LELYILVC++RLE  EQ + NFNS+MKEYK +HDSF+T
Sbjct  273   FNMAVVKLNRQPKLEFLKDCSVLELYILVCMKRLEVKEQNSYNFNSVMKEYKAIHDSFQT  332

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
              DYYAR VCLRAF+HL+Q ELI F++NRG+NQSIE+RPV++LIS +EL QGLK    CP 
Sbjct  333   PDYYARKVCLRAFQHLIQCELICFMDNRGYNQSIEYRPVKILISSYELHQGLKLNQKCPS  392

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  393   ILQKLM  398



>gb|KHN42409.1| Origin recognition complex subunit 4 [Glycine soja]
Length=413

 Score =   479 bits (1232),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 245/366 (67%), Positives = 292/366 (80%), Gaps = 4/366 (1%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GKNAVLELV++ LL+E+PD ISV++LNGLLHSDD  A KEI RQLC
Sbjct  48    ACNNSILLLGPRGSGKNAVLELVIQDLLQEYPDSISVMRLNGLLHSDDISAFKEIARQLC  107

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSK ASFDDNSQF++AML+ECGLAHKT+IFVLDEFDLF QGKQRLLYSL DAMQ
Sbjct  108   MEHQLLFSKAASFDDNSQFMVAMLKECGLAHKTIIFVLDEFDLFAQGKQRLLYSLPDAMQ  167

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVV+G+SCRLDADQLLEKRVRSRFSHRKL+FLPPS ED +++L H+L LP D   
Sbjct  168   SITSQAVVLGISCRLDADQLLEKRVRSRFSHRKLLFLPPSIEDSQKLLMHMLTLPIDPSF  227

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  Y   FN K+ +I+ D  F + +      DS+  HLLRFLF AV +M++++GFLS +N
Sbjct  228   PQDYAVEFNRKVQNIIEDRGFLETLNKYLNVDSSVKHLLRFLFCAVSRMELQTGFLSREN  287

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  A S+ QRQPKLECL++CSILEL ILVC++RLE  EQ  CNFNS+MKEYK    S  T
Sbjct  288   FEIAFSSIQRQPKLECLRNCSILELQILVCMKRLEVKEQNLCNFNSVMKEYK----STLT  343

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             S+ YAR VCLRAFEHL+ RELI F +NRG + S+EFRPV+LLIS  EL QGL++   CP 
Sbjct  344   SERYARHVCLRAFEHLIHRELICFTDNRGQSLSVEFRPVKLLISSAELHQGLRANNSCPP  403

Query  1081  ILHKLI  1098
              L  L+
Sbjct  404   KLLNLM  409



>ref|XP_003569575.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Brachypodium 
distachyon]
Length=424

 Score =   478 bits (1230),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 239/366 (65%), Positives = 295/366 (81%), Gaps = 0/366 (0%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AVL++VLE L KE PD ISVI+LNG+LHSDDNCA+K+I RQLC
Sbjct  53    ACNNSVLLLGPRGCGKGAVLDMVLEDLKKEHPDAISVIRLNGMLHSDDNCAMKDIARQLC  112

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              +H+L FSKMAS DDN++F+I MLRECGLAHKTVIF+L+EFDLF QGKQRLLYSLLDAMQ
Sbjct  113   LQHELSFSKMASSDDNTEFMIDMLRECGLAHKTVIFILEEFDLFAQGKQRLLYSLLDAMQ  172

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIG+SCRLDADQLLEKRVRSRFSHRKL+F+P S +D++ + +H+L+L +   L
Sbjct  173   SLTSQAVVIGMSCRLDADQLLEKRVRSRFSHRKLLFIPSSLDDIQSLTEHLLMLDQASVL  232

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             PT YV  +N++L SI +  KFK I+ SL   D+T +++LRFLF  V  MD +SG LS+D 
Sbjct  233   PTNYVTEYNSRLTSIFNHKKFKGILNSLTDADATTSNILRFLFRVVSYMDKESGLLSIDC  292

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS  QRQPK++ L+D SILELY+LVC+ RLE  EQ + NFN+IMKEYK + D++KT
Sbjct  293   FTNALSCMQRQPKMDSLQDLSILELYVLVCMNRLEDKEQNSYNFNTIMKEYKSIQDAYKT  352

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA  VC RAFEHLL RELI+F + +G N ++E+RPV+LLIS  EL + LK    CP 
Sbjct  353   SDKYATTVCFRAFEHLLDRELITFADTKGRNIALEYRPVKLLISSRELAESLKLNTTCPT  412

Query  1081  ILHKLI  1098
             +L KL+
Sbjct  413   VLQKLL  418



>ref|XP_004146481.1| PREDICTED: origin recognition complex subunit 4-like [Cucumis 
sativus]
Length=394

 Score =   465 bits (1197),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 230/322 (71%), Positives = 279/322 (87%), Gaps = 0/322 (0%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            ACNNS+LLLGPRG GK AVLELVL+ LL E+PDMI+VI+L+GLLH DDN A KEI RQLC
Sbjct  52   ACNNSILLLGPRGSGKMAVLELVLQDLLLEYPDMITVIRLSGLLHCDDNGAFKEIARQLC  111

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
            SE+QL+FSKMASFDDNSQF++AMLRECGLAHKT++FVLDEFDLF QGKQRLLYSLLDAMQ
Sbjct  112  SEYQLLFSKMASFDDNSQFMVAMLRECGLAHKTIVFVLDEFDLFAQGKQRLLYSLLDAMQ  171

Query  361  SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
            SV+SQA+VIG+SCRLDADQLLEKRVRSRFSHRKL+FLPP KE++ER+L+HIL LP D  L
Sbjct  172  SVSSQAIVIGISCRLDADQLLEKRVRSRFSHRKLLFLPPCKENVERLLEHILSLPIDSDL  231

Query  541  PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
            P  Y+  FN KL ++L++++FK ++ +    DST    +R+LF A+ ++++KSG L+++N
Sbjct  232  PHDYIIKFNAKLHNMLANERFKKVISTYLDSDSTVKQFVRYLFCAISKLNLKSGLLTVEN  291

Query  721  FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
            F  ALS+TQRQPK E +KDCSILELYILVC++RLE  EQ + NFNS+MKEYK +HDSF+T
Sbjct  292  FEHALSDTQRQPKQEYIKDCSILELYILVCMKRLEVKEQNSYNFNSVMKEYKSIHDSFRT  351

Query  901  SDYYARDVCLRAFEHLLQRELI  966
            SDYY+R VCLRAFEHLLQRELI
Sbjct  352  SDYYSRSVCLRAFEHLLQRELI  373



>ref|XP_006843984.1| hypothetical protein AMTR_s00006p00149820 [Amborella trichopoda]
 gb|ERN05659.1| hypothetical protein AMTR_s00006p00149820 [Amborella trichopoda]
Length=425

 Score =   466 bits (1199),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 244/364 (67%), Positives = 289/364 (79%), Gaps = 2/364 (1%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +CNNSVLLLGPRGCGK  VLELVL  L  + PD +SV++LNGLLHSDD CALKEI RQLC
Sbjct  48    SCNNSVLLLGPRGCGKTTVLELVLRKLQTDHPDRLSVVRLNGLLHSDDRCALKEIVRQLC  107

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             ++HQL+FSKMAS DDNSQF+++MLREC LAHK +IFVLDEFDLFT GKQRLLYSLLDAMQ
Sbjct  108   TDHQLIFSKMASCDDNSQFMLSMLRECALAHKAIIFVLDEFDLFTPGKQRLLYSLLDAMQ  167

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SV SQAVV+GVSCRLDADQLLEKRVRSRFSHRKL+FLPPS EDL+R+L+ IL LP D   
Sbjct  168   SVQSQAVVVGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSMEDLQRLLRQILFLPTDSSF  227

Query  541   P-TKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLD  717
               + +   FN KL  I + + F DI+ S+   D++ +HLL FLF AVC MD  SGFLSL 
Sbjct  228   RHSDFAVKFNAKLSVIFNGEGFIDILNSVVGVDNSVSHLLNFLFCAVCNMDSGSGFLSLG  287

Query  718   NFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFK  897
             +F++A+ + QRQ KLE L+D SILELYILVC++RLEA +  + NFNSIMKEYK + D+ +
Sbjct  288   SFKSAMLSVQRQLKLESLQDVSILELYILVCMKRLEAKDCGSYNFNSIMKEYKGLQDASQ  347

Query  898   TSDYYARDVCLRAFEHLLQRELISFVE-NRGHNQSIEFRPVQLLISLHELQQGLKSWGCC  1074
             T  YY+R VCLRAFEHLL+ EL+ F + NRG + SIEFR V LLIS HEL QGL+S   C
Sbjct  348   TGAYYSRQVCLRAFEHLLECELVGFTDNNRGQSLSIEFRAVVLLISSHELYQGLRSSRNC  407

Query  1075  PVIL  1086
             P IL
Sbjct  408   PDIL  411



>ref|NP_001043888.1| Os01g0683400 [Oryza sativa Japonica Group]
 sp|Q5N8Q4.1|ORC4_ORYSJ RecName: Full=Origin of replication complex subunit 4; Short=OsORC4 
[Oryza sativa Japonica Group]
 dbj|BAD82152.1| origin recognition complex subunit 4-like [Oryza sativa Japonica 
Group]
 dbj|BAF05802.1| Os01g0683400 [Oryza sativa Japonica Group]
 dbj|BAG95826.1| unnamed protein product [Oryza sativa Japonica Group]
Length=470

 Score =   466 bits (1200),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 225/338 (67%), Positives = 274/338 (81%), Gaps = 0/338 (0%)
 Frame = +1

Query  85    KEFPDMISVIKLNGLLHSDDNCALKEITRQLCSEHQLVFSKMASFDDNSQFLIAMLRECG  264
             K+ PD ISVI+LNG+LHSDDNCA KEI RQLC EHQL FSKMAS DDN++F+I MLRECG
Sbjct  127   KDHPDAISVIRLNGMLHSDDNCATKEIARQLCLEHQLSFSKMASSDDNTEFMIDMLRECG  186

Query  265   LAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSR  444
             LAHKT+IFVL+EFDLF QGKQRLLYSLLDAMQS+TSQAVVIGVSCRLDADQLLEKRVRSR
Sbjct  187   LAHKTIIFVLEEFDLFAQGKQRLLYSLLDAMQSLTSQAVVIGVSCRLDADQLLEKRVRSR  246

Query  445   FSHRKLIFLPPSKEDLERILKHILLLPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESL  624
             FSHRKL+F+P S + L+R+++H+L LP+D  LPTKYV  +N ++ SI +D KFK I+ SL
Sbjct  247   FSHRKLLFVPSSVDSLQRLMEHLLALPEDSPLPTKYVREYNARITSIFNDKKFKGILSSL  306

Query  625   CTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILELYIL  804
                D+T +H+LRFLF  V  MD+ SG LS+ +F  ALS+ QRQPK++ L+D SILELYIL
Sbjct  307   TDADATTSHILRFLFRVVSYMDIDSGLLSMQSFMNALSSMQRQPKMDSLQDLSILELYIL  366

Query  805   VCLRRLEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENR  984
             VC+ RLE  E+ + NF +IMKEYK V D++KTSD Y+  VC RAFEHLL RELISF +N+
Sbjct  367   VCMNRLEDKEKSSYNFITIMKEYKSVQDAYKTSDKYSHTVCFRAFEHLLDRELISFADNK  426

Query  985   GHNQSIEFRPVQLLISLHELQQGLKSWGCCPVILHKLI  1098
             G NQ++E+RPV+LLIS  EL + LK    CP +L KL+
Sbjct  427   GRNQALEYRPVKLLISSRELAESLKLNTTCPAVLQKLL  464



>ref|NP_001151847.1| origin recognition complex subunit 4 [Zea mays]
 gb|ACG44579.1| origin recognition complex subunit 4 [Zea mays]
Length=406

 Score =   457 bits (1177),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 232/365 (64%), Positives = 287/365 (79%), Gaps = 16/365 (4%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AV+++VL+ L +E PD ISV                EI RQLC
Sbjct  51    ACNNSVLLLGPRGCGKAAVVDMVLDDLKEEHPDAISV----------------EIARQLC  94

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL FSKMAS DDN++F+I MLRECGLAHKT++F+L+EFDLF QGKQRLLYSLLDAMQ
Sbjct  95    LEHQLSFSKMASSDDNTEFMIDMLRECGLAHKTILFILEEFDLFAQGKQRLLYSLLDAMQ  154

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+F+ PS +D++R+++H+L+L KD GL
Sbjct  155   SLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFISPSLDDIQRLVEHLLILAKDSGL  214

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+KY+  +N++L SI SD KFK  + SL   D+T +++ RFLF AV  MDM+SGFLS+++
Sbjct  215   PSKYIADYNSRLTSIFSDKKFKGCLNSLMDADATTSNIQRFLFRAVSYMDMESGFLSVES  274

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+ QRQPK++ L+D SILELYILVC+ RLE+ EQ + NF SIMKEY+ + D++KT
Sbjct  275   FLKALSSMQRQPKMDSLQDLSILELYILVCMHRLESKEQTSYNFTSIMKEYRSIQDAYKT  334

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA  VC RAFE LL RELISF +NR  NQ++E+RPV+LLIS  EL + LK    CP 
Sbjct  335   SDKYASXVCFRAFEXLLDRELISFGDNRWRNQALEYRPVKLLISSRELAESLKLNTTCPA  394

Query  1081  ILHKL  1095
             +L KL
Sbjct  395   VLQKL  399



>gb|KFK40712.1| hypothetical protein AALP_AA2G031400 [Arabis alpina]
Length=382

 Score =   456 bits (1172),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 232/373 (62%), Positives = 290/373 (78%), Gaps = 18/373 (5%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK+AVL+LV+  LL+E+PD +S+I+LNGLLHSDDNCA KEI RQLC
Sbjct  19    GCNNSILLLGPRGSGKSAVLDLVVGDLLEEYPDSVSLIRLNGLLHSDDNCAFKEIARQLC  78

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFD+NS F+IAMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  79    MEHHLLFSKMASFDENSHFIIAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  138

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQA+V+G+S RLDADQLLEKRVRSRFSHRK IFL          L+H+L LP D   
Sbjct  139   SVTSQAIVVGISSRLDADQLLEKRVRSRFSHRK-IFL----------LEHLLSLPADSSF  187

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P  YV  FN K+ SI SD +FKD++ +    + T N L++F+F  V  M+++SG LSL+N
Sbjct  188   PNGYVSQFNEKIKSITSDTRFKDLLTTFFNANYTVNSLVKFIFHTVSLMNLESGLLSLEN  247

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSF--  894
             F+ A S+ QRQPKLE ++DCSILELY+LVC+RRLE  EQ + NF S+MKEYK +HDSF  
Sbjct  248   FKAAFSSMQRQPKLEAIRDCSILELYLLVCMRRLEVKEQSSYNFISVMKEYKTIHDSFQK  307

Query  895   -----KTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLK  1059
                  + S+YYA++VCLRAF+ L +RE+I + EN G +Q+ E+RP++LLIS  EL+QG++
Sbjct  308   SHDSLQKSNYYAQNVCLRAFQQLREREVICYAENIGQSQTGEYRPMKLLISASELRQGMQ  367

Query  1060  SWGCCPVILHKLI  1098
                  P IL KL+
Sbjct  368   MRSHDPAILFKLL  380



>emb|CDY17695.1| BnaA06g35140D [Brassica napus]
Length=401

 Score =   451 bits (1161),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 220/367 (60%), Positives = 286/367 (78%), Gaps = 18/367 (5%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  L++E+PD +++I LNGLLHS+DNCA KEI RQLC
Sbjct  50    GCNNSILLLGPRGSGKAAVLDLVVGDLMEEYPDSVTLISLNGLLHSEDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFD+NSQF+IAMLRECGLAHKT+IFVLDEFD+F Q ++           
Sbjct  110   MEHHLLFSKMASFDENSQFIIAMLRECGLAHKTIIFVLDEFDMFAQARK-----------  158

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
                     + V  RLDADQLLEKRVRSRFSHRK++FLPPS+E+++ +L+H+L LP D   
Sbjct  159   ------ATVAVHSRLDADQLLEKRVRSRFSHRKILFLPPSREEIDSLLEHLLSLPADSSF  212

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+ YV  FN K+ +I SD +FKD++++    +ST N LL+F+F AV  M+++SG LSL+N
Sbjct  213   PSGYVTQFNEKIKNITSDTRFKDMLKTFLNANSTVNSLLKFIFRAVSSMNLESGLLSLEN  272

Query  721   FRTALSNTQRQPKLECLK-DCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFK  897
             F+TALS+ QRQPKLE ++ DCSILELY+LVC+RRLE  EQ + NF S+MKEYK +HDSF+
Sbjct  273   FKTALSSMQRQPKLEAVRADCSILELYLLVCMRRLEVKEQSSYNFISVMKEYKTIHDSFQ  332

Query  898   TSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCP  1077
             TSD+YA++VCLRAFEHL +RE+I + ENRG +Q+ E+R ++LLIS  EL QG++S   CP
Sbjct  333   TSDFYAQNVCLRAFEHLREREVICYAENRGQSQAGEYRSMKLLISASELHQGMRSHAYCP  392

Query  1078  VILHKLI  1098
              IL KL+
Sbjct  393   AILLKLL  399



>ref|XP_008351001.1| PREDICTED: LOW QUALITY PROTEIN: origin recognition complex subunit 
4-like [Malus domestica]
Length=341

 Score =   441 bits (1135),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 218/312 (70%), Positives = 258/312 (83%), Gaps = 0/312 (0%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            ACN+S+LLLGPRG GK A+LELVL  LL+EFPD +SVI+L+GLLHS DNCA KEI RQLC
Sbjct  25   ACNSSILLLGPRGSGKTAMLELVLSDLLQEFPDTVSVIRLSGLLHSSDNCAFKEIARQLC  84

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             EHQLVFS+MASFDDNSQF+IAMLRECGLAHKT+IFVLDEFDLF  GKQRLLY LLDAMQ
Sbjct  85   MEHQLVFSRMASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDLFALGKQRLLYXLLDAMQ  144

Query  361  SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
            SV SQAVVIGVS RLDAD LL+KRVRSRFSHRKL+FLPP+ ED++R+L+HILLLP D   
Sbjct  145  SVXSQAVVIGVSXRLDADMLLDKRVRSRFSHRKLLFLPPAYEDIQRLLEHILLLPTDSSF  204

Query  541  PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
            P      FN KL +IL+D +FK+IV +    DST  HLLR+ F AV  MD++SG L L N
Sbjct  205  PPDXAIVFNAKLQTILADKRFKEIVNAYLNLDSTVKHLLRYPFPAVSDMDLESGMLLLXN  264

Query  721  FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
            F+T LSN QR PKL+C+KDC +LELYILVC++RLE  EQ + NF+++MKEYK +HDS KT
Sbjct  265  FKTTLSNIQRHPKLKCIKDCXVLELYILVCMKRLEVKEQNSYNFSAVMKEYKSIHDSVKT  324

Query  901  SDYYARDVCLRA  936
            +D++AR+VCLR 
Sbjct  325  ADHFARNVCLRG  336



>ref|XP_010232145.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Brachypodium 
distachyon]
Length=471

 Score =   444 bits (1143),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 216/338 (64%), Positives = 270/338 (80%), Gaps = 0/338 (0%)
 Frame = +1

Query  85    KEFPDMISVIKLNGLLHSDDNCALKEITRQLCSEHQLVFSKMASFDDNSQFLIAMLRECG  264
             KE PD ISVI+LNG+LHSDDNCA+K+I RQLC +H+L FSKMAS DDN++F+I MLRECG
Sbjct  128   KEHPDAISVIRLNGMLHSDDNCAMKDIARQLCLQHELSFSKMASSDDNTEFMIDMLRECG  187

Query  265   LAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSR  444
             LAHKTVIF+L+EFDLF QGKQRLLYSLLDAMQS+TSQAVVIG+SCRLDADQLLEKRVRSR
Sbjct  188   LAHKTVIFILEEFDLFAQGKQRLLYSLLDAMQSLTSQAVVIGMSCRLDADQLLEKRVRSR  247

Query  445   FSHRKLIFLPPSKEDLERILKHILLLPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESL  624
             FSHRKL+F+P S +D++ + +H+L+L +   LPT YV  +N++L SI +  KFK I+ SL
Sbjct  248   FSHRKLLFIPSSLDDIQSLTEHLLMLDQASVLPTNYVTEYNSRLTSIFNHKKFKGILNSL  307

Query  625   CTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILELYIL  804
                D+T +++LRFLF  V  MD +SG LS+D F  ALS  QRQPK++ L+D SILELY+L
Sbjct  308   TDADATTSNILRFLFRVVSYMDKESGLLSIDCFTNALSCMQRQPKMDSLQDLSILELYVL  367

Query  805   VCLRRLEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENR  984
             VC+ RLE  EQ + NFN+IMKEYK + D++KTSD YA  VC RAFEHLL RELI+F + +
Sbjct  368   VCMNRLEDKEQNSYNFNTIMKEYKSIQDAYKTSDKYATTVCFRAFEHLLDRELITFADTK  427

Query  985   GHNQSIEFRPVQLLISLHELQQGLKSWGCCPVILHKLI  1098
             G N ++E+RPV+LLIS  EL + LK    CP +L KL+
Sbjct  428   GRNIALEYRPVKLLISSRELAESLKLNTTCPTVLQKLL  465



>ref|XP_010924349.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Elaeis 
guineensis]
Length=389

 Score =   440 bits (1131),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 231/365 (63%), Positives = 275/365 (75%), Gaps = 29/365 (8%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRG GK AV+ELVLE L  E PD ISVI+LNGLLHSDDNCALKEI RQLC
Sbjct  47    ACNNSVLLLGPRGSGKIAVVELVLEDLKAEHPDAISVIRLNGLLHSDDNCALKEIARQLC  106

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMAS DDNSQF++ MLRECGLAHKT+I +LDEFDLFTQ              
Sbjct  107   VEHQLLFSKMASSDDNSQFVMDMLRECGLAHKTIIVILDEFDLFTQ--------------  152

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
                            DADQLLEKR+RSRFSHRKL+F+PPSKED++R+L+ +L LPKD   
Sbjct  153   ---------------DADQLLEKRIRSRFSHRKLLFVPPSKEDVQRLLECLLHLPKDSSF  197

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+KYV  FN +L +ILSD KFK++++SL   D + ++LLR LF AV  MDM+SG LSL+N
Sbjct  198   PSKYVTEFNRRLSNILSDKKFKEVLDSLLDVDGSVSNLLRLLFRAVSYMDMESGLLSLEN  257

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F++A   T RQPK++ L+D SILELYILVC+ RLE  EQ + NFNSIMKEYK +HD++KT
Sbjct  258   FKSAYLCTYRQPKIDNLEDASILELYILVCMNRLETKEQNSYNFNSIMKEYKAIHDAYKT  317

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA +VCLRAFEHLL++ELI F +++G   SIEF PV+LLIS  EL QGL S   CP 
Sbjct  318   SDNYANNVCLRAFEHLLEQELIGFTDSKGRTPSIEFHPVKLLISSRELYQGLTSNSSCPA  377

Query  1081  ILHKL  1095
             IL KL
Sbjct  378   ILQKL  382



>gb|EEC71281.1| hypothetical protein OsI_03294 [Oryza sativa Indica Group]
Length=388

 Score =   437 bits (1125),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 226/366 (62%), Positives = 271/366 (74%), Gaps = 39/366 (11%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AV+++VL+ L K+ PD ISVI+LNG+LHSDDNCA KEI RQLC
Sbjct  56    ACNNSVLLLGPRGCGKAAVVDMVLDDLKKDHPDAISVIRLNGMLHSDDNCATKEIARQLC  115

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL FSKMAS DDN++F+I MLRECGLAHKT+IFVL+EFDLF QGKQRLLYSLLDAMQ
Sbjct  116   LEHQLSFSKMASSDDNTEFMIDMLRECGLAHKTIIFVLEEFDLFAQGKQRLLYSLLDAMQ  175

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+F+P S + L+R+++H+L LP+D  L
Sbjct  176   SLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFVPSSVDSLQRLMEHLLALPEDSPL  235

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             PT                                        F  V  MD+ SG LS+ +
Sbjct  236   PTN---------------------------------------FRVVSYMDIDSGLLSMQS  256

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  ALS+ QRQPK++ L+D SILELYILVC+ RLE  E+ + NF +IMKEYK V D++KT
Sbjct  257   FMNALSSMQRQPKMDGLQDLSILELYILVCMNRLEDKEKSSYNFITIMKEYKSVQDAYKT  316

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD Y+  VC RAFEHLL RELISF +N+G NQ++E+RPV+LLIS  EL + LK    CP 
Sbjct  317   SDKYSHTVCFRAFEHLLDRELISFADNKGRNQALEYRPVKLLISSRELAESLKLNTTCPA  376

Query  1081  ILHKLI  1098
             +L KL+
Sbjct  377   VLQKLL  382



>ref|XP_011070735.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Sesamum 
indicum]
 ref|XP_011070736.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Sesamum 
indicum]
Length=327

 Score =   433 bits (1113),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 214/275 (78%), Positives = 248/275 (90%), Gaps = 0/275 (0%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            ACNNSVLLLGPRGCGK AVLE+VLE LLKE PDMISVI+LNGLLH D+NCALKEI RQLC
Sbjct  50   ACNNSVLLLGPRGCGKVAVLEIVLEELLKEHPDMISVIRLNGLLHCDNNCALKEIARQLC  109

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             EH L+FSKMAS+DDNSQFL++MLRECGLAHKT++FVLDEFDLFTQGKQRLLYSLLDAMQ
Sbjct  110  LEHHLMFSKMASYDDNSQFLLSMLRECGLAHKTIVFVLDEFDLFTQGKQRLLYSLLDAMQ  169

Query  361  SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
            S+TSQAVV+GVSCRLDADQLLEKRVRSRFSHRKL+FLPPS+ED +R+++HILLLP D  L
Sbjct  170  SITSQAVVVGVSCRLDADQLLEKRVRSRFSHRKLLFLPPSREDCQRLVEHILLLPTDSSL  229

Query  541  PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
            P  Y  AFN KLL+IL+D+KFK I+++LC  DS+  HLLRFLFSA+C MDM SGFLS+ N
Sbjct  230  PNDYTAAFNAKLLNILADEKFKGIIDTLCYSDSSVGHLLRFLFSAICHMDMNSGFLSVKN  289

Query  721  FRTALSNTQRQPKLECLKDCSILELYILVCLRRLE  825
            F++AL + QRQPKLE LKDCS+LELYILVC++R++
Sbjct  290  FKSALRSMQRQPKLEALKDCSVLELYILVCMKRVQ  324



>gb|AAT37464.2| origin recognition complex protein 4 [Arabidopsis thaliana]
Length=383

 Score =   432 bits (1111),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 222/366 (61%), Positives = 272/366 (74%), Gaps = 34/366 (9%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
              CNNS+LLLGPRG GK AVL+LV+  LL++FPD +SVI+LNGLLHSDDNCA KEI +QLC
Sbjct  50    GCNNSMLLLGPRGSGKAAVLDLVVGDLLEQFPDSVSVIRLNGLLHSDDNCAFKEIAKQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH L+FSKMASFDDNSQF+IAMLR CGLAHKT+IFVLDEFD+F QGK  +LYSLLDAMQ
Sbjct  110   MEHHLLFSKMASFDDNSQFIIAMLRACGLAHKTIIFVLDEFDMFAQGKAAVLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SVTSQAVV+G+S RLDADQLLEKRVRSRFSHRK +FLPPS+E+L+ +  H+L LP D G 
Sbjct  170   SVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKFLFLPPSREELDGLFVHLLSLPADSGF  229

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
             P+ YV  FN K+ ++ SD +FKDI+++L   +ST N  L+F+F AV  M+++SG LSL+N
Sbjct  230   PSGYVSRFNDKIKNLTSDTRFKDILKTLFNANSTVNSFLKFIFCAVSLMNLESGLLSLEN  289

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F+ ALS+ QRQPK                    LE  EQ + NF S+MKEYK +HDSF T
Sbjct  290   FKAALSSMQRQPK--------------------LEVKEQSSYNFISVMKEYKAIHDSFHT  329

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SDYYA++VCLR              ENRG +Q+ E+R  +LLIS  EL QG++S  CCP 
Sbjct  330   SDYYAQNVCLR--------------ENRGQSQTGEYRLQKLLISASELHQGMRSHACCPA  375

Query  1081  ILHKLI  1098
             IL KL+
Sbjct  376   ILLKLL  381



>gb|ACU18384.1| unknown [Glycine max]
Length=372

 Score =   421 bits (1083),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 214/312 (69%), Positives = 252/312 (81%), Gaps = 4/312 (1%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            ACNNS+LLLGPRG GKNAVLELV++ LL+E+PD +SVI+LNGLLHSDD  A KEI RQLC
Sbjct  48   ACNNSILLLGPRGSGKNAVLELVIQDLLQEYPDSVSVIRLNGLLHSDDISAFKEIARQLC  107

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             EHQL+FSK ASFDDNSQF++A+L+ECGLAHKTVIFVLDEF LF QGKQRLLYSLLDAMQ
Sbjct  108  MEHQLLFSKAASFDDNSQFMVAILKECGLAHKTVIFVLDEFHLFAQGKQRLLYSLLDAMQ  167

Query  361  SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
            S+TSQAVV+G+SCRLDADQLLEKRVRSRFSHRKL+FLPPS ED +++L HIL LP D   
Sbjct  168  SITSQAVVLGISCRLDADQLLEKRVRSRFSHRKLLFLPPSIEDSQKLLMHILTLPIDSSF  227

Query  541  PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
            P  Y   FN K+ +I+ D +FK+ +      DS+  HLLRFLF AV  MD+++GFLS +N
Sbjct  228  PHAYAVEFNRKVQNIIEDRRFKETLNKYLNVDSSVKHLLRFLFCAVSHMDLQTGFLSREN  287

Query  721  FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
            F  A ++ QRQPKLECL++CSILEL ILVC++RLE  EQ  CNFNS+MKEY     S  T
Sbjct  288  FEIAFTSIQRQPKLECLRNCSILELQILVCMKRLEVKEQSLCNFNSVMKEYI----STLT  343

Query  901  SDYYARDVCLRA  936
            S+ YAR VCLR 
Sbjct  344  SERYARHVCLRV  355



>emb|CDY37347.1| BnaC02g33650D [Brassica napus]
Length=401

 Score =   419 bits (1078),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 213/352 (61%), Positives = 268/352 (76%), Gaps = 8/352 (2%)
 Frame = +1

Query  139   DDNCALKEITRQLCSEHQLVFSKMASFDDNSQFLIAMLR---ECGLAHKTVIFVLDEF-D  306
             DDNCA KEI R LC EH L+ SKMASFD+NSQF+IAMLR   ECGLAH T+IF+L     
Sbjct  45    DDNCASKEIARHLCMEHHLLVSKMASFDENSQFIIAMLRFFMECGLAHNTIIFLLLSLHS  104

Query  307   LFTQGKQRLLYSLLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKE  486
              F  GKQRLLYSLLDAMQSVTSQAVVIG+S RLDADQLLEKRVRSRFSHRK++FLPPSKE
Sbjct  105   SFHLGKQRLLYSLLDAMQSVTSQAVVIGISSRLDADQLLEKRVRSRFSHRKILFLPPSKE  164

Query  487   DLERILKHILLLPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFL  666
             +++ +L+H+L LP D   P+ YV  FN K+ +I SD +FKD++ +    +ST N LL+F+
Sbjct  165   EVDSLLEHLLSLPTDSSFPSGYVSQFNEKIKNITSDTRFKDMLRTFLNANSTVNSLLKFI  224

Query  667   FSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLK-DCSILELYILVCLRRLEANEQET  843
             F AV  M+++SG LSL+ F+ ALS+ QRQPKLE ++ DCSILELY+LVC+RRLE  EQ  
Sbjct  225   FRAVSSMNLESGLLSLETFKAALSSMQRQPKLEAVRADCSILELYLLVCMRRLEVKEQSL  284

Query  844   CNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQL  1023
              NF S+MKEYK +HDSF+TSD+YA++VCLRAFEHL +RE+I + ENRG +Q+ E+RP++L
Sbjct  285   YNFISVMKEYKTIHDSFQTSDHYAQNVCLRAFEHLREREVICYAENRGQSQTGEYRPMKL  344

Query  1024  LISLHELQQGLKSWGCCPVILHKLI*SQPCHQHFWRTIPNTLLR*SEVLYLI  1179
             LI   EL QG++S  CCPV LH  I    C  +F + I N +L  S + Y +
Sbjct  345   LILASELHQGMRSHACCPVSLHFCI--YACF-YFCKLISNLVLVISSLFYFV  393



>ref|XP_010096736.1| Origin recognition complex subunit 4 [Morus notabilis]
 gb|EXB65588.1| Origin recognition complex subunit 4 [Morus notabilis]
Length=369

 Score =   402 bits (1033),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 227/368 (62%), Positives = 263/368 (71%), Gaps = 52/368 (14%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GK AVLELV+  LL EFPDMISVIKL+GLLHSDDNCA KEI RQLC
Sbjct  50    ACNNSILLLGPRGSGKIAVLELVISDLLLEFPDMISVIKLSGLLHSDDNCAFKEIARQLC  109

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSKMASFDDNSQF+IAMLRECGLAHKT+IFVLDEFDLF+QGKQRLLYSLLDAMQ
Sbjct  110   VEHQLLFSKMASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDLFSQGKQRLLYSLLDAMQ  169

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             SV+SQAVVIGVSCRLDADQLLEKRVRSRFSHRKL+FLPP+KED++R          +  L
Sbjct  170   SVSSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFLPPNKEDMQRFRA-----VSNMDL  224

Query  541   PTKY--VDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSL  714
              T +  ++ F T L ++    K + I   + T  +  + L  ++                
Sbjct  225   VTGFLSLENFKTALSNVQRQPKLECIKVHMLTCGTDCSILELYI----------------  268

Query  715   DNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSF  894
                            L C+K   I E              Q + NFNSIMKEYK VHDSF
Sbjct  269   ---------------LVCMKKLEIKE--------------QNSYNFNSIMKEYKTVHDSF  299

Query  895   KTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCC  1074
             +TSDYYA++VCLRAFEHLLQRELISF ++RG+NQSIEFRPV+LL+S HEL QGLKS+  C
Sbjct  300   QTSDYYAQNVCLRAFEHLLQRELISFTDSRGNNQSIEFRPVKLLVSSHELHQGLKSYRSC  359

Query  1075  PVILHKLI  1098
             P IL KL+
Sbjct  360   PAILQKLM  367



>ref|XP_010496938.1| PREDICTED: origin recognition complex subunit 4-like, partial 
[Camelina sativa]
Length=330

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/279 (70%), Positives = 236/279 (85%), Gaps = 0/279 (0%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             CNNS+LLLGPRG GK AVL+LV+  LL+EFPD +S+I+LNGLLHSDDNCA KEI RQLC
Sbjct  52   GCNNSILLLGPRGSGKAAVLDLVVGDLLEEFPDSVSLIRLNGLLHSDDNCAFKEIARQLC  111

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             EH L+FSKMAS D+NSQF++AMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  112  MEHHLLFSKMASLDENSQFIVAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  171

Query  361  SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
            SVTSQAVVIG+S RLDADQLLEKRVRSRFSHRK++FLPPS+E+ + +L+H+L LP D   
Sbjct  172  SVTSQAVVIGLSSRLDADQLLEKRVRSRFSHRKILFLPPSREEFDGLLEHLLSLPADSSF  231

Query  541  PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
            P  YV  FN K+ +I SD +FKDI+ +L   +ST N LL+F+F AV  M+++SG LSL+N
Sbjct  232  PNGYVSRFNEKIKNITSDTRFKDILRTLFNANSTVNSLLKFIFRAVSLMNLESGLLSLEN  291

Query  721  FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQ  837
            F+ ALS+ QRQPKLE ++DCSILELY+LVC+RRLE  EQ
Sbjct  292  FKAALSSMQRQPKLEAVRDCSILELYLLVCMRRLEVKEQ  330



>gb|KHN06716.1| Origin recognition complex subunit 4 [Glycine soja]
Length=357

 Score =   397 bits (1019),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 219/366 (60%), Positives = 256/366 (70%), Gaps = 60/366 (16%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS+LLLGPRG GKNAVLEL ++ LL+E+PD +SVI+LNGLLHSDD  A KEI RQLC
Sbjct  48    ACNNSILLLGPRGSGKNAVLELTIQDLLQEYPDSVSVIRLNGLLHSDDISAFKEIARQLC  107

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EHQL+FSK ASFDDNSQF++A+L+ECGLAHKTVIFVLDEF LF QGKQRLLYSLLDAMQ
Sbjct  108   MEHQLLFSKAASFDDNSQFMVAILKECGLAHKTVIFVLDEFHLFAQGKQRLLYSLLDAMQ  167

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVV+G+SCRLDADQLLEKRVRSRFSHRK                 +L LP     
Sbjct  168   SITSQAVVLGISCRLDADQLLEKRVRSRFSHRK-----------------LLFLPPSI--  208

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
                              +D  K                    F AV  MD+++GFLS +N
Sbjct  209   -----------------EDSQK--------------------FCAVSHMDLQTGFLSREN  231

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  A ++ QRQPKLECL++CSILEL ILVC++RLE  EQ  CNFNS+MKEY     S  T
Sbjct  232   FEIAFTSIQRQPKLECLRNCSILELQILVCMKRLEVKEQSLCNFNSVMKEYI----STLT  287

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             S+ YAR VCLRAFEHL+ RELI F +NRG + S+EFRPV+LLIS  EL QGL++   CP 
Sbjct  288   SERYARHVCLRAFEHLIHRELICFTDNRGQSLSVEFRPVKLLISSAELHQGLRANTSCPP  347

Query  1081  ILHKLI  1098
              L KL+
Sbjct  348   KLLKLM  353



>ref|XP_010527759.1| PREDICTED: origin recognition complex subunit 4 isoform X4 [Tarenaya 
hassleriana]
Length=347

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 200/291 (69%), Positives = 242/291 (83%), Gaps = 0/291 (0%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             CNN++LLLGPRG GK AV +LV+  LL+EFPD +SVI+LNGLLHSDDNCA KEI RQLC
Sbjct  50   GCNNTILLLGPRGSGKAAVFDLVVGDLLQEFPDSVSVIRLNGLLHSDDNCAFKEIARQLC  109

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
            +EH L+FSKMASFD+N QF+IAMLRECGLAHKT+IFVLDEFD+F QGKQRLLYSLLDAMQ
Sbjct  110  TEHHLLFSKMASFDENLQFMIAMLRECGLAHKTIIFVLDEFDMFAQGKQRLLYSLLDAMQ  169

Query  361  SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
            SVTSQAVV+G+S RLDADQLLEKRVRSRFS+RKL+FLPPSKE+L+ +L H+L L  D   
Sbjct  170  SVTSQAVVVGISSRLDADQLLEKRVRSRFSNRKLLFLPPSKEELDSLLVHLLSLHTDSSF  229

Query  541  PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
              +YV  FN ++  I +D +FKDI+E+    +ST N LL+ LFSAV  MD+ SG LSL+N
Sbjct  230  SNEYVTQFNERIKKITADARFKDILETFFNANSTVNSLLKLLFSAVSSMDLNSGLLSLEN  289

Query  721  FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEY  873
            F++ALS  QRQ KLE ++DCS+LELYILVC++RLEA EQ + NFNS+MK +
Sbjct  290  FKSALSIMQRQTKLEAVRDCSVLELYILVCMKRLEAKEQSSYNFNSVMKGF  340



>ref|XP_010232147.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Brachypodium 
distachyon]
Length=368

 Score =   389 bits (998),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 209/366 (57%), Positives = 255/366 (70%), Gaps = 56/366 (15%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AVL++VLE L KE PD ISVI+LNG+LHSDDNCA+K+I RQLC
Sbjct  53    ACNNSVLLLGPRGCGKGAVLDMVLEDLKKEHPDAISVIRLNGMLHSDDNCAMKDIARQLC  112

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              +H+L FSKMAS DDN++F+I MLRECGLAHKTVIF+L+EFDLF QGKQRLLYSLLDAMQ
Sbjct  113   LQHELSFSKMASSDDNTEFMIDMLRECGLAHKTVIFILEEFDLFAQGKQRLLYSLLDAMQ  172

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S+TSQAVVIG+SCRLDADQLLEKRVRSRFSHRKL+F+P S +D++   + +  + K+ GL
Sbjct  173   SLTSQAVVIGMSCRLDADQLLEKRVRSRFSHRKLLFIPSSLDDIQS-FRVVSYMDKESGL  231

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
              +  +D F   L                                                
Sbjct  232   LS--IDCFTNAL------------------------------------------------  241

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
                  S  QRQPK++ L+D SILELY+LVC+ RLE  EQ + NFN+IMKEYK + D++KT
Sbjct  242   -----SCMQRQPKMDSLQDLSILELYVLVCMNRLEDKEQNSYNFNTIMKEYKSIQDAYKT  296

Query  901   SDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             SD YA  VC RAFEHLL RELI+F + +G N ++E+RPV+LLIS  EL + LK    CP 
Sbjct  297   SDKYATTVCFRAFEHLLDRELITFADTKGRNIALEYRPVKLLISSRELAESLKLNTTCPT  356

Query  1081  ILHKLI  1098
             +L KL+
Sbjct  357   VLQKLL  362



>tpg|DAA58087.1| TPA: origin recognition complex subunit 4 [Zea mays]
Length=293

 Score =   384 bits (987),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/286 (65%), Positives = 233/286 (81%), Gaps = 0/286 (0%)
 Frame = +1

Query  238   LIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQSVTSQAVVIGVSCRLDADQ  417
             +I MLRECGLAHKT++F+L+EFDLF QGKQRLLYSLLDAMQS+TSQAVVIGVSCRLDADQ
Sbjct  1     MIDMLRECGLAHKTILFILEEFDLFAQGKQRLLYSLLDAMQSLTSQAVVIGVSCRLDADQ  60

Query  418   LLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGLPTKYVDAFNTKLLSILSDD  597
             LLEKRVRSRFSHRKL+F+ PS +D++R+++H+L+L KD GLP+KY+  +N++L SI SD 
Sbjct  61    LLEKRVRSRFSHRKLLFISPSLDDIQRLVEHLLILAKDSGLPSKYIADYNSRLTSIFSDK  120

Query  598   KFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKD  777
             KFK  + SL   D+T +++ RFLF AV  MDM+SGFLS+++F  ALS+ QRQPK++ L+D
Sbjct  121   KFKGCLNSLMDADATTSNIQRFLFRAVSYMDMESGFLSVESFLKALSSMQRQPKMDSLQD  180

Query  778   CSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQR  957
              SILELYILVC+ RLE+ EQ + NF SIMKEY+ + D++KTSD YA  VC RAFEHL  R
Sbjct  181   LSILELYILVCMHRLESKEQTSYNFTSIMKEYRSIQDAYKTSDKYASTVCFRAFEHLSDR  240

Query  958   ELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPVILHKL  1095
             ELISF +NR  NQ++E+RPV+LLIS  EL + LK    CP +L KL
Sbjct  241   ELISFGDNRWRNQALEYRPVKLLISSRELAESLKLNTTCPAVLQKL  286



>ref|XP_001768790.1| predicted protein [Physcomitrella patens]
 gb|EDQ66343.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   377 bits (967),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/366 (53%), Positives = 261/366 (71%), Gaps = 3/366 (1%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
               NNSVLLLGPRG GK  V E VL  L + FP+ +SV++LNGLLH+DD CALK I  QLC
Sbjct  56    GSNNSVLLLGPRGSGKTLVTERVLAHLQRTFPERVSVVRLNGLLHADDRCALKAIAEQLC  115

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQ-GKQRLLYSLLDAM  357
              +H LVFSK A+FDDN  FL  ML+E  L+HK+V+F+L+EFDLF Q  KQRLLY+LLD+M
Sbjct  116   LDHHLVFSKTAAFDDNLHFLTIMLKESALSHKSVVFILEEFDLFAQRPKQRLLYNLLDSM  175

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFG  537
             QS  +QA V+G+SCRLDAD+LLEKRVRSRFS+RKL+FLPPS ED+ ++L  +L+LP D  
Sbjct  176   QSTLTQAAVVGLSCRLDADELLEKRVRSRFSNRKLLFLPPSSEDICQLLHDVLMLPTDGS  235

Query  538   LP-TKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSL  714
             L  + ++  +N     +L +   +DI+      D + +H+      AVC +D   G L++
Sbjct  236   LGDSPFISMWNENTKKVL-EATMQDIIGQTVALDPSPHHIFDLALRAVCNLDQGRGLLTV  294

Query  715   DNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSF  894
              +F+ A +    Q K E L++ S+LELY+LVC++RLE+ EQE CNF  + +EY+ + ++ 
Sbjct  295   ADFKAANTLLHSQFKREALQNLSVLELYLLVCMKRLESKEQEVCNFTIVFEEYQHLQETH  354

Query  895   KTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCC  1074
             KTSD+Y+R++ LRAFEHL++RELI + + RG N +IEFRPVQLLI   ELQ+GL     C
Sbjct  355   KTSDHYSREIALRAFEHLMERELIIYADFRGRNDAIEFRPVQLLIDNLELQEGLSLNPQC  414

Query  1075  PVILHK  1092
             PVIL +
Sbjct  415   PVILRQ  420



>emb|CDY40401.1| BnaA02g27150D [Brassica napus]
Length=437

 Score =   375 bits (963),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 197/352 (56%), Positives = 254/352 (72%), Gaps = 29/352 (8%)
 Frame = +1

Query  139   DDNCALKEITRQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIF--VLDEFDLF  312
             DDNCA KE  RQLC EH L+FSKMASFD+NSQF+IAMLRECGLAH T+IF  +L+ F+L 
Sbjct  109   DDNCAFKETARQLCMEHHLLFSKMASFDENSQFIIAMLRECGLAHNTIIFARILNPFNLL  168

Query  313   TQGKQRLLYSLLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDL  492
               GKQRLLYSLLDAMQSVTSQAVVIG+S RLD DQLLEKRVRSRFSHRK++FLPPSKE++
Sbjct  169   F-GKQRLLYSLLDAMQSVTSQAVVIGISSRLDTDQLLEKRVRSRFSHRKILFLPPSKEEV  227

Query  493   ERILKHILLLPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFS  672
             + +L+H+L LP D   P+ YV  F+ K+ +I SD +FKD++ +    +ST N LL+F+ S
Sbjct  228   DSLLQHLLSLPADSSFPSGYVSEFSEKIKNITSDTRFKDMLSTFLNVNSTVNSLLKFMRS  287

Query  673   AVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNF  852
                 +D++  F +L+  R                DCSILELY+LVC+RR+E  EQ + NF
Sbjct  288   ----LDIR--FRALEAVRA---------------DCSILELYLLVCMRRVEVKEQSSYNF  326

Query  853   NSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLIS  1032
               +MKEYK +HDSF+TSDYY ++VCLRAFEHL +RE+I + ENRG +Q+ E+RP++LLIS
Sbjct  327   ICVMKEYKTIHDSFQTSDYYTQNVCLRAFEHLREREVICYAENRGQSQTGEYRPMKLLIS  386

Query  1033  LHELQQGLKSWGCCPVILHKLI*SQPCHQHFWRTIPNTLLR*SEVLYLISQA  1188
               EL QG++S  CCPV LH  I       +F + I N ++  S   +L+ QA
Sbjct  387   APELHQGMRSHACCPVSLHFCI---YAFFYFCKLISNLVI--SSSFFLLKQA  433



>ref|XP_007028454.1| Origin recognition complex subunit 4 isoform 3, partial [Theobroma 
cacao]
 gb|EOY08956.1| Origin recognition complex subunit 4 isoform 3, partial [Theobroma 
cacao]
Length=283

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 198/230 (86%), Gaps = 0/230 (0%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            ACNNS+LLLGPRG GK AVLELVL  LL+++P+ ISVI+LNGLLH DDNCALKEI RQLC
Sbjct  54   ACNNSILLLGPRGSGKVAVLELVLSDLLQQYPEAISVIRLNGLLHGDDNCALKEIARQLC  113

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             EHQL+FSK+ASFDDNSQFLIAMLRECGLAHKT+IFVLDEFDLF Q KQRLLYSLLDAMQ
Sbjct  114  MEHQLLFSKVASFDDNSQFLIAMLRECGLAHKTIIFVLDEFDLFAQAKQRLLYSLLDAMQ  173

Query  361  SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
            SVTSQAVVIGVSCRLD DQLLEKRVRSRFSHRKL+FLPPSKED ER L+HIL LPKD  L
Sbjct  174  SVTSQAVVIGVSCRLDVDQLLEKRVRSRFSHRKLLFLPPSKEDTERFLEHILSLPKDSSL  233

Query  541  PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMD  690
            P  Y   FN +L ++L+D++FK+++ +  +++ST   L+RFLF AV  MD
Sbjct  234  PHSYTVEFNGRLKNVLADERFKELINTYLSFNSTIGQLMRFLFQAVSYMD  283



>ref|XP_007028455.1| Origin recognition complex subunit 4 isoform 4, partial [Theobroma 
cacao]
 gb|EOY08957.1| Origin recognition complex subunit 4 isoform 4, partial [Theobroma 
cacao]
Length=281

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 196/230 (85%), Gaps = 2/230 (1%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            ACNNS+LLLGPRG GK AVLELVL  LL+++P+ ISVI+LNGLLH DDNCALKEI RQLC
Sbjct  54   ACNNSILLLGPRGSGKVAVLELVLSDLLQQYPEAISVIRLNGLLHGDDNCALKEIARQLC  113

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             EHQL+FSK+ASFDDNSQFLIAMLRECGLAHKT+IFVLDEFDLF Q KQRLLYSLLDAMQ
Sbjct  114  MEHQLLFSKVASFDDNSQFLIAMLRECGLAHKTIIFVLDEFDLFAQAKQRLLYSLLDAMQ  173

Query  361  SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
            SVTSQAVVIGVSCRLD DQLLEKRVRSRFSHRKL+FLPPSKED ER L+HIL LPKD  L
Sbjct  174  SVTSQAVVIGVSCRLDVDQLLEKRVRSRFSHRKLLFLPPSKEDTERFLEHILSLPKDSSL  233

Query  541  PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMD  690
            P  Y   FN +L ++L+D++FK+++ +  +++ST   L+R  F AV  MD
Sbjct  234  PHSYTVEFNGRLKNVLADERFKELINTYLSFNSTIGQLMR--FQAVSYMD  281



>tpg|DAA58086.1| TPA: hypothetical protein ZEAMMB73_713792 [Zea mays]
Length=238

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +1

Query  238  LIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQSVTSQAVVIGVSCRLDADQ  417
            +I MLRECGLAHKT++F+L+EFDLF QGKQRLLYSLLDAMQS+TSQAVVIGVSCRLDADQ
Sbjct  1    MIDMLRECGLAHKTILFILEEFDLFAQGKQRLLYSLLDAMQSLTSQAVVIGVSCRLDADQ  60

Query  418  LLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGLPTKYVDAFNTKLLSILSDD  597
            LLEKRVRSRFSHRKL+F+ PS +D++R+++H+L+L KD GLP+KY+  +N++L SI SD 
Sbjct  61   LLEKRVRSRFSHRKLLFISPSLDDIQRLVEHLLILAKDSGLPSKYIADYNSRLTSIFSDK  120

Query  598  KFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKD  777
            KFK  + SL   D+T +++ RFLF AV  MDM+SGFLS+++F  ALS+ QRQPK++ L+D
Sbjct  121  KFKGCLNSLMDADATTSNIQRFLFRAVSYMDMESGFLSVESFLKALSSMQRQPKMDSLQD  180

Query  778  CSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLR  933
             SILELYILVC+ RLE+ EQ + NF SIMKEY+ + D++KTSD YA  VC R
Sbjct  181  LSILELYILVCMHRLESKEQTSYNFTSIMKEYRSIQDAYKTSDKYASTVCFR  232



>tpg|DAA58085.1| TPA: hypothetical protein ZEAMMB73_713792 [Zea mays]
Length=239

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 181/214 (85%), Gaps = 1/214 (0%)
 Frame = +1

Query  238  LIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQSVTSQAVVIGVSCRLDADQ  417
            +I MLRECGLAHKT++F+L+EFDLF QGKQRLLYSLLDAMQS+TSQAVVIGVSCRLDADQ
Sbjct  1    MIDMLRECGLAHKTILFILEEFDLFAQGKQRLLYSLLDAMQSLTSQAVVIGVSCRLDADQ  60

Query  418  LLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGLPTKYVDAFNTKLLSILSDD  597
            LLEKRVRSRFSHRKL+F+ PS +D++R+++H+L+L KD GLP+KY+  +N++L SI SD 
Sbjct  61   LLEKRVRSRFSHRKLLFISPSLDDIQRLVEHLLILAKDSGLPSKYIADYNSRLTSIFSDK  120

Query  598  KFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKD  777
            KFK  + SL   D+T +++ RFLF AV  MDM+SGFLS+++F  ALS+ QRQPK++ L+D
Sbjct  121  KFKGCLNSLMDADATTSNIQRFLFRAVSYMDMESGFLSVESFLKALSSMQRQPKMDSLQD  180

Query  778  CSILELYILVCLRRLEANEQETCNFNSIMKE-YK  876
             SILELYILVC+ RLE+ EQ + NF SIMK+ YK
Sbjct  181  LSILELYILVCMHRLESKEQTSYNFTSIMKDPYK  214



>ref|XP_010069005.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Eucalyptus 
grandis]
Length=219

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            ACNNSVLLLGPRG GK AVL+LVLE LL E+PDMI++I+LNGLLHSDDN A+KEI RQLC
Sbjct  50   ACNNSVLLLGPRGSGKVAVLDLVLEDLLLEYPDMITLIRLNGLLHSDDNSAVKEIARQLC  109

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             EHQL+FSKMASFDDNS+F+IAMLRECGLAHKT++FVLDEFDLFTQGKQRLLY+LLDAMQ
Sbjct  110  VEHQLLFSKMASFDDNSEFMIAMLRECGLAHKTIVFVLDEFDLFTQGKQRLLYALLDAMQ  169

Query  361  SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDL  492
            SVTSQAVVIGVSCRLDADQLLEKRV+SRFSHRKL+FLPPS+ED+
Sbjct  170  SVTSQAVVIGVSCRLDADQLLEKRVKSRFSHRKLLFLPPSEEDI  213



>gb|EMS52251.1| Origin recognition complex subunit 4 [Triticum urartu]
Length=359

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 160/371 (43%), Positives = 214/371 (58%), Gaps = 76/371 (20%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNSVLLLGPRGCGK AVL++VLE L +E PD ISVI+LNG+LHSDDNCA K       
Sbjct  54    ACNNSVLLLGPRGCGKGAVLDMVLEDLKEEHPDAISVIRLNGMLHSDDNCATK-------  106

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
                       AS DDN++F+I MLR  G +  ++ +++         +  LL+  L    
Sbjct  107   ----------ASSDDNTEFMIDMLR--GSSGYSIAYLM---------QCNLLHHKL----  141

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKH-----ILLLP  525
                           LDADQLLEKRVRSRFSHRKL+F+P S +D++RI+K        ++P
Sbjct  142   ------------LSLDADQLLEKRVRSRFSHRKLLFVPSSLDDIQRIVKSEQNCMYGIIP  189

Query  526   KDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGF  705
                G+   Y     T +  +L              Y+  F H          +      F
Sbjct  190   LQSGVIYGY--GIWTSVNGML--------------YECAFLH---------AEATQDGQF  224

Query  706   LSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVH  885
              S+ +   A+++      L  + D SILELYILVC++RLE  EQ++ NFN+I+KEYK + 
Sbjct  225   ASISSCNNAIASHPCHQIL--MPDLSILELYILVCMKRLEDKEQKSYNFNTIIKEYKSIQ  282

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
             D++KTSD YA  VC RAFEHLL RELI+F +++G N ++E+RPV+LLIS  EL Q LK  
Sbjct  283   DAYKTSDKYATTVCFRAFEHLLDRELITFADSKGRNVALEYRPVKLLISSRELAQSLKLN  342

Query  1066  GCCPVILHKLI  1098
               CP +L KL+
Sbjct  343   TTCPAVLQKLL  353



>ref|XP_008389997.1| PREDICTED: LOW QUALITY PROTEIN: origin recognition complex subunit 
4-like [Malus domestica]
Length=320

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 152/209 (73%), Gaps = 9/209 (4%)
 Frame = +1

Query  478   SKEDLERILKHILLLPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLL  657
             S  +L ++L+HILLLP D   P  Y        ++IL+D +FK+IV +    DST  HLL
Sbjct  115   SFRNLRQLLEHILLLPTDSSFPPDYA-------ITILADKRFKEIVNAYLNLDSTVKHLL  167

Query  658   RFLFSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQ  837
             R+ F AV  MD++SG L L NF+T LSN QR PKL+C+KDC +LELYILVC++RLE  EQ
Sbjct  168   RYPFPAVSDMDLESGMLLLXNFKTTLSNIQRHPKLKCIKDCXVLELYILVCMKRLEVKEQ  227

Query  838   ETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPV  1017
              + NF+++MKEYK +HDS KT+ ++AR+VCLR FEHLLQRELI F +NRG NQ +EF PV
Sbjct  228   NSYNFSAVMKEYKSIHDSVKTAYHFARNVCLRGFEHLLQRELIGFADNRGQNQPVEFNPV  287

Query  1018  QLLIS--LHELQQGLKSWGCCPVILHKLI  1098
             +LLIS   +EL QG+KS+  CP IL +L+
Sbjct  288   KLLISSPCNELHQGMKSYRSCPAILQQLM  316


 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALK  159
            ACN+S+LLLGPRG GK A+LELVL  LL+EFPD +SVI+L+GLLHS DNCA K
Sbjct  51   ACNSSILLLGPRGSGKTAMLELVLSDLLQEFPDTVSVIRLSGLLHSSDNCAFK  103



>ref|XP_009356187.1| PREDICTED: origin recognition complex subunit 4-like [Pyrus x 
bretschneideri]
Length=252

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            ACN+S+LLLGPRG GK A+LELVL  LL+EFPDMISVI+L+GLLHS DNCA KEI RQLC
Sbjct  50   ACNSSILLLGPRGSGKIALLELVLNDLLQEFPDMISVIRLSGLLHSSDNCAFKEIARQLC  109

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
             EHQLVFS+MASFDDNSQF+IAMLRECGLAHKT+IFVLDEFDLF   KQRLL SLL+AMQ
Sbjct  110  MEHQLVFSRMASFDDNSQFMIAMLRECGLAHKTIIFVLDEFDLFAVIKQRLLSSLLNAMQ  169

Query  361  SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLI  465
            SVTSQAVVIGVS RLDAD LL+KR       R+LI
Sbjct  170  SVTSQAVVIGVSSRLDADMLLDKRAFEHLRQRELI  204


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  931   RAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPVILHKLI  1098
             RAFEHL QRELI F +NRG NQS+EF PV+LL+S HEL QG+KS+G CP IL +L+
Sbjct  193   RAFEHLRQRELIGFADNRGQNQSVEFSPVKLLVSSHELHQGMKSFGSCPAILQQLM  248



>ref|XP_002314828.1| origin recognition complex subunit 4 family protein [Populus 
trichocarpa]
 gb|EEF00999.1| origin recognition complex subunit 4 family protein [Populus 
trichocarpa]
Length=228

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 137/190 (72%), Gaps = 12/190 (6%)
 Frame = +1

Query  544   TKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFL---FSAVCQMDMKSGFLSL  714
             + Y   F+ KL  IL+D++FK+ V +    +ST NHLLRFL   F A+  M++KSGFLSL
Sbjct  29    SDYAAEFSEKLRGILADERFKETVGAYLNSNSTINHLLRFLQVQFVAISHMELKSGFLSL  88

Query  715   DNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSF  894
             +NF+ ALS  QRQPK EC+KDCSILEL ILVC++RLE  EQ + NF+S+MKEYK +H+SF
Sbjct  89    ENFKAALSRIQRQPKQECIKDCSILELSILVCMKRLEVKEQNSYNFSSVMKEYKSMHESF  148

Query  895   KTSDYYARDVCL---------RAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQ  1047
              TSDYYA++ CL          AF+H LQ E+I    NRGH+QSIEFR V+LLIS  ELQ
Sbjct  149   PTSDYYAQNFCLWICINIDETSAFQHHLQSEIICSTNNRGHSQSIEFRQVRLLISHAELQ  208

Query  1048  QGLKSWGCCP  1077
             QGLKS+  CP
Sbjct  209   QGLKSYHSCP  218



>tpg|DAA58084.1| TPA: hypothetical protein ZEAMMB73_713792, partial [Zea mays]
Length=135

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  238  LIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQSVTSQAVVIGVSCRLDADQ  417
            +I MLRECGLAHKT++F+L+EFDLF QGKQRLLYSLLDAMQS+TSQAVVIGVSCRLDADQ
Sbjct  1    MIDMLRECGLAHKTILFILEEFDLFAQGKQRLLYSLLDAMQSLTSQAVVIGVSCRLDADQ  60

Query  418  LLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGLPTKYVDAFNTKL  576
            LLEKRVRSRFSHRKL+F+ PS +D++R+++H+L+L KD GLP+KY+  +N++L
Sbjct  61   LLEKRVRSRFSHRKLLFISPSLDDIQRLVEHLLILAKDSGLPSKYIADYNSRL  113



>ref|XP_002968373.1| hypothetical protein SELMODRAFT_409152 [Selaginella moellendorffii]
 gb|EFJ30627.1| hypothetical protein SELMODRAFT_409152 [Selaginella moellendorffii]
Length=346

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 126/373 (34%), Positives = 186/373 (50%), Gaps = 86/373 (23%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS LLLGPRGCGK                   S+++LNGLLH+DD  ALKEI +QLC
Sbjct  38    ACNNSALLLGPRGCGK-------------------SMVRLNGLLHADDRSALKEIAKQLC  78

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH+L FSK ASF++N +FL  +L    L            D  T+         + ++Q
Sbjct  79    VEHELEFSKAASFEENLRFLTVILEYVPLLR----------DQETKA--------VPSVQ  120

Query  361   SVTSQAVVI-GVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFG  537
              V S A+ +   SC                                  L+ +L++P D  
Sbjct  121   LVGSVAIALFPSSCNW-------------------------------FLEAVLVIPVDSS  149

Query  538   LP-TKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSL  714
                 ++ +AFN K+ + L  +  K++V  L   DS+  +++  +F  +           L
Sbjct  150   ANLAQHANAFNAKISAWLQMETTKELVNKLAALDSSPRNIIDSVFRNL-----------L  198

Query  715   DNFRTALSNTQRQPKLEC-LKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDS  891
             D  +   S T + P   C L D S+LEL++L  ++RLE  E++T  FNS+ KEY+   D 
Sbjct  199   DYLKNTKSTTPKHPPTICALADLSVLELFLLTSMKRLENKERDTYTFNSVFKEYQ---DG  255

Query  892   FKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGC  1071
             +K+SD Y++    +AFEHLL+RELI + + R  +     RPV++LIS  EL+QGL++   
Sbjct  256   YKSSDSYSKKAAYKAFEHLLERELIGYSDGRAVSTLSHLRPVKMLISFEELEQGLEASPI  315

Query  1072  CPVILHKLI*SQP  1110
             CP  L +   SQP
Sbjct  316   CPATLRQWY-SQP  327



>gb|EPB82706.1| hypothetical protein HMPREF1544_10552 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=446

 Score =   187 bits (475),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 130/368 (35%), Positives = 198/368 (54%), Gaps = 15/368 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLCSE  186
             +NS L++G RG GK A++  VL  L K   +   V+KLNGL  ++D  AL EI+RQL +E
Sbjct  77    SNSCLIVGNRGTGKTALVRTVLRDLQK-LENEFCVVKLNGLTETNDRLALNEISRQLVTE  135

Query  187   HQLVFSK-MASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQ-GKQRLLYSLLDAMQ  360
              Q    +   SF D+  +L+++L+    +   VIFVLDEFDLF Q  KQ LLY+L DA Q
Sbjct  136   QQDQPDRTFTSFADSFDYLLSLLKSGDKSSLPVIFVLDEFDLFAQHPKQALLYNLFDAAQ  195

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKDFG  537
             S  +   VIG++CRLD   LLEKRV+SRFSHR++   P S   +   I K  L+LP+D+ 
Sbjct  196   SAQNPMAVIGLTCRLDTLDLLEKRVKSRFSHRQIYLFPSSNFGEFLDIAKGTLMLPEDY-  254

Query  538   LPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLD  717
                +  DAFN  L  +  +     I+  +           +  F AVC M  ++ FLS++
Sbjct  255   ---RGSDAFNMDLEELFQNPTVNGILRRIFDISKDIRMFQKICFPAVCTMKGQAPFLSIE  311

Query  718   NFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFK  897
              F  +    +   K E LK  ++LEL ++V +++L   +  T NF  +  EYK   +  +
Sbjct  312   EFTESSLVQRADSKTELLKGIALLELVLIVSMKKLLEKDVTTFNFQMVYDEYKDFMNRTQ  371

Query  898   TSDY------YARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLK  1059
              +        Y R V L+AFE+L   EL+  V+  G     E+R  +L++   ++ + + 
Sbjct  372   VNGMGFGMKLYKRAVALKAFENLQMFELVCPVDAPGKCPK-EYRMTKLMLEQAQVTEAVL  430

Query  1060  SWGCCPVI  1083
              + C  +I
Sbjct  431   KYNCSQII  438



>gb|ELU16403.1| hypothetical protein CAPTEDRAFT_227802 [Capitella teleta]
Length=422

 Score =   186 bits (472),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 127/364 (35%), Positives = 194/364 (53%), Gaps = 10/364 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvl--eallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS+L++GPRG GK+ +LE VL      K+    I V++LNGLL +DD  AL EITRQL 
Sbjct  48    SNSLLVIGPRGSGKSTLLEGVLDDLTNEKDVTGNILVVRLNGLLQTDDKIALAEITRQLQ  107

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECG-LAHKTVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E +       SF +N QFL+  LR       ++++FVLDEFDLF   + Q LLY+L D 
Sbjct  108   LEAESEGKAFGSFAENLQFLLEALRSGSDRKSRSLVFVLDEFDLFAHHRNQTLLYNLFDV  167

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPS--KEDLERILKHILLLPK  528
              QS  +   VIG++ R+D  +LLEKRV+SRFSHR +  LP    KE LE I + +L LP+
Sbjct  168   AQSAQAPICVIGLTVRMDVLELLEKRVKSRFSHRFIHLLPTYEFKEYLE-IAQDVLTLPQ  226

Query  529   DFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             DF    K V  +N      + D    D+++ +   D +  HL + L   VC+++ +   L
Sbjct  227   DFA-SKKLVGDWNKSAQEFMQDSSVIDVLQQIFYLDKSIQHLYQLLMIPVCKLNAEHTKL  285

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEYKIVH  885
                +   +     +  K   L+  SILEL +++ ++ L E  + E  NF  +   YK   
Sbjct  286   LASDLYASFKILHKDDKAAMLQGVSILELTLVLAMKHLNEVYDGEPFNFEMVFSVYKKFT  345

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                     + + V ++AFEHL   E++   E+       EFR ++L+    ++ + +K +
Sbjct  346   QRAALQS-FQKAVVIKAFEHLCSLEIVRAAESSTSRTQREFRALRLMADSSQIMEAVKRY  404

Query  1066  GCCP  1077
               CP
Sbjct  405   PACP  408



>ref|XP_002965944.1| hypothetical protein SELMODRAFT_407107 [Selaginella moellendorffii]
 gb|EFJ33364.1| hypothetical protein SELMODRAFT_407107 [Selaginella moellendorffii]
Length=341

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 121/362 (33%), Positives = 181/362 (50%), Gaps = 85/362 (23%)
 Frame = +1

Query  1     ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             ACNNS LLLGPRGCGK                   S+++LNGLLH+DD  ALKEI +QLC
Sbjct  45    ACNNSALLLGPRGCGK-------------------SMVRLNGLLHADDRSALKEIAKQLC  85

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQ  360
              EH+L FSK ASF++N +FL  +L    L            D  T+         + ++Q
Sbjct  86    VEHELEFSKAASFEENLRFLTVILEYVPLLR----------DQETKA--------VPSVQ  127

Query  361   SVTSQAVVI-GVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFG  537
              V S A+ +   SC                                  L+ +L++P D  
Sbjct  128   LVGSVAIALFPSSCNW-------------------------------FLETVLVIPVDSS  156

Query  538   LP-TKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSL  714
                 ++ +AFN K+ + L  +  K++V  L   DS+  +++  +F  +           L
Sbjct  157   ANLAQHANAFNAKISAWLQMETTKELVNKLAALDSSPRNIIDSVFRNL-----------L  205

Query  715   DNFRTALSNTQRQPKLEC-LKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDS  891
             D  +   S T + P   C L D S+LEL++L  ++RLE  E++T  FNS+ KEY+   D 
Sbjct  206   DYLKNTKSTTPKHPPTICALADLSVLELFLLTSMKRLENKERDTYTFNSVFKEYQ---DG  262

Query  892   FKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGC  1071
             +K+SD Y++    +AFEHLL+RELI + + +  +     RPV++LIS  EL+QGL++   
Sbjct  263   YKSSDSYSKKAAYKAFEHLLERELIGYSDGKAVSSLSHLRPVKMLISFEELEQGLEASPV  322

Query  1072  CP  1077
             CP
Sbjct  323   CP  324



>ref|XP_001634993.1| predicted protein [Nematostella vectensis]
 gb|EDO42930.1| predicted protein [Nematostella vectensis]
Length=396

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 127/365 (35%), Positives = 199/365 (55%), Gaps = 10/365 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFP---DMISVIKLNGLLHSDDNCALKEITRQL  177
             +NSVL++GPRG GK+ +++ VL+ L K      +M+ V  LNGL+ +DD  A+ +ITRQL
Sbjct  24    SNSVLIIGPRGSGKSLLVKDVLKDLSKSKTAKENMLQVY-LNGLVQTDDRLAMLDITRQL  82

Query  178   CSEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGK-QRLLYSLLDA  354
               E+ +      S  +N  FL+  L+ CG A ++++F+LDEFDLF   K Q LLY+L D 
Sbjct  83    QLENTVGERVFGSSAENLAFLLDSLK-CGHASQSILFILDEFDLFVHHKNQTLLYNLFDV  141

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL-IFLPPSKEDLERILKHILLLPKD  531
              QS  +   V+G+SCRLD  +LLEKRV+SRFSHR++ +F   S E+   I++ IL LP+ 
Sbjct  142   SQSAQTPVCVVGLSCRLDVVELLEKRVKSRFSHRQIHLFNSFSFEEYLGIVRSILTLPRS  201

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
              G  T ++  +N  +  +L D K +D +            L R L   +C +   + F++
Sbjct  202   SG-NTSFIQCWNDSVKVLLEDSKSRDTLRRQFHVSKDVRSLHRLLTQPICNLSPDNPFIT  260

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEAN-EQETCNFNSIMKEY-KIVH  885
              D+   + +      K   L   S+LE+ ++V ++ L      E  NF  + KEY K   
Sbjct  261   PDDIVASHAELNMDSKGAILHGLSVLEICLIVAMKHLLTTFNGEPFNFEMVYKEYKKFTQ  320

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 T+  + + V L+AFEHLL  EL+  VE        E+R + LL+   ++ + +  +
Sbjct  321   RPGHTAQSFEKAVVLKAFEHLLALELVKPVEGSSKLVQKEYRLMTLLVDTSQVIEAINKY  380

Query  1066  GCCPV  1080
               CP 
Sbjct  381   PECPT  385



>ref|XP_006820848.1| PREDICTED: origin recognition complex subunit 4-like [Saccoglossus 
kowalevskii]
Length=432

 Score =   176 bits (445),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 124/365 (34%), Positives = 192/365 (53%), Gaps = 10/365 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKE--FPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS +++GPRG GK+ +L+ +LE +  E    D +  + LNGLL +DD  ALKEITRQL 
Sbjct  59    SNSAIIIGPRGSGKSMILKSILEEVKLEDNVQDNLLEVHLNGLLQTDDKVALKEITRQLQ  118

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGK-QRLLYSLLDAM  357
              E+ +      SF +   FL+  L+      + V+F+LDEFDLF   K Q LLY+L D  
Sbjct  119   LENTVGDKVFGSFAETLSFLLEALKSDKKTSRPVLFILDEFDLFAHHKNQTLLYNLFDIS  178

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL-IFLPPSKEDLERILKHILLLPKDF  534
             QS  +   V G++CRLD  +LLEKRV+SRFSHR++ IF   S ++       IL LPK F
Sbjct  179   QSAQTPIAVFGLTCRLDVIELLEKRVKSRFSHRQIHIFSSLSFDEYIDAFLDILSLPKTF  238

Query  535   GLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
               P K +   +N+ + S+  D+   D++  +   + +   L R L   VC++     F+ 
Sbjct  239   --PDKNFTKEWNSHIQSLNDDNITIDVLRRIYQNNKSIGALKRLLLLPVCRLSEDHPFIR  296

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEA-NEQETCNFNSIMKEY-KIVH  885
               +   +        K   L   S+LEL +++ ++ L    + +  NF  +  EY K + 
Sbjct  297   STDLLESCQYLTMDSKAAMLHGVSVLELCLIIAMKHLTTLYDGDPVNFQMVYNEYQKFIQ  356

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   Y + V L+AFEHLL  E+I   +  G     E+RP+ LL+   ++   L+ +
Sbjct  357   RRGHSVQCYEKAVVLKAFEHLLALEMIKPADG-GQRSQKEYRPMMLLVDAMQIDDALQKY  415

Query  1066  GCCPV  1080
               CP 
Sbjct  416   PNCPT  420



>gb|AAF18660.1| unknown protein [Arabidopsis thaliana]
 gb|AAR92242.1| At2g01120 [Arabidopsis thaliana]
 gb|AAS47668.1| At2g01120 [Arabidopsis thaliana]
Length=121

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  745   QRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDV  924
             QRQPKLE ++DCS+LELY+LVC+RRLE  EQ + NF S+MKEYK +HDSF TSDYYA++V
Sbjct  2     QRQPKLEAVRDCSVLELYLLVCMRRLEVKEQSSYNFISVMKEYKAIHDSFHTSDYYAQNV  61

Query  925   CLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPVILHKLI  1098
             CLRAFEHL +R++I + ENRG +Q+ E+R  +LLIS  EL QG++S  CCP IL KL+
Sbjct  62    CLRAFEHLRERQVICYAENRGQSQTGEYRLQKLLISASELHQGMRSHACCPAILLKLL  119



>ref|XP_005069007.1| PREDICTED: origin recognition complex subunit 4 [Mesocricetus 
auratus]
Length=436

 Score =   172 bits (437),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 193/366 (53%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGL+  +D  ALKEITRQL 
Sbjct  60    SNSVLIVGPRGSGKTMLINRALKELMEIREVSENVLQVHLNGLMQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   A    VIF+LDEFDLF  Q  Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRASSCPVIFILDEFDLFAHQKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP++
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYMKIFKEQLSLPEE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N    S+  D   +++++ L   + +   L   L  A+ ++ +   F+
Sbjct  240   F--PNKVFAERWNENAQSLSEDSTVREVLQKLFNVNKSLRSLHTLLMLALTRVTVSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K +
Sbjct  298   TSADLMEAQHLCSLDSKASIIHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFI  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ V+LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YSNCPT  423



>ref|XP_422152.3| PREDICTED: origin recognition complex subunit 4 isoform X4 [Gallus 
gallus]
Length=436

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 197/366 (54%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK A+L  VL+    +K+  + +  + LNGLL ++D  ALKEITRQL 
Sbjct  60    SNSALIIGPRGSGKTALLNRVLKDLREMKQVKENLLEVHLNGLLQTNDKVALKEITRQLH  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  LR+        V+FVLDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLAFLLEALRKGDRTSSCPVLFVLDEFDLFVHHKNQTLLYNLFDV  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CR D  +LLEKRV+SRFSHR++  +   + +   RI K  L LP +
Sbjct  180   SQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRRIYLMNSFAFKQYIRIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K +   +N+ +  +  D   +DI+++L  Y      L   L  AV  + ++   +
Sbjct  240   F--PDKAFAQKWNSNIQLLTEDKTVQDILQNLFHYSKDLRSLNFLLMLAVSNVTVRHPLI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  + + A    +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+ K +
Sbjct  298   TASDLQEASKQYRMDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEFQKFI  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                      + + V ++AFEHLLQ EL+  +E        E+  ++LL+  +++   L++
Sbjct  358   QRKAHCMYNFEKPVVMKAFEHLLQLELVKPIERPSVRSQREYLLMELLLDNNQIMDALQA  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_007422692.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Python 
bivittatus]
 ref|XP_007422693.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Python 
bivittatus]
 ref|XP_007422694.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Python 
bivittatus]
 ref|XP_007422695.1| PREDICTED: origin recognition complex subunit 4 isoform X4 [Python 
bivittatus]
Length=434

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 193/366 (53%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavl--elvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L     +K+  D +  + LNGLL + D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTLLICHVLKKLLEIKQVRDNVLQVHLNGLLQTSDRIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L+     H   V+F+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLAFLLEALKRGDRDHSCPVLFILDEFDLFVHHKNQTLLYNLFDV  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +     +    I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFKTYLNICKEQLSLPPE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K ++  +N  + S+L D K +D++++   Y      L   L  A   +     ++
Sbjct  240   F--PEKSFIQKWNKNIQSLLEDLKVQDVLQNQFHYSKDLRCLFMLLMLASNNITASHPYI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
              + +F  A    +   K   +   S+LEL +++ ++ L +  E E  NF  +  EY K V
Sbjct  298   RVSDFLEASRLCRMDTKANIVHGLSVLELCLIIAMKHLNDIYEGEPFNFQMVYHEYQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  T   + + V ++AFEHL   ELI  VE   ++   E+  ++LL+   ++ + L+ 
Sbjct  358   QRKAHTVYNFEKPVVMKAFEHLQHLELIKPVEGPSNSVQREYLLMKLLLDSSQVIEALQV  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_005650673.1| hypothetical protein COCSUDRAFT_40278 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26129.1| hypothetical protein COCSUDRAFT_40278 [Coccomyxa subellipsoidea 
C-169]
Length=539

 Score =   173 bits (438),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 122/355 (34%), Positives = 177/355 (50%), Gaps = 32/355 (9%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEF---PD--MISVIKLNGLLHSDDNCALKEI  165
              N S L++G RG GK  + E  +  L  ++   PD  ++ V++L+GL+HS D  A +EI
Sbjct  102  GANTSYLIIGARGTGKTLMAERTVGELCAKYNTNPDSPVVGVVRLSGLVHSADRVAFREI  161

Query  166  TRQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQG-KQRLLYS  342
             RQLC    + FS+ AS  DN  FL  ML+E    HK+V+FVLDEFDLF +  KQ +LY+
Sbjct  162  ARQLCEAFNVSFSRAASLGDNLDFLRDMLKELRKGHKSVVFVLDEFDLFAKPVKQTVLYN  221

Query  343  LLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLER-------I  501
            LLDA+Q+   QA V+G+S R D  +++EKRV+SRFSHR+ I L       E        +
Sbjct  222  LLDALQASNIQAAVVGLSARFDVMEIMEKRVKSRFSHRRDIVLELDAAGFEHPHSGVPSL  281

Query  502  LKHILLLPKDFGLP----TKYVDAFNTKLLSILSDDKFKDIVESLCTYD-STFNHLLRFL  666
            L  +L LP++   P    T +   +N  L + L D     + E    +D  T     R  
Sbjct  282  LAAMLALPEEGASPEAPCTAFARGWNKSLHAALQDSAL--LAELRLLFDKGTAGDACR--  337

Query  667  FSAVCQMDMKSGFLSLDNFRTALSNTQRQ---------PKLECLKDCSILELYILVCLRR  819
              A C     +          AL +++R+         P ++ +    ILELY+LV   R
Sbjct  338  PGADCTGGGDARRARAGGAAAALPHSRRRSRAAPIPGMPLVDAVASQGILELYVLVAALR  397

Query  820  LEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENR  984
            L     E  NF  +  EY         +D Y++    RAF+ LL   L+ F + R
Sbjct  398  LHRRGYERVNFELLWAEYAKT-AGMGHADVYSKPAAARAFQRLLDAALLVFTDAR  451



>ref|NP_001258354.1| origin recognition complex subunit 4 [Cricetulus griseus]
 ref|XP_007646937.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Cricetulus 
griseus]
 sp|Q4U3P8.1|ORC4_CRIGR RecName: Full=Origin recognition complex subunit 4 [Cricetulus 
griseus]
 gb|AAY41171.1| origin recognition complex subunit 4 [Cricetulus griseus]
 dbj|BAE16571.1| Origin Recognition Complex Subunit 4 [Cricetulus griseus]
Length=436

 Score =   171 bits (432),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 193/366 (53%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGL+  +D  AL EITRQL 
Sbjct  60    SNSVLIVGPRGSGKTMLINHALKELMEIREVSENVLQVHLNGLMQINDKIALTEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   A+   VIF+LDEFDLF  Q  Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGNRANSCPVIFILDEFDLFAHQKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP++
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYMKIFKEQLSLPEE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N    S+  D   +++++ L   + +   L   L  A+ ++ +   F+
Sbjct  240   F--PNKVFAERWNENTQSLSEDSTVREVLQKLFNVNKSLRSLHMLLMLALNRVTVSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K +
Sbjct  298   TSADLMEAQHLCSLDSKASIIHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFI  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ V+LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YSNCPT  423



>ref|XP_004943072.1| PREDICTED: origin recognition complex subunit 4 isoform X5 [Gallus 
gallus]
Length=494

 Score =   171 bits (434),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 197/366 (54%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK A+L  VL+    +K+  + +  + LNGLL ++D  ALKEITRQL 
Sbjct  118   SNSALIIGPRGSGKTALLNRVLKDLREMKQVKENLLEVHLNGLLQTNDKVALKEITRQLH  177

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  LR+        V+FVLDEFDLF   K Q LLY+L D 
Sbjct  178   LENVVGDKVFGSFAENLAFLLEALRKGDRTSSCPVLFVLDEFDLFVHHKNQTLLYNLFDV  237

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CR D  +LLEKRV+SRFSHR++  +   + +   RI K  L LP +
Sbjct  238   SQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRRIYLMNSFAFKQYIRIFKEQLSLPAE  297

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K +   +N+ +  +  D   +DI+++L  Y      L   L  AV  + ++   +
Sbjct  298   F--PDKAFAQKWNSNIQLLTEDKTVQDILQNLFHYSKDLRSLNFLLMLAVSNVTVRHPLI  355

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  + + A    +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+ K +
Sbjct  356   TASDLQEASKQYRMDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEFQKFI  415

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                      + + V ++AFEHLLQ EL+  +E        E+  ++LL+  +++   L++
Sbjct  416   QRKAHCMYNFEKPVVMKAFEHLLQLELVKPIERPSVRSQREYLLMELLLDNNQIMDALQA  475

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  476   YPNCPT  481



>ref|XP_010712299.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Meleagris 
gallopavo]
Length=399

 Score =   169 bits (429),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 124/367 (34%), Positives = 200/367 (54%), Gaps = 12/367 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK A+L  VL+    +K+  + +  + LNGLL ++D  ALKEITRQL 
Sbjct  23    SNSALIIGPRGSGKTALLNHVLKDLREMKQVKENLLEVHLNGLLQTNDKVALKEITRQLH  82

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  LR+        V+FVLDEFDLF   K Q LLY+L D 
Sbjct  83    LENVVGDKVFGSFAENLVFLLEALRKGDRTSSCPVLFVLDEFDLFVHHKNQTLLYNLFDV  142

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CR D  +LLEKRV+SRFSHR++  +   + +   RI K  L LP +
Sbjct  143   SQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRRIYLMNSFAFKQYIRIFKEQLSLPAE  202

Query  532   FGLPTK-YVDAFNTKLLSILSDDK-FKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGF  705
             F  P K +   +N+  + +LS+DK  +D++++L  Y      L   L  A+  + ++   
Sbjct  203   F--PDKAFAQKWNSN-IQLLSEDKAVQDVLQNLFHYSKDLRSLHFLLMLALSNVTVRHPL  259

Query  706   LSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KI  879
             ++  + + A    +   K   +   S+LE+ +++ ++ L E  E E  NF  +  E+ K 
Sbjct  260   ITASDLQEASKQYRMDSKANIVHGLSVLEICLIIAMKHLNEVYEGEPFNFQMVYNEFQKF  319

Query  880   VHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLK  1059
             +         + + V ++AFEHLLQ EL+  +E        E+  ++LL+  +++   L+
Sbjct  320   IQRKAHCMYNFEKPVVMKAFEHLLQLELVKPIERPSVRSQREYLLMELLLDNNQIMDALQ  379

Query  1060  SWGCCPV  1080
              +  CP 
Sbjct  380   VYPNCPT  386



>ref|XP_002164229.2| PREDICTED: origin recognition complex subunit 4-like [Hydra vulgaris]
Length=449

 Score =   170 bits (431),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 117/368 (32%), Positives = 197/368 (54%), Gaps = 13/368 (4%)
 Frame = +1

Query  10    NSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLCSEH  189
             NSVL++GPRG GK+ ++E  L  L  E  +    + L+G++H+DD  +L+++TRQL  E+
Sbjct  76    NSVLVIGPRGSGKSKLVEKTLAELHNENVESFYYVYLSGIIHTDDKLSLQDMTRQLQLEN  135

Query  190   QLVFSKMASFDDNSQFLIAMLR--ECGLAHKTVIFVLDEFDLFTQGK-QRLLYSLLDAMQ  360
                     SF DN  F++  L+  +C    K+++ VLDEFD F   K Q LLY+L D   
Sbjct  136   VTKDKVFGSFSDNLAFVLEALKNGKCTAKSKSIVIVLDEFDCFASHKNQTLLYNLFDITM  195

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDFGL  540
             S  +   VIG++CRLD  +LLEKRV+SR+SHR ++  P    D      +     K+  L
Sbjct  196   SQQNPMCVIGITCRLDVVELLEKRVKSRYSHRSILTFPTY--DFSTYTDYFNDKIKE--L  251

Query  541   PTKYVDAFNTKLLSILSD----DKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
                YV+     +L+IL D      F DI++           +++ L   +C +     F+
Sbjct  252   KRVYVNKTYVYILTILPDLFNSSNFNDILKKQFHITKHIGGIIQLLTIPICNLSYAHPFV  311

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRR-LEANEQETCNFNSIMKEYKIVH  885
             ++D+  ++ ++     K   ++  +ILEL ++V  +  LE    +  NF  +  EY+   
Sbjct  312   TVDDINSSYNSLHADSKSFLMQGLAILELCLIVAAKHVLEKRIGQPFNFEMVYNEYENFS  371

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENR-GHNQSIEFRPVQLLISLHELQQGLKS  1062
              S  T  + ++ V ++A+EHLL  ELI   EN+ G++ + EF+P+ L +   ++++ L +
Sbjct  372   KSCLTGVHISKAVAMKAYEHLLTLELIRSTENQTGNSLAKEFKPMLLYVDASQIRETLAN  431

Query  1063  WGCCPVIL  1086
             +  CP  L
Sbjct  432   YTDCPTEL  439



>ref|XP_007646936.1| PREDICTED: origin recognition complex subunit 4 isoform X4 [Cricetulus 
griseus]
Length=453

 Score =   170 bits (431),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 193/366 (53%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGL+  +D  AL EITRQL 
Sbjct  77    SNSVLIVGPRGSGKTMLINHALKELMEIREVSENVLQVHLNGLMQINDKIALTEITRQLN  136

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   A+   VIF+LDEFDLF  Q  Q LLY+L D 
Sbjct  137   LENVVGDKVFGSFAENLSFLLEALKKGNRANSCPVIFILDEFDLFAHQKNQTLLYNLFDI  196

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP++
Sbjct  197   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYMKIFKEQLSLPEE  256

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N    S+  D   +++++ L   + +   L   L  A+ ++ +   F+
Sbjct  257   F--PNKVFAERWNENTQSLSEDSTVREVLQKLFNVNKSLRSLHMLLMLALNRVTVSHPFM  314

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K +
Sbjct  315   TSADLMEAQHLCSLDSKASIIHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFI  374

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ V+LL+   ++   L+ 
Sbjct  375   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQK  434

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  435   YSNCPT  440



>ref|XP_007646935.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Cricetulus 
griseus]
Length=461

 Score =   170 bits (431),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 193/366 (53%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGL+  +D  AL EITRQL 
Sbjct  85    SNSVLIVGPRGSGKTMLINHALKELMEIREVSENVLQVHLNGLMQINDKIALTEITRQLN  144

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   A+   VIF+LDEFDLF  Q  Q LLY+L D 
Sbjct  145   LENVVGDKVFGSFAENLSFLLEALKKGNRANSCPVIFILDEFDLFAHQKNQTLLYNLFDI  204

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP++
Sbjct  205   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYMKIFKEQLSLPEE  264

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N    S+  D   +++++ L   + +   L   L  A+ ++ +   F+
Sbjct  265   F--PNKVFAERWNENTQSLSEDSTVREVLQKLFNVNKSLRSLHMLLMLALNRVTVSHPFM  322

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K +
Sbjct  323   TSADLMEAQHLCSLDSKASIIHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFI  382

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ V+LL+   ++   L+ 
Sbjct  383   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQK  442

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  443   YSNCPT  448



>ref|XP_004651881.1| PREDICTED: origin recognition complex subunit 4-like [Jaculus 
jaculus]
Length=434

 Score =   169 bits (429),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 194/365 (53%), Gaps = 9/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK-EFPDMISVIKLNGLLHSDDNCALKEITRQLCS  183
             +NSVL++GPRG GK  ++   L+ L++ E  + +  + LNGLLH +D  ALKEITRQL  
Sbjct  59    SNSVLIIGPRGSGKTMLINHALKELMEIEVSENVLQVHLNGLLHINDKIALKEITRQLYL  118

Query  184   EHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDAM  357
             E+ +      SF +N  FL+  L++    H   VIFVLDEFDLF   K Q LLY+L D  
Sbjct  119   ENVVGDKVFGSFAENLSFLLEALKKGDRTHSCPVIFVLDEFDLFAHHKNQTLLYNLFDIS  178

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKDF  534
             QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +F
Sbjct  179   QSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQFIKIFKEQLSLPAEF  238

Query  535   GLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
               P K + + +N  +  +  D    ++++     +     L   L  A+ ++ +   +L+
Sbjct  239   --PDKVFAEKWNENVQCLSEDRSVHEVLQKHFNVNKNLRSLHMLLMVALSRITVSRPYLT  296

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V 
Sbjct  297   SADLMEAHQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQ  356

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ +
Sbjct  357   RKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQKEYQLMKLLLDNTQIMNALQKY  416

Query  1066  GCCPV  1080
               CP 
Sbjct  417   PNCPT  421



>ref|XP_007646934.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Cricetulus 
griseus]
Length=484

 Score =   171 bits (432),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 193/366 (53%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGL+  +D  AL EITRQL 
Sbjct  108   SNSVLIVGPRGSGKTMLINHALKELMEIREVSENVLQVHLNGLMQINDKIALTEITRQLN  167

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   A+   VIF+LDEFDLF  Q  Q LLY+L D 
Sbjct  168   LENVVGDKVFGSFAENLSFLLEALKKGNRANSCPVIFILDEFDLFAHQKNQTLLYNLFDI  227

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP++
Sbjct  228   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYMKIFKEQLSLPEE  287

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N    S+  D   +++++ L   + +   L   L  A+ ++ +   F+
Sbjct  288   F--PNKVFAERWNENTQSLSEDSTVREVLQKLFNVNKSLRSLHMLLMLALNRVTVSHPFM  345

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K +
Sbjct  346   TSADLMEAQHLCSLDSKASIIHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFI  405

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ V+LL+   ++   L+ 
Sbjct  406   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQK  465

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  466   YSNCPT  471



>emb|CAN69810.1| hypothetical protein VITISV_043106 [Vitis vinifera]
Length=847

 Score =   174 bits (440),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 125/212 (59%), Gaps = 45/212 (21%)
 Frame = +1

Query  496   RILKHILLLPKDFGLPTKYVDAFNTKL-----LSILSDDKFKDIVESLCTYDSTFNHLLR  660
             R+L+HI  LP D  LP  Y   FN KL      S+        + ES+    + +  L  
Sbjct  135   RLLEHIFSLPVDTSLPNDYAVEFNMKLHVSVSFSVPVTGSMDCLCESMAV--NVYFILFS  192

Query  661   FL--------FSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLR  816
             FL        F AVC MD++SGFLSLDNFRTA+S+ QRQPK+E L+              
Sbjct  193   FLLLTYHVPRFYAVCHMDLESGFLSLDNFRTAMSSIQRQPKMEYLQ--------------  238

Query  817   RLEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQ  996
                              EYK +HD+++TSDYYAR+VCLRAFEHL+QRELI F++NRG+NQ
Sbjct  239   ----------------AEYKGIHDAYQTSDYYARNVCLRAFEHLVQRELICFMDNRGNNQ  282

Query  997   SIEFRPVQLLISLHELQQGLKSWGCCPVILHK  1092
             SIEFR V+LLIS HEL QGLKS+  CPV  +K
Sbjct  283   SIEFRAVKLLISSHELYQGLKSYRSCPVSSYK  314


 Score =   130 bits (327),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  1    ACNNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            ACNNS+LLLGPRG GK AVLELV+  LL E  DMISVI+LNGLLHSDDNCA+KEI RQLC
Sbjct  51   ACNNSILLLGPRGSGKTAVLELVIRDLLAEHADMISVIRLNGLLHSDDNCAVKEIARQLC  110

Query  181  SEHQLVFSKMASFDDNSQFLIAMLR  255
             EHQL+FSKMASFDDNSQF+IAMLR
Sbjct  111  VEHQLLFSKMASFDDNSQFMIAMLR  135



>ref|XP_970921.1| PREDICTED: origin recognition complex subunit 4 [Tribolium castaneum]
 gb|EFA06929.1| hypothetical protein TcasGA2_TC009879 [Tribolium castaneum]
Length=427

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 117/368 (32%), Positives = 199/368 (54%), Gaps = 12/368 (3%)
 Frame = +1

Query  10    NSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLCSEH  189
             NS LL+GPR  GK  +++ VL  L   F     ++KL+GL+H+DD  ALK IT Q+  E+
Sbjct  50    NSALLIGPRASGKTTLVDNVLRDLQPYFSSDAILVKLHGLIHTDDRIALKSITAQMNLEN  109

Query  190   QLVFSKMASFDDNSQFLIAMLR--ECGLAHKTVIFVLDEFDLF-TQGKQRLLYSLLDAMQ  360
              +      SF DN  FL+A L+  E G++ K++IF+++EFDLF +   Q LLY+L D  Q
Sbjct  110   AVDGKVFGSFADNLTFLLACLKSGERGVS-KSIIFIIEEFDLFCSHHNQTLLYNLFDVSQ  168

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL-IFLPPSKED-----LERILKHILL-  519
             S  +   V+G++CRLD  +LLEKRV+SRFSHR++ +FL    E+     L R+ K+ L+ 
Sbjct  169   SAQTPICVLGITCRLDVIELLEKRVKSRFSHRQIFLFLGNDNENHLDQRLARLQKYFLVP  228

Query  520   LPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKS  699
             + +   +   +   +N+ + ++L D  FK +++ L   D +   L   L   V +++  +
Sbjct  229   IQQSVDIAPSFKKQWNSSVHTLLKDRNFKSLMQRLIDLDLSERSLKNILLLVVSELNNDN  288

Query  700   GFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLR-RLEANEQETCNFNSIMKEYK  876
               L+ D F   +   +R   ++ L+D S+LEL +++ ++   E  + +  NF  +   Y 
Sbjct  289   NKLAYDTFLRQVELFERDETVQVLQDLSVLELCLIITMKHHCEIYDNQPMNFEMVFSRYL  348

Query  877   IVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGL  1056
                ++        R V ++AFE +   ELIS +         E++  +LL+  H++ + +
Sbjct  349   KFANANSNIQTVERPVIMKAFEQIENLELISPLTTGNSTVQKEYQLFKLLVLPHQITEAV  408

Query  1057  KSWGCCPV  1080
             K     P 
Sbjct  409   KKITGLPT  416



>ref|XP_005153803.1| PREDICTED: origin recognition complex subunit 4 [Melopsittacus 
undulatus]
Length=436

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/370 (33%), Positives = 194/370 (52%), Gaps = 18/370 (5%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISV------IKLNGLLHSDDNCALKEIT  168
             +NS L++GPRG GK A+L  VL    KE  +M  V      ++LNGLL ++D  ALKEIT
Sbjct  60    SNSALIIGPRGSGKTALLNCVL----KELKEMKQVRGNLLEVRLNGLLQTNDKVALKEIT  115

Query  169   RQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYS  342
             RQL  E+ +      SF +N  FL+  LR+        V+F+LDEFDLF   K Q LLY+
Sbjct  116   RQLNLENVVGDKVFGSFAENLAFLLEALRKGDRTSSCPVLFILDEFDLFVHHKNQTLLYN  175

Query  343   LLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILL  519
             L D  QS  +   VIG++CR D  +LLEKRV+SRFSHR++  +     +   +I K  L 
Sbjct  176   LFDISQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRQIYLMNSFDFKQYIKIFKEQLA  235

Query  520   LPKDFGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMK  696
             LP DF  P K +   +NT +  +  D   +D++++L  +      L  FL  A+  + + 
Sbjct  236   LPADF--PDKSFAQKWNTNVQHLSEDKTVQDVLQNLFHHSKDLRTLHLFLMLALSNVTVH  293

Query  697   SGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY  873
                ++  +   A    +   +   +   S+LE+ +++ ++ L +  E E  NF  +  E+
Sbjct  294   HPLITASDLHEASKQYRTDSRANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEF  353

Query  874   -KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQ  1050
              K +         + + V ++AFEHLLQ EL+  +E        E+  ++LL+   ++  
Sbjct  354   QKFIQRKAHCMYNFEKPVVMKAFEHLLQLELVKPIERPNIRAQREYLLMKLLLDSTQIMD  413

Query  1051  GLKSWGCCPV  1080
              L+ +  CPV
Sbjct  414   ALQVYPNCPV  423



>ref|XP_002121287.2| PREDICTED: origin recognition complex subunit 4 [Ciona intestinalis]
Length=426

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 117/376 (31%), Positives = 204/376 (54%), Gaps = 13/376 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLCSE  186
             +NS+L++G +G GK  +L+  ++ L K+    + +++LNG + +DD  AL EITRQL  E
Sbjct  47    SNSLLVIGSKGSGKTTLLKTTVDLLQKKLSKTLIIVRLNGYMQTDDRIALAEITRQLHLE  106

Query  187   HQLVFSKMASFDDNSQFLIAMLRECGLAHKT--VIFVLDEFDLFTQGK-QRLLYSLLDAM  357
             + L      SF +  QFL+  LR  G +H +  ++F+L+EFDLFTQ K Q LLY+L D  
Sbjct  107   NTLGDKVFGSFSETLQFLLEALR-GGSSHSSQPILFILEEFDLFTQHKNQTLLYNLFDLA  165

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL-IFLPPSKEDLERILKHILLLPKDF  534
              +  +  VV+G++CRLD  +L+EKRV+SRFSHR+L I    + E+  +   ++LLL   F
Sbjct  166   MAGLTPLVVVGLTCRLDVIELMEKRVKSRFSHRQLYICNQWTAENYLQAFSNMLLLDAGF  225

Query  535   GLPTK---YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGF  705
                 K   +++ +N  ++ + ++   +DI++   +       L   L   +C++++   F
Sbjct  226   CKTAKHKSFLERWNANVVELSNNASVQDILKRQFSISKEMPSLQCLLVQPICKLNVNHQF  285

Query  706   LSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KI  879
             ++  +   +  N    PK   L   S+LEL +++ +  L      E+ NF+ +  E+ K 
Sbjct  286   ITAADIADSARNVFSDPKANILHGVSVLELCLIIAMNHLTNIYAGESFNFHMVYNEFLKF  345

Query  880   VHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQS---IEFRPVQLLISLHELQQ  1050
                       + + V L+AFEHL++ ELI   E+     S    E++P  LL+   +L++
Sbjct  346   TQKKLHILQKHNKPVVLKAFEHLMELELIKPKESTLSLASKLLKEYQPTILLLEEQQLKE  405

Query  1051  GLKSWGCCPVILHKLI  1098
              +  +  CP  L + +
Sbjct  406   AVYRYPGCPTELQQWL  421



>ref|XP_009907739.1| PREDICTED: origin recognition complex subunit 4 [Picoides pubescens]
Length=436

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 121/369 (33%), Positives = 199/369 (54%), Gaps = 16/369 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK A+L   L+    +K+  + +  + LNGLL ++D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTALLNHALKDLKEMKQVQENLLEVHLNGLLQTNDKIALKEITRQLQ  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  LR+   A    V+FVLDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLAFLLEALRKGDRASSCPVLFVLDEFDLFVHHKNQTLLYNLFDV  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDF  534
              QS  +   V+G++CR D  +LLEKRV+SRFSHR++  L  +  D ++ LK   +  +  
Sbjct  180   SQSAQTPVTVVGLTCRQDILELLEKRVKSRFSHRQIYLL--NSFDFKQYLK---IFKEQL  234

Query  535   GLPTKYVD-----AFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKS  699
              LP  + D      +N  + S+  D   +D++++L  +      L   L  AVC++ +  
Sbjct  235   SLPAPFPDDSFAHKWNNHIQSLAEDKIVQDVLQNLFHHTKDLRSLHLLLMLAVCKVTVHH  294

Query  700   GFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-  873
               ++  + + A  + +   K   +   S+LE+ +++ ++ L E  E E  NF  +  E+ 
Sbjct  295   PLVTPADLQEASKHYRADSKANIVHGLSVLEICLIIAMKHLNEVYEGEPFNFQMVYNEFQ  354

Query  874   KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQG  1053
             K +       + + + V ++AFEHLLQ EL+  +E        E+  ++LL+  +++   
Sbjct  355   KFIQRKAHCMNNFEKPVVMKAFEHLLQLELVKPIERPTLRAQKEYLLMRLLLDNNQIMDA  414

Query  1054  LKSWGCCPV  1080
             L+ +  CP 
Sbjct  415   LQLYPNCPT  423



>gb|EPZ36810.1| Origin recognition complex, subunit 4 domain-containing protein 
[Rozella allomycis CSF55]
Length=401

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/372 (33%), Positives = 198/372 (53%), Gaps = 25/372 (7%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISV-IKLNGLLHSDDNCALKEITRQLCS  183
             NNSVLLLG R CGK+  L   + ++ +EF D   + I LNG+  +D+  A+K I +QL  
Sbjct  42    NNSVLLLGQRACGKSVTLAKCMNSIREEFGDDCFIHIHLNGIFLTDEKMAIKYILKQL-K  100

Query  184   EHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGKQRLLYSLLDAMQS  363
                L   K+++ + N+ F + MLR+   +   ++FVL+EFD FT GKQ LLY+L D++QS
Sbjct  101   IADLDSVKLSANEANALF-VQMLRQGSKSSTPLVFVLEEFDKFTGGKQNLLYNLFDSVQS  159

Query  364   VTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLP-PSKEDLERILKHILLLPKDFGL  540
             V +  +VIG SCR+D   LLEKRV+SRFSHR + F P     D   + K IL + +D   
Sbjct  160   VETPMLVIGSSCRIDVLDLLEKRVKSRFSHRIIHFYPIKESADFYYLCKSILQVEED---  216

Query  541   PTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDN  720
                  + +N  +  + +D  F  ++ S+           +    A+  ++ +   L+   
Sbjct  217   ---GCEEYNKSVEMVFNDPLFLKVIRSVFDLTKNIRLFYKIAIIAITSLNEQQPTLTSVP  273

Query  721   FRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFKT  900
             F  A ++  +  K   L+  S+LE+ +++ +++LE  E E  NF S   EYK    S K+
Sbjct  274   FFQAYTDQFKDTKSGLLESLSVLEIGLVIAIKKLEELECEHLNFESAYDEYK--RFSIKS  331

Query  901   S-DYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQ---------  1050
               D Y + V  +AFE+L+Q ELI + +N    +  E++ ++L +   +LQQ         
Sbjct  332   MIDCYNKAVSFKAFENLIQTELIEYTDNSKCPK--EYKQIKLNLDSTQLQQVLFKLTTLP  389

Query  1051  -GLKSWGCCPVI  1083
               LK WG    +
Sbjct  390   TALKRWGLSKAV  401



>ref|XP_004577234.1| PREDICTED: origin recognition complex subunit 4 [Ochotona princeps]
Length=436

 Score =   168 bits (426),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 120/366 (33%), Positives = 189/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIFVLDEFDLF   K Q LLY+L D 
Sbjct  120   LENAVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFVLDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              Q+  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQTAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPTE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K +V+ +N  + S+  D   +++++           L   L  A+ ++     FL
Sbjct  240   F--PDKPFVEKWNENVQSLSEDKSVREVLQKHFNVSKNLRSLHMLLMLALNRLTASHPFL  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEATLLFSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPIERTSVNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_005168754.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Danio 
rerio]
Length=432

 Score =   167 bits (424),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 197/365 (54%), Gaps = 8/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavl--elvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  +L   L     LKE    + +++LNGLL +DD  ALKEITRQL 
Sbjct  58    SNSVLIVGPRGSGKTMLLGCVLRELMSLKEVQKNVLLVELNGLLQTDDKIALKEITRQLH  117

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAH-KTVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +  + V+F+LDEFDLF   K Q LLY+LLD 
Sbjct  118   LENVVGDKVFGSFAENLAFLLEALKKGDKSSSRPVLFLLDEFDLFAHHKNQTLLYNLLDV  177

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL-IFLPPSKEDLERILKHILLLPKD  531
              QS  +   V+G++CRLD  +LLEKRV+SRFSHR++ +F   S      +++  L LP+D
Sbjct  178   SQSAQTPVAVVGLTCRLDVLELLEKRVKSRFSHRQIHLFSSLSFSQYVDVVRLQLSLPQD  237

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
             F    ++   +N  +  +  D    ++++        F  L   LF AV ++ +    L 
Sbjct  238   FP-DHRFSSQWNQSVTKLCEDKSVLEVLKRSFNSSKDFRSLYSLLFMAVSRVSVSHSTLC  296

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +F  +        K   L   SILEL +++ ++ L +  + E  NF  +  E+ K + 
Sbjct  297   EADFLESGRLISADSKANVLHGLSILELCLIIAMKHLNDTYDGEPFNFQMVHNEFKKFIQ  356

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHLLQ EL+  V++       E++ ++L++   ++ + L+ +
Sbjct  357   RKSHSIHKFEKPVVMKAFEHLLQLELVRPVDSGVCKVQREYQLMRLMLEHGQVMEALQRY  416

Query  1066  GCCPV  1080
               CP 
Sbjct  417   PQCPT  421



>ref|NP_998348.1| origin recognition complex subunit 4 [Danio rerio]
 gb|AAH67614.1| Zgc:85772 [Danio rerio]
Length=432

 Score =   167 bits (423),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 196/365 (54%), Gaps = 8/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavl--elvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  +L   L     LKE    + +++LNGLL +DD  ALKEITRQL 
Sbjct  58    SNSVLIVGPRGSGKTMLLGCVLRELMSLKEVQKNVLLVELNGLLQTDDKIALKEITRQLH  117

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAH-KTVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +  + V+F+LDEFDLF   K Q LLY+LLD 
Sbjct  118   LENVVGDKVFGSFAENLAFLLEALKKGDKSSSRPVLFLLDEFDLFAHHKNQTLLYNLLDV  177

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL-IFLPPSKEDLERILKHILLLPKD  531
              QS  +   V+G +CRLD  +LLEKRV+SRFSHR++ +F   S      +++  L LP+D
Sbjct  178   SQSAQTPVAVVGFTCRLDVLELLEKRVKSRFSHRQIHLFSSLSFSQYVDVVRLQLSLPQD  237

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
             F    ++   +N  +  +  D    ++++        F  L   LF AV ++ +    L 
Sbjct  238   FP-DHRFSSQWNQSVTKLCEDKSVLEVLKRSFNSSKDFRSLFSLLFMAVSRVSVSHSTLC  296

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +F  +        K   L   SILEL +++ ++ L +  + E  NF  +  E+ K + 
Sbjct  297   EADFLESGRLISADSKANVLHGLSILELCLIIAMKHLNDTYDGEPFNFQMVHNEFKKFIQ  356

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHLLQ EL+  V++       E++ ++L++   ++ + L+ +
Sbjct  357   RKSHSIHKFEKPVVMKAFEHLLQLELVRPVDSGVCKVQREYQLMRLMLEHGQVMEALQRY  416

Query  1066  GCCPV  1080
               CP 
Sbjct  417   PQCPT  421



>ref|XP_006636292.1| PREDICTED: origin recognition complex subunit 4-like [Lepisosteus 
oculatus]
Length=434

 Score =   167 bits (423),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 195/367 (53%), Gaps = 12/367 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavle--lvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK+ +L   L      KE  + I ++ LNGLL +DD  ALKEITRQL 
Sbjct  60    SNSVLIVGPRGAGKSMLLSCVLNELQKEKEVMENILLVHLNGLLQTDDRIALKEITRQLH  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAH-KTVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +  + V+F LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLAFLLEALKKGDRSSSRPVLFTLDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLER---ILKHILLLP  525
              QS  +   V+G++CRLD  +LLEKRV+SRFSHR++  L  S  D ++   I +  L LP
Sbjct  180   SQSAQAPVAVVGLTCRLDVLELLEKRVKSRFSHRQIHLL--SAFDFQKYLEIFQQQLSLP  237

Query  526   KDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGF  705
             +DF     + + +N  + S+  D   +DI++        F  L R L   + ++ + +  
Sbjct  238   EDFP-DGGFAEQWNESIKSLCDDRSVEDILQKHFHSSKDFRSLQRLLVLTLSRVTVSNPA  296

Query  706   LSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KI  879
             +   +   A        K   L   S+LEL +++ ++ L +  + E  NF  +  E+ K 
Sbjct  297   VKPADLLEASRLCTMDSKANILHGLSVLELCLIIAMKHLSDIYDGEPYNFQMVHNEFKKF  356

Query  880   VHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLK  1059
             +     +   + + V ++AFEHL Q ELI  V+        E++ V+L++   ++ + L+
Sbjct  357   LQRKSHSIHNFEKPVVMKAFEHLHQLELIKAVDGPSVKTQKEYQLVRLMLDNGQIMEALQ  416

Query  1060  SWGCCPV  1080
              +  CP 
Sbjct  417   KYPQCPT  423



>ref|NP_001081561.1| origin recognition complex subunit 4 [Xenopus laevis]
 gb|AAI06364.1| Orc4 protein [Xenopus laevis]
Length=432

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 194/365 (53%), Gaps = 8/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleal--lKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK+ +L+  LE +  +K+  +    + LNGLL + D  ALKEITRQL 
Sbjct  58    SNSALIIGPRGSGKSMLLKGALEDIFGMKQMKETALQVNLNGLLQTTDKIALKEITRQLH  117

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L+         V+FVLDEFDLF   K Q LLY+L D 
Sbjct  118   LENVVGDRVFGSFAENLSFLLEALKTGDRKSSCPVLFVLDEFDLFAHHKNQTLLYNLFDI  177

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  L   S    ++I +  L LP  
Sbjct  178   AQSAQTPVAVIGLTCRLDVMELLEKRVKSRFSHRQIHLLNSFSFSQYQQIFQEKLSLPAS  237

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
             F   +++ + +N  + S++     +D+++           L   +  AVC++++    ++
Sbjct  238   FP-DSQFAEKWNESIKSLVESKLVEDVLQKQYNASKDVRSLHMLMLLAVCRVNVSHPHIT  296

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLE-ANEQETCNFNSIMKEY-KIVH  885
               +F        +  K   L   S+LEL +++ ++ L+   + E  NF  +  E+ K + 
Sbjct  297   AADFLEVFRLRNQDSKANILHGVSVLELCLIIAMKHLQDIYDGEPFNFQMVHNEFQKFIQ  356

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q ELI  +E        E+R ++LL+   ++ + L+ +
Sbjct  357   RKAHSVYNFEKAVVIKAFEHLHQLELIKPMEGLSVRTQKEYRLMKLLLDNTQIVEALQKY  416

Query  1066  GCCPV  1080
               CP 
Sbjct  417   PNCPT  421



>ref|XP_005956059.1| PREDICTED: origin recognition complex subunit 4 [Pantholops hodgsonii]
Length=436

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 193/366 (53%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavl--elvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L     ++   + I  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEGVSENILQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   A+   VIF+LDEFDLF   K Q LLY+LLD 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRANSCPVIFILDEFDLFAHHKNQTLLYNLLDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +  V+IG++CRLD  +LLEKRV+SRFSHR++  +   S     +I K  L LP  
Sbjct  180   SQSAQTPVVIIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFSFPQYLKIFKEQLSLPSI  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   K++++           L   L  A+ ++     F+
Sbjct  240   F--PEKIFAEKWNENVQSLSEDRSVKEVLQKHFNVSKNLRSLHMLLMLALNRVTPSHPFI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKGNIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_005315878.1| PREDICTED: origin recognition complex subunit 4 [Ictidomys tridecemlineatus]
Length=436

 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 120/369 (33%), Positives = 190/369 (51%), Gaps = 16/369 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISV------IKLNGLLHSDDNCALKEIT  168
             +NSVL++GPRG GK  ++   L    KE  D+  V      + LNGLL  +D  ALKEIT
Sbjct  60    SNSVLIIGPRGSGKTTLINHAL----KELMDIEEVNENVLQVHLNGLLQINDKIALKEIT  115

Query  169   RQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYS  342
             RQL  E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+
Sbjct  116   RQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYN  175

Query  343   LLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILL  519
             L D  QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  LL
Sbjct  176   LFDISQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEELL  235

Query  520   LPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKS  699
             LP++      + + +N  +  +  D   +++++           L   L  A+ ++ +  
Sbjct  236   LPEEIS-DKHFAEKWNENVQCLSEDTSVREVLQKHFNISKNLRSLHTLLMLALSRVTVSH  294

Query  700   GFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-  873
              FL+  +F  A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ 
Sbjct  295   PFLTAADFMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQ  354

Query  874   KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQG  1053
             K V     +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   
Sbjct  355   KFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLMKLLLDNTQIMNA  414

Query  1054  LKSWGCCPV  1080
             L+ +  CP 
Sbjct  415   LQKYPNCPT  423



>ref|XP_004375422.1| PREDICTED: origin recognition complex subunit 4 [Trichechus manatus 
latirostris]
Length=436

 Score =   166 bits (419),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 192/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK--EFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L+ L++  E  + I  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMQIEEVNENILQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGNRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +DI++           L   L  A+ ++     F+
Sbjct  240   F--PDKLFAEKWNENIQCLSEDRSIRDILQKHFNVSKNLRSLHMLLMLALNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L + +E+E  NF  +  E+ K V
Sbjct  298   TTADLMEASQLCSMDSKANVVHGLSVLEICLIIAMKHLNDIHEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSIYNFEKPVVMKAFEHLQQLELIKPMERTPINAQKEYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_008115329.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Anolis 
carolinensis]
Length=434

 Score =   165 bits (418),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 121/368 (33%), Positives = 192/368 (52%), Gaps = 14/368 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavl--elvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  +    L     +K+  D    + LNGLL ++D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTLLTCHVLNKLMEIKQVKDNTLYVHLNGLLQTNDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L+    AH   V+FVLDEFDLF   + Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLTFLLEALKRGDRAHSCPVLFVLDEFDLFVHHRNQTLLYNLFDV  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERIL---KHILLLP  525
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +  +  D ++ L   K  L LP
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLV--NSFDFKKYLNICKEQLSLP  237

Query  526   KDFGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSG  702
              +F  P K +   +N  + S L D   ++++++   Y      L   L   +  + +   
Sbjct  238   SEF--PEKQFYQKWNKNIESALEDPTVQNVLQNQFHYSKDLRSLSILLMLTLNNITVSHP  295

Query  703   FLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEYKI  879
             +++  +F  A    +   K   +   S+LE  +++ ++ L +  + E  NF  +  EY++
Sbjct  296   YMNASDFLEASRLCRMNSKANIVHGLSVLEFCLIIAMKHLNDTYDGEPFNFQMVYNEYQM  355

Query  880   -VHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGL  1056
              V     T   + + V ++AFEHL   ELI  VE   +    E+  ++LL+   ++   L
Sbjct  356   FVQRKAHTVYSFEKPVVMKAFEHLQHLELIKPVEGTSNCAQREYLLMKLLLDNSQIMDAL  415

Query  1057  KSWGCCPV  1080
             + +  CP 
Sbjct  416   QFYPNCPT  423



>ref|XP_005025038.1| PREDICTED: origin recognition complex subunit 4 [Anas platyrhynchos]
Length=436

 Score =   165 bits (418),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 119/365 (33%), Positives = 190/365 (52%), Gaps = 8/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK A+L  VL+    +K+  + +  ++LNGLL ++D  ALKEITRQL 
Sbjct  60    SNSALIIGPRGSGKTALLNRVLKDLMEIKQVKENLLEVRLNGLLQTNDKVALKEITRQLR  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  LR+        V+F+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLAFLLEALRKGNRTSSCPVLFILDEFDLFVHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CR D  +L EKRV+SRFSHR++  L     +   +I K  L LP D
Sbjct  180   SQSAQTPVTVIGLTCRRDILELFEKRVKSRFSHRQIYVLNSFDFKQYIKIFKEQLSLPAD  239

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
             F   T +   +N  +  +  D    D+++ L  Y      L   L  AV  + +    ++
Sbjct  240   FPDET-FAQKWNNNVQHLSVDKTVNDVLQDLFHYTKDLRSLHFLLMLAVSNVTVHHPLIT  298

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               + + A    +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+ K + 
Sbjct  299   ASDLQEASKQYRMDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEFQKFIQ  358

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                     + + V ++AFEHLLQ EL+  +E        E+  ++LL+   ++   L+++
Sbjct  359   RKAHCMYNFEKPVVMKAFEHLLQLELVKPIEKPSVRTQREYLLMKLLLDNTQIMDALQAY  418

Query  1066  GCCPV  1080
               CP 
Sbjct  419   PNCPT  423



>ref|XP_003225025.2| PREDICTED: origin recognition complex subunit 4 isoform X1 [Anolis 
carolinensis]
Length=471

 Score =   165 bits (418),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 121/368 (33%), Positives = 192/368 (52%), Gaps = 14/368 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavl--elvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  +    L     +K+  D    + LNGLL ++D  ALKEITRQL 
Sbjct  97    SNSVLIIGPRGSGKTLLTCHVLNKLMEIKQVKDNTLYVHLNGLLQTNDKIALKEITRQLN  156

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L+    AH   V+FVLDEFDLF   + Q LLY+L D 
Sbjct  157   LENVVGDKVFGSFAENLTFLLEALKRGDRAHSCPVLFVLDEFDLFVHHRNQTLLYNLFDV  216

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERIL---KHILLLP  525
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +  +  D ++ L   K  L LP
Sbjct  217   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLV--NSFDFKKYLNICKEQLSLP  274

Query  526   KDFGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSG  702
              +F  P K +   +N  + S L D   ++++++   Y      L   L   +  + +   
Sbjct  275   SEF--PEKQFYQKWNKNIESALEDPTVQNVLQNQFHYSKDLRSLSILLMLTLNNITVSHP  332

Query  703   FLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEYKI  879
             +++  +F  A    +   K   +   S+LE  +++ ++ L +  + E  NF  +  EY++
Sbjct  333   YMNASDFLEASRLCRMNSKANIVHGLSVLEFCLIIAMKHLNDTYDGEPFNFQMVYNEYQM  392

Query  880   -VHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGL  1056
              V     T   + + V ++AFEHL   ELI  VE   +    E+  ++LL+   ++   L
Sbjct  393   FVQRKAHTVYSFEKPVVMKAFEHLQHLELIKPVEGTSNCAQREYLLMKLLLDNSQIMDAL  452

Query  1057  KSWGCCPV  1080
             + +  CP 
Sbjct  453   QFYPNCPT  460



>sp|O93479.1|ORC4_XENLA RecName: Full=Origin recognition complex subunit 4 [Xenopus laevis]
 emb|CAA76187.1| origin recognition complex subunit 4 [Xenopus laevis]
Length=432

 Score =   164 bits (416),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 193/365 (53%), Gaps = 8/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleal--lKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK+ +L+  LE +  +K+  +    + LNGLL + D  ALKEITRQL 
Sbjct  58    SNSALIIGPRGSGKSMLLKGALEDIFGMKQMKETALQVNLNGLLQTTDKIALKEITRQLH  117

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L+         V+FVLDEFDLF   K Q LLY+L D 
Sbjct  118   LENVVGDRVFGSFAENLSFLLEALKTGDRKSSCPVLFVLDEFDLFAHHKNQTLLYNLFDI  177

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  L   S     +I +  L LP  
Sbjct  178   AQSAQTPVAVIGLTCRLDVMELLEKRVKSRFSHRQIHLLNSFSFSQYLQIFQEKLSLPAS  237

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
             F   +++ + +N  + S++     +D+++           L   +  AVC++++    ++
Sbjct  238   FP-DSQFAEKWNESIKSLVESKLVEDVLQKQYNASKDVRSLHMLMLLAVCRVNVSHPHIT  296

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLE-ANEQETCNFNSIMKEY-KIVH  885
               +F        +  K   L   S+LEL +++ ++ L+   + E  NF  +  E+ K + 
Sbjct  297   AADFLEVFRLRNQDSKANILHGVSVLELCLIIAMKHLQDIYDGEPFNFQMVHNEFQKFIQ  356

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q ELI  +E        E+R ++LL+   ++ + L+ +
Sbjct  357   RKAHSVYNFEKAVVIKAFEHLHQLELIKPMEGLSVRTQKEYRLMKLLLDNTQIVEALQKY  416

Query  1066  GCCPV  1080
               CP 
Sbjct  417   PNCPT  421



>ref|XP_004757924.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Mustela 
putorius furo]
 ref|XP_004757925.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Mustela 
putorius furo]
 ref|XP_004757926.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Mustela 
putorius furo]
 ref|XP_004757927.1| PREDICTED: origin recognition complex subunit 4 isoform X4 [Mustela 
putorius furo]
 ref|XP_004757928.1| PREDICTED: origin recognition complex subunit 4 isoform X5 [Mustela 
putorius furo]
 ref|XP_004757929.1| PREDICTED: origin recognition complex subunit 4 isoform X6 [Mustela 
putorius furo]
 ref|XP_004795270.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Mustela 
putorius furo]
 ref|XP_004795271.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Mustela 
putorius furo]
 ref|XP_004795272.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Mustela 
putorius furo]
 ref|XP_004795273.1| PREDICTED: origin recognition complex subunit 4 isoform X4 [Mustela 
putorius furo]
 ref|XP_004795274.1| PREDICTED: origin recognition complex subunit 4 isoform X5 [Mustela 
putorius furo]
 ref|XP_004795275.1| PREDICTED: origin recognition complex subunit 4 isoform X6 [Mustela 
putorius furo]
Length=436

 Score =   164 bits (415),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 189/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTTLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRSSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++     +     L   L  A+ ++     F+
Sbjct  240   F--PDKIFTERWNENVQGLTEDRSVREVLQKHFNLNKNLRSLHMLLMLALNRVTTSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPVERTSVNTQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_007183093.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007183094.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=436

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEMSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP  
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAV  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   +D+++       +   L   L  A+ ++     F+
Sbjct  240   F--PGKIFAEKWNENVQSLSEDRSVRDVLQKHFNVSKSLRSLHTLLMLALNRVTPSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_533348.2| PREDICTED: origin recognition complex subunit 4 isoform X3 [Canis 
lupus familiaris]
 ref|XP_005632024.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Canis 
lupus familiaris]
 ref|XP_005632025.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Canis 
lupus familiaris]
Length=436

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 190/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +    VIF+LDEFDLFT  K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRSSSCPVIFILDEFDLFTHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  ++ D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKLFSEKWNENVQCLMEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTTSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNTQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_004674728.1| PREDICTED: origin recognition complex subunit 4 [Condylura cristata]
Length=436

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 120/366 (33%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINRALKELMEVEEISENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        V+F+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVEDKVFGSFAENLSFLLEALKKGDRTSSCPVLFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL-IFLPPSKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++ I    S     +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHIMNSFSFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K Y + +N  +  +  D   ++I+E           L   L   + ++     F+
Sbjct  240   F--PDKLYAEKWNEHIQCLSEDKSVQEILEKHFNVSKNLRSLHMLLMLTLNRVTSSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             ++ +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TVADLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_004268286.1| PREDICTED: origin recognition complex subunit 4 [Orcinus orca]
Length=436

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP  
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAV  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   +D+++       +   L   L  A+ ++     F+
Sbjct  240   F--PGKIFAEKWNENVQSLSEDRNVRDVLQKHFNVSKSLRSLHTLLMLALNRVTPSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|NP_001005654.1| origin recognition complex, subunit 4 [Xenopus (Silurana) tropicalis]
 gb|AAH74668.1| origin recognition complex, subunit 4-like (yeast) [Xenopus (Silurana) 
tropicalis]
 emb|CAJ83538.1| origin recognition complex, subunit 4-like (yeast) [Xenopus (Silurana) 
tropicalis]
Length=432

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/365 (32%), Positives = 188/365 (52%), Gaps = 8/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK+      L     +K+  +    ++LNGLL + D  ALKEITRQL 
Sbjct  58    SNSALIIGPRGSGKSMLLKGALEEILAMKQVKENALQVRLNGLLQTTDKIALKEITRQLH  117

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L+         V+F+LDEFDLF   K Q LLY+L D 
Sbjct  118   LENVVGDRVFGSFAENLAFLLEALKTGDRKSSCPVLFLLDEFDLFAHHKNQTLLYNLFDI  177

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  L   S      I +  L LP  
Sbjct  178   AQSAQTPVAVIGLTCRLDVMELLEKRVKSRFSHRQIHLLNSFSFIQYLEIFQEKLFLPAS  237

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
             F   +++ + +N  + S++     +DI++   +       L   L  AVC++ +    ++
Sbjct  238   FP-DSQFAEKWNESIKSLVESKMVEDILQKQYSASKDVRSLHMLLLLAVCRVSVSHPHIT  296

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLE-ANEQETCNFNSIMKEY-KIVH  885
               +F        +  K   +   S+LEL +++ ++ L+   + E  NF  +  E+ K + 
Sbjct  297   AADFLEVFRLRNQDSKANIMHGLSVLELCLIIAMKHLQDIYDGEPFNFQMVHNEFQKFIQ  356

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q ELI  +E        E+R ++LL+   ++ + L+ +
Sbjct  357   RKAHSVYNFEKPVVMKAFEHLHQLELIKPMEGLSMRTQKEYRLMKLLLDNTQVIEALQKY  416

Query  1066  GCCPV  1080
               CP 
Sbjct  417   PNCPT  421



>ref|XP_006974352.1| PREDICTED: origin recognition complex subunit 4 [Peromyscus maniculatus 
bairdii]
Length=436

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 120/366 (33%), Positives = 193/366 (53%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK--EFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L+ L+K  E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIVGPRGSGKTMLINHALKELMKIREVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   A    VIF+LDEFDLF  Q  Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRASSCPVIFILDEFDLFAHQKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP++
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYMKIFKEQLSLPEE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N     +  D    ++++     +     L   L  A+ ++ +   F+
Sbjct  240   F--PDKAFAERWNENTQCLSEDSTVCEVLQKHFNVNKNLRSLHMLLMLALNRVTVSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K +
Sbjct  298   TSADLMEAQHLCSLDSKASIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFI  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ V+LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YSNCPT  423



>ref|XP_007108106.1| PREDICTED: origin recognition complex subunit 4-like isoform 
X1 [Physeter catodon]
Length=436

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP  
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAV  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   +D+++       +   L   L  A+ ++     F+
Sbjct  240   F--PGKIFAEKWNENVQSLSEDRSVRDVLQKHFNVSKSLRSLHTLLMLALNRVTPSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>dbj|BAC36300.1| unnamed protein product [Mus musculus]
Length=433

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 195/365 (53%), Gaps = 9/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK-EFPDMISVIKLNGLLHSDDNCALKEITRQLCS  183
             +NSVL++GPRG GK  +L   L+ L++ E  + +  + LNGLL +++  ALKEITRQL  
Sbjct  58    SNSVLIVGPRGSGKTTLLNHALKELMEIEVSENVIQVHLNGLLQTNEKIALKEITRQLNL  117

Query  184   EHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDAM  357
             ++ +      SF +N  FL+  L++        VIF+LDEFD+F  Q  Q LLY+L D  
Sbjct  118   DNVVEDKVFGSFAENLSFLLEALQKGDRTSSCPVIFILDEFDIFAHQKNQTLLYNLFDIS  177

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKDF  534
             QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +F
Sbjct  178   QSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAEF  237

Query  535   GLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
               P K + + +N  +  +  D    ++++   + +  F  L   L  A+ ++ +   F++
Sbjct  238   --PDKAFAERWNENVHCLSEDSTVLEVLQKHFSVNKNFQSLHMLLMLALNRVTVSHPFMT  295

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K + 
Sbjct  296   SADLMEAQHMCSLDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFIQ  355

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q ELI  VE    N   E++ V+LL+   ++   L+ +
Sbjct  356   RKAHSVYNFEKPVVMKAFEHLQQLELIKPVERTSVNSQREYQLVKLLLDNTQIMNALQKY  415

Query  1066  GCCPV  1080
               CP 
Sbjct  416   SNCPT  420



>ref|XP_007454613.1| PREDICTED: origin recognition complex subunit 4 [Lipotes vexillifer]
Length=436

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP  
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAV  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   +D+++       +   L   L  A+ ++     F+
Sbjct  240   F--PGKIFAEKWNENVQSLSEDRNVRDVLQRHFNVSKSLRSLHTLLMLALNRVTPSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_005676229.1| PREDICTED: origin recognition complex subunit 4 [Capra hircus]
Length=436

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 189/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++   + I  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEGVSENILQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+LLD 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLLDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +  V+IG++CRLD  +LLEKRV+SRFSHR++  +   S     +I K  L LP  
Sbjct  180   SQSAQTPVVIIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFSFPQYLKIFKEQLSLPSI  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   K++++           L   L  A+ ++     F+
Sbjct  240   F--PEKIFAEKWNENVQSLSEDRSVKEVLQKHFNVSKNLRSLHMLLMLALNRVTPSHPFI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKGNIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_009884654.1| PREDICTED: origin recognition complex subunit 4 [Charadrius vociferus]
Length=436

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 191/369 (52%), Gaps = 16/369 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISV------IKLNGLLHSDDNCALKEIT  168
             +NS L++GPRG GK A+L  VL    KE  +M  V      + LNGLL ++D  ALKEIT
Sbjct  60    SNSALIIGPRGSGKTALLNHVL----KELTEMKQVRENLLEVHLNGLLQTNDKVALKEIT  115

Query  169   RQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYS  342
             RQL  E+ +      SF +N  FL+  LR+        V+F+LDEFDLF   K Q LLY+
Sbjct  116   RQLHLENVVGDKVFGSFAENLVFLLEALRKGDRTSSCPVLFILDEFDLFVHHKNQTLLYN  175

Query  343   LLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILL  519
             L D  QS  +   VIG++CR D  +LLEKRV+SRFSHR++  +     +   RI K  L 
Sbjct  176   LFDISQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRQIYLMNSFDFKQYIRIFKEQLS  235

Query  520   LPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKS  699
             LP +F     +   +N+ +  +  D   KD +++L  Y      L   L  AV  + ++ 
Sbjct  236   LPSEFP-DESFAQKWNSNVQHLSEDKTVKDTLQNLFHYTKDLRSLHLLLMLAVSNVTVRH  294

Query  700   GFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-  873
               ++  +   A    +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+ 
Sbjct  295   PLITASDLHEASKQIRMDSKANIVHGLSVLEICLVIAMKHLNDVYEGEPFNFQMVYNEFQ  354

Query  874   KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQG  1053
             K +         + + V ++AFEHLLQ EL+  +E        E+  ++LL+  +++   
Sbjct  355   KFIQRKAHCMYNFEKPVVMKAFEHLLQLELVKPIERPSVRVQREYLLMRLLLDNNQIMDA  414

Query  1054  LKSWGCCPV  1080
             L+++  CP 
Sbjct  415   LQAYPNCPT  423



>ref|XP_004004765.1| PREDICTED: origin recognition complex subunit 4 [Ovis aries]
Length=436

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 189/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++   + I  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEGVSENILQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+LLD 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLLDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +  V+IG++CRLD  +LLEKRV+SRFSHR++  +   S     +I K  L LP  
Sbjct  180   SQSAQTPVVIIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFSFPQYLKIFKEQLSLPSI  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   K++++           L   L  A+ ++     F+
Sbjct  240   F--PEKIFAEKWNENVQSLSEDRSVKEVLQKHFNVSKNLRSLHMLLMLALNRVTPSHPFI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKGNIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_006078706.1| PREDICTED: origin recognition complex subunit 4 [Bubalus bubalis]
Length=436

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 123/370 (33%), Positives = 192/370 (52%), Gaps = 18/370 (5%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISV------IKLNGLLHSDDNCALKEIT  168
             +NSVL++GPRG GK  ++   L    KE  ++  V      + LNGLL  +D  ALKEIT
Sbjct  60    SNSVLIIGPRGSGKTMLINHAL----KELMEIEGVNENILQVHLNGLLQINDKIALKEIT  115

Query  169   RQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYS  342
             RQL  E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+
Sbjct  116   RQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYN  175

Query  343   LLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILL  519
             LLD  QS  +  V+IG++CRLD  +LLEKRV+SRFSHR++  +   S     +I K  L 
Sbjct  176   LLDISQSAQTPVVIIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFSFPQYLKIFKEQLS  235

Query  520   LPKDFGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMK  696
             LP  F  P + + + +N  + S+  D   K++++           L   L  A+ ++   
Sbjct  236   LPSVF--PEEIFAEKWNENVQSLSEDRSVKEVLQKHFNVSKNLRSLHMLLMLALNRVTPS  293

Query  697   SGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY  873
               F++  +   A        K   L   S+LE+ +++ ++ L +  E+E  NF  +  E+
Sbjct  294   HPFITAADLMEANQLCSMDSKGNILHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEF  353

Query  874   -KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQ  1050
              K V     +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++  
Sbjct  354   QKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNAQREYQLMKLLLDNTQIMN  413

Query  1051  GLKSWGCCPV  1080
              L+ +  CP 
Sbjct  414   ALQKYPNCPT  423



>ref|XP_003133297.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Sus 
scrofa]
 ref|XP_005671660.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Sus 
scrofa]
 ref|XP_005671661.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Sus 
scrofa]
 ref|XP_005671662.1| PREDICTED: origin recognition complex subunit 4 isoform X4 [Sus 
scrofa]
Length=436

 Score =   163 bits (412),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIFVLDEFDLFT  K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFVLDEFDLFTHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP  
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAV  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + ++  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKIFAEKWNENVQTLSEDRSVREVLQKHFNVTKNLRSLHMLLMLALNRVTPSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TATDLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPIERTTVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_004032673.1| PREDICTED: origin recognition complex subunit 4 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004032674.1| PREDICTED: origin recognition complex subunit 4 isoform 2 [Gorilla 
gorilla gorilla]
Length=436

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPVERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_010889373.1| PREDICTED: origin recognition complex subunit 4 [Esox lucius]
 ref|XP_010889374.1| PREDICTED: origin recognition complex subunit 4 [Esox lucius]
 ref|XP_010889375.1| PREDICTED: origin recognition complex subunit 4 [Esox lucius]
 ref|XP_010889376.1| PREDICTED: origin recognition complex subunit 4 [Esox lucius]
Length=434

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 127/372 (34%), Positives = 200/372 (54%), Gaps = 22/372 (6%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavle--lvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  +L+  L     +K+    +  + LNGLL +DD  ALKEITRQL 
Sbjct  60    SNSVLIVGPRGSGKTMLLKCVLRDLLEVKDVNKNVLQVHLNGLLQTDDRIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAH-KTVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +  + V+F+LDEFDLF   K Q LLY+LLD 
Sbjct  120   LENVVGDKVFGSFAENLAFLLEALKKGDRSSSRPVLFILDEFDLFAHHKNQTLLYNLLDV  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILL---LP  525
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  L  S     + L +++L   LP
Sbjct  180   SQSAQAPVAVIGLTCRLDVLELLEKRVKSRFSHRQIHLL--SSLSFRQYLDNVILQLSLP  237

Query  526   KDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFS-----AVCQMD  690
              DF    K+ + +N  +  +  D    D++E        F  L   L       +VC+  
Sbjct  238   PDFA-DAKFFEEWNDSIKRLCKDKSVVDVLEKHYNSSKDFRSLHLLLMLVLSQVSVCKPS  296

Query  691   MKSGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMK  867
             +K   L L+  R  ++++    K   L   S+LEL +++ ++ L +  E E  NF  +  
Sbjct  297   IKPTDL-LEASRVCVADS----KANILHGLSVLELCLIIAMKHLSDIYEGEPFNFQMVHN  351

Query  868   EYKIVHDSFKTSDY-YARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHEL  1044
             E+K        S Y + + V ++AFEHL Q ELI  V+        E++ ++L++  +++
Sbjct  352   EFKKFLQRKSQSIYNFDKPVVMKAFEHLQQLELIKSVDGSTGKIHKEYQLMKLMLDHNQI  411

Query  1045  QQGLKSWGCCPV  1080
              + L+ +  CP 
Sbjct  412   MEALQKYPQCPT  423



>ref|XP_006935334.1| PREDICTED: origin recognition complex subunit 4 isoform X4 [Felis 
catus]
Length=398

 Score =   162 bits (409),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  22    SNSVLIIGPRGSGKTTLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  81

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  82    LENVVGDKVFGSFAENLSFLLEALKKGDRSSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  141

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  142   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  201

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  202   F--PDKLFTEKWNESIQCLTEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTTSHPFM  259

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  260   TAADMMEAHQFCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  319

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  320   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNTQREYQLMKLLLDNTQIMNALQK  379

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  380   YPNCPT  385



>ref|XP_007078613.1| PREDICTED: origin recognition complex subunit 4 isoform X4 [Panthera 
tigris altaica]
Length=398

 Score =   162 bits (409),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  22    SNSVLIIGPRGSGKTTLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  81

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  82    LENVVGDKVFGSFAENLSFLLEALKKGDRSSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  141

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  142   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  201

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  202   F--PDKLFTEKWNESIQCLTEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTTSHPFM  259

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  260   TAADMMEAHQFCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  319

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  320   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNTQREYQLMKLLLDNTQIMNALQK  379

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  380   YPNCPT  385



>ref|XP_010073343.1| PREDICTED: origin recognition complex subunit 4 [Pterocles gutturalis]
Length=438

 Score =   162 bits (411),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 125/370 (34%), Positives = 193/370 (52%), Gaps = 21/370 (6%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISV------IKLNGLLHSDDNCALKEIT  168
             +NS L++GPRG GK A+L  VL    KE  +M  V      + LNGLL ++D  ALKEIT
Sbjct  65    SNSALIIGPRGSGKTALLNCVL----KELREMKQVRENLLEVHLNGLLQTNDKVALKEIT  120

Query  169   RQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYS  342
             RQL  E+ +      SF +N  FL+  LR+        V+F+LDEFDLF   K Q LLY+
Sbjct  121   RQLQLENVVGDKVFGSFAENLAFLLEALRKGDRTSSCPVLFILDEFDLFVHHKNQTLLYN  180

Query  343   LLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKE--DLERILKHIL  516
             L D  QS  +   VIG++CR D  +LLEKRV+SRFSHR+ I+L  S +     RI K  L
Sbjct  181   LFDISQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRQ-IYLKNSFDFKQYIRIFKEQL  239

Query  517   LLPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMK  696
              LP +     K+    N  +  +  D   KD++++L  Y      L   L  AV  + ++
Sbjct  240   SLPANESFAQKW----NNNVQHLSEDKTVKDMLQNLFHYTKDLRSLHLLLMLAVSNVTVQ  295

Query  697   SGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY  873
                +++ +   A  + +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+
Sbjct  296   HPLITVSDLHEASKHYRMDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEF  355

Query  874   -KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQ  1050
              K +         + + V ++AFEHLLQ EL+  +E        E+  ++LL+  +++  
Sbjct  356   QKFIQRKAHCMHNFEKPVVMKAFEHLLQLELVKPIERPSVRAQREYLLMKLLLDNNQIMD  415

Query  1051  GLKSWGCCPV  1080
              L+ +  CP 
Sbjct  416   ALQVYPNCPT  425



>ref|XP_008395811.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Poecilia 
reticulata]
 ref|XP_008395819.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Poecilia 
reticulata]
Length=434

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 125/371 (34%), Positives = 199/371 (54%), Gaps = 20/371 (5%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISVIK--LNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  +L+ VL  L +E     ++++  LNGLL +DD  ALKEITRQL 
Sbjct  60    SNSVLIVGPRGAGKTMLLKSVLRELSQETEVQKNLLQVHLNGLLQTDDRIALKEITRQLQ  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAH-KTVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +  + V+FVLDEFDLF Q K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLTFLLDALKKGDRSSSRPVLFVLDEFDLFAQHKNQTLLYNLFDV  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHI---LLLP  525
              QS  +   V+G++CRLD  +LLEKRV+SRFSHR++  L  SK    + L+ I   L LP
Sbjct  180   SQSAQAPVAVVGLTCRLDVLELLEKRVKSRFSHRQMHLL--SKLTFPQYLERIRDQLSLP  237

Query  526   KDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGF  705
              DF    K+   +N  + ++  D   +++++      + F  L   L   + ++ +    
Sbjct  238   DDFP-DGKFAQEWNAGVTTLCEDKSAEEVLQRYFNSSTDFRSLHTLLMLCLSRVSVARPS  296

Query  706   LS----LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKE  870
             ++    LD  R  L++         L   SILEL +++ ++ L +  E E  N   +  E
Sbjct  297   ITPADLLDASRFCLADA----NANMLHGLSILELCLIIAMKHLNDVYEGEPFNLQMVHNE  352

Query  871   YKIVHDSFKTSDY-YARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQ  1047
             +K        S Y + + V ++AFEHL Q ELI   +        EF+ ++L++   ++ 
Sbjct  353   FKKFLQRKSNSMYNFEQPVIMKAFEHLQQLELIQPADGASDKTQREFQLMRLMLDHSQIM  412

Query  1048  QGLKSWGCCPV  1080
             + ++ +  CP 
Sbjct  413   EAMQKYPQCPT  423



>ref|XP_004888471.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Heterocephalus 
glaber]
 gb|EHB05350.1| Origin recognition complex subunit 4 [Heterocephalus glaber]
Length=435

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 186/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + I  + LNGLL  +D  ALKEITRQL 
Sbjct  59    SNSVLIVGPRGSGKTMLINHALKELMEIEEVSENILQVYLNGLLQINDKIALKEITRQLH  118

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  119   LENVVGDKVFGSFAENFSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  178

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  179   SQSPQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPVE  238

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   +D++            L      A+ ++     FL
Sbjct  239   F--PDKLFAEKWNENVQSLSEDKSVRDVLLKHFNVSKDLRSLHMLSMVALNRVTASHPFL  296

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  297   TAADLMEAAQLCSMDSKANVVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  356

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ 
Sbjct  357   QRKAHSIYNFEKPVVMKAFEHLQQLELIKPVERTSVNSQREYQLMKLLLDNTQIMNSLQK  416

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  417   YPNCPT  422



>ref|XP_001487939.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Equus 
caballus]
 ref|XP_005601533.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Equus 
caballus]
 ref|XP_008516905.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Equus 
przewalskii]
 ref|XP_008516907.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Equus 
przewalskii]
 ref|XP_008516908.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Equus 
przewalskii]
Length=436

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +DN ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDNIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   V+G++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPVAVVGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKLFAEKWNENVQCLSEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTSSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_002509047.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO70305.1| predicted protein, partial [Micromonas sp. RCC299]
Length=308

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 156/296 (53%), Gaps = 12/296 (4%)
 Frame = +1

Query  7    NNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC--  180
            NNSVLL+G RG GK  VL+  L  L +   D +  ++LNG+LH+D+  A++EI  QLC  
Sbjct  16   NNSVLLVGARGSGKTLVLDSALRQLREAHGDGVLPVRLNGMLHADERVAMREIAEQLCLG  75

Query  181  -SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFT-QGKQRLLYSLLDA  354
                +L FS+ A F +N  F+  +LR      + V+FVL+EFDLF  + KQ LLY+++D 
Sbjct  76   FKAEELEFSRAAGFAENVAFMREVLRVLENGRRGVVFVLEEFDLFAHRPKQTLLYAVMDL  135

Query  355  MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHI---LLLP  525
            +Q    QA V+GV+CR DA +LLEKRV+SRFS R+++  PP  +        I   L+ P
Sbjct  136  LQQTQVQAAVVGVTCRHDAAELLEKRVKSRFSSRRILLAPPRGKGAAASPTGIEPALVYP  195

Query  526  KDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGF  705
             D G   ++ DA +  +  +  D   +      CT  +  +     LF+  C MD   G 
Sbjct  196  PDPGFAARWNDAVDAAVSQVGVDHTLRAYEALECTPRAASDLA---LFALAC-MDRNKGT  251

Query  706  LSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETC-NFNSIMKE  870
            ++  +   A         +  L   S LEL ++V + RL    ++   NFN +  E
Sbjct  252  IAAKDIMVASQRLLGDTYVRALSGVSALELCMVVAMSRLHRFRRKAVFNFNHVEDE  307



>ref|XP_003763894.1| PREDICTED: origin recognition complex subunit 4 [Sarcophilus 
harrisii]
Length=436

 Score =   162 bits (410),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNav--lelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK  +    L     +K+  + +  + LNGLL  +D  ALKEIT+QLC
Sbjct  60    SNSALIIGPRGSGKTMILNQALEELMEIKQVRENVLQVHLNGLLQINDKIALKEITKQLC  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      +F +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKIFGTFAENLSFLLEALKKGDRTTSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +   S     +I K  L LP++
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFSFSQYLKIFKEQLTLPEE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   KD++            L   L  A+  +     F+
Sbjct  240   F--PDKHFTEKWNETVQGLSEDKNVKDVLLKHFHASKDLRSLHMLLMLALSHITSSRPFI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
                +   A        K   +   S+LE+ +L+ ++ L +  + E  NF  +  E+ K +
Sbjct  298   IPTDLIEANHLCSMDSKANIVHGLSVLEICLLIAMKHLNDIYQDEPFNFQMVYNEFQKFI  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q EL+  +E    N   E++ V+LL+  +++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELVKVMERTSVNTQREYQLVKLLLDNNQIMDALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_008823396.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Nannospalax 
galili]
Length=436

 Score =   162 bits (409),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS+L++GPRG GK       L     ++E  + +  + LNGLL + D  ALKEITRQL 
Sbjct  60    SNSILIIGPRGSGKTKLINHALKELMEVEEVSENVLQVHLNGLLQTSDKIALKEITRQLS  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      +F +N  FL+  L++        VIF+LDEFDLF  Q  Q LLY+L D 
Sbjct  120   LENVVGDKVFGTFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHQKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +     +   +I K  L LP +
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFQQYMKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N     +L D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKAFAEKWNDNAQCLLEDLTVREVLQKHFNVSKNLRSLHMLLMLALNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TSADLVEAQQLCSMDSKASIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    +   E++ V+LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVSSQREYQLVKLLLDNTQIMSALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>gb|ELR49163.1| Origin recognition complex subunit 4, partial [Bos mutus]
Length=418

 Score =   161 bits (408),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/370 (33%), Positives = 192/370 (52%), Gaps = 18/370 (5%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISV------IKLNGLLHSDDNCALKEIT  168
             +NS+L++GPRG GK  ++   L    KE  ++  V      + LNGLL  +D  ALKEIT
Sbjct  42    SNSILIIGPRGSGKTMLINHAL----KELMEIEGVSENILQVHLNGLLQINDKIALKEIT  97

Query  169   RQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYS  342
             RQL  E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+
Sbjct  98    RQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYN  157

Query  343   LLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILL  519
             LLD  QS  +  V+IG++CRLD  +LLEKRV+SRFSHR++  +   S     +I K  L 
Sbjct  158   LLDISQSAQTPVVIIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFSFPQYLKIFKEQLS  217

Query  520   LPKDFGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMK  696
             LP  F  P + + + +N  + S+  D   K++++           L   L  A+ ++   
Sbjct  218   LPSVF--PEEIFAEKWNENVQSLSEDRSVKEVLQKHFNVSKNLRSLHMLLMLALNRVTPS  275

Query  697   SGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY  873
               F++  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+
Sbjct  276   HPFITAADLMEANQLCSMDSKGNIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEF  335

Query  874   -KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQ  1050
              K V     +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++  
Sbjct  336   QKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMN  395

Query  1051  GLKSWGCCPV  1080
              L+ +  CP 
Sbjct  396   ALQKYPNCPT  405



>emb|CDS05825.1| hypothetical protein LRAMOSA08353 [Absidia idahoensis var. thermophila]
Length=502

 Score =   163 bits (412),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 119/384 (31%), Positives = 196/384 (51%), Gaps = 21/384 (5%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEF-----PDMISVIKLNGLLHSDDNCALKEITR  171
             +NS LL+G RG GK  ++   LE L K++          VI+LNG   + D  AL EI R
Sbjct  118   SNSCLLIGNRGVGKTMLVRRALEDLDKQYNRTSEASNFCVIRLNGQTETTDRLALSEIAR  177

Query  172   QLCSEHQLVFSK----MASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQ-GKQRLL  336
             QL  + +    +     ASF ++  +L+++++    +   +IF+LDEFDLF Q  KQ LL
Sbjct  178   QLFLQQKQPQQQQSRQFASFAESFDYLLSLIKAGDKSTLPIIFILDEFDLFAQQPKQALL  237

Query  337   YSLLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK----EDLERIL  504
             Y+L DA QS  +   VIG++CRLDA  LLEKRV+SRFSHR++   PPS      +L +  
Sbjct  238   YNLFDAAQSAQNPMAVIGLTCRLDALSLLEKRVKSRFSHRQIYVFPPSTFGEFIELAKSQ  297

Query  505   KHILLLPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQ  684
               + ++  D    + YV+ FN  L  +  +     I+  +           +  F  V +
Sbjct  298   LRLQVVLGDHAAYSVYVEKFNAALEDLFQNPTMNTILRRIFDLTKDIRSFYKLCFEPVSK  357

Query  685   MDMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIM  864
             +  ++ +L +++F+      +   K E LK  S+LEL ++V +++L   +  T NF  + 
Sbjct  358   LSQENPYLRVEDFQETSIAQRSDAKTEILKGVSMLELVLIVSMKKLLEKDITTFNFEMVY  417

Query  865   KEYKIVHDSFKTSD------YYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLL  1026
              EYK   +  + S        Y R V L+AFE+L   E++  VE+       E+R  +L+
Sbjct  418   DEYKDFMNRTQVSGGGFGVKLYKRPVALKAFENLQGFEIVCPVEDIAKCPK-EYRMARLM  476

Query  1027  ISLHELQQGLKSWGCCPVILHKLI  1098
             +   ++ + +  +  CP  + K +
Sbjct  477   LEQPQVTEAVLKYKNCPAPIKKWV  500



>ref|XP_004870041.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Heterocephalus 
glaber]
Length=456

 Score =   162 bits (410),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 186/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + I  + LNGLL  +D  ALKEITRQL 
Sbjct  80    SNSVLIVGPRGSGKTMLINHALKELMEIEEVSENILQVYLNGLLQINDKIALKEITRQLH  139

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  140   LENVVGDKVFGSFAENFSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  199

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  200   SQSPQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPVE  259

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   +D++            L      A+ ++     FL
Sbjct  260   F--PDKLFAEKWNENVQSLSEDKSVRDVLLKHFNVSKDLRSLHMLSMVALNRVTASHPFL  317

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  318   TAADLMEAAQLCSMDSKANVVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  377

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ 
Sbjct  378   QRKAHSIYNFEKPVVMKAFEHLQQLELIKPVERTSVNSQREYQLMKLLLDNTQIMNSLQK  437

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  438   YPNCPT  443



>ref|XP_007078610.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007078611.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Panthera 
tigris altaica]
 ref|XP_007078612.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Panthera 
tigris altaica]
Length=436

 Score =   162 bits (409),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTTLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRSSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKLFTEKWNESIQCLTEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTTSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADMMEAHQFCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNTQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_005601532.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Equus 
caballus]
 ref|XP_008516904.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Equus 
przewalskii]
Length=477

 Score =   162 bits (411),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +DN ALKEITRQL 
Sbjct  101   SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDNIALKEITRQLN  160

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  161   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  220

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   V+G++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  221   SQSAQTPVAVVGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  280

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  281   F--PDKLFAEKWNENVQCLSEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTSSHPFM  338

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  339   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  398

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  399   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  458

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  459   YPNCPT  464



>ref|XP_003990798.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Felis 
catus]
 ref|XP_006935332.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Felis 
catus]
 ref|XP_006935333.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Felis 
catus]
Length=436

 Score =   162 bits (409),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTTLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRSSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKLFTEKWNESIQCLTEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTTSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADMMEAHQFCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNTQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_005390847.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Chinchilla 
lanigera]
Length=435

 Score =   162 bits (409),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 185/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  59    SNSVLIVGPRGSGKTMLISHALKELMEIEEVSENVLQVYLNGLLQINDKIALKEITRQLH  118

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  119   LENVVGDKVFGSFAENFSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  178

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   V+G++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  179   SQSAQTPVAVVGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  238

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   ++I+            L   L  A+ ++      +
Sbjct  239   F--PDKLFAEKWNQTIQGLSEDKSVREILLKHFNVSKNLRSLHMLLMLALNRVTASHPLV  296

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  297   TAADLTEAAQLCSMDSKANVVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  356

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V L+AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ 
Sbjct  357   QRKAHSVYAFEKPVVLKAFEHLQQLELIKPVERTSVNSQREYQLMRLLLDNTQIMNALQK  416

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  417   YPNCPT  422



>ref|XP_002092897.1| GE11410 [Drosophila yakuba]
 gb|EDW92609.1| GE11410 [Drosophila yakuba]
Length=459

 Score =   162 bits (410),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 114/358 (32%), Positives = 179/358 (50%), Gaps = 38/358 (11%)
 Frame = +1

Query  7    NNSVLLLGPRGCGKNavlelvleal--lKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            +NS+LL+GPRG GK  ++  VL  +   K F +   V+ L+G LH+DD  ALK IT Q+ 
Sbjct  49   SNSLLLIGPRGSGKTTLINAVLADVLPNKAFAENTLVVHLDGNLHTDDRVALKSITVQMQ  108

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLF-TQGKQRLLYSLLDAM  357
             E+        SF +N  FL+  L+  G   K+V+F+L+EFDLF     Q LLY+L D  
Sbjct  109  LENAADGKVFGSFAENLAFLLQCLKAGGKHSKSVVFILEEFDLFCAHHNQTLLYNLFDVS  168

Query  358  QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK--EDLERILKHILLLPK-  528
            QS  +   V+GV+CRLD  +LLEKRV+SRFSHR++   P S+  E+   + K +L LP  
Sbjct  169  QSAQAPICVLGVTCRLDVIELLEKRVKSRFSHRQVFLFPSSQRFEEYVNLCKELLSLPSG  228

Query  529  -------------------------------DFGLPTKYVDAFNTKLLSILSDDKFKDIV  615
                                           ++G   K  + +N ++  +L+  + K  +
Sbjct  229  DSLLLAAERIYSLQNIHSEALHFSRNHFDPGEYGFSPKVRETWNKQVGKVLATQQAKSTL  288

Query  616  ESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILEL  795
            ++L  +D +  +L  FLF  V  +  +S  ++ +      S  +   K+E L   S+LEL
Sbjct  289  QTLYDFDISEAYLKNFLFRLVAHLQPQSPHITAEKMAAVGSQFESDDKIELLCGLSVLEL  348

Query  796  YILVCLR-RLEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELI  966
             +++ ++   E  +++  NF  I   +        T     R + L+AFEHL   ELI
Sbjct  349  CLIIAIKHHSEIYDRDPFNFEIIYARFSKFAKVSTTMQAVERSIVLKAFEHLRIAELI  406



>ref|XP_008572806.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Galeopterus 
variegatus]
 ref|XP_008572807.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Galeopterus 
variegatus]
Length=436

 Score =   162 bits (409),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 190/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK--EFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L+ L +  E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLVNHALKELTELEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIFVLDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFVLDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKLFAEKWNENVQCLSEDRSVREVLQKYFNVSKNLRSLHMLLMLALNRVTASHTFI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLIEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>emb|CAA76188.1| origin recognition complex subunit 4 [Mus musculus]
Length=433

 Score =   161 bits (408),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 194/365 (53%), Gaps = 9/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK-EFPDMISVIKLNGLLHSDDNCALKEITRQLCS  183
             +NSVL++GPRG GK  +L   L+ L++ E  + +  + LNGLL +++  ALKEITRQL  
Sbjct  58    SNSVLIVGPRGSGKTTLLNHALKELMEIEVSENVIQVHLNGLLQTNEKIALKEITRQLNL  117

Query  184   EHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDAM  357
             ++ +      SF +N  FL+  L++        VIF+LDEFD+F  Q  Q LLY+L D  
Sbjct  118   DNVVEDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDIFAHQKNQTLLYNLFDIS  177

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKDF  534
             QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +F
Sbjct  178   QSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAEF  237

Query  535   GLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
               P K + + +N  +  +  D    ++++   + +     L   L  A+ ++ +   F++
Sbjct  238   --PDKAFAERWNENVHCLSEDSTVLEVLQKHFSVNKNLQSLHMLLMLALNRVTVSHPFMT  295

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K + 
Sbjct  296   SADLMEAQHMCSLDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFIQ  355

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q ELI  VE    N   E++ V+LL+   ++   L+ +
Sbjct  356   RKAHSVYNFEKPVVMKAFEHLQQLELIKPVERTSVNSQREYQLVKLLLDNTQIMNALQKY  415

Query  1066  GCCPV  1080
               CP 
Sbjct  416   SNCPT  420



>ref|XP_007568725.1| PREDICTED: origin recognition complex subunit 4 [Poecilia formosa]
Length=434

 Score =   161 bits (408),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 125/371 (34%), Positives = 198/371 (53%), Gaps = 20/371 (5%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISVIK--LNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  +L  VL  L +E     ++++  LNGLL +DD  ALKEITRQL 
Sbjct  60    SNSVLIVGPRGAGKTMLLRSVLRELSQETEVQKNLLQVHLNGLLQTDDRIALKEITRQLQ  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAH-KTVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +  + V+FVLDEFDLF Q K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLTFLLDALKKGDRSSSRPVLFVLDEFDLFAQHKNQTLLYNLFDV  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHI---LLLP  525
              QS  +   V+G++CRLD  +LLEKRV+SRFSHR++  L  SK    + L+ I   L LP
Sbjct  180   SQSAQAPVAVVGLTCRLDVLELLEKRVKSRFSHRQMYLL--SKLTFPQYLERIRDQLSLP  237

Query  526   KDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGF  705
              DF    K+   +N  + ++  D   +++++      + F  L   L   + ++ +    
Sbjct  238   DDFP-DGKFAQEWNAAVTTLCEDKSAEEVLQRHFNSSTDFRSLHMLLMLCLSRVSVARPS  296

Query  706   LS----LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKE  870
             ++    LD  R  L++         L   SILEL +++ ++ L +  E E  N   +  E
Sbjct  297   ITPTDLLDASRFCLADA----NANMLHGLSILELCLIIAMKHLNDVYEGEPFNLQMVHNE  352

Query  871   YKIVHDSFKTSDY-YARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQ  1047
             +K        S Y + + + ++AFEHL Q ELI   +        EF+ ++L++   ++ 
Sbjct  353   FKKFLQRKSNSMYNFEQPIIMKAFEHLQQLELIRPADGASAKTQREFQLMRLMLDHSQIM  412

Query  1048  QGLKSWGCCPV  1080
             + L+ +  CP 
Sbjct  413   EALQKYPQCPT  423



>ref|NP_001039766.1| origin recognition complex subunit 4 [Bos taurus]
 ref|XP_005202501.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Bos 
taurus]
 ref|XP_005905675.1| PREDICTED: origin recognition complex subunit 4 [Bos mutus]
 ref|XP_010838253.1| PREDICTED: origin recognition complex subunit 4 [Bison bison 
bison]
 sp|Q2YDI2.1|ORC4_BOVIN RecName: Full=Origin recognition complex subunit 4 [Bos taurus]
 gb|AAI10212.1| Origin recognition complex, subunit 4-like (yeast) [Bos taurus]
 tpg|DAA32685.1| TPA: origin recognition complex subunit 4 [Bos taurus]
Length=436

 Score =   161 bits (408),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 121/370 (33%), Positives = 192/370 (52%), Gaps = 18/370 (5%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISV------IKLNGLLHSDDNCALKEIT  168
             +NS+L++GPRG GK  ++   L    KE  ++  V      + LNGLL  +D  ALKEIT
Sbjct  60    SNSILIIGPRGSGKTMLINHAL----KELMEIEGVSENILQVHLNGLLQINDKIALKEIT  115

Query  169   RQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYS  342
             RQL  E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+
Sbjct  116   RQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYN  175

Query  343   LLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILL  519
             LLD  QS  +  V+IG++CRLD  +LLEKRV+SRFSHR++  +   S     +I K  L 
Sbjct  176   LLDISQSAQTPVVIIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFSFPQYLKIFKEQLS  235

Query  520   LPKDFGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMK  696
             LP  F  P + + + +N  + S+  D   K++++           L   L  A+ ++   
Sbjct  236   LPSVF--PEEIFAEKWNENVQSLSEDRSVKEVLQKHFNVSKNLRSLHMLLMLALNRVTPS  293

Query  697   SGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY  873
               F++  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+
Sbjct  294   HPFITAADLMEANQLCSMDSKGNIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEF  353

Query  874   -KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQ  1050
              K V     +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++  
Sbjct  354   QKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMN  413

Query  1051  GLKSWGCCPV  1080
              L+ +  CP 
Sbjct  414   ALQKYPNCPT  423



>ref|XP_003267675.1| PREDICTED: origin recognition complex subunit 4 isoform 1 [Nomascus 
leucogenys]
 ref|XP_003267676.1| PREDICTED: origin recognition complex subunit 4 isoform 2 [Nomascus 
leucogenys]
Length=436

 Score =   161 bits (408),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGNKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHVLLMLALNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_006187660.1| PREDICTED: origin recognition complex subunit 4 [Camelus ferus]
Length=436

 Score =   161 bits (408),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVNENVLQVHLNGLLQINDKTALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP  
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAV  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   ++I++     +     L   L  A+ ++     F+
Sbjct  240   F--PDKIFAEKWNENVQSLSEDRSVREILQKHFNVNKNLRSLHMLLMLALNRVTPSYPFV  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAAHLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_004423904.1| PREDICTED: origin recognition complex subunit 4 [Ceratotherium 
simum simum]
Length=436

 Score =   161 bits (408),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + I  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINRALKELMEVEEVSENILQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIFVLDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALQKGDRTSSCPVIFVLDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEELSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++ +   F+
Sbjct  240   F--PDKLFAEKWNENVQCLSEDRSVREVLQKHFNVSKNLRSLHVLLMLALNRVTISHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_004943073.1| PREDICTED: origin recognition complex subunit 4 isoform X6 [Gallus 
gallus]
Length=470

 Score =   162 bits (410),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 116/332 (35%), Positives = 181/332 (55%), Gaps = 10/332 (3%)
 Frame = +1

Query  7    NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            +NS L++GPRG GK A+L  VL+    +K+  + +  + LNGLL ++D  ALKEITRQL 
Sbjct  118  SNSALIIGPRGSGKTALLNRVLKDLREMKQVKENLLEVHLNGLLQTNDKVALKEITRQLH  177

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
             E+ +      SF +N  FL+  LR+        V+FVLDEFDLF   K Q LLY+L D 
Sbjct  178  LENVVGDKVFGSFAENLAFLLEALRKGDRTSSCPVLFVLDEFDLFVHHKNQTLLYNLFDV  237

Query  355  MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
             QS  +   VIG++CR D  +LLEKRV+SRFSHR++  +   + +   RI K  L LP +
Sbjct  238  SQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRRIYLMNSFAFKQYIRIFKEQLSLPAE  297

Query  532  FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
            F  P K +   +N+ +  +  D   +DI+++L  Y      L   L  AV  + ++   +
Sbjct  298  F--PDKAFAQKWNSNIQLLTEDKTVQDILQNLFHYSKDLRSLNFLLMLAVSNVTVRHPLI  355

Query  709  SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
            +  + + A    +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+ K +
Sbjct  356  TASDLQEASKQYRMDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEFQKFI  415

Query  883  HDSFKTSDYYARDVCLRAFEHLLQRELISFVE  978
                     + + V ++AFEHLLQ EL+  +E
Sbjct  416  QRKAHCMYNFEKPVVMKAFEHLLQLELVKPIE  447



>gb|AAC01957.1| putative replication initiator origin recognition complex subunit 
Orc4Lp [Homo sapiens]
 gb|AAC80282.1| origin recognition complex subunit 4 [Homo sapiens]
 gb|AAD22110.1| origin recognition complex subunit 4 [Homo sapiens]
 gb|EAX11555.1| origin recognition complex, subunit 4-like (yeast), isoform CRA_a 
[Homo sapiens]
 gb|EAX11556.1| origin recognition complex, subunit 4-like (yeast), isoform CRA_a 
[Homo sapiens]
 gb|EAX11557.1| origin recognition complex, subunit 4-like (yeast), isoform CRA_a 
[Homo sapiens]
 gb|EAX11558.1| origin recognition complex, subunit 4-like (yeast), isoform CRA_a 
[Homo sapiens]
 dbj|BAI46199.1| origin recognition complex, subunit 4-like protein [synthetic 
construct]
Length=436

 Score =   161 bits (408),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLISHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_007933136.1| PREDICTED: origin recognition complex subunit 4 [Orycteropus 
afer afer]
Length=436

 Score =   161 bits (408),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 191/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS+L++GPRG GK       L     ++E  + I  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSMLIIGPRGSGKTMLINHALKELMEIEEMSENILQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGEKVFGSFAENLSFLLEALKKGNRSSSCPVIFILDEFDLFAYHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +   S     +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFSFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  +   +++++     + +   L   L  A+ ++     F+
Sbjct  240   F--PDKLFAEKWNENIQCLSEERNVREVLQKHFNVNKSLRSLHMLLMLALNRVTSSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEASQLCDMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSIYNFEKPVVMKAFEHLQQLELIKPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|NP_036088.3| origin recognition complex subunit 4 isoform 1 [Mus musculus]
 ref|XP_006498126.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Mus 
musculus]
 ref|XP_006498127.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Mus 
musculus]
 ref|XP_006498128.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Mus 
musculus]
 sp|O88708.2|ORC4_MOUSE RecName: Full=Origin recognition complex subunit 4 [Mus musculus]
 emb|CAA05896.1| ORC4-related protein [Mus musculus]
 dbj|BAB26801.1| unnamed protein product [Mus musculus]
 gb|AAH15072.1| Origin recognition complex, subunit 4-like (S. cerevisiae) [Mus 
musculus]
 gb|AAH19748.1| Origin recognition complex, subunit 4-like (S. cerevisiae) [Mus 
musculus]
 dbj|BAE41048.1| unnamed protein product [Mus musculus]
 dbj|BAE28161.1| unnamed protein product [Mus musculus]
 gb|EDL26871.1| origin recognition complex, subunit 4-like (S. cerevisiae), isoform 
CRA_a [Mus musculus]
Length=433

 Score =   161 bits (408),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 194/365 (53%), Gaps = 9/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK-EFPDMISVIKLNGLLHSDDNCALKEITRQLCS  183
             +NSVL++GPRG GK  +L   L+ L++ E  + +  + LNGLL +++  ALKEITRQL  
Sbjct  58    SNSVLIVGPRGSGKTTLLNHALKELMEIEVSENVIQVHLNGLLQTNEKIALKEITRQLNL  117

Query  184   EHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDAM  357
             ++ +      SF +N  FL+  L++        VIF+LDEFD+F  Q  Q LLY+L D  
Sbjct  118   DNVVEDKVFGSFAENLSFLLEALQKGDRTSSCPVIFILDEFDIFAHQKNQTLLYNLFDIS  177

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKDF  534
             QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +F
Sbjct  178   QSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAEF  237

Query  535   GLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
               P K + + +N  +  +  D    ++++   + +     L   L  A+ ++ +   F++
Sbjct  238   --PDKAFAERWNENVHCLSEDSTVLEVLQKHFSVNKNLQSLHMLLMLALNRVTVSHPFMT  295

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K + 
Sbjct  296   SADLMEAQHMCSLDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFIQ  355

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q ELI  VE    N   E++ V+LL+   ++   L+ +
Sbjct  356   RKAHSVYNFEKPVVMKAFEHLQQLELIKPVERTSVNSQREYQLVKLLLDNTQIMNALQKY  415

Query  1066  GCCPV  1080
               CP 
Sbjct  416   SNCPT  420



>ref|XP_006880822.1| PREDICTED: origin recognition complex subunit 4 [Elephantulus 
edwardii]
Length=436

 Score =   161 bits (408),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 193/364 (53%), Gaps = 10/364 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L+    ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTVLMNHALKELMEIEEIRENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGTRSTSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLINSFGFPQYIKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   +++++     + +   L   L  A+ ++     F+
Sbjct  240   F--PDKLFAEKWNENIQSLSDDSSIREVLQKHFNINKSLRSLHMLLMLALNRVTTTHPFV  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TATDLIEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSIYNFEKPVVMKAFEHLQQLELIKPMERPSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCC  1074
             +  C
Sbjct  418   YPNC  421



>dbj|BAF84678.1| unnamed protein product [Homo sapiens]
Length=436

 Score =   161 bits (408),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAVDLMEACQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_004401591.1| PREDICTED: origin recognition complex subunit 4 [Odobenus rosmarus 
divergens]
Length=436

 Score =   161 bits (408),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L      +E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEAEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +    VIFVLDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRSSSCPVIFVLDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKIFTEKWNENVQCLTEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTTSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADVMEANHLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNTQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|NP_859525.1| origin recognition complex subunit 4 isoform 1 [Homo sapiens]
 ref|NP_859526.1| origin recognition complex subunit 4 isoform 1 [Homo sapiens]
 ref|NP_002543.2| origin recognition complex subunit 4 isoform 1 [Homo sapiens]
 ref|NP_001177808.1| origin recognition complex subunit 4 isoform 1 [Homo sapiens]
 ref|XP_003816739.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pan 
paniscus]
 ref|XP_003816740.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pan 
paniscus]
 ref|XP_003816741.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pan 
paniscus]
 ref|XP_003816742.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pan 
paniscus]
 sp|O43929.2|ORC4_HUMAN RecName: Full=Origin recognition complex subunit 4 [Homo sapiens]
 gb|AAH14847.1| Origin recognition complex, subunit 4-like (yeast) [Homo sapiens]
 gb|AAS94326.1| origin recognition complex, subunit 4-like (yeast) [Homo sapiens]
 gb|ABZ92520.1| origin recognition complex, subunit 4-like (yeast) [synthetic 
construct]
 gb|AIC49318.1| ORC4, partial [synthetic construct]
Length=436

 Score =   161 bits (408),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_008572805.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Galeopterus 
variegatus]
Length=470

 Score =   162 bits (409),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 189/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavl--elvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L     L+E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  94    SNSVLIIGPRGSGKTMLVNHALKELTELEEVSENVLQVHLNGLLQINDKIALKEITRQLN  153

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIFVLDEFDLF   K Q LLY+L D 
Sbjct  154   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFVLDEFDLFAHHKNQTLLYNLFDI  213

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  214   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  273

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  274   F--PDKLFAEKWNENVQCLSEDRSVREVLQKYFNVSKNLRSLHMLLMLALNRVTASHTFI  331

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  332   TAADLIEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  391

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  392   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLMKLLLDNTQIMNALQK  451

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  452   YPNCPT  457



>ref|XP_006727739.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006727740.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Leptonychotes 
weddellii]
Length=436

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRSSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKIFTEKWNENVQCLTEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTTSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADVMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNTQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_008572804.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Galeopterus 
variegatus]
Length=485

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 189/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavl--elvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L     L+E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  109   SNSVLIIGPRGSGKTMLVNHALKELTELEEVSENVLQVHLNGLLQINDKIALKEITRQLN  168

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIFVLDEFDLF   K Q LLY+L D 
Sbjct  169   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFVLDEFDLFAHHKNQTLLYNLFDI  228

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  229   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  288

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  289   F--PDKLFAEKWNENVQCLSEDRSVREVLQKYFNVSKNLRSLHMLLMLALNRVTASHTFI  346

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  347   TAADLIEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  406

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  407   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLMKLLLDNTQIMNALQK  466

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  467   YPNCPT  472



>gb|ENN72970.1| hypothetical protein YQE_10401, partial [Dendroctonus ponderosae]
Length=422

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 114/368 (31%), Positives = 195/368 (53%), Gaps = 13/368 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLCSE  186
             +NS+LL+GP+G  + + L   +   L+   D I +++L+GLLH+DD  ALK IT QL  +
Sbjct  45    SNSMLLIGPQG-AETSKLVNSVLKELEGLKDYI-IVELHGLLHTDDRLALKSITFQLNLD  102

Query  187   HQLVFSKMASFDDNSQFLIAMLRECGL-AHKTVIFVLDEFDLF-TQGKQRLLYSLLDAMQ  360
             + +      SF +N  FL+A LR  G  + K+VIF+L  FDLF     Q LLY+L D  Q
Sbjct  103   NAVDGKVFGSFAENLAFLLACLRTGGKESSKSVIFILQAFDLFCAHHNQTLLYNLFDISQ  162

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKED------LERILKHILLL  522
             S  +   V+G++CR+D  QLLEKRV+SRFSHR++     S+E       L+R+  ++ L 
Sbjct  163   SAQTPICVLGLTCRIDVIQLLEKRVKSRFSHRQMFLYAGSEETSDLDFALDRMAWYLELP  222

Query  523   PK-DFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKS  699
             PK   G+ +K  DA+N  +  +L + KF+ + E +   + +   L   L   +  +    
Sbjct  223   PKCPVGITSKARDAWNLNVQELLKNKKFRAVTERMIGLELSEQILKNVLLKCLYSLTNTD  282

Query  700   GFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLR-RLEANEQETCNFNSIMKEYK  876
               L+++ F   L + ++   ++ L+D S LE+ ++V ++   +  +    NF  +   Y 
Sbjct  283   QLLTVNQFEKELESLEKDEMVQVLQDLSALEICLIVAMQHHSDIYDNSPMNFEMVYTRYV  342

Query  877   IVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQ-SIEFRPVQLLISLHELQQG  1053
                    +     R V ++AFEH+   ELI+ V  +G  +   E++  +LL++  ++ + 
Sbjct  343   KFAHKHSSMQNVQRPVVMKAFEHIEAIELIAMVNQQGSAKLQKEYQFFKLLVTPQQISEA  402

Query  1054  LKSWGCCP  1077
             +      P
Sbjct  403   IGKMQGLP  410



>ref|XP_004636702.1| PREDICTED: origin recognition complex subunit 4 [Octodon degus]
Length=435

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavl--elvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  59    SNSVLIVGPRGSGKTMLINHALKELMEIEEVSENVLQVYLNGLLQINDKIALKEITRQLH  118

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  119   LENVVGDKVFGSFAENFSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  178

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  179   AQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPPE  238

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   ++++            L   L  A+ ++      +
Sbjct  239   F--PDKLFAEKWNQTVQGLSEDKSVREVLLKHFNVSKNLRSLHMLLMLALNRVTASHPLM  296

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  297   TAADLMEAAQLCSMDSKANVVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  356

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V L+AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ 
Sbjct  357   QRKAHSVYNFEKPVVLKAFEHLQQLELIKPVERTSVNSQREYQLMKLLLDNTQIMNALQK  416

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  417   YPNCPT  422



>ref|XP_004614144.1| PREDICTED: origin recognition complex subunit 4 [Sorex araneus]
Length=436

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 186/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSALIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  LR+        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVEDKVFGSFAENLSFLLEALRKGKRTTSCPVIFILDEFDLFAHHKNQTLLYNLFDV  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL-IFLPPSKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++ I          +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHIMNSFGFPQYLKIFKEQLSLPVE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D    ++++           L   L  A+ ++ +   F+
Sbjct  240   F--PDKLFAEKWNEHVQGLSEDGSVNEVLQKHFNISKNLRSLHMLLMLALNRVTVSCPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEAHQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNAQKEYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_010291314.1| PREDICTED: origin recognition complex subunit 4 [Phaethon lepturus]
Length=436

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 189/369 (51%), Gaps = 16/369 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISV------IKLNGLLHSDDNCALKEIT  168
             +NS L++GPRG GK  +L  VL    KE  +M         + LNGLL ++D  ALKEIT
Sbjct  60    SNSALIIGPRGSGKTVLLNRVL----KELKEMKQARENLLEVHLNGLLQTNDKVALKEIT  115

Query  169   RQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYS  342
             RQL  E+ +      SF +N  FL+  LR+        V+F+LDEFDLF   K Q LLY+
Sbjct  116   RQLHLENVVGDKVFGSFAENLAFLLEALRKGDRTSSCPVLFILDEFDLFVHHKNQTLLYN  175

Query  343   LLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILL  519
             L D  QS  +   VIG++CR D  +LLEKRV+SRFSHR++  +     +   RI K  L 
Sbjct  176   LFDISQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRQMYLMNSFDFKQYIRIFKEQLS  235

Query  520   LPKDFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKS  699
             LP +F     +   +N+ +  +  D   +D++++L  Y      L   L  AV  + +  
Sbjct  236   LPAEFP-DESFAQKWNSNVRHLSEDKTVQDMLQNLFHYTKDLRSLNLLLMLAVSSVTVHH  294

Query  700   GFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-  873
               ++  +   A    +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+ 
Sbjct  295   PLITASDLHEASKQCRMDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEFQ  354

Query  874   KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQG  1053
             K +         + + V ++AFEHLLQ EL+  +E        E+  ++LL+  +++   
Sbjct  355   KFIQRKAHCMYNFEKPVVMKAFEHLLQLELVKPIERPSVRAQREYLLMKLLLDNNQIMDA  414

Query  1054  LKSWGCCPV  1080
             L+++  CP 
Sbjct  415   LQAYPNCPT  423



>ref|XP_010353215.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Rhinopithecus 
roxellana]
Length=420

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  44    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  103

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++    +   VIF+LDEFDLF   K Q LLY+L D 
Sbjct  104   LENVVGDKVFGSFAENLSFLLEALKKGDRTNSCPVIFILDEFDLFAHHKNQTLLYNLFDI  163

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  164   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  223

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L   + ++     F+
Sbjct  224   F--PDKLFAEKWNENVQYLSEDRSVQEVLQRHFNISKNLRSLHMLLMLTLNRVTASHPFM  281

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  282   TAIDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  341

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  342   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  401

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  402   YPNCPT  407



>ref|XP_010948559.1| PREDICTED: origin recognition complex subunit 4 [Camelus bactrianus]
 ref|XP_010973057.1| PREDICTED: origin recognition complex subunit 4 [Camelus dromedarius]
 ref|XP_010973067.1| PREDICTED: origin recognition complex subunit 4 [Camelus dromedarius]
Length=436

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVNENVLQVHLNGLLQINDKTALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP  
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAV  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   ++I++           L   L  A+ ++     F+
Sbjct  240   F--PDKIFAEKWNENVQSLSEDRSVREILQKHFNVSKNLRSLHMLLMLALNRVTPSYPFV  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAAHLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_006196205.1| PREDICTED: origin recognition complex subunit 4 [Vicugna pacos]
Length=436

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVNENVLQVHLNGLLQINDKTALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP  
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAV  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  + S+  D   ++I++           L   L  A+ ++     F+
Sbjct  240   F--PDKIFAEKWNENVQSLSEDRSVREILQKHFNVSKNLRSLHMLLMLALNRITPSYPFV  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAAHLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_001364856.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Monodelphis 
domestica]
 ref|XP_007494191.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Monodelphis 
domestica]
 ref|XP_007494192.1| PREDICTED: origin recognition complex subunit 4 isoform X3 [Monodelphis 
domestica]
 ref|XP_007494193.1| PREDICTED: origin recognition complex subunit 4 isoform X4 [Monodelphis 
domestica]
Length=436

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/365 (32%), Positives = 185/365 (51%), Gaps = 8/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNav--lelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK  +    L     +K+  + +  + LNGLL + D  ALKEIT+QLC
Sbjct  60    SNSALIIGPRGSGKTMILNQALEELMEIKQVRENVLQVHLNGLLQTSDKIALKEITKQLC  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKIFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +   S     +I K  L LP++
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFSFSQYLKIFKEQLTLPEE  239

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
             F     + + +N  +  +  D   K+++            L   L  A+  +     F+ 
Sbjct  240   FS-DKHFTEKWNETIQCLSEDKNVKEVLLKHFHTSKDLRSLHMLLMLALSHITPSRPFII  298

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +   A        K   +   S+LE+ +L+ ++ L +  + E  NF  +  E+ K + 
Sbjct  299   PTDLVEANHLCSMDSKGNIVHGLSVLEICLLIAMKHLNDIYQDEPFNFQMVYNEFQKFIQ  358

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q EL+  +E    N   EF+ V+LL+  +++   L+ +
Sbjct  359   RKAHSVYNFEKPVVMKAFEHLQQLELVKVMERTSVNTQREFQLVKLLLDNNQIMDALQKY  418

Query  1066  GCCPV  1080
               CP 
Sbjct  419   PNCPT  423



>ref|NP_001126452.1| origin recognition complex subunit 4 [Pongo abelii]
 ref|XP_009235966.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pongo 
abelii]
 ref|XP_009235967.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pongo 
abelii]
 ref|XP_009235968.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pongo 
abelii]
 sp|Q5R6Z7.1|ORC4_PONAB RecName: Full=Origin recognition complex subunit 4 [Pongo abelii]
 emb|CAH92463.1| hypothetical protein [Pongo abelii]
Length=436

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        V+F+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVVFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAVDLIEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_005099548.1| PREDICTED: origin recognition complex subunit 4-like isoform 
X1 [Aplysia californica]
 ref|XP_005099549.1| PREDICTED: origin recognition complex subunit 4-like isoform 
X2 [Aplysia californica]
Length=448

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 117/363 (32%), Positives = 192/363 (53%), Gaps = 8/363 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKE--FPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS+LL+GPRGCGK+ ++  V+E++ K+      + V++LNGLL +DD  AL+EIT QL 
Sbjct  78    SNSLLLIGPRGCGKSMLIRNVVESVCKKESVRSNLLVVQLNGLLQTDDKVALREITVQLQ  137

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQGK-QRLLYSLLDAM  357
              E+ +      SF +  QFL+  L++     K ++ VL+EFDLF Q K Q LLY+L D  
Sbjct  138   LENAVGDKVFGSFAETLQFLLTALKKGDQGSKPILIVLEEFDLFAQHKNQTLLYNLFDIT  197

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKL-IFLPPSKEDLERILKHILLLPKDF  534
             QS  +   VIG++CRLD  +LLEKRV+SRFSHR+L ++   +     ++ +  L L   F
Sbjct  198   QSAQTPLCVIGLTCRLDVVELLEKRVKSRFSHRQLHLYNKLNLSQYRQLCQAYLSLGAAF  257

Query  535   GLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSL  714
                 K+ D+++  +  +L +   KDI+E   +  +    L+  L   VC++  +   ++ 
Sbjct  258   P-DRKFADSWDQSIKELLEEVSVKDILERQFSLTNDVRGLMTLLTYPVCKLCEQHPRITA  316

Query  715   DNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEYKIVHDS  891
              +  T+        K   L   SILE+ +++ ++ L +  E E  NF  +  EY      
Sbjct  317   GDLVTSFKIISTDTKSAMLHGLSILEVCLIIAMKHLTDIYEGEPFNFEMVYSEYLKFARR  376

Query  892   FKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGC  1071
                   Y + V ++A+EHL   ELI            E++ + LL+   ++   L+ +  
Sbjct  377   RSGMQVYEKPVVMKAYEHLQTLELIRGHGGG--QGQREYKLMTLLVHPTQILDALQHYPG  434

Query  1072  CPV  1080
             CP 
Sbjct  435   CPT  437



>ref|XP_002712193.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Oryctolagus 
cuniculus]
 ref|XP_008256777.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Oryctolagus 
cuniculus]
Length=436

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 191/365 (52%), Gaps = 10/365 (3%)
 Frame = +1

Query  10    NSVLLLGPRGCGKNavlelvleallK--EFPDMISVIKLNGLLHSDDNCALKEITRQLCS  183
             NSVL++GPRG GK  ++   L+ L++  E  + I  + LNGLL  +D  ALKEITRQL  
Sbjct  61    NSVLIIGPRGSGKTMLINHALKELMEIGEASENILQVHLNGLLQINDKIALKEITRQLNL  120

Query  184   EHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDAM  357
             E+ +      SF +N  FL+  L++    +   VIF+LDEFDLF   K Q LLY+L D  
Sbjct  121   ENAVGDKVFGSFAENLSFLLEALKKGDRTNSCPVIFILDEFDLFAHHKNQTLLYNLFDIS  180

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKDF  534
             Q+  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +F
Sbjct  181   QTAQTPVSVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEF  240

Query  535   GLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
               P K + + +N  +  +  D   +++++           L   L  A+ ++     F++
Sbjct  241   --PDKVFAEKWNENVQCLSEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTASHPFVT  298

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K + 
Sbjct  299   PADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFIQ  358

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ +
Sbjct  359   RKAHSVYNFEKPVVMKAFEHLQQLELIKPIERTSVNSQREYQLMKLLLDNTQIMNALQKY  418

Query  1066  GCCPV  1080
               CP 
Sbjct  419   PNCPT  423



>ref|XP_006135736.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pelodiscus 
sinensis]
Length=436

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 196/369 (53%), Gaps = 16/369 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK       L     +KE  + +  + LNGLL ++D  ALKEITRQL 
Sbjct  60    SNSALIIGPRGSGKTMLLNHVLKELMEIKEVRENLLQVHLNGLLQTNDKIALKEITRQLQ  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++    +   V+F+LDEFDLF   K Q LLY+L D 
Sbjct  120   MENVVGDKVFGSFAENLSFLLEALKKGDRENSCPVLFILDEFDLFVHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPS---KEDLERILKHILLLP  525
              QS  +   +IG++CR D  +LLEKRV+SRFSHR+ I+L  S   K+ L +I K  L LP
Sbjct  180   SQSAQTPVTIIGLTCRQDILELLEKRVKSRFSHRQ-IYLMNSFDFKQYL-KIFKEQLYLP  237

Query  526   KDFGLPTKYVDAFNTKLLSILSDDKFKDIVES--LCTYDSTFNHLLRFLFSAVCQMDMKS  699
              +F   T +   +N  + S+  D   +D++ +   C+ D    H+L  L  A+  + +  
Sbjct  238   AEFSDKT-FTQKWNKNVQSLSEDKTVQDVLRNHFHCSKDLRSLHMLLML--ALSSITVSH  294

Query  700   GFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-  873
              F++  +   A    +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+ 
Sbjct  295   PFMTGADLLEASKLCRMDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEFQ  354

Query  874   KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQG  1053
             K +     +   + + V ++AFEHLLQ ELI  V+        E++ ++LL+   ++   
Sbjct  355   KFIQRKAHSMYNFEKPVVMKAFEHLLQLELIKPVDGPSVRAQREYQLMKLLLDNSQIMDA  414

Query  1054  LKSWGCCPV  1080
             L+ +  CP 
Sbjct  415   LQVYPNCPT  423



>ref|XP_009914303.1| PREDICTED: origin recognition complex subunit 4 [Haliaeetus albicilla]
 ref|XP_010573497.1| PREDICTED: origin recognition complex subunit 4 [Haliaeetus leucocephalus]
Length=436

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 123/371 (33%), Positives = 195/371 (53%), Gaps = 20/371 (5%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISV------IKLNGLLHSDDNCALKEIT  168
             +NS L++GPRG GK A+L  VL    KE  +M  V      + LNGLL ++D  ALKEIT
Sbjct  60    SNSALIIGPRGSGKTALLNHVL----KELTEMKQVRENLLEVHLNGLLQTNDKVALKEIT  115

Query  169   RQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYS  342
             RQL  E+ +      SF +N  FL+  L++        V+F+LDEFDLF   K Q LLY+
Sbjct  116   RQLHLENVVGDKVFGSFAENLAFLLEALKKGDRTSSCPVLFILDEFDLFVHHKNQTLLYN  175

Query  343   LLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKE--DLERILKHIL  516
             L D  QS  +   VIG++CR D  +LLEKRV+SRFSHR+ I+L  S +     RI K  L
Sbjct  176   LFDISQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRQ-IYLTNSFDFKQYIRIFKEQL  234

Query  517   LLPKDFGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDM  693
              LP   G P + +   +N  +  +  D   +D++++L  +      L   L  AV  +++
Sbjct  235   SLPA--GFPDESFAQKWNKNVQHLSEDKTVQDMLQNLFHHTKDLRSLHLLLMLAVSNVNV  292

Query  694   KSGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKE  870
                 ++  +   A   ++   K   +   S+LE+ +++ ++ L +  E E  NF  +  E
Sbjct  293   HHPLITASDLHEASKQSRMDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNE  352

Query  871   Y-KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQ  1047
             + K +         + + V ++AFEHLLQ EL+  +E        E+  ++LL+  +++ 
Sbjct  353   FQKFIQRKAHCMYNFEKPVVMKAFEHLLQLELVRPIERPSVRAQREYLLMKLLLDNNQIM  412

Query  1048  QGLKSWGCCPV  1080
               L+++  CP 
Sbjct  413   DALQAYPNCPT  423



>ref|XP_010619269.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Fukomys 
damarensis]
 gb|KFO34673.1| Origin recognition complex subunit 4 [Fukomys damarensis]
Length=436

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 185/365 (51%), Gaps = 8/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIVGPRGSGKTTLINHSLKELMEIEEVSENVLQVYLNGLLQINDKIALKEITRQLH  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENFSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   V+G++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVVGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPVE  239

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
             F     + + +N  + S+  D   +D++            L      A+ ++ +   FL+
Sbjct  240   FS-DKLFSEKWNENIQSLSEDKSVQDVLLKHFNVSKDLRSLHMLSMVALNRVTVSHPFLT  298

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V 
Sbjct  299   AADLMEAAQLCSMDSKANVVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQ  358

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ +
Sbjct  359   RKAHSVYNFEKPVVMKAFEHLQQLELIKPVERTSVNSQREYQLMKLLLDNTQIMNALQKY  418

Query  1066  GCCPV  1080
               CP 
Sbjct  419   PNCPT  423



>ref|XP_008694107.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Ursus 
maritimus]
 ref|XP_008694108.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Ursus 
maritimus]
 ref|XP_008694109.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Ursus 
maritimus]
Length=436

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L+    +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKRGDRSSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKIFTEKWNENVQCLTEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTTSHPFV  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNTQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_003793056.1| PREDICTED: origin recognition complex subunit 4 [Otolemur garnettii]
Length=436

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     +++  + I  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEDVSENILHVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   ++G++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPVAIVGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++   +   +   L   L  A+  +     F+
Sbjct  240   F--PEKLFAEKWNENVQCLSEDRSVREVLQKHFSVSKSLRSLHMLLMFALNLVTASHPFI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             S  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   SATDLMEANQLCSMDSKANIVHGLSVLEICLVIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_008694106.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Ursus 
maritimus]
Length=445

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  69    SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  128

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L+    +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  129   LENVVGDKVFGSFAENLSFLLEALKRGDRSSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  188

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  189   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  248

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  249   F--PDKIFTEKWNENVQCLTEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTTSHPFV  306

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  307   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  366

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  367   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNTQREYQLMKLLLDNTQIMNALQK  426

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  427   YPNCPT  432



>ref|XP_008136928.1| PREDICTED: origin recognition complex subunit 4 [Eptesicus fuscus]
Length=436

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 189/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     +++  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEDVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  F++  L++    +   VIF+LDEFDLF   + Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFILEALKKGDRTNSCPVIFILDEFDLFAHHRNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQMHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++       +   L   L  A+ ++     F+
Sbjct  240   F--PDKLFAEKWNENVQCLSEDTSVQEVLQKHFNVSKSLRSLHMLLMLALSRVTTSHPFI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPVERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_010738339.1| PREDICTED: origin recognition complex subunit 4 [Larimichthys 
crocea]
Length=434

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 120/366 (33%), Positives = 192/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavle--lvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  +L+  L      KE    +  + LNGLL +DD  ALKEITRQL 
Sbjct  60    SNSVLIVGPRGAGKTMLLKCVLRDLLEEKEVQKNLLQVHLNGLLQTDDRIALKEITRQLH  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAH-KTVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +  + V+FVLDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLAFLLEALKKGDRSSSRPVLFVLDEFDLFAHHKNQTLLYNLFDV  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFL--PPSKEDLERILKHILLLPK  528
              QS  +   V+G++CRLD  +LLEKRV+SRFSHR++  L  P   + ++R+ +  L LP 
Sbjct  180   SQSAQAPIAVVGITCRLDVLELLEKRVKSRFSHRQIHLLSSPTFPQYVDRV-RTQLSLPD  238

Query  529   DFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             DF    K+ + +   + S+  D   +D+++        F  +   L   + ++ +    +
Sbjct  239   DFP-DVKFAEDWKASVKSLCEDKSVEDVLKRHFNSSRDFRSMHMLLMLCLSRVSVSKPAI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEYKIVH  885
                +   A        K   L   SILEL +++ ++ L +  E E  N   +  E+K   
Sbjct  298   RPADLLEASRLCFTDSKANMLHGLSILELCLIIAMKHLNDVYEGEPFNLQMVHNEFKKFL  357

Query  886   DSFKTSDY-YARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  S Y + + V ++AFEHL Q ELI  V++       E++ ++L++   ++ + L+ 
Sbjct  358   QRKSNSMYNFDQPVIMKAFEHLQQLELIRPVDSSSAKTQREYQLMRLMLDHSQIMEALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPQCPT  423



>ref|XP_008058063.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Tarsius 
syrichta]
Length=435

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 190/365 (52%), Gaps = 9/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK-EFPDMISVIKLNGLLHSDDNCALKEITRQLCS  183
             +NSVL++GPRG GK+ ++   L+ L+  E  + +  + LNGLL  +D  A+KEITRQL  
Sbjct  60    SNSVLIIGPRGSGKSMLINHALKELMDIEVSENVLQVHLNGLLQINDKIAIKEITRQLNL  119

Query  184   EHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDAM  357
             E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D  
Sbjct  120   ENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDIS  179

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKDF  534
             QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +F
Sbjct  180   QSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPTEF  239

Query  535   GLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
               P K + + +N  +  +  D   +++++           L   L  A+ ++      L+
Sbjct  240   --PDKFFAEKWNENVQCLSEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTASHPVLT  297

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V 
Sbjct  298   AADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQ  357

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ +
Sbjct  358   RKAHSVYNFEKPVVMKAFEHLQQLELIKPVERTSGNSQREYQLMKLLLDNTQIMNALQKY  417

Query  1066  GCCPV  1080
               CP 
Sbjct  418   PNCPT  422



>ref|XP_007963132.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Chlorocebus 
sabaeus]
Length=420

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 186/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  44    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  103

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  104   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  163

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  164   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  223

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L   + ++     F+
Sbjct  224   F--PDKLFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLTLNRVTASHPFM  281

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  282   TAIDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  341

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  342   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  401

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  402   YPNCPT  407



>emb|CEI88521.1| hypothetical protein RMCBS344292_02908 [Rhizopus microsporus]
Length=435

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 122/371 (33%), Positives = 196/371 (53%), Gaps = 17/371 (5%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLCSE  186
             +NS LL G RG GK  ++  VL  L + +P+   ++KLNGL  + D  AL EI RQL +E
Sbjct  67    SNSCLLYGNRGTGKTVLINTVLRDLRRLYPEF-CIVKLNGLTETTDRLALSEIARQLVTE  125

Query  187   HQLVFS-KMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLFTQ-GKQRLLYSLLDAMQ  360
              Q        SF D+ ++++++L+        VIF+LDEFDLF Q  KQ LLY+L DA Q
Sbjct  126   QQQQQQHSFTSFADSLEYILSLLKSGTKTSLPVIFILDEFDLFAQQPKQTLLYNLFDAAQ  185

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKDFG  537
             S  +   VIG++CRLDA  LLEKRV+SRFSHR++   P S  ++   + K   ++PK   
Sbjct  186   SAQNPMAVIGLTCRLDALDLLEKRVKSRFSHRQIYLFPTSTLDEFMNMAKQTFIIPKHI-  244

Query  538   LPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLD  717
                +  ++FN  +  +  +    +IV+ +           +  +  V ++  +   L+ D
Sbjct  245   ---EGHESFNQSVEELFKNPALNNIVKKIYEVTKDIRLFHKIAYQPVIKLSSQPHLLAQD  301

Query  718   NFRTALSNTQRQPKLECLKDCSILELYILVCLRRLEANEQETCNFNSIMKEYKIVHDSFK  897
                + L+  +   K E L+D ++LEL +++ +++L   E  T NF  +  EYK   +  +
Sbjct  302   FVESNLAQ-RADAKTELLRDIALLELILIISMKKLVEKEITTFNFQMVYDEYKEFMNRTQ  360

Query  898   TSD------YYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLK  1059
                       Y R V L+AFE+L   ELI  VE+ G     E+R  +L++   ++ + + 
Sbjct  361   LKGLGFGMKLYKRAVALKAFENLQLLELIYPVESSGKCPK-EYRMAKLMLERAQITEAVL  419

Query  1060  SWGCCPVILHK  1092
              +  CP I+ K
Sbjct  420   KYD-CPSIIKK  429



>ref|XP_005296479.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Chrysemys 
picta bellii]
Length=436

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 123/369 (33%), Positives = 196/369 (53%), Gaps = 16/369 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK       L     +K+  + +  + LNGLL ++D  ALKEITRQL 
Sbjct  60    SNSALIIGPRGSGKTMLLNHVLKELMEVKQVRENLLQVHLNGLLQTNDKIALKEITRQLQ  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        V+F+LDEFDLF   K Q LLY+L D 
Sbjct  120   MENVVGDKVFGSFAENLAFLLDALKKGDRDSSCPVLFILDEFDLFVHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPS---KEDLERILKHILLLP  525
              QS  +   VIG++CR D  +LLEKRV+SRFSHR+ I+L  S   K+ L RI K  L LP
Sbjct  180   SQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRQ-IYLMNSFDFKQYL-RIFKEQLYLP  237

Query  526   KDFGLPTKYVDAFNTKLLSILSDDKFKDIVES--LCTYDSTFNHLLRFLFSAVCQMDMKS  699
              +F L   ++  +N  + S+  D   +D++ +   C+ D    H+L  L  A+  + +  
Sbjct  238   AEF-LYKPFIQKWNKNVQSLSEDRTVQDVLRNHFHCSKDLRSLHMLLML--ALSSITISH  294

Query  700   GFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-  873
              F++  +   A    +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+ 
Sbjct  295   PFMTGSDLLEASKLCRMDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEFQ  354

Query  874   KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQG  1053
             K +     +   + + V ++AFEHLLQ ELI  +E        E+  ++LL+  +++   
Sbjct  355   KFIQRKAHSMYNFEKPVVMKAFEHLLQLELIKPIEGLPLRAQREYLLMKLLLDNNQIMDA  414

Query  1054  LKSWGCCPV  1080
             L+ +  CP 
Sbjct  415   LQVYPNCPT  423



>ref|XP_005346446.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Microtus 
ochrogaster]
Length=436

 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++   + +  + LNGLL  ++  ALKEITRQL 
Sbjct  60    SNSVLIVGPRGSGKTMLLNQALKELMEIQGMSENVLQVHLNGLLQINEKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF  Q  Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHQKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N     +  D   +++++     +     L   L  A+ ++ +   F+
Sbjct  240   F--PDKVFAERWNENTQCLSEDSTVREVLQKHFNVNKNLRSLHMLLMLALNRVTVSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             S  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K +
Sbjct  298   SSADLMEAQHLCNLDSKASIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFI  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ V+LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YSNCPT  423



>ref|XP_010353213.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Rhinopithecus 
roxellana]
 ref|XP_010353214.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Rhinopithecus 
roxellana]
Length=436

 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++    +   VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTNSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L   + ++     F+
Sbjct  240   F--PDKLFAEKWNENVQYLSEDRSVQEVLQRHFNISKNLRSLHMLLMLTLNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAIDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_007963129.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_007963130.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_007963131.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Chlorocebus 
sabaeus]
Length=436

 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 186/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L   + ++     F+
Sbjct  240   F--PDKLFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLTLNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAIDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|NP_001272749.1| origin recognition complex, subunit 4 [Macaca fascicularis]
 dbj|BAE91509.1| unnamed protein product [Macaca fascicularis]
 gb|EHH54854.1| hypothetical protein EGM_03946 [Macaca fascicularis]
Length=436

 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 186/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L   + ++     F+
Sbjct  240   F--PDKLFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLTLNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAIDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_006753653.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Myotis 
davidii]
Length=436

 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     +++  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEDVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  F++  L++        VIF+LDEFDLF   + Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFILEALKKGDRTSSCPVIFILDEFDLFAHHRNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQMHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++       +   L   L  A+ ++     F+
Sbjct  240   F--PDKLFAEKWNENVQCLSEDKSVQEVLQKHFNISKSLRSLHMLLMLALSRVTTSHPFI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPVERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_002004621.1| GI19505 [Drosophila mojavensis]
 gb|EDW08556.1| GI19505 [Drosophila mojavensis]
Length=456

 Score =   160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 116/397 (29%), Positives = 195/397 (49%), Gaps = 39/397 (10%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS+LL+GPRG GK  ++  VL      K F D   ++ L+G LH+DD  ALK IT Q+ 
Sbjct  49    SNSLLLIGPRGAGKTTLINAVLTDLLENKSFVDNTLIVHLDGNLHTDDRIALKSITVQMR  108

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLF-TQGKQRLLYSLLDAM  357
              E+        SF +N  FL+  L+      K+V+F+L+EFDLF T   Q LLY+L D  
Sbjct  109   LENAADGKVFGSFAENLAFLLQCLKAGDKKSKSVVFILEEFDLFCTHHNQTLLYNLFDVS  168

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK--EDLERILKHILLLPK-  528
             QS  +   V+GV+CRLD  +LLEKRV+SRFSHR++   P +   ED   + +H++ LP  
Sbjct  169   QSAQAPICVLGVTCRLDVIELLEKRVKSRFSHRQVFLFPSANKFEDYVSLFQHLVSLPSN  228

Query  529   -------------------------------DFGLPTKYVDAFNTKLLSILSDDKFKDIV  615
                                            ++    K+V+ +N ++  ++     +  +
Sbjct  229   KELQAAVDRIDSLQMFKSDAFTFQRNHFDGIEYSFDKKHVENWNKQIGKLVKTPAAQKTL  288

Query  616   ESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILEL  795
             + L  +D +   L  F+F  V Q+   +  ++++   T  +  +   K+E L   S+LEL
Sbjct  289   QMLYDFDISEAFLKTFIFRLVAQLKADAPHITVEQLATLGAQYECDDKVELLCGLSVLEL  348

Query  796   YILVCLRRLEA-NEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELISF  972
              +L+ ++   +  +++  NF  I   +        T     R + L+AFEHL   ELI  
Sbjct  349   CLLIAIKHHSSIYDRDPFNFEIIFGRFSKFAKVSTTMQGVERAIVLKAFEHLRIVELIMP  408

Query  973   VENRGHNQ-SIEFRPVQLLISLHELQQGLKSWGCCPV  1080
             + + G  +   EF   ++ ++  ++QQ ++ +   P 
Sbjct  409   LSSSGMGKVQKEFEMHKMALTYGQIQQAVQRYQALPT  445



>ref|XP_006140566.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Tupaia 
chinensis]
 ref|XP_006140567.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Tupaia 
chinensis]
Length=436

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 183/366 (50%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E    +  + LNGLL  +D  AL EITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSGNVLQVHLNGLLQINDKIALTEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L+         VIFVLDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKRGDRTSSCPVIFVLDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP  
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPA-  238

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
              G P K + + +N  + S+  D   +++++           L   L  AV ++      +
Sbjct  239   -GFPDKLFSEKWNENVQSLSEDRSVREVLQKHFNVSKNLRSLHMLLMLAVNRVSAAHPLM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLVEAHQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_006921113.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pteropus 
alecto]
 ref|XP_006921114.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Pteropus 
alecto]
 gb|ELK04597.1| Origin recognition complex subunit 4 [Pteropus alecto]
Length=436

 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIVGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  F++  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFILEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++     +     L   L  A+ ++     F+
Sbjct  240   F--PDKLFAEKWNENVQCLSEDISVREVLQKHFNINKNLRSLHMLLMLALNRITTSHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_002043133.1| GM11786 [Drosophila sechellia]
 gb|EDW49264.1| GM11786 [Drosophila sechellia]
Length=459

 Score =   160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 115/358 (32%), Positives = 178/358 (50%), Gaps = 38/358 (11%)
 Frame = +1

Query  7    NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            +NS+LL+GPRG GK  ++  VL      K F +   ++ L+G LH+DD  ALK IT Q+ 
Sbjct  49   SNSLLLIGPRGSGKTTLINSVLADLLPNKSFGENTLIVHLDGNLHTDDRVALKSITVQMQ  108

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLF-TQGKQRLLYSLLDAM  357
             E+        SF +N  FL+  L+  G   K V+F+L+EFDLF     Q LLY+L D  
Sbjct  109  LENAADGKVFGSFAENLAFLLQCLKSGGKNSKCVVFILEEFDLFCAHHNQTLLYNLFDVS  168

Query  358  QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK--EDLERILKHILLLPK-  528
            QS  +   V+GV+CRLD  +LLEKRV+SRFSHR++   P S+  E+   + K +L LP  
Sbjct  169  QSAQAPICVLGVTCRLDVIELLEKRVKSRFSHRQVFLFPSSQRFEEYVDLCKDLLSLPTG  228

Query  529  -------------------------------DFGLPTKYVDAFNTKLLSILSDDKFKDIV  615
                                           ++G   +  DA+N ++  +L+  + + I+
Sbjct  229  NSLLLAAERIYNLQNIQSGALYFSRNHFDSGEYGFSPRLRDAWNKQICKVLATQQARSIL  288

Query  616  ESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILEL  795
            +SL  +D +  +L  FLF  V  +   S  ++ +      S  +   K+E L   S+LEL
Sbjct  289  QSLHDFDISEAYLKNFLFRLVAHLRPLSPHITAEKMAAVGSQFEGDDKIELLCGLSVLEL  348

Query  796  YILVCLR-RLEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELI  966
             +++ ++   E  +++  NF  I   +        T     R + L+AFEHL   ELI
Sbjct  349  CLIIAIKHHSEIYDRDPFNFEIIYARFSKFAKVSTTMQAVERSIVLKAFEHLRIAELI  406



>ref|XP_005179312.1| PREDICTED: origin recognition complex subunit 4-like [Musca domestica]
Length=458

 Score =   160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 124/402 (31%), Positives = 193/402 (48%), Gaps = 47/402 (12%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS+LL+GPRG GK  ++  VL      K+F     ++ LNG LH+DD  ALK +T Q+ 
Sbjct  49    SNSMLLIGPRGSGKTTLVNAVLTDLMKNKDFIQNTLIVHLNGNLHTDDRLALKSVTVQMQ  108

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLF-TQGKQRLLYSLLDAM  357
              E+        SF +N  FL+A L+      K+V+F+LDEFDLF     Q LLY+L D  
Sbjct  109   LENATDGKVFGSFSENLAFLLACLKAGNKRSKSVVFILDEFDLFCAHHNQTLLYNLFDVS  168

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLP------------------PSK  483
             QS  +   V+GV+CRLD  +LLEKRV+SRFSHR++   P                  PS+
Sbjct  169   QSAQAPICVLGVTCRLDVIELLEKRVKSRFSHRQVFIFPNAEDFDEYVKLFAELLTIPSE  228

Query  484   EDLERI------LKHIL----------LLPKDFGLPTKYVDAFNTKLLSILSDDKFKDIV  615
             + L+ +      LKH+             P  +    KY++A+N  +  ++        +
Sbjct  229   KQLKELADRVGTLKHLQSSELTFHRSHFQPSKYKFSKKYMEAWNKHIAELIKTPSVVKSL  288

Query  616   ESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDNFRTALSNTQ------RQPKLECLKD  777
             ++L  +D +   L  F+F  VCQM      LS+    TA   TQ         K+E L  
Sbjct  289   QALFDFDVSQAFLKIFIFRLVCQMQTS---LSIAEQITAEQITQLTAIYEMDEKVELLCG  345

Query  778   CSILELYILVCLR-RLEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQ  954
              S+LEL +++ ++   E  +++  NF  I   +        T     R V L+AFEHL  
Sbjct  346   LSVLELCLIIAIKHHSEIYDRDPFNFEIIFSRFHKFAKVSSTMQGIERPVALKAFEHLRN  405

Query  955   RELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWGCCPV  1080
              E+I  +         EF   +++++  ++ Q ++ +   P 
Sbjct  406   MEIILPLTATTCKVQKEFEMHKMVLTYGQINQAVQRYQALPT  447



>ref|XP_005859344.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Myotis 
brandtii]
Length=436

 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     +++  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEDVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  F++  L++        VIF+LDEFDLF   + Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFILEALKKGDRTSSCPVIFILDEFDLFAHHRNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQMHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++       +   L   L  A+ ++     F+
Sbjct  240   F--PDKLFAEKWNENVQCLSEDKSVQEVLQKHFNISKSLRSLHMLLMLALSRVTTSHPFI  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPVERTSVNAQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_003907506.1| PREDICTED: origin recognition complex subunit 4 [Papio anubis]
 ref|XP_009180446.1| PREDICTED: origin recognition complex subunit 4 [Papio anubis]
 ref|XP_009180447.1| PREDICTED: origin recognition complex subunit 4 [Papio anubis]
 ref|XP_009180448.1| PREDICTED: origin recognition complex subunit 4 [Papio anubis]
 ref|XP_009180449.1| PREDICTED: origin recognition complex subunit 4 [Papio anubis]
Length=436

 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 186/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L   + ++     F+
Sbjct  240   F--PDKLFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLTLNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAIDLMEASQLCSMDSKANIVHGLSVLEVCLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_009441712.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Pan 
troglodytes]
Length=424

 Score =   159 bits (402),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 185/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  48    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  107

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  108   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  167

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  168   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  227

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   ++++            L   L  A+ ++     F+
Sbjct  228   F--PDKVFAEKWNENVQYLSEDRSVQEVLRKHFNISKNLRSLHMLLMLALNRVTASHPFM  285

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  286   TAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  345

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q E I  +E    N   E++ ++LL+   ++   L+ 
Sbjct  346   QRKAHSVYNFEKPVVMKAFEHLQQLEFIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  405

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  406   YPNCPT  411



>gb|ERL92166.1| hypothetical protein D910_09486 [Dendroctonus ponderosae]
Length=422

 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 113/368 (31%), Positives = 196/368 (53%), Gaps = 13/368 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLCSE  186
             +NS+LL+GP+G  +++ L   +   L+   D I +++L+GLLH+DD  ALK IT QL  +
Sbjct  45    SNSMLLIGPQG-AESSKLVNSVLKELEGLKDYI-IVELHGLLHTDDRLALKSITFQLNLD  102

Query  187   HQLVFSKMASFDDNSQFLIAMLRECGL-AHKTVIFVLDEFDLF-TQGKQRLLYSLLDAMQ  360
             + +      SF +N  FL+A LR  G  + K+VIF+L  FDLF     Q LLY+L D  Q
Sbjct  103   NAVDGKVFGSFAENLAFLLACLRTGGKESSKSVIFILQAFDLFCAHHNQTLLYNLFDISQ  162

Query  361   SVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKED------LERILKHILLL  522
             S  +   V+G++CR++  QLLEKRV+SRFSHR++     S+E       L+R+  ++ L 
Sbjct  163   SAQTPICVLGLTCRINVIQLLEKRVKSRFSHRQMFLYAGSEETSDLDFALDRMAWYLELP  222

Query  523   PK-DFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKS  699
             PK   G+ +K  DA+N  +  +L + KF+ + E +   + +   L   L   +  +    
Sbjct  223   PKCPVGITSKARDAWNLNVQELLKNKKFRAVTERMIGLELSEQILKNVLLKCLYSLTNTD  282

Query  700   GFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLR-RLEANEQETCNFNSIMKEYK  876
               L+++ F   L + ++   ++ L+D S LE+ ++V ++   +  +    NF  +   Y 
Sbjct  283   QLLTVNQFEKELESLEKDEMVQVLQDLSALEICLIVAMQHHSDIYDNSPMNFEMVYTRYV  342

Query  877   IVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQ-SIEFRPVQLLISLHELQQG  1053
                    +     R V ++AFEH+   ELI+ V  +G  +   E++  +LL++  ++ + 
Sbjct  343   KFAHKHSSMQNVQRPVVMKAFEHIEAIELIAMVNQQGSAKLQKEYQFFKLLVTPQQISEA  402

Query  1054  LKSWGCCP  1077
             +      P
Sbjct  403   IGKMQGLP  410



>ref|XP_010003894.1| PREDICTED: LOW QUALITY PROTEIN: origin recognition complex subunit 
4 [Chaetura pelagica]
Length=436

 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 190/364 (52%), Gaps = 10/364 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK A     L      K+  + +  I LNGLL ++D  ALKEITRQL 
Sbjct  64    SNSALIIGPRGSGKTALLNHVLKEITEKKQVRENLLEIHLNGLLQTNDKVALKEITRQLH  123

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        ++F+LDEFDLF   K Q LLY+L D 
Sbjct  124   LENVVGDKVFGSFAENLAFLLEALKKGNRTSSCPILFILDEFDLFVHHKNQTLLYNLFDI  183

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERILKHILLLPKDF  534
              QS  +   VIG++CR D  +LLEKRV+SRFSHR++  +  +  D ++ ++ I  LP +F
Sbjct  184   SQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRQIYLM--NSFDFKQYIR-IXELPAEF  240

Query  535   GLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSL  714
                  +   +N  +  +L D   +D++++L  +      L   L  AV  + +    L+ 
Sbjct  241   S-DVSFAQKWNKNVQYLLEDKTARDVLQNLFHFTKDLRSLHLLLMLAVSNVTVYHPLLTT  299

Query  715   DNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVHD  888
              + + A  + +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+ K +  
Sbjct  300   SDLQEASKHYRMDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEFQKFIQR  359

Query  889   SFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSWG  1068
                    + + V ++AFEHLLQ EL+  +E        E+  ++LL+  +++   L+ + 
Sbjct  360   KAHCMYNFEKPVVMKAFEHLLQLELVKPIERPTVRAQKEYLLMRLLLDNNQIMDALQVYP  419

Query  1069  CCPV  1080
              CP 
Sbjct  420   NCPT  423



>ref|XP_001159230.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pan 
troglodytes]
 ref|XP_001159285.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pan 
troglodytes]
 ref|XP_001159493.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pan 
troglodytes]
 ref|XP_009441711.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Pan 
troglodytes]
Length=436

 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 185/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   ++++            L   L  A+ ++     F+
Sbjct  240   F--PDKVFAEKWNENVQYLSEDRSVQEVLRKHFNISKNLRSLHMLLMLALNRVTASHPFM  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q E I  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLEFIKPMERTSGNSQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>ref|XP_005859343.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Myotis 
brandtii]
Length=458

 Score =   159 bits (403),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     +++  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  82    SNSVLIIGPRGSGKTMLINHALKELMEVEDVSENVLQVHLNGLLQINDKIALKEITRQLN  141

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  F++  L++        VIF+LDEFDLF   + Q LLY+L D 
Sbjct  142   LENVVGDKVFGSFAENLSFILEALKKGDRTSSCPVIFILDEFDLFAHHRNQTLLYNLFDI  201

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  202   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQMHLMNSFGFPQYLKIFKEQLSLPAE  261

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++       +   L   L  A+ ++     F+
Sbjct  262   F--PDKLFAEKWNENVQCLSEDKSVQEVLQKHFNISKSLRSLHMLLMLALSRVTTSHPFI  319

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  320   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  379

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ 
Sbjct  380   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPVERTSVNAQREYQLMKLLLDNTQIMNALQK  439

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  440   YPNCPT  445



>ref|XP_006086932.1| PREDICTED: origin recognition complex subunit 4 [Myotis lucifugus]
Length=458

 Score =   159 bits (403),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 188/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     +++  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  82    SNSVLIIGPRGSGKTMLINHALKELMEVEDVSENVLQVHLNGLLQINDKIALKEITRQLN  141

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  F++  L++        VIF+LDEFDLF   + Q LLY+L D 
Sbjct  142   LENVVGDKVFGSFAENLSFILEALKKGDRTSSCPVIFILDEFDLFAHHRNQTLLYNLFDI  201

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  202   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQMHLMNSFGFPQYLKIFKEQLSLPAE  261

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++       +   L   L  A+ ++     F+
Sbjct  262   F--PDKLFAEKWNENVQCLSEDKSVQEVLQKHFNVSKSLRSLHMLLMLALSRVTTSHPFI  319

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  320   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  379

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  VE    N   E++ ++LL+   ++   L+ 
Sbjct  380   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPVERTSVNAQREYQLMKLLLDNTQIMNALQK  439

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  440   YPNCPT  445



>ref|XP_009868984.1| PREDICTED: origin recognition complex subunit 4 [Apaloderma vittatum]
Length=436

 Score =   159 bits (402),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 116/365 (32%), Positives = 186/365 (51%), Gaps = 8/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK A     L     +K+  + I  ++LNGLL ++D  ALKEITRQL 
Sbjct  60    SNSALIIGPRGSGKTALLNRVLKELKEMKQVRENILEVRLNGLLQTNDKVALKEITRQLH  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  LR+        V+F+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAENLVFLLEALRKGDRNSSCPVLFILDEFDLFVHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CR D  +LLEKRV+SRFSHR++  +     +   RI K  L LP  
Sbjct  180   SQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRQIYLMNSFDFKQYIRIFKEQLSLPAA  239

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
             F     +   +N  +  +  D   ++++++L  Y      L   L  AV ++ +    ++
Sbjct  240   FP-DESFAQKWNNNVQHLSEDKTVQEVLQNLFHYTKDLRSLHLLLMLAVSKVTVHHSLIT  298

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +   A    +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+ K V 
Sbjct  299   ASDLHEASKQYRTDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEFQKFVQ  358

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                     + + V ++AFEHLLQ E +  +E        E+  ++LL+   ++   L+++
Sbjct  359   RKAHCMYNFEKPVVMKAFEHLLQLEFVKPIERPAVCTQREYLLMKLLLDNKQIMDALQAY  418

Query  1066  GCCPV  1080
               CP 
Sbjct  419   PNCPT  423



>ref|XP_006234214.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Rattus 
norvegicus]
 ref|XP_008759929.1| PREDICTED: origin recognition complex subunit 4 isoform X2 [Rattus 
norvegicus]
Length=441

 Score =   159 bits (402),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 192/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK--EFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS+L++GPRG GK  +L   L+ L++  +  + +  + LNGLL ++D  ALKEITRQL 
Sbjct  65    SNSLLIVGPRGSGKTTLLNHALKELMQIGDMSENVLQVHLNGLLQTNDKIALKEITRQLN  124

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF  Q  Q LLY+L D 
Sbjct  125   LENVVGDKVFGSFAENLSFLLEALQKGNRTSSCPVIFILDEFDLFAHQKNQTLLYNLFDI  184

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  185   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAE  244

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N     +  D    ++++     +     L   L  A+ ++ +   F+
Sbjct  245   F--PDKIFAEKWNENAHCLSEDSTVLEVLQKHFNVNKNLQSLHMLLMLALNRVTVTHPFM  302

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K +
Sbjct  303   TSADLMEAQHLCSLDAKASIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFI  362

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ V+LL+   ++   L+ 
Sbjct  363   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQK  422

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  423   YSNCPT  428



>ref|NP_954523.1| origin recognition complex subunit 4 [Rattus norvegicus]
 sp|Q6P9Z8.1|ORC4_RAT RecName: Full=Origin recognition complex subunit 4 [Rattus norvegicus]
 gb|AAH60516.1| Origin recognition complex, subunit 4-like (yeast) [Rattus norvegicus]
 gb|EDM00467.1| origin recognition complex, subunit 4-like (S. cerevisiae), isoform 
CRA_a [Rattus norvegicus]
 gb|EDM00468.1| origin recognition complex, subunit 4-like (S. cerevisiae), isoform 
CRA_a [Rattus norvegicus]
Length=434

 Score =   159 bits (401),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 192/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK--EFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS+L++GPRG GK  +L   L+ L++  +  + +  + LNGLL ++D  ALKEITRQL 
Sbjct  58    SNSLLIVGPRGSGKTTLLNHALKELMQIGDMSENVLQVHLNGLLQTNDKIALKEITRQLN  117

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF  Q  Q LLY+L D 
Sbjct  118   LENVVGDKVFGSFAENLSFLLEALQKGNRTSSCPVIFILDEFDLFAHQKNQTLLYNLFDI  177

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  178   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAE  237

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N     +  D    ++++     +     L   L  A+ ++ +   F+
Sbjct  238   F--PDKIFAEKWNENAHCLSEDSTVLEVLQKHFNVNKNLQSLHMLLMLALNRVTVTHPFM  295

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K +
Sbjct  296   TSADLMEAQHLCSLDAKASIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFI  355

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ V+LL+   ++   L+ 
Sbjct  356   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQK  415

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  416   YSNCPT  421



>ref|XP_006234212.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Rattus 
norvegicus]
 ref|XP_006234213.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Rattus 
norvegicus]
 ref|XP_008759926.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Rattus 
norvegicus]
 ref|XP_008759927.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Rattus 
norvegicus]
 ref|XP_008759928.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Rattus 
norvegicus]
Length=447

 Score =   159 bits (402),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 192/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK--EFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS+L++GPRG GK  +L   L+ L++  +  + +  + LNGLL ++D  ALKEITRQL 
Sbjct  71    SNSLLIVGPRGSGKTTLLNHALKELMQIGDMSENVLQVHLNGLLQTNDKIALKEITRQLN  130

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIF+LDEFDLF  Q  Q LLY+L D 
Sbjct  131   LENVVGDKVFGSFAENLSFLLEALQKGNRTSSCPVIFILDEFDLFAHQKNQTLLYNLFDI  190

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  191   SQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAE  250

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N     +  D    ++++     +     L   L  A+ ++ +   F+
Sbjct  251   F--PDKIFAEKWNENAHCLSEDSTVLEVLQKHFNVNKNLQSLHMLLMLALNRVTVTHPFM  308

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K +
Sbjct  309   TSADLMEAQHLCSLDAKASIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFI  368

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ V+LL+   ++   L+ 
Sbjct  369   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQK  428

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  429   YSNCPT  434



>ref|XP_001361211.1| GA15517 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL25789.1| GA15517 [Drosophila pseudoobscura pseudoobscura]
Length=456

 Score =   159 bits (402),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 117/398 (29%), Positives = 196/398 (49%), Gaps = 41/398 (10%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS+LL+GPRG GK  ++  VL    + + F D   ++ L+G LH+DD  ALK IT Q+ 
Sbjct  49    SNSLLLIGPRGAGKTTLINAVLTDLLVNRSFVDNTLIVHLDGNLHTDDRIALKSITVQMR  108

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLF-TQGKQRLLYSLLDAM  357
              E+        SF +N  FL+  L+      K+V+F+L+EFDLF T   Q LLY+L D  
Sbjct  109   LENAADGKVFGSFAENLAFLLQCLKAGDKKSKSVVFILEEFDLFCTHHNQTLLYNLFDVS  168

Query  358   QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLE---RILKHILLLPK  528
             QS  +   V+GV+CRLD  +LLEKRV+SRFSHR+ +FL PS +  E   ++ + +LL+P 
Sbjct  169   QSAQAPICVLGVTCRLDVIELLEKRVKSRFSHRQ-VFLFPSADQFEAYTKLCQELLLIPS  227

Query  529   --------------------------------DFGLPTKYVDAFNTKLLSILSDDKFKDI  612
                                             ++    K+V+ +N     +L   + +  
Sbjct  228   NSELKASADRIDSLHLLKSEALNFNRNHFDGVEYEFDNKFVENWNKHHAKMLKSSQAQKT  287

Query  613   VESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILE  792
              + L  +D +   L  F+F  V Q+   +  +++D      +  +   K++ L   S+LE
Sbjct  288   FQMLYDFDISEAFLKNFIFRLVAQLKPDAPHITVDQLTALSAQYEGDDKIDLLCGLSVLE  347

Query  793   LYILVCLR-RLEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELIS  969
             L +++ ++   E  +++  NF  +   +        T     R + L+AFEHL   ELI 
Sbjct  348   LCLIIAIKHHSEIYDRDPFNFEIVFARFSKFAKISTTMQSVERSIVLKAFEHLRIGELIM  407

Query  970   FVENRGHNQ-SIEFRPVQLLISLHELQQGLKSWGCCPV  1080
              + N G  +   EF   ++ ++  ++QQ ++ +   P 
Sbjct  408   PLSNSGVGKVQKEFEMHKMALTYGQIQQAVQRYQALPT  445



>ref|XP_008256776.1| PREDICTED: origin recognition complex subunit 4 isoform X1 [Oryctolagus 
cuniculus]
Length=537

 Score =   160 bits (405),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 192/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallK--EFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L+ L++  E  + I  + LNGLL  +D  ALKEITRQL 
Sbjct  161   SNSVLIIGPRGSGKTMLINHALKELMEIGEASENILQVHLNGLLQINDKIALKEITRQLN  220

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++    +   VIF+LDEFDLF   K Q LLY+L D 
Sbjct  221   LENAVGDKVFGSFAENLSFLLEALKKGDRTNSCPVIFILDEFDLFAHHKNQTLLYNLFDI  280

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              Q+  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  281   SQTAQTPVSVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAE  340

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  341   F--PDKVFAEKWNENVQCLSEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRVTASHPFV  398

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K +
Sbjct  399   TPADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFI  458

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  459   QRKAHSVYNFEKPVVMKAFEHLQQLELIKPIERTSVNSQREYQLMKLLLDNTQIMNALQK  518

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  519   YPNCPT  524



>ref|XP_007061850.1| PREDICTED: origin recognition complex subunit 4 [Chelonia mydas]
Length=436

 Score =   159 bits (401),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 118/367 (32%), Positives = 191/367 (52%), Gaps = 12/367 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS L++GPRG GK       L     +K+  + +  + LNGLL ++D  ALKEITRQL 
Sbjct  60    SNSALIIGPRGSGKTMLLNHVLKELMEVKQVRENLLQVHLNGLLQTNDKIALKEITRQLQ  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        V+F+LDEFDLF   K Q LLY+L D 
Sbjct  120   MENVVGDKVFGSFAENLAFLLEALKKGDRDSSCPVLFILDEFDLFVHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK-EDLERILKHILLLPKD  531
              QS  +   VIG++CR D  +LLEKRV+SRFSHR++  L     +   +I K  L LP +
Sbjct  180   SQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRQIYLLNSFDFKQYLKIFKEQLYLPAE  239

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVES--LCTYDSTFNHLLRFLFSAVCQMDMKSGF  705
             F L   +   +N  + S+  D   +D++ +   C+ D    H+L  L  A+  + +   F
Sbjct  240   F-LYKPFTQKWNKNVQSLSEDRTVQDVLRNHFHCSKDLRSLHMLLML--ALSSITVSHPF  296

Query  706   LSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KI  879
             ++  +   A    +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E+ K 
Sbjct  297   MTGSDLLEASKLCRMDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNEFQKF  356

Query  880   VHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLK  1059
             +     +   + + V ++AFEHLLQ ELI  +E        E+  ++LL+  +++   L+
Sbjct  357   IQRKAHSMYNFEKPVVMKAFEHLLQLELIKPIEGLSVRAQREYLLMKLLLDNNQIMDALQ  416

Query  1060  SWGCCPV  1080
              +  CP 
Sbjct  417   VYPNCPT  423



>ref|XP_005807425.1| PREDICTED: origin recognition complex subunit 4-like [Xiphophorus 
maculatus]
Length=434

 Score =   159 bits (401),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 124/370 (34%), Positives = 197/370 (53%), Gaps = 18/370 (5%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISVIK--LNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  +L  VL  L +E     ++++  LNGLL +DD  ALKEITRQL 
Sbjct  60    SNSVLIVGPRGSGKTMLLRSVLRELSQETEVQKNLLQVHLNGLLQTDDRIALKEITRQLQ  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAH-KTVIFVLDEFDLFT-QGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L++   +  + V+FVLDEFDLF     Q LLY+L D 
Sbjct  120   LENVVGDRVFGSFAENLTFLLDALKKGDRSSSRPVLFVLDEFDLFACHKNQTLLYNLFDV  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLP--PSKEDLERILKHILLLPK  528
              QS  +   V+G++CRLD  +LLEKRV+SRFSHR++  L      + LER+ +  L LP 
Sbjct  180   AQSAQAPVAVVGLTCRLDVLELLEKRVKSRFSHRQIHLLSKLTFPQYLERV-RDQLSLPD  238

Query  529   DFGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             DF L  K+   +N  + ++  D   +++++      + F  L   L   + ++ +    +
Sbjct  239   DF-LDGKFAQEWNAAVTTLCEDRSAEEVLQRHFNSSTDFRSLHTLLMLCLSRVSVARPSI  297

Query  709   S----LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY  873
             +    LD  R  L++         L   SILEL +++ ++ L +  E E  N   +  E+
Sbjct  298   TPADLLDASRLCLADA----NANMLHGLSILELCLIIAMKHLNDVYEGEPFNLQMVHNEF  353

Query  874   KIVHDSFKTSDY-YARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQ  1050
             K        S Y + + V ++AFEHL Q ELI   +        EF+ ++L++   ++ +
Sbjct  354   KKFLQRKSNSMYNFEQPVIMKAFEHLQQLELIRPADGASAKTQREFQLMRLMLDHGQIME  413

Query  1051  GLKSWGCCPV  1080
              L+ +  CP 
Sbjct  414   ALQKYPQCPT  423



>gb|EFB29484.1| hypothetical protein PANDA_012343 [Ailuropoda melanoleuca]
Length=425

 Score =   158 bits (400),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 189/366 (52%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavl--elvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  49    SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  108

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF ++  FL+  L+    +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  109   LENVVGDKVFGSFAESLSFLLEALKRGDRSSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  168

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  169   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  228

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  229   F--PDKIFTEKWNENVQCLTEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRITTSHPFV  286

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  287   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  346

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  347   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNTQREYQLMKLLLDNTQIMNALQK  406

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  407   YPNCPT  412



>ref|XP_009976777.1| PREDICTED: origin recognition complex subunit 4 [Tauraco erythrolophus]
Length=441

 Score =   159 bits (401),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 125/371 (34%), Positives = 193/371 (52%), Gaps = 20/371 (5%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISV------IKLNGLLHSDDNCALKEIT  168
             +NS L++GPRG GK A+L  VL    KE  +M  V      + LNGLL ++D  ALKEIT
Sbjct  65    SNSALVIGPRGSGKTALLNHVL----KELREMKQVRGNLLEVHLNGLLQTNDKVALKEIT  120

Query  169   RQLCSEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYS  342
             RQL  E+ +      SF +N  FL+  LR+        V+F+LDEFDLF   K Q LLY+
Sbjct  121   RQLNLENVVGDKVFGSFAENLTFLLEALRKGNRTSSCPVLFILDEFDLFVHHKNQTLLYN  180

Query  343   LLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLE--RILKHIL  516
             L D  QS  +   VIG++CR D  +LLEKRV+SRFSHR+ I+L  S +  +  RI K  L
Sbjct  181   LFDISQSAQTPVTVIGLTCRQDILELLEKRVKSRFSHRQ-IYLMNSFDFRQYIRIFKEQL  239

Query  517   LLPKDFGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDM  693
              LP +F  P + +   +N  +  +  D   +D++++L  Y      L   L   V  + +
Sbjct  240   SLPAEF--PDECFAQKWNNNVQRLSEDKSVQDVLQNLFHYTKDLRTLHLLLMLGVSNVTV  297

Query  694   KSGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKE  870
                 ++  +   A    +   K   +   S+LE+ +++ ++ L +  E E  NF  +  E
Sbjct  298   HHPLITASDLHEASKQYRTDSKANIVHGLSVLEICLIIAMKHLNDVYEGEPFNFQMVYNE  357

Query  871   Y-KIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQ  1047
             + K +         + + V ++AFEHLLQ EL+  VE        E+  ++LL+  +++ 
Sbjct  358   FQKFIQRKAHCMYNFEKPVVMKAFEHLLQLELVKPVERPSVCVQREYVLMKLLLDNNQIM  417

Query  1048  QGLKSWGCCPV  1080
               L+ +  CP 
Sbjct  418   DALQVYPNCPT  428



>ref|XP_002923238.1| PREDICTED: origin recognition complex subunit 4-like [Ailuropoda 
melanoleuca]
Length=436

 Score =   158 bits (400),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 187/366 (51%), Gaps = 10/366 (3%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNa--vlelvleallKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK       L     ++E  + +  + LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKELMEVEEVSENVLQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF ++  FL+  L+    +    VIF+LDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVGDKVFGSFAESLSFLLEALKRGDRSSSCPVIFILDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPLAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYLKIFKEQLSLPAE  239

Query  532   FGLPTK-YVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFL  708
             F  P K + + +N  +  +  D   +++++           L   L  A+ ++     F+
Sbjct  240   F--PDKIFTEKWNENVQCLTEDRSVREVLQKHFNVSKNLRSLHMLLMLALNRITTSHPFV  297

Query  709   SLDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIV  882
             +  +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V
Sbjct  298   TAADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFV  357

Query  883   HDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKS  1062
                  +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ 
Sbjct  358   QRKAHSVYNFEKPVVMKAFEHLQQLELIRPMERTSVNTQREYQLMKLLLDNTQIMNALQK  417

Query  1063  WGCCPV  1080
             +  CP 
Sbjct  418   YPNCPT  423



>gb|KDR12067.1| Origin recognition complex subunit 4 [Zootermopsis nevadensis]
Length=434

 Score =   158 bits (400),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 114/372 (31%), Positives = 197/372 (53%), Gaps = 14/372 (4%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKE--FPDMISVIKLNGLLHSDDNCALKEITRQLC  180
             +NS LL+GPRGCGK A+L  V+  L  E  F +   V++LNGL+H+DD  ALK+ TRQ+ 
Sbjct  52    SNSALLIGPRGCGKTALLNSVINELKNEKSFHEKAFVVELNGLMHTDDRLALKDATRQMQ  111

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAH-KTVIFVLDEFDLF-TQGKQRLLYSLLDA  354
              E+ +      SF +N  FL+  L+       K++IF+LDEFDLF     Q LLY+L + 
Sbjct  112   LENAVGNKVFGSFAENLTFLLQCLKSGNKDRSKSIIFILDEFDLFCNHHNQTLLYNLFNV  171

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSKEDLERI-------LKHI  513
              QS  +   V+G++CRLD  +LLEKRV+SRFSHR++   P + +  + +       LK++
Sbjct  172   AQSAQAPICVVGLTCRLDVMELLEKRVKSRFSHRQIFIFPDTCQKEQSVFEVRMALLKNL  231

Query  514   LLLPKDFGLPTKYVDAF--NTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQM  687
             L+L +D       V ++  N  +  + +++  ++++ ++   D++   L  FL   + ++
Sbjct  232   LILSEDDVCVDDAVFSYCWNCHVEDLCTEEPVQNVMRTILNLDNSERTLRSFLLVVISRL  291

Query  688   DMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILELYILVCLR-RLEANEQETCNFNSIM  864
                   L+ ++F        R  K+  ++  S+LEL +++ ++ + E  E E  NF  + 
Sbjct  292   SDTHPTLTAEDFLQVHKLWSRDAKVAMVEGLSVLELCLIIAMKHQTEIYEGEPLNFEMVY  351

Query  865   KEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHEL  1044
             + Y        T     R V L+AFEHL   EL+  +     +   EF+  + +++  ++
Sbjct  352   RRYCKFLSQNSTVQNVERPVVLKAFEHLESLELVVPIGGPSIHILKEFQLHRFVLTSQQV  411

Query  1045  QQGLKSWGCCPV  1080
                +K +   P 
Sbjct  412   SDAVKRYQGLPT  423



>ref|XP_007522293.1| PREDICTED: origin recognition complex subunit 4 [Erinaceus europaeus]
Length=436

 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 115/365 (32%), Positives = 191/365 (52%), Gaps = 8/365 (2%)
 Frame = +1

Query  7     NNSVLLLGPRGCGKNavlelvleallKEFPDMISVIK--LNGLLHSDDNCALKEITRQLC  180
             +NSVL++GPRG GK  ++   L+ +++      ++++  LNGLL  +D  ALKEITRQL 
Sbjct  60    SNSVLIIGPRGSGKTMLINHALKEVMEVEEVSENILQVHLNGLLQINDKIALKEITRQLN  119

Query  181   SEHQLVFSKMASFDDNSQFLIAMLRECGLAHK-TVIFVLDEFDLFTQGK-QRLLYSLLDA  354
              E+ +      SF +N  FL+  L++        VIFVLDEFDLF   K Q LLY+L D 
Sbjct  120   LENVVEDKVFGSFAENLSFLLEALKKGDRTSSCPVIFVLDEFDLFAHHKNQTLLYNLFDI  179

Query  355   MQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPP-SKEDLERILKHILLLPKD  531
              QS  +   VIG++CRLD  +LLEKRV+SRFSHR++  +         +I K  L LP +
Sbjct  180   SQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYIKIFKEQLSLPAE  239

Query  532   FGLPTKYVDAFNTKLLSILSDDKFKDIVESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLS  711
             F     + + +N ++  +  D   +++++       +   L   L  A+ ++     F++
Sbjct  240   FSNKI-FAEKWNHQVQCLSEDGSVREVLQKHFNASKSLRSLHMLLMLALNRVTSSHPFIT  298

Query  712   LDNFRTALSNTQRQPKLECLKDCSILELYILVCLRRL-EANEQETCNFNSIMKEY-KIVH  885
               +   A        K   +   S+LE+ +++ ++ L +  E+E  NF  +  E+ K V 
Sbjct  299   AADLMEANQLCSMDSKANIVHGLSVLEICLIIAMKHLNDVYEEEPFNFQMVYNEFQKFVQ  358

Query  886   DSFKTSDYYARDVCLRAFEHLLQRELISFVENRGHNQSIEFRPVQLLISLHELQQGLKSW  1065
                 +   + + V ++AFEHL Q ELI  +E    N   E++ ++LL+   ++   L+ +
Sbjct  359   RKAHSVYNFEKPVVMKAFEHLQQLELIRPLERTSVNAQREYQLMKLLLDNTQIMNALQKY  418

Query  1066  GCCPV  1080
               CP 
Sbjct  419   PNCPT  423



>ref|NP_477320.1| origin recognition complex subunit 4 [Drosophila melanogaster]
 gb|AAF47276.1| origin recognition complex subunit 4 [Drosophila melanogaster]
 gb|AAO45224.1| LD43280p [Drosophila melanogaster]
 gb|ACL85737.1| Orc4-PA, partial [synthetic construct]
 gb|ACL90547.1| Orc4-PA [synthetic construct]
Length=459

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/358 (32%), Positives = 179/358 (50%), Gaps = 38/358 (11%)
 Frame = +1

Query  7    NNSVLLLGPRGCGKNavlelvle--allKEFPDMISVIKLNGLLHSDDNCALKEITRQLC  180
            +NS+LLLGPRG GK  ++  VL      K F +   ++ L+G LH+DD  ALK IT Q+ 
Sbjct  49   SNSLLLLGPRGSGKTTLINSVLADLLPNKSFGENTLIVHLDGNLHTDDRVALKSITVQMQ  108

Query  181  SEHQLVFSKMASFDDNSQFLIAMLRECGLAHKTVIFVLDEFDLF-TQGKQRLLYSLLDAM  357
             E+        SF +N  FL+  L+  G   K+VIF+L+EFDLF     Q LLY+L D  
Sbjct  109  LENAADGKVFGSFAENLAFLLQCLKAGGKHSKSVIFILEEFDLFCAHHNQTLLYNLFDVS  168

Query  358  QSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLIFLPPSK--EDLERILKHILLLPK-  528
            QS  +   V+GV+CRLD  +LLEKRV+SRFSHR++   P  +  ED   + + +L LP  
Sbjct  169  QSAQAPICVLGVTCRLDVIELLEKRVKSRFSHRQVFLFPSLRRFEDYVDLCRDLLSLPTG  228

Query  529  -------------------------------DFGLPTKYVDAFNTKLLSILSDDKFKDIV  615
                                           ++G   +  DA+N ++  +L+  + +  +
Sbjct  229  NSLLLAAEKIYNLQNIQSGALYFSRNHFDPGEYGFSPRLRDAWNKQICKVLATQQARSTL  288

Query  616  ESLCTYDSTFNHLLRFLFSAVCQMDMKSGFLSLDNFRTALSNTQRQPKLECLKDCSILEL  795
            ++L  +D +  +L  FLF  V  +  +S  ++ +      S  +   K+E L   S+LEL
Sbjct  289  QALHDFDISEAYLKNFLFRLVAHLRPQSPHITAEKMAAVGSQFEGDDKIELLCGLSVLEL  348

Query  796  YILVCLR-RLEANEQETCNFNSIMKEYKIVHDSFKTSDYYARDVCLRAFEHLLQRELI  966
             +++ ++   +  ++++ NF  I   +        T     R + L+AFEHL   ELI
Sbjct  349  CLIIAIKHHSQIYDRDSFNFEIIYARFSKFAKVSTTMQAVERSIVLKAFEHLRIAELI  406



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3500367830012