BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c95642_g1_i1 len=477 path=[1:0-476]

Length=477
                                                                      Score     E

ref|XP_011092632.1|  PREDICTED: uncharacterized protein LOC105172754    172   3e-47   
ref|XP_004229552.1|  PREDICTED: uncharacterized protein LOC101265960    166   2e-45   
ref|XP_006359130.1|  PREDICTED: uncharacterized protein LOC102589484    162   5e-44   
ref|XP_009615972.1|  PREDICTED: uncharacterized protein LOC104108601    162   1e-43   
gb|KDP32272.1|  hypothetical protein JCGZ_13197                         162   1e-43   
ref|XP_006364462.1|  PREDICTED: uncharacterized protein LOC102578745    160   3e-43   
ref|XP_011086788.1|  PREDICTED: uncharacterized protein LOC105168414    160   4e-43   
ref|XP_011009639.1|  PREDICTED: uncharacterized protein LOC105114698    160   5e-43   
ref|XP_011008815.1|  PREDICTED: uncharacterized protein LOC105114095    160   5e-43   
ref|XP_004245944.2|  PREDICTED: uncharacterized protein LOC101257692    160   6e-43   
ref|XP_006341329.1|  PREDICTED: uncharacterized protein LOC102584466    160   6e-43   
ref|XP_009793524.1|  PREDICTED: uncharacterized protein LOC104240380    160   6e-43   
emb|CDX79771.1|  BnaA05g03850D                                          155   1e-42   
ref|XP_010508320.1|  PREDICTED: uncharacterized protein LOC104784914    159   1e-42   
ref|XP_004248824.1|  PREDICTED: uncharacterized protein LOC101253331    158   3e-42   
ref|XP_010030212.1|  PREDICTED: uncharacterized protein LOC104420...    159   3e-42   
ref|XP_002523580.1|  conserved hypothetical protein                     158   3e-42   Ricinus communis
ref|XP_010030210.1|  PREDICTED: uncharacterized protein LOC104420...    159   3e-42   
ref|XP_009797417.1|  PREDICTED: uncharacterized protein LOC104243...    157   5e-42   
gb|EYU37528.1|  hypothetical protein MIMGU_mgv1a003548mg                157   6e-42   
ref|XP_009596811.1|  PREDICTED: uncharacterized protein LOC104092840    157   7e-42   
ref|XP_010518017.1|  PREDICTED: uncharacterized protein LOC104793362    157   7e-42   
emb|CDP14941.1|  unnamed protein product                                156   9e-42   
ref|XP_006293958.1|  hypothetical protein CARUB_v10022948mg             156   1e-41   
emb|CDP07655.1|  unnamed protein product                                156   1e-41   
ref|XP_006379002.1|  hypothetical protein POPTR_0009s03000g             156   1e-41   
ref|XP_009143004.1|  PREDICTED: uncharacterized protein LOC103866778    156   1e-41   
ref|NP_030961.1|  uncharacterized protein                               155   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397602.1|  hypothetical protein EUTSA_v10001390mg             155   2e-41   
ref|XP_009776767.1|  PREDICTED: uncharacterized protein LOC104226450    155   2e-41   
gb|KDO46021.1|  hypothetical protein CISIN_1g008353mg                   155   3e-41   
ref|XP_006482794.1|  PREDICTED: uncharacterized protein LOC102620179    155   3e-41   
ref|XP_011041980.1|  PREDICTED: uncharacterized protein LOC105137797    155   3e-41   
gb|EYU27168.1|  hypothetical protein MIMGU_mgv1a019297mg                154   6e-41   
gb|KFK37236.1|  hypothetical protein AALP_AA4G231600                    153   1e-40   
ref|XP_009589347.1|  PREDICTED: uncharacterized protein LOC104086727    153   1e-40   
ref|XP_006438992.1|  hypothetical protein CICLE_v10031170mg             153   1e-40   
emb|CDP14942.1|  unnamed protein product                                153   1e-40   
ref|XP_010506336.1|  PREDICTED: uncharacterized protein LOC104782963    152   2e-40   
emb|CDY17873.1|  BnaC04g03460D                                          149   4e-40   
gb|KCW71746.1|  hypothetical protein EUGRSUZ_E00249                     152   4e-40   
ref|XP_010055279.1|  PREDICTED: uncharacterized protein LOC104443...    152   4e-40   
ref|XP_007022584.1|  Uncharacterized protein TCM_033363                 152   4e-40   
ref|XP_007201170.1|  hypothetical protein PRUPE_ppa003618mg             152   5e-40   
ref|XP_010544519.1|  PREDICTED: uncharacterized protein LOC104817144    151   8e-40   
ref|XP_010659612.1|  PREDICTED: uncharacterized protein LOC100242...    151   8e-40   
ref|XP_002269745.2|  PREDICTED: uncharacterized protein LOC100242...    151   8e-40   Vitis vinifera
ref|XP_010053627.1|  PREDICTED: uncharacterized protein LOC104442037    151   8e-40   
emb|CDP20933.1|  unnamed protein product                                150   9e-40   
ref|XP_010934618.1|  PREDICTED: uncharacterized protein LOC105054732    150   1e-39   
ref|XP_002325025.1|  hypothetical protein POPTR_0018s09440g             150   2e-39   Populus trichocarpa [western balsam poplar]
emb|CDP14946.1|  unnamed protein product                                149   3e-39   
ref|XP_004303088.1|  PREDICTED: uncharacterized protein LOC101300074    149   3e-39   
ref|XP_010099772.1|  hypothetical protein L484_010959                   149   5e-39   
ref|XP_011007114.1|  PREDICTED: uncharacterized protein LOC105112912    148   8e-39   
ref|XP_004488551.1|  PREDICTED: uncharacterized protein LOC101507229    147   2e-38   
gb|KEH38307.1|  DUF946 family protein                                   147   2e-38   
ref|XP_008235570.1|  PREDICTED: uncharacterized protein LOC103334389    147   3e-38   
ref|XP_006858981.1|  hypothetical protein AMTR_s00068p00125530          147   3e-38   
ref|XP_007218959.1|  hypothetical protein PRUPE_ppa003559mg             144   3e-37   
ref|XP_008231390.1|  PREDICTED: uncharacterized protein LOC103330573    144   4e-37   
ref|XP_010111946.1|  hypothetical protein L484_004609                   143   4e-37   
ref|XP_010276359.1|  PREDICTED: uncharacterized protein LOC104611127    143   5e-37   
emb|CDX83433.1|  BnaA03g20730D                                          143   6e-37   
ref|XP_010923372.1|  PREDICTED: uncharacterized protein LOC105046482    140   3e-36   
ref|XP_003546829.1|  PREDICTED: uncharacterized protein LOC100806731    140   4e-36   
emb|CDX95597.1|  BnaC03g24780D                                          140   6e-36   
ref|XP_007149124.1|  hypothetical protein PHAVU_005G043000g             140   7e-36   
ref|XP_009142253.1|  PREDICTED: uncharacterized protein LOC103866129    140   8e-36   
gb|KHN21339.1|  hypothetical protein glysoja_026540                     139   1e-35   
ref|XP_006585381.1|  PREDICTED: uncharacterized protein LOC100783235    139   2e-35   
ref|NP_030964.1|  uncharacterized protein                               138   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003532908.1|  PREDICTED: uncharacterized protein LOC100792266    138   3e-35   
gb|KHN49063.1|  hypothetical protein glysoja_031274                     138   3e-35   
ref|XP_010506342.1|  PREDICTED: uncharacterized protein LOC104782970    138   3e-35   
ref|XP_003548708.2|  PREDICTED: uncharacterized protein LOC100808166    138   4e-35   
ref|XP_006598236.1|  PREDICTED: uncharacterized protein LOC102669203    137   7e-35   
ref|XP_008813096.1|  PREDICTED: uncharacterized protein LOC103723822    136   1e-34   
ref|XP_006295574.1|  hypothetical protein CARUB_v10024679mg             136   2e-34   
ref|XP_010512857.1|  PREDICTED: uncharacterized protein LOC104788773    136   2e-34   
gb|KHM99442.1|  hypothetical protein glysoja_045356                     136   2e-34   
ref|XP_006397604.1|  hypothetical protein EUTSA_v10001386mg             135   2e-34   
ref|XP_010518022.1|  PREDICTED: uncharacterized protein LOC104793366    135   4e-34   
ref|XP_010055277.1|  PREDICTED: uncharacterized protein LOC104443...    135   4e-34   
emb|CBI18663.3|  unnamed protein product                                134   4e-34   
ref|XP_010055278.1|  PREDICTED: uncharacterized protein LOC104443...    135   4e-34   
ref|XP_006585380.1|  PREDICTED: uncharacterized protein LOC100783773    135   5e-34   
gb|AES66093.2|  DUF946 family protein                                   134   6e-34   
ref|XP_003595842.1|  hypothetical protein MTR_2g062430                  134   8e-34   
gb|ABN08110.1|  Protein of unknown function DUF946, plant               133   2e-33   Medicago truncatula
emb|CAN82512.1|  hypothetical protein VITISV_002153                     135   2e-33   Vitis vinifera
ref|XP_003595840.1|  hypothetical protein MTR_2g062410                  133   2e-33   
gb|KHN21340.1|  hypothetical protein glysoja_026541                     132   3e-33   
ref|XP_009385974.1|  PREDICTED: uncharacterized protein LOC103973198    132   4e-33   
gb|KHG05345.1|  Vacuolar sorting-associated protein 62                  132   5e-33   
ref|XP_007156321.1|  hypothetical protein PHAVU_003G276600g             130   1e-32   
gb|KDP32271.1|  hypothetical protein JCGZ_13196                         129   3e-32   
ref|NP_186837.1|  uncharacterized protein                               130   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003610391.1|  hypothetical protein MTR_4g131710                  129   7e-32   
ref|XP_009354799.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    129   1e-31   
emb|CDY23425.1|  BnaC04g49530D                                          128   1e-31   
ref|XP_002880097.1|  hypothetical protein ARALYDRAFT_483546             128   1e-31   
ref|XP_008375114.1|  PREDICTED: uncharacterized protein LOC103438346    128   2e-31   
ref|XP_009385972.1|  PREDICTED: uncharacterized protein LOC103973196    127   2e-31   
ref|XP_006369488.1|  hypothetical protein POPTR_0001s23900g             127   2e-31   
ref|XP_010675110.1|  PREDICTED: uncharacterized protein LOC104891...    127   3e-31   
ref|XP_002884254.1|  hypothetical protein ARALYDRAFT_340259             127   3e-31   
ref|XP_010675108.1|  PREDICTED: uncharacterized protein LOC104891...    127   3e-31   
ref|XP_006483670.1|  PREDICTED: uncharacterized protein LOC102607172    127   4e-31   
emb|CDY30462.1|  BnaA04g25630D                                          126   9e-31   
ref|XP_003545952.1|  PREDICTED: uncharacterized protein LOC100820073    126   1e-30   
ref|XP_009124050.1|  PREDICTED: uncharacterized protein LOC103848966    126   1e-30   
ref|XP_009354660.1|  PREDICTED: uncharacterized protein LOC103945804    125   1e-30   
gb|KHN49064.1|  hypothetical protein glysoja_031275                     125   1e-30   
ref|XP_007149177.1|  hypothetical protein PHAVU_005G047900g             125   2e-30   
ref|NP_850414.1|  uncharacterized protein                               125   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658730.1|  PREDICTED: uncharacterized protein LOC102705931    124   4e-30   
ref|XP_010496430.1|  PREDICTED: uncharacterized protein LOC104773501    124   4e-30   
ref|XP_009134576.1|  PREDICTED: uncharacterized protein LOC103858883    123   8e-30   
ref|XP_004958121.1|  PREDICTED: uncharacterized protein LOC101758191    122   1e-29   
ref|XP_008461747.1|  PREDICTED: uncharacterized protein LOC103500279    122   2e-29   
dbj|BAJ94819.1|  predicted protein                                      121   3e-29   
ref|XP_004151268.1|  PREDICTED: uncharacterized protein LOC101218337    121   3e-29   
ref|XP_004161418.1|  PREDICTED: uncharacterized protein LOC101228858    121   3e-29   
gb|KGN58638.1|  hypothetical protein Csa_3G708680                       121   3e-29   
gb|EMT10845.1|  hypothetical protein F775_21218                         119   4e-29   
ref|XP_003595833.1|  hypothetical protein MTR_2g062340                  120   4e-29   
ref|XP_010485351.1|  PREDICTED: uncharacterized protein LOC104763704    121   4e-29   
emb|CDX74324.1|  BnaA03g27230D                                          121   6e-29   
ref|XP_009388451.1|  PREDICTED: uncharacterized protein LOC103975261    120   8e-29   
gb|EPS59601.1|  hypothetical protein M569_15204                         120   9e-29   
ref|XP_006408555.1|  hypothetical protein EUTSA_v10020344mg             120   1e-28   
ref|XP_008461748.1|  PREDICTED: uncharacterized protein LOC103500280    120   1e-28   
gb|AAF14848.1|AC011664_30  hypothetical protein, 5' partial             120   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008804360.1|  PREDICTED: uncharacterized protein LOC103717662    119   2e-28   
ref|NP_186836.1|  uncharacterized protein                               120   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004172675.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    119   2e-28   
ref|XP_004151267.1|  PREDICTED: uncharacterized protein LOC101218097    119   2e-28   
ref|XP_002884255.1|  hypothetical protein ARALYDRAFT_896056             119   3e-28   
gb|EMS61200.1|  hypothetical protein TRIUR3_15102                       117   3e-28   
ref|XP_002460910.1|  hypothetical protein SORBIDRAFT_02g037340          118   5e-28   Sorghum bicolor [broomcorn]
ref|XP_006395185.1|  hypothetical protein EUTSA_v10005422mg             117   1e-27   
ref|XP_004958115.1|  PREDICTED: vacuolar protein sorting-associat...    116   2e-27   
gb|KFK37645.1|  hypothetical protein AALP_AA3G010100                    117   4e-27   
tpg|DAA63291.1|  TPA: hypothetical protein ZEAMMB73_737791              115   5e-27   
ref|NP_001145101.1|  uncharacterized protein LOC100278316               115   5e-27   Zea mays [maize]
ref|XP_010236503.1|  PREDICTED: uncharacterized protein LOC104584083    114   1e-26   
gb|EEE67462.1|  hypothetical protein OsJ_24853                          112   4e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82315.1|  hypothetical protein OsI_26592                          112   7e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_007149125.1|  hypothetical protein PHAVU_005G043100g             112   1e-25   
emb|CDX85337.1|  BnaC07g26480D                                          110   1e-24   
gb|AES66087.2|  DUF946 family protein                                   109   1e-24   
ref|XP_010435678.1|  PREDICTED: uncharacterized protein LOC104719438    105   5e-24   
ref|XP_010675107.1|  PREDICTED: uncharacterized protein LOC104891...    107   6e-24   
ref|XP_010485352.1|  PREDICTED: uncharacterized protein LOC104763705    106   1e-23   
emb|CDY14902.1|  BnaA02g22440D                                          106   1e-23   
emb|CDX96930.1|  BnaC02g30680D                                          105   3e-23   
ref|XP_002880101.1|  hypothetical protein ARALYDRAFT_483550             104   6e-23   
ref|XP_004963802.1|  PREDICTED: uncharacterized protein LOC101761210    105   6e-23   
ref|XP_010496432.1|  PREDICTED: uncharacterized protein LOC104773502    104   6e-23   
ref|XP_009111945.1|  PREDICTED: uncharacterized protein LOC103837336    104   7e-23   
emb|CDY19950.1|  BnaA09g03010D                                          104   8e-23   
emb|CDX86305.1|  BnaA06g30220D                                          103   8e-23   
ref|XP_006299211.1|  hypothetical protein CARUB_v10015358mg             103   1e-22   
emb|CDY00059.1|  BnaC09g02420D                                          103   1e-22   
gb|EYU40301.1|  hypothetical protein MIMGU_mgv1a018219mg                102   1e-22   
ref|XP_010684871.1|  PREDICTED: uncharacterized protein LOC104899394    103   1e-22   
ref|XP_010918943.1|  PREDICTED: uncharacterized protein LOC105043187    102   2e-22   
ref|XP_009395601.1|  PREDICTED: uncharacterized protein LOC103980787    102   3e-22   
ref|XP_009123923.1|  PREDICTED: uncharacterized protein LOC103848849    102   4e-22   
emb|CAN77840.1|  hypothetical protein VITISV_015561                     101   9e-22   Vitis vinifera
ref|XP_007143957.1|  hypothetical protein PHAVU_007G116800g             100   1e-21   
ref|XP_004155688.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   2e-21   
ref|XP_004142542.1|  PREDICTED: uncharacterized protein LOC101216081    100   2e-21   
ref|XP_002873898.1|  hypothetical protein ARALYDRAFT_909860             100   2e-21   
ref|XP_003595837.1|  hypothetical protein MTR_2g062380                  100   2e-21   
emb|CBI37192.3|  unnamed protein product                                100   2e-21   
ref|XP_002272156.1|  PREDICTED: uncharacterized protein LOC100259944    100   2e-21   Vitis vinifera
ref|XP_008443774.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.8    3e-21   
gb|KDO60351.1|  hypothetical protein CISIN_1g045952mg                 99.8    3e-21   
ref|XP_006443731.1|  hypothetical protein CICLE_v10019502mg           99.8    4e-21   
ref|XP_010691350.1|  PREDICTED: uncharacterized protein LOC104904...  99.4    5e-21   
gb|KHN14825.1|  hypothetical protein glysoja_020998                   99.4    5e-21   
ref|XP_003536134.1|  PREDICTED: uncharacterized protein LOC100788778  99.0    5e-21   
ref|XP_003556481.1|  PREDICTED: uncharacterized protein LOC100814522  98.6    7e-21   
ref|XP_009120969.1|  PREDICTED: uncharacterized protein LOC103845831  98.6    8e-21   
ref|XP_006408193.1|  hypothetical protein EUTSA_v10020390mg           98.6    8e-21   
emb|CDP03796.1|  unnamed protein product                              98.2    1e-20   
ref|XP_007050164.1|  Vacuolar protein sorting-associated protein ...  97.8    2e-20   
emb|CDX92605.1|  BnaA10g16440D                                        97.4    2e-20   
ref|NP_197350.1|  uncharacterized protein                             97.1    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003595836.1|  Vacuolar protein sorting-associated protein      97.1    3e-20   
gb|KHN43170.1|  Glycogenin-1                                          97.8    4e-20   
ref|XP_006400398.1|  hypothetical protein EUTSA_v10013152mg           96.7    4e-20   
gb|KHG12486.1|  Vacuolar sorting-associated protein 62                96.7    4e-20   
gb|KDO53065.1|  hypothetical protein CISIN_1g008314mg                 96.7    4e-20   
ref|XP_003590981.1|  hypothetical protein MTR_1g080370                96.3    4e-20   
gb|AAM64724.1|  unknown                                               96.3    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454091.1|  PREDICTED: uncharacterized protein LOC104735910  95.9    7e-20   
ref|XP_006403160.1|  hypothetical protein EUTSA_v10003172mg           95.9    7e-20   
ref|XP_007147203.1|  hypothetical protein PHAVU_006G104300g           95.5    8e-20   
ref|XP_006437467.1|  hypothetical protein CICLE_v10031092mg           95.5    9e-20   
ref|NP_001048935.1|  Os03g0142900                                     95.5    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006484620.1|  PREDICTED: uncharacterized protein LOC102609992  95.5    1e-19   
ref|XP_010674262.1|  PREDICTED: uncharacterized protein LOC104890460  95.1    1e-19   
gb|AFK13836.1|  putative pre-mRNA processing protein PRP39            95.1    1e-19   
ref|XP_010936079.1|  PREDICTED: vacuolar protein sorting-associat...  95.1    1e-19   
ref|XP_003538659.2|  PREDICTED: uncharacterized protein LOC100811439  95.1    1e-19   
ref|XP_010091803.1|  hypothetical protein L484_015871                 95.1    1e-19   
gb|KDP23733.1|  hypothetical protein JCGZ_23566                       95.1    1e-19   
gb|KHN25608.1|  hypothetical protein glysoja_018182                   94.7    2e-19   
ref|XP_008796406.1|  PREDICTED: uncharacterized protein LOC103711872  94.7    2e-19   
gb|KFK26090.1|  hypothetical protein AALP_AA8G201500                  94.4    2e-19   
ref|XP_010102201.1|  hypothetical protein L484_024482                 94.4    3e-19   
gb|KHG05685.1|  Vacuolar sorting-associated protein 62                94.4    3e-19   
ref|XP_002884442.1|  hypothetical protein ARALYDRAFT_477694           94.4    3e-19   
ref|XP_006854359.1|  hypothetical protein AMTR_s00039p00159460        94.0    3e-19   
ref|XP_002465876.1|  hypothetical protein SORBIDRAFT_01g047420        93.6    4e-19   Sorghum bicolor [broomcorn]
gb|KFK37858.1|  hypothetical protein AALP_AA3G038300                  93.6    4e-19   
ref|XP_011080117.1|  PREDICTED: uncharacterized protein LOC105163463  93.6    4e-19   
ref|XP_009397900.1|  PREDICTED: uncharacterized protein LOC103982643  93.6    5e-19   
ref|XP_007030349.1|  Vacuolar protein sorting-associated protein 62   93.6    5e-19   
ref|XP_006651028.1|  PREDICTED: uncharacterized protein LOC102705992  93.2    5e-19   
ref|XP_010463914.1|  PREDICTED: uncharacterized protein LOC104744543  93.2    7e-19   
emb|CBI22319.3|  unnamed protein product                              90.9    9e-19   
ref|XP_010414155.1|  PREDICTED: uncharacterized protein LOC104700315  92.8    9e-19   
gb|KHG15512.1|  Vacuolar sorting-associated protein 62                92.8    9e-19   
ref|NP_199208.1|  uncharacterized protein                             92.4    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008218354.1|  PREDICTED: uncharacterized protein LOC103318...  92.4    1e-18   
ref|XP_010542907.1|  PREDICTED: vacuolar protein sorting-associat...  92.4    1e-18   
gb|EYU46397.1|  hypothetical protein MIMGU_mgv1a003803mg              92.4    1e-18   
ref|XP_007204992.1|  hypothetical protein PRUPE_ppa003496mg           92.0    1e-18   
gb|ACN26628.1|  unknown                                               92.0    2e-18   Zea mays [maize]
ref|XP_010475050.1|  PREDICTED: uncharacterized protein LOC104754534  92.0    2e-18   
ref|NP_001145283.1|  uncharacterized protein LOC100278579             91.3    3e-18   Zea mays [maize]
ref|XP_010485809.1|  PREDICTED: uncharacterized protein LOC104764063  91.3    3e-18   
ref|NP_566224.1|  uncharacterized protein                             91.3    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495588.1|  PREDICTED: uncharacterized protein LOC101489287  91.3    3e-18   
ref|XP_010457440.1|  PREDICTED: uncharacterized protein LOC104738921  91.3    3e-18   
ref|XP_003558835.1|  PREDICTED: uncharacterized protein LOC100834654  90.9    3e-18   
ref|XP_008388738.1|  PREDICTED: uncharacterized protein LOC103451082  90.9    4e-18   
ref|XP_004985743.1|  PREDICTED: uncharacterized protein LOC101775810  90.9    4e-18   
ref|XP_008459966.1|  PREDICTED: uncharacterized protein LOC103498924  90.9    4e-18   
ref|XP_010036155.1|  PREDICTED: uncharacterized protein LOC104425227  90.9    4e-18   
ref|XP_010262454.1|  PREDICTED: uncharacterized protein LOC104600975  90.9    4e-18   
ref|XP_002263468.1|  PREDICTED: uncharacterized protein LOC100263054  90.9    5e-18   Vitis vinifera
ref|XP_011014100.1|  PREDICTED: uncharacterized protein LOC105117...  90.9    5e-18   
ref|XP_009343782.1|  PREDICTED: vacuolar protein sorting-associat...  90.5    5e-18   
ref|XP_009379740.1|  PREDICTED: uncharacterized protein LOC103968124  90.5    5e-18   
ref|XP_002319114.1|  hypothetical protein POPTR_0013s04580g           90.5    5e-18   Populus trichocarpa [western balsam poplar]
ref|XP_002320610.1|  hypothetical protein POPTR_0014s18710g           90.5    6e-18   Populus trichocarpa [western balsam poplar]
ref|XP_008370756.1|  PREDICTED: uncharacterized protein LOC103434218  90.5    6e-18   
ref|XP_006400397.1|  hypothetical protein EUTSA_v10013152mg           90.1    7e-18   
ref|XP_010549647.1|  PREDICTED: uncharacterized protein LOC104820762  90.1    7e-18   
ref|XP_010483068.1|  PREDICTED: uncharacterized protein LOC104761646  90.1    7e-18   
ref|XP_001782049.1|  predicted protein                                90.1    7e-18   
ref|XP_002863623.1|  hypothetical protein ARALYDRAFT_494605           89.7    9e-18   
ref|XP_006299082.1|  hypothetical protein CARUB_v10015223mg           89.7    9e-18   
ref|XP_004237516.1|  PREDICTED: uncharacterized protein LOC101249631  89.7    9e-18   
ref|XP_006281615.1|  hypothetical protein CARUB_v10027740mg           89.7    1e-17   
gb|KFK31677.1|  hypothetical protein AALP_AA6G144800                  89.7    1e-17   
ref|XP_010494389.1|  PREDICTED: uncharacterized protein LOC104771...  89.4    1e-17   
gb|ABF93921.1|  pre-mRNA processing protein PRP39, putative, expr...  89.0    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88495.1|  hypothetical protein OsI_09966                        89.0    2e-17   Oryza sativa Indica Group [Indian rice]
gb|AAC16751.1|  Contains similarity to pre-mRNA processing protei...  90.1    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140668.1|  PREDICTED: uncharacterized protein LOC101209282  89.0    2e-17   
ref|XP_004157618.1|  PREDICTED: uncharacterized protein LOC101230031  89.0    2e-17   
ref|XP_004511441.1|  PREDICTED: uncharacterized protein LOC101506...  89.0    2e-17   
emb|CDY18204.1|  BnaC05g02270D                                        88.6    2e-17   
ref|XP_010024939.1|  PREDICTED: uncharacterized protein LOC104415357  88.6    2e-17   
ref|XP_011038467.1|  PREDICTED: uncharacterized protein LOC105135340  88.6    3e-17   
ref|XP_009119330.1|  PREDICTED: uncharacterized protein LOC103844286  88.2    3e-17   
ref|XP_009802615.1|  PREDICTED: uncharacterized protein LOC104248123  88.2    3e-17   
gb|KDP26464.1|  hypothetical protein JCGZ_17622                       88.2    4e-17   
ref|NP_171905.1|  uncharacterized protein                             88.2    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441929.1|  PREDICTED: uncharacterized protein LOC104725034  88.2    4e-17   
ref|XP_011077064.1|  PREDICTED: uncharacterized protein LOC105161158  87.8    5e-17   
ref|NP_001060082.1|  Os07g0575900                                     87.4    5e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EMT32036.1|  hypothetical protein F775_07429                       87.8    5e-17   
ref|XP_006304926.1|  hypothetical protein CARUB_v10012003mg           87.8    5e-17   
ref|XP_002521999.1|  conserved hypothetical protein                   87.4    6e-17   
ref|XP_002526543.1|  conserved hypothetical protein                   87.4    6e-17   
ref|XP_002889490.1|  hypothetical protein ARALYDRAFT_333729           88.2    7e-17   
emb|CDY29997.1|  BnaC01g40110D                                        87.0    8e-17   
ref|XP_007131534.1|  hypothetical protein PHAVU_011G021100g           87.0    9e-17   
ref|XP_006605254.1|  PREDICTED: uncharacterized protein LOC102664486  84.7    9e-17   
ref|XP_004289989.1|  PREDICTED: uncharacterized protein LOC101301919  87.0    9e-17   
ref|XP_009621765.1|  PREDICTED: uncharacterized protein LOC104113342  87.0    1e-16   
ref|XP_010481793.1|  PREDICTED: uncharacterized protein LOC104760554  87.0    1e-16   
ref|XP_011014095.1|  PREDICTED: uncharacterized protein LOC105117...  86.7    1e-16   
ref|XP_003607401.1|  hypothetical protein MTR_4g077620                87.0    1e-16   
ref|XP_006340465.1|  PREDICTED: uncharacterized protein LOC102604240  86.7    1e-16   
gb|AES89598.2|  pre-mRNA processing protein PRP39, putative           86.3    1e-16   
ref|XP_009598580.1|  PREDICTED: uncharacterized protein LOC104094361  86.3    2e-16   
ref|XP_009772277.1|  PREDICTED: uncharacterized protein LOC104222703  86.3    2e-16   
ref|XP_003610864.1|  hypothetical protein MTR_5g007860                85.9    2e-16   
gb|EYU39520.1|  hypothetical protein MIMGU_mgv1a003717mg              85.9    3e-16   
emb|CDX89845.1|  BnaA10g02370D                                        85.5    3e-16   
ref|XP_011102188.1|  PREDICTED: uncharacterized protein LOC105180219  85.5    3e-16   
ref|XP_011102311.1|  PREDICTED: uncharacterized protein LOC105180351  85.5    3e-16   
ref|XP_006355887.1|  PREDICTED: uncharacterized protein LOC102585636  85.1    4e-16   
ref|XP_009757101.1|  PREDICTED: uncharacterized protein LOC104210010  84.3    7e-16   
dbj|BAJ86107.1|  predicted protein                                    84.3    8e-16   
ref|XP_010326346.1|  PREDICTED: uncharacterized protein LOC101247062  84.0    1e-15   
ref|XP_003538932.1|  PREDICTED: uncharacterized protein LOC100793026  83.6    1e-15   
ref|XP_008235593.1|  PREDICTED: uncharacterized protein LOC103334410  84.0    1e-15   
ref|XP_004302106.1|  PREDICTED: uncharacterized protein LOC101296875  84.0    1e-15   
emb|CDY21128.1|  BnaA01g33590D                                        83.6    1e-15   
ref|XP_007199743.1|  hypothetical protein PRUPE_ppa003532mg           83.6    1e-15   
ref|XP_009124997.1|  PREDICTED: uncharacterized protein LOC103850048  83.6    1e-15   
ref|XP_008382712.1|  PREDICTED: uncharacterized protein LOC103445...  82.8    2e-15   
ref|XP_009370479.1|  PREDICTED: uncharacterized protein LOC103959833  82.8    2e-15   
ref|XP_009591728.1|  PREDICTED: uncharacterized protein LOC104088707  82.0    4e-15   
ref|XP_006287419.1|  hypothetical protein CARUB_v10000625mg           81.6    6e-15   
ref|XP_009335223.1|  PREDICTED: uncharacterized protein LOC103927...  81.6    7e-15   
ref|XP_010264864.1|  PREDICTED: uncharacterized protein LOC104602762  80.9    1e-14   
emb|CDP04277.1|  unnamed protein product                              79.3    4e-14   
ref|XP_004505614.1|  PREDICTED: uncharacterized protein LOC101493338  79.0    5e-14   
ref|XP_007157037.1|  hypothetical protein PHAVU_002G038300g           79.0    7e-14   
ref|XP_010492853.1|  PREDICTED: uncharacterized protein LOC104770176  78.2    9e-14   
ref|XP_010420612.1|  PREDICTED: uncharacterized protein LOC104706157  77.0    2e-13   
gb|EAY91685.1|  hypothetical protein OsI_13324                        76.3    4e-13   
ref|XP_001776039.1|  predicted protein                                75.9    7e-13   
gb|KHN31487.1|  hypothetical protein glysoja_035594                   73.2    1e-12   
ref|XP_002463969.1|  hypothetical protein SORBIDRAFT_01g009850        74.3    2e-12   
ref|XP_006345810.1|  PREDICTED: uncharacterized protein LOC102590400  73.9    3e-12   
ref|XP_004239684.1|  PREDICTED: uncharacterized protein LOC101256489  73.9    3e-12   
ref|NP_001051103.1|  Os03g0721300                                     72.4    1e-11   
gb|KGN46372.1|  hypothetical protein Csa_6G088000                     71.6    2e-11   
ref|XP_004511442.1|  PREDICTED: uncharacterized protein LOC101506...  71.2    2e-11   
gb|KHG08645.1|  Vacuolar sorting-associated protein 62                71.6    2e-11   
ref|XP_007147204.1|  hypothetical protein PHAVU_006G104300g           70.9    3e-11   
ref|XP_006580739.1|  PREDICTED: uncharacterized protein LOC102670058  68.6    4e-11   
gb|KFK42751.1|  hypothetical protein AALP_AA1G034900                  69.7    6e-11   
ref|NP_001183917.1|  hypothetical protein                             69.7    8e-11   
gb|EMS62765.1|  hypothetical protein TRIUR3_20195                     68.9    1e-10   
dbj|BAJ96649.1|  predicted protein                                    68.9    1e-10   
ref|XP_008382713.1|  PREDICTED: uncharacterized protein LOC103445...  65.5    2e-09   
emb|CDX77088.1|  BnaC04g38830D                                        65.1    2e-09   
ref|XP_008218355.1|  PREDICTED: vacuolar protein sorting-associat...  65.5    2e-09   
emb|CDY37499.1|  BnaA05g33640D                                        65.1    2e-09   
ref|XP_011069465.1|  PREDICTED: uncharacterized protein LOC105155289  64.3    2e-09   
ref|XP_009335224.1|  PREDICTED: vacuolar protein sorting-associat...  64.7    4e-09   
emb|CDX91920.1|  BnaC03g32220D                                        63.9    5e-09   
ref|XP_003559488.1|  PREDICTED: uncharacterized protein LOC100822588  62.0    2e-08   
ref|XP_002969346.1|  hypothetical protein SELMODRAFT_231324           58.5    4e-07   
ref|XP_002970679.1|  hypothetical protein SELMODRAFT_94162            58.5    4e-07   
gb|AFK34680.1|  unknown                                               57.0    5e-07   
gb|AFW67788.1|  hypothetical protein ZEAMMB73_320181                  52.4    3e-06   
ref|XP_007149123.1|  hypothetical protein PHAVU_005G043000g           54.7    6e-06   
ref|XP_006651759.1|  PREDICTED: uncharacterized protein LOC102718729  54.3    8e-06   
ref|XP_004488585.1|  PREDICTED: uncharacterized protein LOC101493362  50.8    9e-05   



>ref|XP_011092632.1| PREDICTED: uncharacterized protein LOC105172754 [Sesamum indicum]
Length=600

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 94/113 (83%), Gaps = 4/113 (4%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPIDT FKLPSPLPTWP+GG FGSG IDLGGLQV Q+S+ KK+W  Y GGP N+GAT FE
Sbjct  63   LPIDTVFKLPSPLPTWPAGGEFGSGVIDLGGLQVRQLSSFKKVWEVYAGGPGNLGATFFE  122

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGK----DNNGEILKPPTDYTLVWSS  1
            PSSIPDGF MLGSYAQPNNQPL GWVLVGK    D +G+ILK PTDY LVW++
Sbjct  123  PSSIPDGFSMLGSYAQPNNQPLFGWVLVGKTDAADQSGDILKQPTDYNLVWAN  175



>ref|XP_004229552.1| PREDICTED: uncharacterized protein LOC101265960 [Solanum lycopersicum]
Length=540

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPIDT FK PSPLPTWPSG GF SG IDLGGLQV QIS+  KIW S EGGP+N+GATIFE
Sbjct  15   LPIDTPFKFPSPLPTWPSGEGFASGIIDLGGLQVSQISSFTKIWASQEGGPDNLGATIFE  74

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            PS++P+ F MLGSY+QPNN PL GWVLVGKD++G+ LK P DYTLVWSS
Sbjct  75   PSNLPNDFFMLGSYSQPNNLPLFGWVLVGKDSSGDALKLPNDYTLVWSS  123



>ref|XP_006359130.1| PREDICTED: uncharacterized protein LOC102589484 [Solanum tuberosum]
Length=543

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPIDT FK PSPLPTWPSG GF SG IDLGGLQV QIS+  K+W S EGGP+N+GAT FE
Sbjct  18   LPIDTPFKFPSPLPTWPSGEGFASGIIDLGGLQVSQISSFTKVWASQEGGPDNLGATFFE  77

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            PS++P+ F MLGSY+QPNN PL GW+L+GKD++G+ LK P DYTLVWSS
Sbjct  78   PSNLPNDFFMLGSYSQPNNLPLFGWLLIGKDSSGDALKLPNDYTLVWSS  126



>ref|XP_009615972.1| PREDICTED: uncharacterized protein LOC104108601 [Nicotiana tomentosiformis]
Length=573

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            TLPIDT FKLPSPLP WP GG FGSGY+DL GL+VCQI    K+W   +GGP+N+GAT +
Sbjct  31   TLPIDTVFKLPSPLPNWPPGGEFGSGYVDLEGLEVCQIVTFNKVWAIDKGGPDNLGATFY  90

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGEILKPPTDYTLVWSS  1
            EPS IPDGF M G Y QPNNQP  GWVLVGKD NNG+ LK P DYTLVWSS
Sbjct  91   EPSPIPDGFSMFGCYCQPNNQPHFGWVLVGKDKNNGQTLKNPIDYTLVWSS  141



>gb|KDP32272.1| hypothetical protein JCGZ_13197 [Jatropha curcas]
Length=554

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            +LPI+T+FKLPSPLPTWP G GFG+G IDLGGL+VCQIS+LKK+W ++EGGP+N+GA+ F
Sbjct  16   SLPIETSFKLPSPLPTWPPGDGFGNGSIDLGGLRVCQISSLKKVWATHEGGPDNLGASFF  75

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN--GEILKPPTDYTLVWSS  1
            EPS  P GF MLG Y+QPNN+ L GWVL GKD     EILK P DYTLVWSS
Sbjct  76   EPSETPQGFFMLGCYSQPNNRSLYGWVLAGKDEGTAQEILKKPLDYTLVWSS  127



>ref|XP_006364462.1| PREDICTED: uncharacterized protein LOC102578745 [Solanum tuberosum]
Length=558

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
            I  LPIDT FK PSPLP WP G G FGSGYIDLGGL+VCQI    K+W   +GGP N+GA
Sbjct  12   IKYLPIDTIFKFPSPLPNWPPGTGDFGSGYIDLGGLKVCQIVTFNKVWAIDKGGPENLGA  71

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            T +EPS IPDGF M G Y QPNN+PL GWVL GKDN GEILK P DYTLVWSS
Sbjct  72   TFYEPSPIPDGFSMFGCYCQPNNKPLFGWVLAGKDNVGEILKNPIDYTLVWSS  124



>ref|XP_011086788.1| PREDICTED: uncharacterized protein LOC105168414 [Sesamum indicum]
Length=559

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 89/113 (79%), Gaps = 4/113 (4%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPI+T F+LPSPLP+WP+GGGF SG IDLGGL+VCQ+S   K+W + EGGP+N GAT FE
Sbjct  22   LPIETLFRLPSPLPSWPAGGGFASGIIDLGGLEVCQVSTFAKVWATQEGGPDNHGATFFE  81

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN----GEILKPPTDYTLVWSS  1
            PS +PDGF MLG Y QPNN+PL GWVL GKD      G  LKPPTDY+LVWSS
Sbjct  82   PSPLPDGFFMLGCYGQPNNKPLFGWVLAGKDATNDPLGGALKPPTDYSLVWSS  134



>ref|XP_011009639.1| PREDICTED: uncharacterized protein LOC105114698 [Populus euphratica]
Length=558

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLG-GLQVCQISNLKKIWRSYEGGPNNVGATI  154
             LPID +FK P+PLP+WP GGGFGSG IDLG GLQVCQIS+  K+W ++EGGP+++GA+ 
Sbjct  23   VLPIDASFKFPAPLPSWPPGGGFGSGIIDLGDGLQVCQISSFNKVWATHEGGPDDLGASF  82

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            FEPS +P GF MLG Y+QPNN+PL GWVL G+D  G  LK P DYTLVWSS
Sbjct  83   FEPSQLPQGFSMLGCYSQPNNRPLYGWVLAGRDETGSALKQPIDYTLVWSS  133



>ref|XP_011008815.1| PREDICTED: uncharacterized protein LOC105114095 [Populus euphratica]
Length=558

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLG-GLQVCQISNLKKIWRSYEGGPNNVGATI  154
             LPID +FK P+PLP+WP GGGFGSG IDLG GLQVCQIS+  K+W ++EGGP+++GA+ 
Sbjct  23   VLPIDASFKFPAPLPSWPPGGGFGSGIIDLGDGLQVCQISSFNKVWATHEGGPDDLGASF  82

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            FEPS +P GF MLG Y+QPNN+PL GWVL G+D  G  LK P DYTLVWSS
Sbjct  83   FEPSQLPQGFSMLGCYSQPNNRPLYGWVLAGRDETGSALKQPIDYTLVWSS  133



>ref|XP_004245944.2| PREDICTED: uncharacterized protein LOC101257692 [Solanum lycopersicum]
Length=591

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATI  154
            +LPIDT FKLPSPLP WPSG G FGSGYIDLGGL+V QI    K+W   +GGP N+GAT 
Sbjct  47   SLPIDTIFKLPSPLPNWPSGTGEFGSGYIDLGGLKVYQIVTFNKVWAIDKGGPENLGATF  106

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            +EPS IPDGF M G Y QPNN+PL GWVL GKDN GEILK P DYTLVWSS
Sbjct  107  YEPSPIPDGFSMFGCYCQPNNKPLFGWVLAGKDNVGEILKNPIDYTLVWSS  157



>ref|XP_006341329.1| PREDICTED: uncharacterized protein LOC102584466 [Solanum tuberosum]
Length=579

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  FGVEEL*VMGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRS  190
            F V+ +    NI +L ID  F LPSPLPTWPSGG F SG+IDLGGLQV QIS+L K+W +
Sbjct  39   FLVDNITSTKNIMSLSIDDAFCLPSPLPTWPSGGCFASGFIDLGGLQVSQISSLTKVWST  98

Query  189  YEGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            +EGGP+N+GAT FEPS+IP+GF M GSY Q NN PL GW L G+D +   LK PTDYTLV
Sbjct  99   HEGGPDNLGATFFEPSNIPNGFFMFGSYTQTNNIPLFGWTLAGRDTSRGTLKMPTDYTLV  158

Query  9    WSS  1
            WSS
Sbjct  159  WSS  161



>ref|XP_009793524.1| PREDICTED: uncharacterized protein LOC104240380 [Nicotiana sylvestris]
Length=581

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            PIDT FKLPSPLPTWPSG GF +G IDLGGL+V QIS+L K+W + EGGP+++GAT FEP
Sbjct  58   PIDTPFKLPSPLPTWPSGQGFATGVIDLGGLEVSQISSLAKVWATQEGGPDDLGATFFEP  117

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            S++P+GF MLGSY+QPNN PL G VL GKD+ G+ LK PTDYTLVWSS
Sbjct  118  SNLPNGFFMLGSYSQPNNLPLFGSVLAGKDSTGDTLKMPTDYTLVWSS  165



>emb|CDX79771.1| BnaA05g03850D [Brassica napus]
Length=340

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 92/121 (76%), Gaps = 7/121 (6%)
 Frame = -1

Query  345  MGNIPT-------LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSY  187
            MGNI +       LPID+TF LPSPLP+WPSG GF  G IDLGGL+V Q++   K+W  Y
Sbjct  1    MGNISSAQSSSPSLPIDSTFDLPSPLPSWPSGEGFAKGIIDLGGLEVFQVTKFNKVWTVY  60

Query  186  EGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVW  7
            EGG +N+GAT FEPSS+P+GF +LGSYAQPNN+ L GW LVGKD +G+ L+PP DY L+W
Sbjct  61   EGGQDNLGATFFEPSSLPEGFSLLGSYAQPNNRKLFGWTLVGKDISGDSLRPPVDYLLLW  120

Query  6    S  4
            S
Sbjct  121  S  121



>ref|XP_010508320.1| PREDICTED: uncharacterized protein LOC104784914 [Camelina sativa]
Length=543

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPID+TF LPSPLP+WPSG GF  G IDLGGL+VCQ+   KK+W +YEGG +N+GAT FE
Sbjct  14   LPIDSTFNLPSPLPSWPSGEGFAKGRIDLGGLEVCQVETFKKVWTAYEGGQDNLGATFFE  73

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWS  4
            PSS+P GF +LG YAQPNN+ L GW LVGKD +G+ L+PP DY L+WS
Sbjct  74   PSSVPQGFSILGFYAQPNNRKLFGWTLVGKDLSGDSLRPPVDYLLLWS  121



>ref|XP_004248824.1| PREDICTED: uncharacterized protein LOC101253331 [Solanum lycopersicum]
Length=612

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -1

Query  321  IDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPS  142
            ID  F+ PSPLPTWPSGG F SG+IDLGGLQV QIS+L K+W ++EGGP+N+GAT FEPS
Sbjct  88   IDNAFRFPSPLPTWPSGGCFASGFIDLGGLQVSQISSLTKVWSTHEGGPDNLGATFFEPS  147

Query  141  SIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            +IP+GF M GSY QPNN PL GW L G+D +   LK PTDYTLVWSS
Sbjct  148  NIPNGFFMFGSYTQPNNIPLFGWTLAGRDTSQGTLKMPTDYTLVWSS  194



>ref|XP_010030212.1| PREDICTED: uncharacterized protein LOC104420021 isoform X2 [Eucalyptus 
grandis]
 gb|KCW57154.1| hypothetical protein EUGRSUZ_I02787 [Eucalyptus grandis]
Length=724

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
             LPIDT FKLPSPLPTWP+GGGF  G ID GGL V Q S+  K+W +YEGG +N GAT F
Sbjct  189  ALPIDTVFKLPSPLPTWPAGGGFAGGTIDFGGLLVHQTSSFSKVWAAYEGGADNRGATFF  248

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEI----LKPPTDYTLVWSS  1
            EPSS+P+G+ M GSYAQPNN+PLSGW+LVGKD   +I    LK P DY+L+WSS
Sbjct  249  EPSSLPEGYFMFGSYAQPNNRPLSGWLLVGKDQTNDISNGTLKKPVDYSLIWSS  302



>ref|XP_002523580.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38775.1| conserved hypothetical protein [Ricinus communis]
Length=551

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            TLPI+T+FKLPS LP WP G GFG+G IDLGGLQVCQIS+L K+W + EGGP+NVGA+ F
Sbjct  16   TLPIETSFKLPSSLPKWPPGEGFGNGTIDLGGLQVCQISSLNKVWSTQEGGPDNVGASFF  75

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            EPS IP GF MLG Y Q N++PL GWVL GKD+ G  L+ P DYTLVWSS
Sbjct  76   EPSQIPQGFFMLGCYCQSNSRPLYGWVLAGKDDAGGALEKPIDYTLVWSS  125



>ref|XP_010030210.1| PREDICTED: uncharacterized protein LOC104420021 isoform X1 [Eucalyptus 
grandis]
Length=726

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
             LPIDT FKLPSPLPTWP+GGGF  G ID GGL V Q S+  K+W +YEGG +N GAT F
Sbjct  191  ALPIDTVFKLPSPLPTWPAGGGFAGGTIDFGGLLVHQTSSFSKVWAAYEGGADNRGATFF  250

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEI----LKPPTDYTLVWSS  1
            EPSS+P+G+ M GSYAQPNN+PLSGW+LVGKD   +I    LK P DY+L+WSS
Sbjct  251  EPSSLPEGYFMFGSYAQPNNRPLSGWLLVGKDQTNDISNGTLKKPVDYSLIWSS  304



>ref|XP_009797417.1| PREDICTED: uncharacterized protein LOC104243853 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797418.1| PREDICTED: uncharacterized protein LOC104243853 isoform X2 [Nicotiana 
sylvestris]
Length=556

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            TLPIDT FKLPS LP WP GG FGSGY+DL GL+VCQI    K+W   +GGP+N+GAT +
Sbjct  14   TLPIDTIFKLPSSLPNWPPGGEFGSGYVDLEGLKVCQIVTFNKVWAVDKGGPDNLGATFY  73

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGEILKPPTDYTLVWSS  1
            EPS IPDGF M G Y QPNNQP  GWVL GKD NNG+ LK P DYTLVWSS
Sbjct  74   EPSPIPDGFSMFGCYCQPNNQPHFGWVLAGKDKNNGQTLKNPIDYTLVWSS  124



>gb|EYU37528.1| hypothetical protein MIMGU_mgv1a003548mg [Erythranthe guttata]
Length=579

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = -1

Query  357  EL*VMGNIPT--LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYE  184
            +L +MGN     LP+DT F  P+ LPTWP+GGGFGSG +DLGGLQ+ ++S  KKIW SY+
Sbjct  38   KLLIMGNCQNNPLPVDTFFGFPTALPTWPTGGGFGSGEMDLGGLQIRKVSTFKKIWTSYQ  97

Query  183  GGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWS  4
             G NN GAT FEP  IPDGF MLGSYAQ N+QPL GW  VGK +  +ILK PTDYTLVWS
Sbjct  98   SGMNNFGATFFEPDPIPDGFSMLGSYAQTNDQPLFGWNFVGKSDGTDILKQPTDYTLVWS  157



>ref|XP_009596811.1| PREDICTED: uncharacterized protein LOC104092840 [Nicotiana tomentosiformis]
Length=599

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -1

Query  339  NIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
            N  ++PI T F+LPSPLP WPSG GF SG IDLGGL V Q+S L K+W ++EGGP+N+GA
Sbjct  69   NSMSIPIHTHFQLPSPLPRWPSGEGFASGVIDLGGLLVSQVSLLTKVWATHEGGPDNLGA  128

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            T FEPS++P+GF MLGSY+QPNN PL GW+L GKD +G  LK P+DY LVWSS
Sbjct  129  TFFEPSNLPNGFFMLGSYSQPNNMPLFGWILAGKDTSGGALKMPSDYALVWSS  181



>ref|XP_010518017.1| PREDICTED: uncharacterized protein LOC104793362 [Camelina sativa]
Length=543

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPID+TF LPSPLP+WPSG GF  G ID GGL+VCQ+   KK+W +YEGG +N+GAT FE
Sbjct  14   LPIDSTFNLPSPLPSWPSGEGFAKGKIDSGGLEVCQVETFKKVWTAYEGGQDNLGATFFE  73

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWS  4
            PSS+P GF +LG YAQPNN+ L GW LVGKD +G+ LKPP DY L+WS
Sbjct  74   PSSVPQGFSILGFYAQPNNRKLFGWTLVGKDLSGDSLKPPVDYLLLWS  121



>emb|CDP14941.1| unnamed protein product [Coffea canephora]
Length=563

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 87/116 (75%), Gaps = 6/116 (5%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            +LPIDT FK PSP+PTW S GGF S YIDLGGLQV QIS   K+W  Y GGP+N+GAT +
Sbjct  17   SLPIDTIFKFPSPIPTWLSEGGFASDYIDLGGLQVHQISTFNKVWTVYGGGPDNLGATFY  76

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD------NNGEILKPPTDYTLVWSS  1
            EPS IPDGF MLGSY+QPNNQP  GW+LV KD      ++ E LK PTDY L+WSS
Sbjct  77   EPSQIPDGFFMLGSYSQPNNQPFFGWILVAKDTSSDQSSSNETLKKPTDYALIWSS  132



>ref|XP_006293958.1| hypothetical protein CARUB_v10022948mg [Capsella rubella]
 gb|EOA26856.1| hypothetical protein CARUB_v10022948mg [Capsella rubella]
Length=543

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -1

Query  321  IDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPS  142
            ID+TF LPSPLP+WPSG GF  G IDLGGL+VCQ+    K+W  YEGGP+N+GAT FEPS
Sbjct  16   IDSTFSLPSPLPSWPSGEGFAKGRIDLGGLEVCQVETFNKVWTVYEGGPDNLGATFFEPS  75

Query  141  SIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWS  4
            S+P+GF +LG YAQPNN+ L GW LVGKD +G+ L+PP DY L+WS
Sbjct  76   SVPEGFSILGFYAQPNNRKLFGWALVGKDLSGDSLRPPVDYLLLWS  121



>emb|CDP07655.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            PI+T FKLPSPLP WP G GF +G IDLGGLQVCQ+S   K+W ++EGGP+N+GAT FEP
Sbjct  24   PIETMFKLPSPLPAWPQGAGFANGTIDLGGLQVCQVSTFNKVWATHEGGPDNLGATFFEP  83

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGE-ILKPPTDYTLVWSS  1
            SSIPDGF  LG Y+QPNN PL GWVL  KD ++G+ IL  PTDYTL+WSS
Sbjct  84   SSIPDGFFTLGYYSQPNNSPLFGWVLAAKDASSGQGILSKPTDYTLIWSS  133



>ref|XP_006379002.1| hypothetical protein POPTR_0009s03000g [Populus trichocarpa]
 gb|ERP56799.1| hypothetical protein POPTR_0009s03000g [Populus trichocarpa]
Length=540

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLG-GLQVCQISNLKKIWRSYEGGPNNVGATI  154
            TLPID +FKLP+PLP+WP G GFGSG IDLG GLQVC +S+  K+W ++EGGP+N+GA+ 
Sbjct  23   TLPIDASFKLPAPLPSWPPGEGFGSGIIDLGDGLQVCLLSSFNKVWATHEGGPDNLGASF  82

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            FEPS  P GF MLGSY+QPNN  L GWVL G+D+ G  LK P DYTLVWSS
Sbjct  83   FEPSQFPQGFSMLGSYSQPNNTLLHGWVLAGRDDTGSALKQPIDYTLVWSS  133



>ref|XP_009143004.1| PREDICTED: uncharacterized protein LOC103866778 [Brassica rapa]
Length=538

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 92/121 (76%), Gaps = 7/121 (6%)
 Frame = -1

Query  345  MGNIPT-------LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSY  187
            MGNI +       LPID+TF LPSPLP+WPSG GF  G IDLGGL+V Q++   K+W  Y
Sbjct  1    MGNISSAQSSSPSLPIDSTFDLPSPLPSWPSGEGFAKGIIDLGGLEVFQVTKFNKVWTVY  60

Query  186  EGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVW  7
            EGG +N+GAT FEPSS+P+GF +LGSYAQPNN+ L GW LVGKD +G+ L+PP DY L+W
Sbjct  61   EGGQDNLGATFFEPSSLPEGFSLLGSYAQPNNRKLFGWTLVGKDISGDSLRPPVDYLLLW  120

Query  6    S  4
            S
Sbjct  121  S  121



>ref|NP_030961.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC16074.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96487.1| At2g44230/F4I1.4 [Arabidopsis thaliana]
 gb|AAM19976.1| At2g44230/F4I1.4 [Arabidopsis thaliana]
 dbj|BAE98671.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10394.1| uncharacterized protein AT2G44230 [Arabidopsis thaliana]
Length=542

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -1

Query  333  PTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATI  154
            P+LPID+TF LPSPLP+WPSG GF  G IDLGGL+V Q+    K+W  YEGG +N+GAT 
Sbjct  12   PSLPIDSTFNLPSPLPSWPSGEGFAKGRIDLGGLEVSQVDTFNKVWTVYEGGQDNLGATF  71

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWS  4
            FEPSS+P+GF +LG YAQPNN+ L GW LVGKD +G+ L+PP DY L+WS
Sbjct  72   FEPSSVPEGFSILGFYAQPNNRKLFGWTLVGKDLSGDSLRPPVDYLLLWS  121



>ref|XP_006397602.1| hypothetical protein EUTSA_v10001390mg [Eutrema salsugineum]
 gb|ESQ39055.1| hypothetical protein EUTSA_v10001390mg [Eutrema salsugineum]
Length=541

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPI++TF LPSPLP+WPSGGGF  G IDLGGL+VCQ++   K+W  YEGG +N+GAT FE
Sbjct  14   LPINSTFDLPSPLPSWPSGGGFAKGIIDLGGLEVCQVTTFNKVWAVYEGGQDNLGATFFE  73

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWS  4
            PSS+P+GF +LG YAQPNN+ L GW LVGKD +G+ L+ P DY L+WS
Sbjct  74   PSSVPEGFSILGFYAQPNNRKLFGWTLVGKDLSGDSLRAPVDYLLLWS  121



>ref|XP_009776767.1| PREDICTED: uncharacterized protein LOC104226450 [Nicotiana sylvestris]
Length=596

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -1

Query  339  NIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
            N  ++PIDT F+LPSPLP WPSG GF SG IDLGGL V Q+S L K+W ++EGGP+N+GA
Sbjct  66   NSMSIPIDTHFQLPSPLPRWPSGEGFASGVIDLGGLLVSQVSLLTKVWATHEGGPDNLGA  125

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            T FEP+++P+GF MLGSY+QPNN PL GW+L GKD +G  LK PTDY LV SS
Sbjct  126  TFFEPTNLPNGFFMLGSYSQPNNMPLFGWILAGKDTSGGALKMPTDYALVCSS  178



>gb|KDO46021.1| hypothetical protein CISIN_1g008353mg [Citrus sinensis]
Length=569

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 88/111 (79%), Gaps = 2/111 (2%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
             PI+TTFKLP+P+PTWP G GFGSG IDLGGLQV QI++ KKIW ++EGGP+N G T FE
Sbjct  24   FPIETTFKLPAPIPTWPPGEGFGSGTIDLGGLQVRQITSFKKIWATHEGGPDNAGTTFFE  83

Query  147  PSS--IPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            PS+  IP GF MLG YAQPNN PL GWVL  KD++G  LK P DYTLVWSS
Sbjct  84   PSTIDIPPGFFMLGCYAQPNNTPLFGWVLAAKDSSGLSLKKPVDYTLVWSS  134



>ref|XP_006482794.1| PREDICTED: uncharacterized protein LOC102620179 [Citrus sinensis]
Length=569

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 88/111 (79%), Gaps = 2/111 (2%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
             PI+TTFKLP+P+PTWP G GFGSG IDLGGLQV QI++ KKIW ++EGGP+N G T FE
Sbjct  24   FPIETTFKLPAPIPTWPPGEGFGSGTIDLGGLQVRQITSFKKIWATHEGGPDNAGTTFFE  83

Query  147  PSS--IPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            PS+  IP GF MLG YAQPNN PL GWVL  KD++G  LK P DYTLVWSS
Sbjct  84   PSTIDIPPGFFMLGCYAQPNNTPLFGWVLAAKDSSGLSLKKPVDYTLVWSS  134



>ref|XP_011041980.1| PREDICTED: uncharacterized protein LOC105137797 [Populus euphratica]
Length=558

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLG-GLQVCQISNLKKIWRSYEGGPNNVGATI  154
            TLPID +FKLP+PLP+WP G GFGSG IDLG GLQVC +S+  K+W ++EGGP+N+GA+ 
Sbjct  23   TLPIDASFKLPAPLPSWPPGEGFGSGIIDLGDGLQVCLLSSFNKVWATHEGGPDNLGASF  82

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            FEPS  P GF MLGSY+QPNN  L GWVL G+D+ G  LK P DYTLVWSS
Sbjct  83   FEPSQFPQGFSMLGSYSQPNNTLLYGWVLAGRDDTGSALKQPIDYTLVWSS  133



>gb|EYU27168.1| hypothetical protein MIMGU_mgv1a019297mg [Erythranthe guttata]
Length=558

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 91/117 (78%), Gaps = 8/117 (7%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPI+T F LPSPLP+WP+G GF SG IDLGGL++ Q+S   KIW + EGGP N+GAT FE
Sbjct  25   LPIETLFTLPSPLPSWPAGEGFASGIIDLGGLEIRQVSEFDKIWAALEGGPANLGATFFE  84

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD--------NNGEILKPPTDYTLVWSS  1
            PSSIP+GF MLG Y+QPNN+PLSG+VLVGKD        NN   LKPPTDYTLVWSS
Sbjct  85   PSSIPEGFSMLGCYSQPNNKPLSGYVLVGKDVTTNNNNNNNNAALKPPTDYTLVWSS  141



>gb|KFK37236.1| hypothetical protein AALP_AA4G231600 [Arabis alpina]
Length=546

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -1

Query  339  NIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
            ++P+LPID+TF LPSPLP+WPSG GF  G IDLGGL+V Q++   K+W  YEGG +N+GA
Sbjct  11   SLPSLPIDSTFDLPSPLPSWPSGQGFAKGRIDLGGLEVYQVTTFNKVWTVYEGGQDNLGA  70

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWS  4
            T FEPS +P+ F +LG YAQPNN+ L GW LVGKD +G+ LKPP DY L+WS
Sbjct  71   TFFEPSLVPESFSILGFYAQPNNRKLFGWTLVGKDISGDSLKPPVDYLLLWS  122



>ref|XP_009589347.1| PREDICTED: uncharacterized protein LOC104086727 [Nicotiana tomentosiformis]
Length=540

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            + PIDT FKLPSPLPTWPSG  F +G IDLGGL+V Q S+L K+W + E GP+++GAT F
Sbjct  15   SRPIDTPFKLPSPLPTWPSGQAFATGVIDLGGLEVSQTSSLAKVWATQESGPDDLGATFF  74

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            EPS++P+GF MLGSY+QPNN PL G VLVGKD+ G+ LK P DYTLVWSS
Sbjct  75   EPSNLPNGFFMLGSYSQPNNLPLFGSVLVGKDSKGDALKIPIDYTLVWSS  124



>ref|XP_006438992.1| hypothetical protein CICLE_v10031170mg [Citrus clementina]
 gb|ESR52232.1| hypothetical protein CICLE_v10031170mg [Citrus clementina]
Length=541

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 89/111 (80%), Gaps = 2/111 (2%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPI+TTFKLP+P+PTWP G GFGSG IDLGGLQV QI++ KKIW ++EGGP+N GAT FE
Sbjct  24   LPIETTFKLPAPIPTWPPGEGFGSGTIDLGGLQVRQITSFKKIWATHEGGPDNAGATFFE  83

Query  147  PSS--IPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            PS+  IP GF MLG YAQPNN PL G VL  KD++G  LK P DYTLVWSS
Sbjct  84   PSTIDIPPGFFMLGCYAQPNNTPLFGSVLAAKDSSGLSLKKPVDYTLVWSS  134



>emb|CDP14942.1| unnamed protein product [Coffea canephora]
Length=563

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 85/115 (74%), Gaps = 6/115 (5%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPIDT FK PS +P WPSGGGF S YIDLGGLQV Q S   K+W  Y GGP+++GAT +E
Sbjct  18   LPIDTIFKFPSSMPKWPSGGGFASDYIDLGGLQVHQTSTFNKVWTIYGGGPDDLGATFYE  77

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD------NNGEILKPPTDYTLVWSS  1
            PS IPDGF MLGSY+QPNNQP  GW+LV KD      ++ E LK PTDY L+WSS
Sbjct  78   PSQIPDGFFMLGSYSQPNNQPFFGWILVAKDTSSDQSSSNETLKKPTDYALIWSS  132



>ref|XP_010506336.1| PREDICTED: uncharacterized protein LOC104782963 [Camelina sativa]
Length=543

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPID+TF LP  LP+WPSG GF  G IDLGGL+VCQ+   KK+W  YEGG +N+GAT FE
Sbjct  14   LPIDSTFNLPFALPSWPSGEGFAKGRIDLGGLEVCQVETFKKVWTVYEGGQDNLGATFFE  73

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWS  4
            PSS+P GF +LG YAQPNN+ L GW LVGKD +G+ L+PP DY L+WS
Sbjct  74   PSSVPQGFSILGFYAQPNNRNLFGWTLVGKDLSGDSLRPPVDYLLLWS  121



>emb|CDY17873.1| BnaC04g03460D [Brassica napus]
Length=340

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 89/121 (74%), Gaps = 7/121 (6%)
 Frame = -1

Query  345  MGNIPT-------LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSY  187
            MGNI +       LPID+TF LPSPLP+WPSG GF  G IDLGGL+V Q++   K+W  Y
Sbjct  1    MGNISSAQSSSPSLPIDSTFDLPSPLPSWPSGEGFAKGVIDLGGLEVFQVTKFNKVWTVY  60

Query  186  EGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVW  7
            E G +N+GAT FEPSS+P+GF +LG YAQPNN+ L GW LVGKD +G  ++PP DY L+W
Sbjct  61   EEGQDNLGATFFEPSSLPEGFSLLGFYAQPNNRKLFGWTLVGKDISGNSIRPPVDYLLLW  120

Query  6    S  4
            S
Sbjct  121  S  121



>gb|KCW71746.1| hypothetical protein EUGRSUZ_E00249 [Eucalyptus grandis]
 gb|KCW71747.1| hypothetical protein EUGRSUZ_E00249 [Eucalyptus grandis]
Length=591

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 84/112 (75%), Gaps = 4/112 (4%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            PI+TTFKLPSPLP WPSG GF +G ID GGLQVCQ+S+  KIW ++EGGPNN+GAT FEP
Sbjct  53   PIETTFKLPSPLPAWPSGSGFATGTIDFGGLQVCQVSSFNKIWATHEGGPNNLGATFFEP  112

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE----ILKPPTDYTLVWSS  1
            S +P+GF +LG Y QPNNQ L GWVLVGKD   +     LK P DY   W+S
Sbjct  113  SQVPEGFSVLGFYCQPNNQALHGWVLVGKDETDDPSNGALKEPIDYAPTWNS  164



>ref|XP_010055279.1| PREDICTED: uncharacterized protein LOC104443521 isoform X3 [Eucalyptus 
grandis]
Length=592

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 84/112 (75%), Gaps = 4/112 (4%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            PI+TTFKLPSPLP WPSG GF +G ID GGLQVCQ+S+  KIW ++EGGPNN+GAT FEP
Sbjct  54   PIETTFKLPSPLPAWPSGSGFATGTIDFGGLQVCQVSSFNKIWATHEGGPNNLGATFFEP  113

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE----ILKPPTDYTLVWSS  1
            S +P+GF +LG Y QPNNQ L GWVLVGKD   +     LK P DY   W+S
Sbjct  114  SQVPEGFSVLGFYCQPNNQALHGWVLVGKDETDDPSNGALKEPIDYAPTWNS  165



>ref|XP_007022584.1| Uncharacterized protein TCM_033363 [Theobroma cacao]
 gb|EOY14109.1| Uncharacterized protein TCM_033363 [Theobroma cacao]
Length=555

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
             LPI+T F+LPSPLPTWP+G GF SG IDLGG+ V Q+S+  K+W + EGGP+N+GAT F
Sbjct  19   ALPIETAFRLPSPLPTWPAGEGFASGAIDLGGMHVYQVSSFTKVWATREGGPDNLGATFF  78

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN-GEILKPPTDYTLVWSS  1
            EPSSIP+G+ MLG YAQPNN  L GWVL  KD+  G +LK P DYTLVWSS
Sbjct  79   EPSSIPEGYYMLGCYAQPNNGLLFGWVLAAKDDTGGALLKQPIDYTLVWSS  129



>ref|XP_007201170.1| hypothetical protein PRUPE_ppa003618mg [Prunus persica]
 gb|EMJ02369.1| hypothetical protein PRUPE_ppa003618mg [Prunus persica]
Length=561

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 89/120 (74%), Gaps = 4/120 (3%)
 Frame = -1

Query  348  VMGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNN  169
            V  N   LPI+TTFKLP+PLP+WP G GF SG IDLGGLQV QIS+  K+W ++EGGP+N
Sbjct  14   VFKNSKALPIETTFKLPAPLPSWPPGDGFASGSIDLGGLQVYQISSFTKVWATHEGGPDN  73

Query  168  VGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE----ILKPPTDYTLVWSS  1
            +GA+ FEPS +P GF MLG Y+QPNN+PLSGW L  K    +    +LK P DYTLVW+S
Sbjct  74   LGASFFEPSPLPQGFYMLGCYSQPNNKPLSGWALAAKSTEHKDDHLLLKKPLDYTLVWNS  133



>ref|XP_010544519.1| PREDICTED: uncharacterized protein LOC104817144 [Tarenaya hassleriana]
Length=539

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
             LP+D  FK PSPLP+WP GGGF  G IDLGGLQ+CQ+S   K+W + EGGP+N+GAT F
Sbjct  19   ALPVDAAFKFPSPLPSWPQGGGFAKGIIDLGGLQICQVSTFNKVWTTNEGGPDNLGATFF  78

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            EP+S+P GF +LG YAQPNN+PL GWVL  KD +G  L+ P DY+LV S+
Sbjct  79   EPASVPPGFSILGFYAQPNNRPLFGWVLAAKDASGNTLETPVDYSLVGST  128



>ref|XP_010659612.1| PREDICTED: uncharacterized protein LOC100242579 isoform X2 [Vitis 
vinifera]
Length=532

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 89/115 (77%), Gaps = 5/115 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGATI  154
            +L I+T+FKLP+P+PTWP G GF  G IDLGG L+VCQIS+  K+W ++EGGP+N+GAT 
Sbjct  50   SLAIETSFKLPAPMPTWPPGEGFAGGTIDLGGGLEVCQISSFTKVWATHEGGPDNLGATF  109

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN----GEILKPPTDYTLVWSS  1
            FEPS +P+ FCMLG Y+QPN +PL GWVL GKDN     G  LK P DYTLVWSS
Sbjct  110  FEPSPMPEEFCMLGCYSQPNKKPLFGWVLAGKDNTNNPLGGALKKPIDYTLVWSS  164



>ref|XP_002269745.2| PREDICTED: uncharacterized protein LOC100242579 isoform X1 [Vitis 
vinifera]
Length=590

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 89/115 (77%), Gaps = 5/115 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGATI  154
            +L I+T+FKLP+P+PTWP G GF  G IDLGG L+VCQIS+  K+W ++EGGP+N+GAT 
Sbjct  50   SLAIETSFKLPAPMPTWPPGEGFAGGTIDLGGGLEVCQISSFTKVWATHEGGPDNLGATF  109

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN----GEILKPPTDYTLVWSS  1
            FEPS +P+ FCMLG Y+QPN +PL GWVL GKDN     G  LK P DYTLVWSS
Sbjct  110  FEPSPMPEEFCMLGCYSQPNKKPLFGWVLAGKDNTNNPLGGALKKPIDYTLVWSS  164



>ref|XP_010053627.1| PREDICTED: uncharacterized protein LOC104442037 [Eucalyptus grandis]
 gb|KCW77971.1| hypothetical protein EUGRSUZ_D02217 [Eucalyptus grandis]
Length=554

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            PI+T FKLPSPLPTWP G GF  G IDLGGL   ++S+L K+W ++EGGP+N+GAT FEP
Sbjct  20   PIETAFKLPSPLPTWPHGTGFALGTIDLGGLVASRVSSLNKVWAAHEGGPDNLGATFFEP  79

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            S +P+GF ML  Y Q N++PL+GWVL GKD +G  L+ PTDYTLVWSS
Sbjct  80   SKLPEGFFMLACYGQANDKPLNGWVLAGKDGSGGALRKPTDYTLVWSS  127



>emb|CDP20933.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            PI+T FKLPSPLP WP G GF SG IDLGGL++CQ+S   K+W ++EGGP+N+GAT FEP
Sbjct  24   PIETMFKLPSPLPAWPQGAGFASGTIDLGGLRICQVSTFNKVWATHEGGPDNLGATFFEP  83

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGE-ILKPPTDYTLVWSS  1
            SSIP GF  +G Y+QPNN PL GWVL  KD ++G+ IL  PTDYTL+WSS
Sbjct  84   SSIPVGFFTVGYYSQPNNSPLFGWVLAAKDASSGQGILSKPTDYTLIWSS  133



>ref|XP_010934618.1| PREDICTED: uncharacterized protein LOC105054732 [Elaeis guineensis]
Length=548

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
             LP++++FKLPSPLP+WPSGGGF  G IDLGGL+VCQ+S+  K+W S+EGG ++ GAT F
Sbjct  17   VLPVESSFKLPSPLPSWPSGGGFAKGVIDLGGLEVCQVSSFTKVWASHEGGEDDSGATFF  76

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGEILKPPTDYTLVWSS  1
            +PS IP GF +LGSYAQ N++PL GWVLV +D  NG  L  P DYTLVWSS
Sbjct  77   DPSPIPSGFSLLGSYAQSNSRPLFGWVLVARDTTNGGNLAKPVDYTLVWSS  127



>ref|XP_002325025.1| hypothetical protein POPTR_0018s09440g [Populus trichocarpa]
 gb|EEF03590.1| hypothetical protein POPTR_0018s09440g [Populus trichocarpa]
Length=546

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLG-GLQVCQISNLKKIWRSYEGGPNNVGATI  154
             LPI T FKLPSPLP+ P G GFG+G I+LG GLQVCQ+ +L KIW + EGGP+N+GAT 
Sbjct  11   ALPIATPFKLPSPLPSLPQGEGFGNGIINLGSGLQVCQVVSLNKIWATNEGGPDNLGATF  70

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            FEPS +P GF MLG Y+QPNN+ L GWVL GKD  GE L  P DYTLVWSS
Sbjct  71   FEPSQMPQGFSMLGCYSQPNNRMLHGWVLAGKDETGEALTKPVDYTLVWSS  121



>emb|CDP14946.1| unnamed protein product [Coffea canephora]
Length=550

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 85/114 (75%), Gaps = 5/114 (4%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LP+ +TF+ P PLPTWP GGGF  GYIDLGGL V QI+  KKIW  Y+GGP ++GAT +E
Sbjct  6    LPVHSTFEFPFPLPTWPPGGGFARGYIDLGGLHVYQITTFKKIWGVYQGGPKDLGATFYE  65

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-----NNGEILKPPTDYTLVWSS  1
            PS IPDGF MLGSY+QPN+QPL G +LVGKD        E LK P DYTLVWSS
Sbjct  66   PSEIPDGFFMLGSYSQPNDQPLFGSLLVGKDVANATGQPETLKSPIDYTLVWSS  119



>ref|XP_004303088.1| PREDICTED: uncharacterized protein LOC101300074 [Fragaria vesca 
subsp. vesca]
Length=556

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 91/128 (71%), Gaps = 13/128 (10%)
 Frame = -1

Query  345  MGNIPTL-------PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSY  187
            MGN  +L       PI+TTFKLPSPLP WPSGGGF +G I+LGGLQVCQIS+  K+W ++
Sbjct  1    MGNCLSLSSSTKATPIETTFKLPSPLPAWPSGGGFANGIINLGGLQVCQISSFNKVWATH  60

Query  186  EGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE------ILKPPT  25
            EGGP+N+GAT FEPS +P GF MLG Y+QPNN+PL GW L  K  + +       L+ P 
Sbjct  61   EGGPDNIGATFFEPSPLPQGFYMLGCYSQPNNKPLFGWALAAKAEDDQPSSPSPALQQPV  120

Query  24   DYTLVWSS  1
            DYT VWSS
Sbjct  121  DYTRVWSS  128



>ref|XP_010099772.1| hypothetical protein L484_010959 [Morus notabilis]
 gb|EXB80390.1| hypothetical protein L484_010959 [Morus notabilis]
Length=536

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 84/115 (73%), Gaps = 6/115 (5%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LP+D+ FKLPS LP+ P G GF SG IDLGG+QVCQIS   K+W + EGGP+N+GAT FE
Sbjct  17   LPVDSIFKLPSALPSLPPGDGFASGRIDLGGIQVCQISTFNKVWATQEGGPDNLGATFFE  76

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN------NGEILKPPTDYTLVWSS  1
            PS IP+GF MLG Y+QPNN+PL GW L  KDN      NG  L  P DY+LVWSS
Sbjct  77   PSPIPEGFHMLGCYSQPNNKPLFGWALAAKDNNEGGSTNGNALSKPVDYSLVWSS  131



>ref|XP_011007114.1| PREDICTED: uncharacterized protein LOC105112912 [Populus euphratica]
Length=546

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLG-GLQVCQISNLKKIWRSYEGGPNNVGATI  154
             LPI T FKLPSPLP+ P G GFG+G I LG GLQVCQ+ +L KIW + EGGP+N+GAT 
Sbjct  11   ALPIATPFKLPSPLPSLPQGEGFGNGIIHLGSGLQVCQVVSLNKIWATNEGGPDNLGATF  70

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            FEPS +P GF MLG Y+QPNN+ L GWVL GKD  G+ L  P DYTLVWSS
Sbjct  71   FEPSQMPQGFSMLGCYSQPNNRMLHGWVLAGKDETGDALTKPVDYTLVWSS  121



>ref|XP_004488551.1| PREDICTED: uncharacterized protein LOC101507229 [Cicer arietinum]
Length=539

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            +LPIDTTFKLP+ LP WP GG FGSG IDLGGL+V QIS   KIW + EGG N+ GAT F
Sbjct  12   SLPIDTTFKLPANLPVWPQGGEFGSGIIDLGGLKVSQISTFNKIWTTLEGGQNDEGATFF  71

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            EP  IP+GF  LG Y+QPNN+ L GWVLV KD +   LK P DYTLVW+S
Sbjct  72   EPIGIPEGFFTLGHYSQPNNKSLFGWVLVAKDESNGALKKPIDYTLVWTS  121



>gb|KEH38307.1| DUF946 family protein [Medicago truncatula]
Length=541

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPIDTTFKLP+ +P+WP GGGFG+G IDLG L+V QIS   KIW + EGG  ++GAT FE
Sbjct  14   LPIDTTFKLPANIPSWPQGGGFGNGIIDLGELKVSQISTFNKIWTTLEGGQGDLGATFFE  73

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            P+ IP GF  LG Y+QPNN+PL GWVLV KD +   LK P DYTLVWSS
Sbjct  74   PTGIPQGFFTLGHYSQPNNKPLFGWVLVAKDESNGALKKPIDYTLVWSS  122



>ref|XP_008235570.1| PREDICTED: uncharacterized protein LOC103334389 [Prunus mume]
Length=569

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 87/122 (71%), Gaps = 12/122 (10%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
             LPI+TTF+LP+PLP+WP G GF SG IDLGGLQV QIS+  K+W +YEGGP+N+GA+ F
Sbjct  20   ALPIETTFRLPAPLPSWPPGNGFASGSIDLGGLQVYQISSFTKVWATYEGGPDNLGASFF  79

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE------------ILKPPTDYTLVW  7
            EPS +P GF MLG Y+QPNN+PLSGW L  K    +            +LK P DYTLVW
Sbjct  80   EPSPLPQGFYMLGCYSQPNNKPLSGWALAAKSTKHKDEDEYEDEDDHLLLKKPLDYTLVW  139

Query  6    SS  1
            +S
Sbjct  140  NS  141



>ref|XP_006858981.1| hypothetical protein AMTR_s00068p00125530 [Amborella trichopoda]
 gb|ERN20448.1| hypothetical protein AMTR_s00068p00125530 [Amborella trichopoda]
Length=537

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGAT  157
            +  +P+DT FKLPS LP+WP G GFG+G I LGGL++ Q+S   K+W S+EGGPNN GAT
Sbjct  12   VKLMPVDTPFKLPSTLPSWPPGSGFGTGTIALGGLELRQVSTFSKVWASHEGGPNNTGAT  71

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
             F PSSIP GF  LG+Y+QPNNQPL GWVLV KDN+G IL  P +++L+
Sbjct  72   FFTPSSIPSGFYALGAYSQPNNQPLFGWVLVAKDNDGSILAKPLNFSLI  120



>ref|XP_007218959.1| hypothetical protein PRUPE_ppa003559mg [Prunus persica]
 gb|EMJ20158.1| hypothetical protein PRUPE_ppa003559mg [Prunus persica]
Length=565

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 87/124 (70%), Gaps = 8/124 (6%)
 Frame = -1

Query  348  VMGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNN  169
            V      LPI+TTFKLP+PLP+WP G GF S  IDLGGLQV QIS+  K+W ++EGGP+N
Sbjct  14   VFKKSKALPIETTFKLPAPLPSWPPGDGFASESIDLGGLQVYQISSFSKVWSTHEGGPDN  73

Query  168  VGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE--------ILKPPTDYTL  13
            +GA+ FEPS +P GF MLG Y+QPNN+PLSGW L  K    +        +LK P DYTL
Sbjct  74   LGASFFEPSPLPKGFYMLGCYSQPNNKPLSGWALAAKSTKDKDEDEDDHPLLKKPLDYTL  133

Query  12   VWSS  1
            VW+S
Sbjct  134  VWNS  137



>ref|XP_008231390.1| PREDICTED: uncharacterized protein LOC103330573 [Prunus mume]
 ref|XP_008231391.1| PREDICTED: uncharacterized protein LOC103330573 [Prunus mume]
 ref|XP_008231392.1| PREDICTED: uncharacterized protein LOC103330573 [Prunus mume]
Length=565

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 87/124 (70%), Gaps = 8/124 (6%)
 Frame = -1

Query  348  VMGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNN  169
            V      LPI+TTFKLP+PLP+WP G GF S  IDLGGLQV QIS+  K+W ++EGGP+N
Sbjct  14   VFKKSKALPIETTFKLPAPLPSWPPGDGFASESIDLGGLQVYQISSFSKVWATHEGGPDN  73

Query  168  VGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE--------ILKPPTDYTL  13
            +GA+ FEPS +P GF MLG Y+QPNN+PLSGW L  K    +        +LK P DYTL
Sbjct  74   LGASFFEPSPLPQGFYMLGCYSQPNNKPLSGWALAAKSTKDKDEDEDDHPLLKKPLDYTL  133

Query  12   VWSS  1
            VW+S
Sbjct  134  VWNS  137



>ref|XP_010111946.1| hypothetical protein L484_004609 [Morus notabilis]
 gb|EXC32127.1| hypothetical protein L484_004609 [Morus notabilis]
Length=573

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 83/115 (72%), Gaps = 6/115 (5%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LPID+ FKLPS +P+ P G GF SG I LGG+QVCQIS   K+W ++EGGP N+GAT FE
Sbjct  22   LPIDSIFKLPSAVPSLPPGDGFASGRIGLGGIQVCQISTFYKVWATHEGGPGNLGATFFE  81

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN------NGEILKPPTDYTLVWSS  1
            PS IP+GF MLG Y+QPNN+PL GW L  KD+      NG  L  P DY+LVWSS
Sbjct  82   PSPIPEGFHMLGCYSQPNNKPLFGWALAAKDDSGDESTNGSALSKPVDYSLVWSS  136



>ref|XP_010276359.1| PREDICTED: uncharacterized protein LOC104611127 [Nelumbo nucifera]
Length=545

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            PI+T FKLPSPLP+WP G GF +G I LGG++VC +S   K+W  +EGGP N+GAT FEP
Sbjct  15   PIETIFKLPSPLPSWPRGDGFATGIISLGGVEVCLVSTFTKVWAVHEGGPGNLGATFFEP  74

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNG----EILKPPTDYTLVWSS  1
            S IP GF MLG Y+QPNN PL GW L GKD+ G    E L+ P DYTLVW+S
Sbjct  75   SPIPAGFFMLGCYSQPNNVPLFGWALAGKDDGGDPSTEALQTPLDYTLVWNS  126



>emb|CDX83433.1| BnaA03g20730D [Brassica napus]
Length=551

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGAT  157
            +  LP++TTFK PSPLPT+  GGGF  G IDLGGL+V Q+    K+W +YEGGP+N+G T
Sbjct  15   LKALPVETTFKFPSPLPTFTQGGGFAKGTIDLGGLEVSQVPTFNKVWSTYEGGPDNLGVT  74

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGEILKPPTDYTLV  10
             FEPSS+P GF +LG YAQPNN+ L GWVLV KD ++   LKPP DYTLV
Sbjct  75   FFEPSSVPTGFSILGYYAQPNNRQLFGWVLVAKDLSSNNTLKPPVDYTLV  124



>ref|XP_010923372.1| PREDICTED: uncharacterized protein LOC105046482 [Elaeis guineensis]
Length=563

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = -1

Query  327  LPIDTTF-KLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            LP++++F KLPSPLP+WPSGGGF  G IDLGGL+VCQ+S   K+W ++EGG ++ GAT F
Sbjct  31   LPVESSFFKLPSPLPSWPSGGGFAKGIIDLGGLEVCQVSTFTKVWATHEGGQDDSGATFF  90

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE-ILKPPTDYTLVWSS  1
             PS IP GF +LG YAQPNN+PL G VLVG+D + E  L  P DYTL+WSS
Sbjct  91   LPSPIPTGFSLLGCYAQPNNRPLFGCVLVGRDTSNEGTLAKPVDYTLLWSS  141



>ref|XP_003546829.1| PREDICTED: uncharacterized protein LOC100806731 [Glycine max]
 gb|KHN48861.1| hypothetical protein glysoja_019370 [Glycine soja]
Length=548

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 5/118 (4%)
 Frame = -1

Query  339  NIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
             I TLPIDTTFKLP+ +P WP GGGF +G I++GGL++ QIS   K+W++ EGGP + GA
Sbjct  9    KIETLPIDTTFKLPANIPVWPQGGGFATGTINIGGLKLFQISTFNKVWKTLEGGPGDAGA  68

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-----NNGEILKPPTDYTLVWSS  1
              FEP+ IP+GF  LG Y+QPNN+PL G +LV KD     +N   LK P DYTLVWSS
Sbjct  69   AFFEPAGIPEGFFTLGHYSQPNNKPLFGSILVAKDETSSGDNNGALKKPIDYTLVWSS  126



>emb|CDX95597.1| BnaC03g24780D [Brassica napus]
Length=489

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGAT  157
            +  LP++T FK PSPLPT+  GG F +G IDLGGL V Q+    K+W +YEGGPNN+G T
Sbjct  15   LKALPVETAFKFPSPLPTFTQGGRFANGTIDLGGLDVSQVPTFNKVWSTYEGGPNNLGVT  74

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGEILKPPTDYTLV  10
             FEPSS+P GF +LG YAQPNN+ L GWVLV KD ++   LKPP DYTLV
Sbjct  75   FFEPSSVPTGFSILGYYAQPNNRQLFGWVLVAKDLSSNNTLKPPVDYTLV  124



>ref|XP_007149124.1| hypothetical protein PHAVU_005G043000g [Phaseolus vulgaris]
 gb|ESW21118.1| hypothetical protein PHAVU_005G043000g [Phaseolus vulgaris]
Length=517

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 6/115 (5%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGATI  154
            +LPI+TTF LP+ +P WP GGGF SG IDLGG L V QI+   K+W ++EGGPNN+GAT 
Sbjct  13   SLPIETTFNLPTDIPVWPPGGGFASGIIDLGGGLLVSQITTFNKVWTTFEGGPNNLGATF  72

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN----NGEILKPPTDYTLVWSS  1
            FEP+ +  GF MLG Y QPNN PL GWVLVGKDN    NG + K P DY LVW++
Sbjct  73   FEPTGLSQGFFMLGCYCQPNNMPLHGWVLVGKDNSSISNGALAK-PVDYKLVWTT  126



>ref|XP_009142253.1| PREDICTED: uncharacterized protein LOC103866129 [Brassica rapa]
Length=552

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGAT  157
            +  LP++T FK PSPLPT P G GF    IDLGGL+V Q+S   K+W +YEGGP+N+GAT
Sbjct  20   LKALPVETPFKFPSPLPTLPQGNGFAKQTIDLGGLEVSQVSTFNKVWSTYEGGPDNLGAT  79

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
             FEPSS+P GF +LG YAQPNN  L GWVL  +D + + LK P DYTLV
Sbjct  80   FFEPSSVPSGFSILGYYAQPNNHQLFGWVLTARDLSSDTLKSPLDYTLV  128



>gb|KHN21339.1| hypothetical protein glysoja_026540 [Glycine soja]
Length=540

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGATIF  151
            LPI+TTFKLP+ +P WP GGGF +G IDLGG L V QIS   K+W +YEGGPNN+GAT F
Sbjct  36   LPIETTFKLPADIPVWPPGGGFATGIIDLGGGLLVSQISTFNKVWTTYEGGPNNLGATFF  95

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE---ILKPPTDYTLVWSS  1
            EP+ + +GF MLG Y QPNN+PL G VLVGKDN+      L  P DY LVW++
Sbjct  96   EPTGLSEGFFMLGCYCQPNNKPLHGCVLVGKDNSSTSNGALAEPVDYKLVWNT  148



>ref|XP_006585381.1| PREDICTED: uncharacterized protein LOC100783235 [Glycine max]
Length=518

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGATIF  151
            LPI+TTFKLP+ +P WP GGGF +G IDLGG L V QIS   K+W +YEGGPNN+GAT F
Sbjct  14   LPIETTFKLPADIPVWPPGGGFATGIIDLGGGLLVSQISTFNKVWTTYEGGPNNLGATFF  73

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE---ILKPPTDYTLVWSS  1
            EP+ + +GF MLG Y QPNN+PL G VLVGKDN+      L  P DY LVW++
Sbjct  74   EPTGLSEGFFMLGCYCQPNNKPLHGCVLVGKDNSSTSNGALAEPVDYKLVWNT  126



>ref|NP_030964.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK93630.1| unknown protein [Arabidopsis thaliana]
 gb|AAC16076.2| expressed protein [Arabidopsis thaliana]
 gb|AAM91718.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10397.1| uncharacterized protein AT2G44260 [Arabidopsis thaliana]
Length=553

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGATI  154
             LP+D  FK PSPLPT+  G GF  G IDLGG L+V Q+S   K+W +YEGGP+N+GAT 
Sbjct  22   ALPVDAAFKFPSPLPTFTRGDGFAKGTIDLGGGLEVSQVSTFNKVWSTYEGGPDNLGATF  81

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            FEPSSIP GF +LG YAQPNN+ L GWVL  +D +   LKPP DYTLV
Sbjct  82   FEPSSIPSGFSILGYYAQPNNRNLFGWVLTARDLSSNTLKPPVDYTLV  129



>ref|XP_003532908.1| PREDICTED: uncharacterized protein LOC100792266 [Glycine max]
 gb|KHN21373.1| hypothetical protein glysoja_026574 [Glycine soja]
Length=549

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = -1

Query  339  NIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
             I TLPIDTTFKLP+ +P WP GG F +G I++GGL++ QIS   K+W++ EGGP + GA
Sbjct  9    KIETLPIDTTFKLPANIPVWPQGGEFATGTINIGGLKLFQISIFNKVWKTLEGGPGDAGA  68

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD------NNGEILKPPTDYTLVWSS  1
            T FEP+ +P+GF  LG Y+QPNN+PL G +LV KD      +N   LK P DYTLVWSS
Sbjct  69   TFFEPAGVPEGFFTLGHYSQPNNKPLFGSILVAKDESSSSGDNNGALKKPVDYTLVWSS  127



>gb|KHN49063.1| hypothetical protein glysoja_031274 [Glycine soja]
Length=518

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 82/111 (74%), Gaps = 4/111 (4%)
 Frame = -1

Query  321  IDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            I+TTFKLP+ +P WP GGGF +  IDLGG L V QIS   K+W +YEGGPNN+GAT FEP
Sbjct  16   IETTFKLPADIPVWPPGGGFATSIIDLGGGLLVSQISTFNKVWTTYEGGPNNLGATFFEP  75

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEI---LKPPTDYTLVWSS  1
            + + +GF MLG Y QPNN+PL GWVLVGKDN+  +   L  P DY LVW++
Sbjct  76   TGLSEGFFMLGCYCQPNNKPLHGWVLVGKDNSSTLNGALAKPVDYKLVWNT  126



>ref|XP_010506342.1| PREDICTED: uncharacterized protein LOC104782970 [Camelina sativa]
Length=553

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGA  160
            +  LP++T FK PSPLPT+  G GF    IDLGG L+V Q+S   K+W +YEGGP+N+GA
Sbjct  20   LKALPVETAFKFPSPLPTFTQGDGFAKRTIDLGGGLEVSQVSTFNKVWSTYEGGPDNLGA  79

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            T FEPSSIP GF +LG YAQPNN+ L GWVL  +D +   LKPP DYTLV
Sbjct  80   TFFEPSSIPSGFSILGHYAQPNNRKLFGWVLTARDFSSNTLKPPVDYTLV  129



>ref|XP_003548708.2| PREDICTED: uncharacterized protein LOC100808166 [Glycine max]
Length=561

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 82/116 (71%), Gaps = 6/116 (5%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLP--TWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGAT  157
            +LPIDT FKLP P+   +WP GG F SG IDLGGLQV QIS   K+W +Y GGP+N G T
Sbjct  25   SLPIDTIFKLPVPVANSSWPQGGNFASGIIDLGGLQVSQISTFNKVWGTYGGGPDNQGFT  84

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLVWSS  1
            +FE S IP GF MLGSY QPNN+PL GWVLV KD     +   LK P DYTLVW+S
Sbjct  85   MFEASGIPQGFFMLGSYCQPNNKPLFGWVLVAKDVSKSTSNPTLKQPIDYTLVWNS  140



>ref|XP_006598236.1| PREDICTED: uncharacterized protein LOC102669203 [Glycine max]
Length=518

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 82/111 (74%), Gaps = 4/111 (4%)
 Frame = -1

Query  321  IDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            I+TTFKLP+ +P WP GGGF +  IDLGG L + QIS   K+W +YEGGPNN+GAT FEP
Sbjct  16   IETTFKLPADIPVWPPGGGFATSIIDLGGGLLLSQISTFNKVWTTYEGGPNNLGATFFEP  75

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEI---LKPPTDYTLVWSS  1
            + + +GF MLG Y QPNN+PL GWVLVGKDN+  +   L  P DY LVW++
Sbjct  76   TGLSEGFFMLGCYCQPNNKPLHGWVLVGKDNSSTLNGALAKPVDYKLVWNT  126



>ref|XP_008813096.1| PREDICTED: uncharacterized protein LOC103723822 [Phoenix dactylifera]
Length=547

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
             LP++++FKLPSPLP+WPSGGGF  G +DLGGL+VCQ+S+  K+W S+EGG    GA+ F
Sbjct  16   ALPVESSFKLPSPLPSWPSGGGFSKGVMDLGGLEVCQVSSFTKVWASHEGGEGGSGASFF  75

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGEILKPPTDYTLVWSS  1
             PS IP GF MLG YAQPNN+PL GWVLV +D ++G  L  P DYTLVWSS
Sbjct  76   NPSPIPSGFSMLGCYAQPNNRPLFGWVLVARDTSSGGTLAKPVDYTLVWSS  126



>ref|XP_006295574.1| hypothetical protein CARUB_v10024679mg [Capsella rubella]
 gb|EOA28472.1| hypothetical protein CARUB_v10024679mg [Capsella rubella]
Length=552

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGA  160
            +  LP++T FK PSPLPT+  G GF    IDLGG L+V Q+S   K+W +YEGGP+N+GA
Sbjct  20   LKALPVETVFKFPSPLPTFTQGDGFAKQTIDLGGGLEVSQVSTFNKVWSTYEGGPDNLGA  79

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            T FEPSSIP GF +LG YAQPNN+ L GWVL  +D +   LKPP DYTL+
Sbjct  80   TFFEPSSIPSGFSILGYYAQPNNRQLFGWVLTARDLSSNTLKPPLDYTLI  129



>ref|XP_010512857.1| PREDICTED: uncharacterized protein LOC104788773, partial [Camelina 
sativa]
Length=591

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGA  160
            +  LP++T FK PSPLPT+  G GF    IDLGG L+V Q+S   K+W  YEGGP+N+GA
Sbjct  57   LKALPVETAFKFPSPLPTFTQGDGFAKRTIDLGGGLEVSQVSTFNKVWSIYEGGPDNLGA  116

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            T FEPSSIP GF +LG YAQPNN+ L GWVL  +D +   +KPP DYTLV
Sbjct  117  TFFEPSSIPSGFSILGHYAQPNNRKLFGWVLTARDLSSNTMKPPVDYTLV  166



>gb|KHM99442.1| hypothetical protein glysoja_045356 [Glycine soja]
Length=556

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 81/116 (70%), Gaps = 6/116 (5%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLP--TWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGAT  157
            +LPIDT FKLP P    +WP GG F SG IDLGGLQV QIS   K+W +Y GGP+N G T
Sbjct  20   SLPIDTIFKLPVPDANSSWPQGGNFASGIIDLGGLQVSQISTFNKVWGTYGGGPDNQGFT  79

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLVWSS  1
            +FE S IP GF MLGSY QPNN+PL GWVLV KD     +   LK P DYTLVW+S
Sbjct  80   MFEASGIPQGFFMLGSYCQPNNKPLFGWVLVAKDVSKSTSNPTLKQPIDYTLVWNS  135



>ref|XP_006397604.1| hypothetical protein EUTSA_v10001386mg [Eutrema salsugineum]
 gb|ESQ39057.1| hypothetical protein EUTSA_v10001386mg [Eutrema salsugineum]
Length=554

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTW-PSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
            +  LP++T FK PSPLPT+   GGGF    IDLGGL+V Q+S   K+W +YEGGPNN+GA
Sbjct  20   LKALPVETAFKFPSPLPTFTHQGGGFAKQTIDLGGLEVSQVSTFSKVWSTYEGGPNNLGA  79

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            T FEPS IP GF +LG YAQ NN+ L GWVL  +D +   LKPP DYTLV
Sbjct  80   TFFEPSLIPSGFSILGYYAQSNNRQLFGWVLTARDLSSNTLKPPIDYTLV  129



>ref|XP_010518022.1| PREDICTED: uncharacterized protein LOC104793366 [Camelina sativa]
Length=552

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGA  160
            +  LP++T FK PSPLPT+  G GF    IDLGG L+V Q+S   K+W +YEGGP+N+GA
Sbjct  20   LKALPVETPFKFPSPLPTFTQGDGFAKRTIDLGGGLEVSQVSTFNKVWSTYEGGPDNLGA  79

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            T FEPSS P GF +LG YAQPNN+ L GWVL  +D +   LKPP DYTLV
Sbjct  80   TFFEPSSFPSGFSILGHYAQPNNRKLFGWVLTARDLSSNTLKPPVDYTLV  129



>ref|XP_010055277.1| PREDICTED: uncharacterized protein LOC104443521 isoform X1 [Eucalyptus 
grandis]
Length=625

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 84/145 (58%), Gaps = 37/145 (26%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSG---------------------------------GGFGSGYID  244
            PI+TTFKLPSPLP WPSG                                  GF +G ID
Sbjct  54   PIETTFKLPSPLPAWPSGNSLLCKVWFSRVVLVANYMMKFLRSPCSSYYTGSGFATGTID  113

Query  243  LGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLV  64
             GGLQVCQ+S+  KIW ++EGGPNN+GAT FEPS +P+GF +LG Y QPNNQ L GWVLV
Sbjct  114  FGGLQVCQVSSFNKIWATHEGGPNNLGATFFEPSQVPEGFSVLGFYCQPNNQALHGWVLV  173

Query  63   GKDNNGE----ILKPPTDYTLVWSS  1
            GKD   +     LK P DY   W+S
Sbjct  174  GKDETDDPSNGALKEPIDYAPTWNS  198



>emb|CBI18663.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGATI  154
            +L I+T+FKLP+P+PTWP G GF  G IDLGG L+VCQIS+  K+W ++EGGP+N+GAT 
Sbjct  19   SLAIETSFKLPAPMPTWPPGEGFAGGTIDLGGGLEVCQISSFTKVWATHEGGPDNLGATF  78

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN  52
            FEPS +P+ FCMLG Y+QPN +PL GWVL GKDN
Sbjct  79   FEPSPMPEEFCMLGCYSQPNKKPLFGWVLAGKDN  112



>ref|XP_010055278.1| PREDICTED: uncharacterized protein LOC104443521 isoform X2 [Eucalyptus 
grandis]
Length=624

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 84/145 (58%), Gaps = 37/145 (26%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSG---------------------------------GGFGSGYID  244
            PI+TTFKLPSPLP WPSG                                  GF +G ID
Sbjct  53   PIETTFKLPSPLPAWPSGNSLLCKVWFSRVVLVANYMMKFLRSPCSSYYTGSGFATGTID  112

Query  243  LGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLV  64
             GGLQVCQ+S+  KIW ++EGGPNN+GAT FEPS +P+GF +LG Y QPNNQ L GWVLV
Sbjct  113  FGGLQVCQVSSFNKIWATHEGGPNNLGATFFEPSQVPEGFSVLGFYCQPNNQALHGWVLV  172

Query  63   GKDNNGE----ILKPPTDYTLVWSS  1
            GKD   +     LK P DY   W+S
Sbjct  173  GKDETDDPSNGALKEPIDYAPTWNS  197



>ref|XP_006585380.1| PREDICTED: uncharacterized protein LOC100783773 [Glycine max]
Length=579

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLP-TWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATI  154
             LPI++ FKLP+P+  +WP GG F SG IDLGGLQVC+ S   K+W +Y GGP++ G +I
Sbjct  48   ALPINSIFKLPAPVTNSWPPGGNFASGTIDLGGLQVCEASTFNKVWGTYGGGPDDQGFSI  107

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEI----LKPPTDYTLVWSS  1
            FEPS +P GF MLGSY+QPNN+PLSG+VLV KD +       LK P DYTLVW+S
Sbjct  108  FEPSGVPKGFSMLGSYSQPNNKPLSGYVLVAKDVSTNTSNPSLKQPLDYTLVWNS  162



>gb|AES66093.2| DUF946 family protein [Medicago truncatula]
Length=553

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 83/125 (66%), Gaps = 4/125 (3%)
 Frame = -1

Query  363  VEEL*VMGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYE  184
            V+ L       + PIDTTFKLP     WP G GF +G IDLGGLQV Q+S   K+W +Y+
Sbjct  11   VDNLFKRKQFRSRPIDTTFKLPVAPNAWPPGSGFANGIIDLGGLQVSQVSTFNKVWATYD  70

Query  183  GGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYT  16
            GGP+N GATIFEP+ IP GF MLG Y+QPNN+PL G+VLV KD         LK P DYT
Sbjct  71   GGPDNQGATIFEPTGIPQGFSMLGCYSQPNNKPLFGYVLVAKDVSSSTTNSTLKKPIDYT  130

Query  15   LVWSS  1
            LV ++
Sbjct  131  LVLNT  135



>ref|XP_003595842.1| hypothetical protein MTR_2g062430 [Medicago truncatula]
 gb|ABN08108.1| Protein of unknown function DUF946, plant [Medicago truncatula]
Length=561

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 4/114 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            + PIDTTFKLP     WP G GF +G IDLGGLQV Q+S   K+W +Y+GGP+N GATIF
Sbjct  30   SRPIDTTFKLPVAPNAWPPGSGFANGIIDLGGLQVSQVSTFNKVWATYDGGPDNQGATIF  89

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLVWSS  1
            EP+ IP GF MLG Y+QPNN+PL G+VLV KD         LK P DYTLV ++
Sbjct  90   EPTGIPQGFSMLGCYSQPNNKPLFGYVLVAKDVSSSTTNSTLKKPIDYTLVLNT  143



>gb|ABN08110.1| Protein of unknown function DUF946, plant [Medicago truncatula]
Length=556

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            + PID TFKLP    +WP G GF  G++DLGGLQV Q S   K+W +YEGG +N GA+++
Sbjct  20   SRPIDYTFKLPIAQTSWPKGNGFAGGFLDLGGLQVYQASTFSKVWGAYEGGLDNQGASVY  79

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLV  10
            EP+ IP GF MLGSY+QPNN+PL G+V V KD      G  LKPP DYTLV
Sbjct  80   EPTGIPKGFSMLGSYSQPNNKPLFGYVFVAKDVSSSTTGRTLKPPVDYTLV  130



>emb|CAN82512.1| hypothetical protein VITISV_002153 [Vitis vinifera]
Length=913

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 77/102 (75%), Gaps = 5/102 (5%)
 Frame = -1

Query  291  LPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPDGFCML  115
            +PTWP G GF  G IDLGG L+VCQIS+  K+W ++EGGP+N+GAT FEPS +P+ FCML
Sbjct  1    MPTWPPGEGFAGGTIDLGGGLEVCQISSFTKVWATHEGGPDNLGATFFEPSPMPEEFCML  60

Query  114  GSYAQPNNQPLSGWVLVGKDNN----GEILKPPTDYTLVWSS  1
            G Y+QPN +PL GWVL GKDN     G  LK P DYTLVWSS
Sbjct  61   GCYSQPNKKPLFGWVLAGKDNTNNPLGGALKKPIDYTLVWSS  102



>ref|XP_003595840.1| hypothetical protein MTR_2g062410 [Medicago truncatula]
 gb|AES66091.1| DUF946 family protein [Medicago truncatula]
Length=586

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            + PID TFKLP    +WP G GF  G++DLGGLQV Q S   K+W +YEGG +N GA+++
Sbjct  50   SRPIDYTFKLPIAQTSWPKGNGFAGGFLDLGGLQVYQASTFSKVWGAYEGGLDNQGASVY  109

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLV  10
            EP+ IP GF MLGSY+QPNN+PL G+V V KD      G  LKPP DYTLV
Sbjct  110  EPTGIPKGFSMLGSYSQPNNKPLFGYVFVAKDVSSSTTGRTLKPPVDYTLV  160



>gb|KHN21340.1| hypothetical protein glysoja_026541 [Glycine soja]
Length=557

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLP-TWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATI  154
             LPI++ FKLP+P+  +WP GG F SG IDLGGLQVC+ S   K+W +Y GGP++ G +I
Sbjct  26   ALPINSIFKLPAPVTNSWPPGGNFASGTIDLGGLQVCEASTFNKVWGTYGGGPDDQGFSI  85

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLVWSS  1
            FEPS +P GF MLGSY+QPNN+PL G+VLV KD     +   LK P DYTLVW+S
Sbjct  86   FEPSGVPKGFSMLGSYSQPNNKPLFGYVLVAKDVSTNTSNPSLKQPLDYTLVWNS  140



>ref|XP_009385974.1| PREDICTED: uncharacterized protein LOC103973198 [Musa acuminata 
subsp. malaccensis]
Length=551

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -1

Query  363  VEEL*VMGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYE  184
              +L V     +LPI T+FKLPSPLP+WP GG F  G IDLGGL+VCQ+S   ++W ++E
Sbjct  10   TRDLSVSRRRKSLPIQTSFKLPSPLPSWPPGGEFAQGIIDLGGLEVCQVSTFTQVWATHE  69

Query  183  GGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGEILKPPTDYTLVW  7
            GG + +GAT F+PS++P GF +LG YAQPNNQPL GWVLVG+D ++G+ L  P+DYTLVW
Sbjct  70   GGQDGLGATFFKPSTVPSGFSVLGYYAQPNNQPLFGWVLVGRDSSDGDTLAQPSDYTLVW  129

Query  6    SS  1
            SS
Sbjct  130  SS  131



>gb|KHG05345.1| Vacuolar sorting-associated protein 62 [Gossypium arboreum]
Length=554

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQI---SNLKKIWRSYEGGPNNVGA  160
             LPIDT F+LPSPLPTWP G GF SG IDLGG+ VCQ    S+  K+W ++EGGP N+GA
Sbjct  19   ALPIDTAFRLPSPLPTWPPGEGFASGSIDLGGIHVCQCGISSSSPKVWATHEGGPGNLGA  78

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWV--LVGKDNNGEILKPPTDYTLVWSS  1
            + FEPSSIPDG+ MLG Y QPNN+ LSGWV       ++  +LK P DYTLVWSS
Sbjct  79   SFFEPSSIPDGYYMLGCYGQPNNRLLSGWVLAAKDDSDDDSLLKQPIDYTLVWSS  133



>ref|XP_007156321.1| hypothetical protein PHAVU_003G276600g [Phaseolus vulgaris]
 gb|ESW28315.1| hypothetical protein PHAVU_003G276600g [Phaseolus vulgaris]
Length=553

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 82/116 (71%), Gaps = 7/116 (6%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLP--TWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGAT  157
            +LPI+TTFKLP P+   +WP GG F +G +DLGGLQV QIS   K+W +Y GGP+N G T
Sbjct  20   SLPIETTFKLPVPVAKSSWPPGGDFATGIVDLGGLQVSQISTFNKVWSTYGGGPDNQGFT  79

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLVWSS  1
            +FEP SIP GF MLG Y+QPNN+PL GWVL  KD         LK P D+TLVW+S
Sbjct  80   MFEP-SIPQGFSMLGCYSQPNNKPLFGWVLAAKDVCPNTRNPTLKQPIDFTLVWNS  134



>gb|KDP32271.1| hypothetical protein JCGZ_13196 [Jatropha curcas]
Length=508

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = -1

Query  276  SGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQP  97
            +G GFG+G IDLGGL+VCQIS+LKK+W ++EGGP+N+GA+ FEPS  P GF MLG Y+QP
Sbjct  3    TGDGFGNGSIDLGGLRVCQISSLKKVWATHEGGPDNLGASFFEPSETPQGFFMLGCYSQP  62

Query  96   NNQPLSGWVLVGKDNNG--EILKPPTDYTLVWSS  1
            NN+ L GWVL GKD     EILK P DYTLVWSS
Sbjct  63   NNRSLYGWVLAGKDEGTAQEILKKPLDYTLVWSS  96



>ref|NP_186837.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF03440.1|AC010797_16 hypothetical protein [Arabidopsis thaliana]
 gb|AAF14847.1|AC011664_29 hypothetical protein [Arabidopsis thaliana]
 gb|AEE73729.1| uncharacterized protein AT3G01880 [Arabidopsis thaliana]
Length=592

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 5/111 (5%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPS-GGGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNVG  163
            LP++T+FK PSPLP+ PS GG FG   ID+GGL+V QIS       ++WR+YEGGP+N+G
Sbjct  56   LPVETSFKFPSPLPSMPSDGGNFGKRSIDMGGLEVTQISISNSTSHRVWRTYEGGPDNMG  115

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
             +IFEP++IP  F  LG YAQPNN+ L GW+LV KD +G  L+PP DYT V
Sbjct  116  VSIFEPTTIPRNFFKLGFYAQPNNRQLFGWILVAKDVSGSNLRPPVDYTEV  166



>ref|XP_003610391.1| hypothetical protein MTR_4g131710 [Medicago truncatula]
 gb|AES92588.1| pre-mRNA processing protein PRP39, putative [Medicago truncatula]
Length=586

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            PIDT FKLP+   +WP G GF  G +DLGGLQV   S   KIW + +GGP++ GA++FEP
Sbjct  46   PIDTVFKLPTATTSWPKGNGFARGVLDLGGLQVSAASTFNKIWGAIDGGPDDKGASVFEP  105

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLVWSS  1
            + IP GF MLGSY+QPNN+PL G+VLV KD         LKPP DYT V  +
Sbjct  106  TGIPQGFSMLGSYSQPNNKPLFGYVLVAKDVSSSTTKSTLKPPIDYTFVLKA  157



>ref|XP_009354799.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103945924 
[Pyrus x bretschneideri]
Length=589

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 78/109 (72%), Gaps = 7/109 (6%)
 Frame = -1

Query  306  KLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPDG  127
            KLPS LP+WP G GF SG IDLGGL VCQIS+  K+W ++EGGP N+GA+ FEPS +P G
Sbjct  50   KLPSLLPSWPPGDGFASGMIDLGGLLVCQISSFNKVWATHEGGPGNLGASFFEPSPLPHG  109

Query  126  FCMLGSYAQPNNQPLSGWVLVG---KDNNGE----ILKPPTDYTLVWSS  1
            F MLG Y+QPNN P  GW L     KDN+ +    +L+ P D+TL+WSS
Sbjct  110  FYMLGCYSQPNNIPFYGWALAAKPTKDNDDDPSSPLLRQPVDFTLIWSS  158



>emb|CDY23425.1| BnaC04g49530D [Brassica napus]
Length=571

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 78/126 (62%), Gaps = 19/126 (15%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWP-------------------SGGGFGSGYIDLGGLQVCQISNL  208
             LP++T FK PSPLPT P                   SG GF    IDLGGL+V Q+S  
Sbjct  22   ALPVETPFKFPSPLPTLPQGNMNNIKDLDGFKLKIQSSGNGFAKRTIDLGGLEVSQVSTF  81

Query  207  KKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPP  28
             K+W +YEGGP+N+GAT FEPSS+P GF +LG YAQPNN  L GWVL  +D +   LK P
Sbjct  82   NKVWSTYEGGPDNLGATFFEPSSVPSGFSILGYYAQPNNHQLFGWVLTARDLSSNTLKSP  141

Query  27   TDYTLV  10
             DYTLV
Sbjct  142  LDYTLV  147



>ref|XP_002880097.1| hypothetical protein ARALYDRAFT_483546 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56356.1| hypothetical protein ARALYDRAFT_483546 [Arabidopsis lyrata subsp. 
lyrata]
Length=542

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -1

Query  333  PTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATI  154
            P+LPID+TF LPSPLP+WP G GFG G IDLGGL+V Q+    K+W  YEGG +N+GAT 
Sbjct  12   PSLPIDSTFNLPSPLPSWPPGEGFGQGRIDLGGLEVFQVEIFNKVWTVYEGGQDNLGATF  71

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWS  4
            FEPSSIP+GF +LG YAQPNN+ L G  LVGKD +G+ L+PP D+ L+WS
Sbjct  72   FEPSSIPEGFTILGFYAQPNNRKLFGRTLVGKDLSGDSLRPPVDFLLLWS  121



>ref|XP_008375114.1| PREDICTED: uncharacterized protein LOC103438346 [Malus domestica]
Length=566

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = -1

Query  348  VMGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNN  169
            V      LPI+TTFKLPSPLP+WP G GF SG IDLGGL VCQIS+  K+W ++EGGP N
Sbjct  14   VFKKTKALPIETTFKLPSPLPSWPPGNGFASGMIDLGGLLVCQISSFNKVWATHEGGPGN  73

Query  168  VGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVG---KDNNGE----ILKPPTDYTLV  10
            +GA+ FEPS +P GF MLG Y+QPNN+PL GW L     KDN+ +    +L+ P D+TLV
Sbjct  74   LGASFFEPSPLPQGFYMLGCYSQPNNKPLCGWALAAKQTKDNDDDPSSPLLRQPVDFTLV  133

Query  9    WSS  1
            WSS
Sbjct  134  WSS  136



>ref|XP_009385972.1| PREDICTED: uncharacterized protein LOC103973196 [Musa acuminata 
subsp. malaccensis]
Length=532

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            +LPI T+FKLPSPLP+WP GG F  G IDLGGL+VCQ+S   ++W ++EGG + +GAT F
Sbjct  2    SLPIQTSFKLPSPLPSWPPGGEFAQGIIDLGGLEVCQVSTFTQVWATHEGGQDGLGATFF  61

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGK-DNNGEILKPPTDYTLVWSS  1
            +PS++P GF +LG YAQPNNQPL GWVLVG+   +G  L  P+DYTLVWSS
Sbjct  62   KPSTVPSGFSVLGYYAQPNNQPLFGWVLVGRGSGDGNTLAQPSDYTLVWSS  112



>ref|XP_006369488.1| hypothetical protein POPTR_0001s23900g [Populus trichocarpa]
 gb|ERP66057.1| hypothetical protein POPTR_0001s23900g [Populus trichocarpa]
Length=530

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = -1

Query  270  GGFGSGYIDLG-GLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQPN  94
            GGFGSG IDLG GLQVCQIS+  K+W ++EGGP+++GA+ FEPS +P GF MLG Y+QPN
Sbjct  15   GGFGSGIIDLGDGLQVCQISSFNKVWATHEGGPDDLGASFFEPSQLPQGFSMLGCYSQPN  74

Query  93   NQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            N+ L GWVL G+D  G  LK P DYTLVWSS
Sbjct  75   NRSLYGWVLAGRDETGSALKQPIDYTLVWSS  105



>ref|XP_010675110.1| PREDICTED: uncharacterized protein LOC104891150 isoform X3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010675111.1| PREDICTED: uncharacterized protein LOC104891150 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=551

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
             L ID  F LPSPLP WP G GF SG +D GGL V +++   K+W +Y+GGP++ GAT F
Sbjct  11   ALAIDAKFTLPSPLPEWPLGNGFASGTMDFGGLVVAEVTTFDKVWATYDGGPDDQGATFF  70

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN---GEILKPPTDYTLVWSS  1
            EP+ +P+GF +LG Y+Q NN+PL G VLVGKD +      LK P DY LVWSS
Sbjct  71   EPTGLPEGFFLLGYYSQSNNRPLYGRVLVGKDTSNPANPALKWPIDYALVWSS  123



>ref|XP_002884254.1| hypothetical protein ARALYDRAFT_340259 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60513.1| hypothetical protein ARALYDRAFT_340259 [Arabidopsis lyrata subsp. 
lyrata]
Length=590

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 5/111 (5%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPS-GGGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNVG  163
            LP++TTFK PS LP+ PS GG FG   IDLGGL+V Q+S       ++WR+YEGGPNN+G
Sbjct  56   LPVETTFKSPSLLPSMPSDGGNFGKRSIDLGGLEVTQLSISNSTSHRVWRTYEGGPNNMG  115

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
             +IFEP+++P  F  LG YAQPNN+ L GW+LV KD  G  L+PP DYT V
Sbjct  116  VSIFEPTTLPRNFLKLGFYAQPNNRQLFGWILVAKDVAGSNLRPPVDYTEV  166



>ref|XP_010675108.1| PREDICTED: uncharacterized protein LOC104891150 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010675109.1| PREDICTED: uncharacterized protein LOC104891150 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=567

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
             L ID  F LPSPLP WP G GF SG +D GGL V +++   K+W +Y+GGP++ GAT F
Sbjct  27   ALAIDAKFTLPSPLPEWPLGNGFASGTMDFGGLVVAEVTTFDKVWATYDGGPDDQGATFF  86

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN---GEILKPPTDYTLVWSS  1
            EP+ +P+GF +LG Y+Q NN+PL G VLVGKD +      LK P DY LVWSS
Sbjct  87   EPTGLPEGFFLLGYYSQSNNRPLYGRVLVGKDTSNPANPALKWPIDYALVWSS  139



>ref|XP_006483670.1| PREDICTED: uncharacterized protein LOC102607172 [Citrus sinensis]
Length=536

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = -1

Query  276  SGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSI--PDGFCMLGSYA  103
            +G GFGSG IDLGGLQV QI++ KKIW ++EGGP+N G T FEPS+I  P GF MLG YA
Sbjct  8    AGEGFGSGTIDLGGLQVRQITSFKKIWATHEGGPDNAGTTFFEPSTIDIPPGFFMLGCYA  67

Query  102  QPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            QPNN PL GWVL  KD++G  LK P DYTLVWSS
Sbjct  68   QPNNTPLFGWVLAAKDSSGLSLKKPVDYTLVWSS  101



>emb|CDY30462.1| BnaA04g25630D [Brassica napus]
Length=572

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 78/129 (60%), Gaps = 20/129 (16%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTWPS--------------------GGGFGSGYIDLGGLQVCQI  217
            +  LP++T FK PSPLPT P                       GF    IDLGGL+V Q+
Sbjct  20   LKALPVETPFKFPSPLPTLPQEFRGNMNNIKDLDQSSQLVLSNGFAKQTIDLGGLEVSQV  79

Query  216  SNLKKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEIL  37
            S   K+W +YEGGP+N+GAT FEPSS+P GF +LG YAQPNN  L GWVL  +D + + L
Sbjct  80   STFNKVWSTYEGGPDNLGATFFEPSSVPSGFSILGYYAQPNNHQLFGWVLTARDLSSDTL  139

Query  36   KPPTDYTLV  10
            K P DYTLV
Sbjct  140  KSPLDYTLV  148



>ref|XP_003545952.1| PREDICTED: uncharacterized protein LOC100820073 [Glycine max]
Length=581

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 81/115 (70%), Gaps = 5/115 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLP-TWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATI  154
             LPI+T FKLP  +  +WP GG F SG IDLGGLQ+ + S   K+W +Y GGP++ G +I
Sbjct  48   ALPINTIFKLPVHVTNSWPPGGNFASGTIDLGGLQLYEASTFNKVWGTYSGGPDDRGFSI  107

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLVWSS  1
            FEPS IP GF MLGSY+QPNN+PL G+VLV KD     +   LK P DYTLVW+S
Sbjct  108  FEPSGIPQGFSMLGSYSQPNNKPLFGYVLVAKDVSTNTSNPSLKQPLDYTLVWNS  162



>ref|XP_009124050.1| PREDICTED: uncharacterized protein LOC103848966 [Brassica rapa]
Length=590

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 81/109 (74%), Gaps = 6/109 (6%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGG--GFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNV  166
            LP++T+FK PSPLP  P GG   FG+G IDLGGL+V Q+S      +++WR++EGGP+N+
Sbjct  58   LPVETSFKFPSPLPVIPPGGEKNFGNGKIDLGGLEVIQVSISESTSQRVWRAFEGGPDNM  117

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDY  19
            G +IFEP ++P GF  LG YAQPNN+ L GWVLV KD +G  L+PP DY
Sbjct  118  GVSIFEPINLPAGFFTLGFYAQPNNRMLFGWVLVAKDVSGNNLRPPVDY  166



>ref|XP_009354660.1| PREDICTED: uncharacterized protein LOC103945804 [Pyrus x bretschneideri]
Length=566

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 7/123 (6%)
 Frame = -1

Query  348  VMGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNN  169
            V      LPI+TTFKLPSPLP+WP G GF SG IDLGGL VCQIS+  K+W ++EGGP N
Sbjct  14   VFKKTKALPIETTFKLPSPLPSWPPGDGFASGMIDLGGLLVCQISSFNKVWATHEGGPGN  73

Query  168  VGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVG---KDNNGE----ILKPPTDYTLV  10
            +GA+ FEPS +P GF MLG Y+QPNN PL GW L     KDN+ +    +L+ P D+TL+
Sbjct  74   LGASFFEPSPLPHGFYMLGCYSQPNNIPLYGWALAAKPTKDNDDDPSSPLLRQPVDFTLI  133

Query  9    WSS  1
            WSS
Sbjct  134  WSS  136



>gb|KHN49064.1| hypothetical protein glysoja_031275 [Glycine soja]
Length=581

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 81/115 (70%), Gaps = 5/115 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLP-TWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATI  154
             LPI+T FKLP  +  +WP GG F SG IDLGGLQ+ + S   K+W +Y GGP++ G +I
Sbjct  48   ALPINTIFKLPVHVTNSWPPGGNFASGTIDLGGLQLYEASTFNKVWGTYSGGPDDRGFSI  107

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLVWSS  1
            FEPS +P GF MLGSY+QPNN+PL G+VLV KD     +   LK P DYTLVW+S
Sbjct  108  FEPSGVPQGFSMLGSYSQPNNKPLFGYVLVAKDVSTNTSNPSLKQPLDYTLVWNS  162



>ref|XP_007149177.1| hypothetical protein PHAVU_005G047900g [Phaseolus vulgaris]
 gb|ESW21171.1| hypothetical protein PHAVU_005G047900g [Phaseolus vulgaris]
Length=546

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 83/116 (72%), Gaps = 6/116 (5%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGG--FGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGAT  157
            TLPIDTTFKLP+ LP    GGG  F +G I +GGL++ QIS   K+WR+ EGGP+N GAT
Sbjct  10   TLPIDTTFKLPANLPLLAQGGGGGFATGTITIGGLKLVQISTFNKVWRTLEGGPSNAGAT  69

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN----NGEILKPPTDYTLVWSS  1
             FEP+ IP+GF +LG Y+QPNN+PL G VLV K+     N   LK P DY+LVWSS
Sbjct  70   FFEPTGIPEGFFILGHYSQPNNKPLFGSVLVAKEESSSGNSGALKKPVDYSLVWSS  125



>ref|NP_850414.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC10398.1| uncharacterized protein AT2G44260 [Arabidopsis thaliana]
Length=583

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 80/138 (58%), Gaps = 31/138 (22%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWP------------------------------SGGGFGSGYIDL  241
             LP+D  FK PSPLPT+                               SG GF  G IDL
Sbjct  22   ALPVDAAFKFPSPLPTFTRGLYYHRFLLISLSLSVSQLVLIILISLASSGDGFAKGTIDL  81

Query  240  GG-LQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLV  64
            GG L+V Q+S   K+W +YEGGP+N+GAT FEPSSIP GF +LG YAQPNN+ L GWVL 
Sbjct  82   GGGLEVSQVSTFNKVWSTYEGGPDNLGATFFEPSSIPSGFSILGYYAQPNNRNLFGWVLT  141

Query  63   GKDNNGEILKPPTDYTLV  10
             +D +   LKPP DYTLV
Sbjct  142  ARDLSSNTLKPPVDYTLV  159



>ref|XP_006658730.1| PREDICTED: uncharacterized protein LOC102705931 [Oryza brachyantha]
Length=555

 Score =   124 bits (310),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 64/140 (46%), Positives = 84/140 (60%), Gaps = 25/140 (18%)
 Frame = -1

Query  345  MGNIPTLPIDTTFKLPSPLPTWPSG---------------------GGFGSGYIDLGGLQ  229
            M +   LP++T F LP+PLP WPS                      GGF  G I+LGGL+
Sbjct  1    MASTAALPVETPFSLPAPLPAWPSSSSVFDLIITALVAFVKVSVSDGGFAKGRINLGGLE  60

Query  228  VCQISNLKKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD--  55
            V Q++   K+W + +GG + +GAT F+P+++P GFC LG YAQPNN+PL G VLV +D  
Sbjct  61   VRQVATFDKVWSTAKGGEDGLGATFFKPAAVPAGFCTLGHYAQPNNRPLFGHVLVARDAS  120

Query  54   --NNGEILKPPTDYTLVWSS  1
                G +L PP DYTLVWSS
Sbjct  121  GGGTGALLAPPLDYTLVWSS  140



>ref|XP_010496430.1| PREDICTED: uncharacterized protein LOC104773501 [Camelina sativa]
Length=587

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNVG  163
            LP+DTTF  P+PLP+ PS  G FG   IDLGGL+V Q+S      +++WR+YEGGP N+G
Sbjct  53   LPVDTTFTFPTPLPSIPSDDGNFGKRSIDLGGLEVAQLSMSDSTTRRVWRTYEGGPANMG  112

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
             +IFEP ++P  F  LG YAQPNN+ L GW+LV +D +G  L+PP DYT V
Sbjct  113  VSIFEPITLPRNFFRLGFYAQPNNRQLFGWILVARDVSGGNLRPPLDYTEV  163



>ref|XP_009134576.1| PREDICTED: uncharacterized protein LOC103858883 [Brassica rapa]
Length=587

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGG---FGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPN  172
            TLP++TTFK PSPL   P GGG   FG G IDLGGL+V QIS      +++WR++E GP 
Sbjct  50   TLPVETTFKFPSPLHVIPPGGGERNFGKGKIDLGGLEVIQISISTSTSQRVWRTFERGPG  109

Query  171  NVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            N+G +IF+P ++P GF  LG YAQPNN+ L GWVLV +D +G  L+PP DY  V
Sbjct  110  NMGVSIFQPINLPSGFFTLGFYAQPNNRMLFGWVLVARDLSGNSLRPPLDYIEV  163



>ref|XP_004958121.1| PREDICTED: uncharacterized protein LOC101758191 [Setaria italica]
Length=551

 Score =   122 bits (306),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 79/116 (68%), Gaps = 7/116 (6%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWP-----SGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVG  163
            LPI+  F  P+ LP+WP     S GGF  G IDLGGL+V QI+   K+W + +GG + VG
Sbjct  18   LPIEKQFVPPAALPSWPASAAVSDGGFAKGSIDLGGLEVRQITTFAKVWSTTQGGEDGVG  77

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE--ILKPPTDYTLVWSS  1
            AT FEPS +P GF +LG YAQPN++PL G VLV +D +G   +L  P DYTLVWSS
Sbjct  78   ATFFEPSPVPAGFSVLGHYAQPNSRPLFGHVLVARDTSGTGALLAAPVDYTLVWSS  133



>ref|XP_008461747.1| PREDICTED: uncharacterized protein LOC103500279 [Cucumis melo]
Length=600

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGAT  157
             LPI TTF  PSPLP +P G   F  G I+LGG L++ +IS+  KIW ++EGGP+N+GAT
Sbjct  60   ALPIHTTFNFPSPLPPFPQGKSAFAGGVINLGGGLKIRRISSFNKIWTTHEGGPSNLGAT  119

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN--GEILKPPTDYTLVWSS  1
             FEPS +P GF  LG Y QPNN+P    +LVG+D++  G+ LK P D+TLVW+S
Sbjct  120  FFEPSPLPQGFFSLGHYCQPNNKPFFARILVGRDDSLAGDALKKPVDFTLVWTS  173



>dbj|BAJ94819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=555

 Score =   121 bits (304),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 60/114 (53%), Positives = 79/114 (69%), Gaps = 5/114 (4%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSG---GGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGAT  157
            LP++  F LP+ +P+WPS    GGF  G IDLGG++V Q++   K+W + +GG + +GAT
Sbjct  18   LPVERAFDLPAAMPSWPSSVSDGGFAKGSIDLGGMEVRQVTTFAKVWSTAQGGQDGLGAT  77

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD--NNGEILKPPTDYTLVWSS  1
             F+PS +P GF  LG YAQPNN+PL G VLV +D    G +L PP DYTLVWSS
Sbjct  78   FFKPSPVPAGFHALGHYAQPNNRPLFGRVLVARDASGTGALLAPPLDYTLVWSS  131



>ref|XP_004151268.1| PREDICTED: uncharacterized protein LOC101218337 [Cucumis sativus]
Length=553

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGAT  157
             LPI+TTF  PSPLP +P G   F  G IDLGG L++  IS+  KIW +++GGP+N+GAT
Sbjct  13   ALPINTTFNFPSPLPPFPQGKSAFAGGVIDLGGGLKIRLISSFNKIWTTHDGGPSNLGAT  72

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN--GEILKPPTDYTLVWSS  1
             FEPS +P GF  LG Y QPNN+P    +LVG+D++  G+ LK P D+TLVW+S
Sbjct  73   FFEPSPLPQGFFSLGHYCQPNNKPFFARILVGRDDSLAGDALKKPVDFTLVWTS  126



>ref|XP_004161418.1| PREDICTED: uncharacterized protein LOC101228858 [Cucumis sativus]
Length=553

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGAT  157
             LPI+TTF  PSPLP +P G   F  G IDLGG L++  IS+  KIW +++GGP+N+GAT
Sbjct  13   ALPINTTFNFPSPLPPFPQGKSAFAGGVIDLGGGLKIRLISSFNKIWTTHDGGPSNLGAT  72

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN--GEILKPPTDYTLVWSS  1
             FEPS +P GF  LG Y QPNN+P    +LVG+D++  G+ LK P D+TLVW+S
Sbjct  73   FFEPSPLPQGFFSLGHYCQPNNKPFFARILVGRDDSLAGDALKKPVDFTLVWTS  126



>gb|KGN58638.1| hypothetical protein Csa_3G708680 [Cucumis sativus]
Length=553

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGAT  157
             LPI+TTF  PSPLP +P G   F  G IDLGG L++  IS+  KIW +++GGP+N+GAT
Sbjct  13   ALPINTTFNFPSPLPPFPQGKSAFAGGVIDLGGGLKIRLISSFNKIWTTHDGGPSNLGAT  72

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN--GEILKPPTDYTLVWSS  1
             FEPS +P GF  LG Y QPNN+P    +LVG+D++  G+ LK P D+TLVW+S
Sbjct  73   FFEPSPLPQGFFSLGHYCQPNNKPFFARILVGRDDSLAGDALKKPVDFTLVWTS  126



>gb|EMT10845.1| hypothetical protein F775_21218 [Aegilops tauschii]
Length=325

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (68%), Gaps = 5/115 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSG---GGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
             LP++  F LP+  P+WPS    GGF  G IDLGG++V Q++   K+W + +GG + +GA
Sbjct  17   ALPVERDFDLPAVKPSWPSSVSDGGFAKGSIDLGGIEVRQVTTFAKVWSTTQGGQDGLGA  76

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN--GEILKPPTDYTLVWSS  1
            T F+P+ +P GF  LG YAQPNN+PL G VLV +D +  G +L PP DY LVWSS
Sbjct  77   TFFKPAPVPTGFHALGHYAQPNNRPLFGHVLVTRDASGTGALLAPPLDYALVWSS  131



>ref|XP_003595833.1| hypothetical protein MTR_2g062340 [Medicago truncatula]
 gb|ABN08116.1| Protein of unknown function DUF946, plant [Medicago truncatula]
 gb|AES66084.1| DUF946 family protein [Medicago truncatula]
Length=517

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = -1

Query  321  IDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            I+T+FKLPS +P  P G GF SG IDLGG L V QIS   K+W + EGGP+++G TIFEP
Sbjct  16   IETSFKLPSDIPVLPPGDGFASGIIDLGGGLLVSQISTFNKVWTTNEGGPDDLGVTIFEP  75

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNG---EILKPPTDYTLV  10
            + + +GF +LG Y QPNN+PL GWVLVGKDN+      LK P +Y LV
Sbjct  76   TGLSEGFFVLGYYCQPNNKPLHGWVLVGKDNSSTTNRALKKPLNYKLV  123



>ref|XP_010485351.1| PREDICTED: uncharacterized protein LOC104763704 [Camelina sativa]
Length=581

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNVG  163
            LP++TTF  P+PLP+ PS  G FG   IDLGGL+V Q+S      +++WR+YEGGP N+G
Sbjct  50   LPVETTFMFPTPLPSIPSDDGNFGKRSIDLGGLEVAQLSMSDSTTRRVWRTYEGGPANMG  109

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
             +IFE  ++P  F  LGSYAQPNN+ L GW+LV +D +G  L+PP DYT V
Sbjct  110  VSIFELITLPGNFFKLGSYAQPNNRQLFGWILVARDVSGSNLRPPLDYTEV  160



>emb|CDX74324.1| BnaA03g27230D [Brassica napus]
Length=587

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGG---FGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPN  172
            TLP++TTFK PSPL   P GGG   FG G  DLGGL+V QIS      +++WR++E GP 
Sbjct  50   TLPVETTFKFPSPLHVIPPGGGERNFGKGKKDLGGLEVIQISISTSTSQRVWRTFERGPG  109

Query  171  NVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            N+G +IF+P ++P GF  LG YAQPNN+ L GWVLV +D +G  L+PP DY  V
Sbjct  110  NMGVSIFQPINLPSGFFTLGFYAQPNNRMLFGWVLVARDLSGNSLRPPLDYIEV  163



>ref|XP_009388451.1| PREDICTED: uncharacterized protein LOC103975261 [Musa acuminata 
subsp. malaccensis]
Length=542

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = -1

Query  342  GNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVG  163
            G +  LPIDT+F+LPSPLP+WP GG F  G IDLGGL+V Q+S   K+W    GG +++G
Sbjct  8    GALSPLPIDTSFRLPSPLPSWPPGGEFAEGRIDLGGLEVRQVSTFTKVWAVRGGGQDDLG  67

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN-NGEILKPPTDYTLVWSS  1
            AT F PS +P GF +LG YAQPNN+PL GWVLV  D  NG+ L  P+DYTLVWSS
Sbjct  68   ATFFRPSPVPPGFSVLGYYAQPNNRPLFGWVLVATDTGNGDALAKPSDYTLVWSS  122



>gb|EPS59601.1| hypothetical protein M569_15204 [Genlisea aurea]
Length=541

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = -1

Query  342  GNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPNNV  166
              I  LP+D  F  PSPLP WP G GF SG +DLGG L+V Q+ +  K+   + GG + +
Sbjct  11   AEIGNLPVDAVFNFPSPLPEWPPGDGFASGVMDLGGGLRVMQVWSFAKVAAVHYGGEDGL  70

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN--NGEILKPPTDYTLV  10
            GAT FEP  IP+G+ +LGSYAQP+N+PL GWVLVG D   +G+ILK P DYTL+
Sbjct  71   GATFFEPWPIPEGYSLLGSYAQPSNRPLFGWVLVGSDILPSGDILKQPIDYTLI  124



>ref|XP_006408555.1| hypothetical protein EUTSA_v10020344mg [Eutrema salsugineum]
 gb|ESQ50008.1| hypothetical protein EUTSA_v10020344mg [Eutrema salsugineum]
Length=596

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 80/116 (69%), Gaps = 10/116 (9%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTW---PSGGG---FGSGYIDLGGLQVCQIS----NLKKIWRSYEGG  178
            LP++TTFK PSPLP     P  GG   FG G IDLGGL+V Q+S      K++WR++EGG
Sbjct  54   LPVETTFKFPSPLPVILPGPGQGGERNFGKGKIDLGGLEVIQVSISTTTSKRVWRTFEGG  113

Query  177  PNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            P N+GA+IFEP ++P GF  +G YAQPNN+ L GWVLV +D +G  L+ P DY  V
Sbjct  114  PENMGASIFEPVNLPAGFFKIGFYAQPNNRMLFGWVLVARDVSGNSLRAPVDYIQV  169



>ref|XP_008461748.1| PREDICTED: uncharacterized protein LOC103500280 [Cucumis melo]
Length=560

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 81/120 (68%), Gaps = 9/120 (8%)
 Frame = -1

Query  333  PTLPIDTTFKLPSP-LPTWPSG----GGFGSGYIDLG-GLQVCQISNLKKIWRSYEGGPN  172
            PTLPID+ F  PSP L T        GGF SG IDLG GL VCQIS+  KIW + +GGP+
Sbjct  12   PTLPIDSKFSFPSPHLATLSETNTLTGGFASGTIDLGRGLHVCQISSFNKIWAARQGGPD  71

Query  171  NVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN---NGEILKPPTDYTLVWSS  1
            N+GAT FEP+S+P+GF +LG + + N   L G+VL GKDN     E LK P DYTLVWS+
Sbjct  72   NLGATFFEPNSLPEGFFVLGYFCRSNKNALFGFVLAGKDNGFDGEEALKKPVDYTLVWST  131



>gb|AAF14848.1|AC011664_30 hypothetical protein, 5' partial [Arabidopsis thaliana]
Length=549

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 5/112 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGG-FGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNV  166
            +LP++T F  PS LP  PSGGG FG G IDLGGL+V Q+S      +++WR+YEGGP+N+
Sbjct  17   SLPVETAFTFPSALPVIPSGGGNFGKGRIDLGGLEVIQVSISTSTSQRVWRTYEGGPDNM  76

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            G +IF+P ++P  F  LG Y QPNN+ L GWVL  +D +G  L+PP DY  V
Sbjct  77   GLSIFQPINLPPSFSTLGFYGQPNNRLLFGWVLAARDVSGNSLRPPVDYIQV  128



>ref|XP_008804360.1| PREDICTED: uncharacterized protein LOC103717662 [Phoenix dactylifera]
Length=550

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 88/111 (79%), Gaps = 2/111 (2%)
 Frame = -1

Query  327  LPIDTT-FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            LP++++ FKLPSP P+WPSGGGFG G IDLGGL+VCQ+S   K+W ++EGG ++ GAT+F
Sbjct  17   LPVESSSFKLPSPPPSWPSGGGFGKGIIDLGGLEVCQVSTFAKVWATHEGGQDDSGATVF  76

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE-ILKPPTDYTLVWSS  1
             PS IP GF +LG YAQPNN+PL GWVLVG+D + E  L  P DYTL+WSS
Sbjct  77   VPSPIPTGFSVLGCYAQPNNRPLFGWVLVGRDTSCEGTLAKPVDYTLLWSS  127



>ref|NP_186836.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF03439.1|AC010797_15 hypothetical protein [Arabidopsis thaliana]
 gb|AAZ52714.1| hypothetical protein At3g01870 [Arabidopsis thaliana]
 gb|ABE97186.1| hypothetical protein At3g01870 [Arabidopsis thaliana]
 gb|AEE73728.1| uncharacterized protein AT3G01870 [Arabidopsis thaliana]
Length=583

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 5/112 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGG-FGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNV  166
            +LP++T F  PS LP  PSGGG FG G IDLGGL+V Q+S      +++WR+YEGGP+N+
Sbjct  51   SLPVETAFTFPSALPVIPSGGGNFGKGRIDLGGLEVIQVSISTSTSQRVWRTYEGGPDNM  110

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            G +IF+P ++P  F  LG Y QPNN+ L GWVL  +D +G  L+PP DY  V
Sbjct  111  GLSIFQPINLPPSFSTLGFYGQPNNRLLFGWVLAARDVSGNSLRPPVDYIQV  162



>ref|XP_004172675.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101218097 
[Cucumis sativus]
Length=560

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 81/120 (68%), Gaps = 9/120 (8%)
 Frame = -1

Query  333  PTLPIDTTFKLPSPLPTWPS-----GGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPN  172
            PTLPID+ F  PSP     S      GGF SG IDLGG L VCQIS+  KIW + +GGP+
Sbjct  12   PTLPIDSKFSFPSPHLATHSETNTVNGGFASGTIDLGGGLHVCQISSFNKIWAARQGGPD  71

Query  171  NVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN--NGE-ILKPPTDYTLVWSS  1
            N+GAT FEP+S+P+GF +LG + Q N   L G VL GKDN  +GE  LK P DYTLVWS+
Sbjct  72   NLGATFFEPNSLPEGFFVLGYFCQSNKNALFGSVLAGKDNGSDGEDALKKPVDYTLVWST  131



>ref|XP_004151267.1| PREDICTED: uncharacterized protein LOC101218097 [Cucumis sativus]
 gb|KGN58636.1| hypothetical protein Csa_3G708170 [Cucumis sativus]
Length=560

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 81/120 (68%), Gaps = 9/120 (8%)
 Frame = -1

Query  333  PTLPIDTTFKLPSPLPTWPS-----GGGFGSGYIDLGG-LQVCQISNLKKIWRSYEGGPN  172
            PTLPID+ F  PSP     S      GGF SG IDLGG L VCQIS+  KIW + +GGP+
Sbjct  12   PTLPIDSKFSFPSPHLATHSETNTVNGGFASGTIDLGGGLHVCQISSFNKIWAARQGGPD  71

Query  171  NVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN--NGE-ILKPPTDYTLVWSS  1
            N+GAT FEP+S+P+GF +LG + Q N   L G VL GKDN  +GE  LK P DYTLVWS+
Sbjct  72   NLGATFFEPNSLPEGFFVLGYFCQSNKNALFGSVLAGKDNGSDGEDALKKPVDYTLVWST  131



>ref|XP_002884255.1| hypothetical protein ARALYDRAFT_896056 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60514.1| hypothetical protein ARALYDRAFT_896056 [Arabidopsis lyrata subsp. 
lyrata]
Length=583

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 78/112 (70%), Gaps = 5/112 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGG-FGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNV  166
            +LP++T F  PS LP  PSGGG FG G IDLGGL+V Q+S      +++WR+YEGGPN++
Sbjct  50   SLPVETAFTFPSALPVIPSGGGNFGKGRIDLGGLEVIQVSISTSTSQRVWRTYEGGPNSM  109

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            G TIF+P ++P  F  LG YAQPNN+ L GWVL  +D +G  L+PP  Y  V
Sbjct  110  GLTIFQPINLPPSFFTLGFYAQPNNRLLFGWVLAARDVSGNSLRPPVGYVEV  161



>gb|EMS61200.1| hypothetical protein TRIUR3_15102 [Triticum urartu]
Length=329

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 77/115 (67%), Gaps = 5/115 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSG---GGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
             LP++  F LP+   +WPS    GGF  G IDLGG++V Q++   K+W + +GG + +GA
Sbjct  17   ALPVERDFDLPAVKLSWPSSASDGGFAKGSIDLGGMEVRQVTTFAKVWSTTQGGQDGLGA  76

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN--GEILKPPTDYTLVWSS  1
            T F+P+ +P GF  LG YAQPNN+PL G VLV +D +  G +L PP DY LVWSS
Sbjct  77   TFFKPAPVPAGFHALGHYAQPNNRPLFGHVLVARDASGTGALLAPPLDYALVWSS  131



>ref|XP_002460910.1| hypothetical protein SORBIDRAFT_02g037340 [Sorghum bicolor]
 gb|EER97431.1| hypothetical protein SORBIDRAFT_02g037340 [Sorghum bicolor]
Length=553

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGG----GFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVG  163
             LPI+  F  P+ LP  P+ G    GFG G IDLGGL+V QI+   K+W + +GG + +G
Sbjct  17   ALPIEDRFVPPAGLPAVPASGSEDGGFGKGSIDLGGLEVRQITTFAKVWSTTQGGQDGLG  76

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN--GEILKPPTDYTLVWSS  1
            AT F+PS +P GF +LG YAQPNN+PL G VLVG+D +  G +L  P DY LVWSS
Sbjct  77   ATFFKPSPVPAGFSVLGHYAQPNNRPLFGHVLVGRDTSGTGAVLAAPLDYALVWSS  132



>ref|XP_006395185.1| hypothetical protein EUTSA_v10005422mg [Eutrema salsugineum]
 gb|ESQ32471.1| hypothetical protein EUTSA_v10005422mg [Eutrema salsugineum]
Length=569

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 77/108 (71%), Gaps = 5/108 (5%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTW-PSGGGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNVG  163
            LP++TTF  P PLP+  P  G FG G IDLGGL+V Q+S      +++WR+YEGG +N+G
Sbjct  35   LPVETTFTFPGPLPSMLPDHGVFGKGTIDLGGLEVKQLSISNSTAQRVWRTYEGGRDNMG  94

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDY  19
             +IFEP ++P  F  LG YAQPNNQ L GW+LV +D +G  L+PP+DY
Sbjct  95   FSIFEPINLPPNFFKLGFYAQPNNQKLFGWILVARDVSGSNLRPPSDY  142



>ref|XP_004958115.1| PREDICTED: vacuolar protein sorting-associated protein 62-like 
[Setaria italica]
Length=553

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/114 (54%), Positives = 77/114 (68%), Gaps = 5/114 (4%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWP---SGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGAT  157
            LPI+  F  P  LP+WP   S GGF  G IDLGGL+V QI+   K+W + +GG + VGAT
Sbjct  18   LPIEKHFVPPVALPSWPASVSDGGFAKGSIDLGGLEVRQITTFAKVWSTTQGGEDGVGAT  77

Query  156  IFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN--GEILKPPTDYTLVWSS  1
             F+PS +P GF +LG YAQPN++PL G VLV +D +  G +L  P DY LVWSS
Sbjct  78   FFKPSPVPAGFSVLGHYAQPNSRPLFGHVLVARDTSGTGALLAAPVDYNLVWSS  131



>gb|KFK37645.1| hypothetical protein AALP_AA3G010100 [Arabis alpina]
Length=1024

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTW-PSGGGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNV  166
             LP++TTF  P PLPT  PSGG F  G IDLGGL+V Q+S      +++WR++EGG  N+
Sbjct  489  ALPVETTFSCPGPLPTMLPSGGNFSKGIIDLGGLEVMQVSVSNSTSQRVWRTFEGGQENM  548

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            G +IFEP ++   F  LG YAQPNN+ L GW+LV +D +G  L+PP DYT V
Sbjct  549  GFSIFEPINLSSNFSKLGFYAQPNNRLLFGWILVARDVSGTSLRPPVDYTEV  600


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  168  VGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            +G +IFEP ++P GF  LG YAQPNN+ L GWVLV +  +G  L+PP DYT V
Sbjct  1    MGVSIFEPINLPPGFFKLGLYAQPNNRQLFGWVLVARGVSGTSLRPPVDYTEV  53



>tpg|DAA63291.1| TPA: hypothetical protein ZEAMMB73_737791 [Zea mays]
Length=559

 Score =   115 bits (289),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 60/116 (52%), Positives = 79/116 (68%), Gaps = 7/116 (6%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSG----GGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
            LPI+  F  P+ LP+ P+     GGFG G IDLGGL+V Q++   K+W + +GG + +GA
Sbjct  18   LPIENHFVAPAALPSVPASDSEDGGFGKGSIDLGGLEVRQVTTFAKVWSTTQGGQDGLGA  77

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN---GEILKPPTDYTLVWSS  1
            T F+PS +P GF +LG YAQPNN+PL G VLVG+D +   G +L  P DY LVWSS
Sbjct  78   TFFKPSPVPAGFSVLGHYAQPNNRPLFGHVLVGRDTSGAGGALLAAPVDYALVWSS  133



>ref|NP_001145101.1| uncharacterized protein LOC100278316 [Zea mays]
 gb|ACG45082.1| hypothetical protein [Zea mays]
Length=559

 Score =   115 bits (288),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 60/116 (52%), Positives = 79/116 (68%), Gaps = 7/116 (6%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSG----GGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
            LPI+  F  P+ LP+ P+     GGFG G IDLGGL+V Q++   K+W + +GG + +GA
Sbjct  18   LPIENHFVAPAALPSVPASDSEDGGFGKGSIDLGGLEVRQVTTFAKVWSTTQGGQDGLGA  77

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN---GEILKPPTDYTLVWSS  1
            T F+PS +P GF +LG YAQPNN+PL G VLVG+D +   G +L  P DY LVWSS
Sbjct  78   TFFKPSPVPAGFSVLGHYAQPNNRPLFGHVLVGRDTSGAGGALLAAPVDYALVWSS  133



>ref|XP_010236503.1| PREDICTED: uncharacterized protein LOC104584083 [Brachypodium 
distachyon]
Length=553

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 9/118 (8%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            LP++  F LP+P+P+WPS  GGF  G IDLGGL+  Q++   K+W + +GG + +GAT  
Sbjct  18   LPVEKHFALPAPMPSWPSSDGGFAKGSIDLGGLEARQVTTFTKVWSTAQGGQDGLGATFL  77

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLV--------GKDNNGEILKPPTDYTLVWSS  1
            +PS IP GF  LG YAQPN++PL G VLV        G  +  ++L PP DYTLVWSS
Sbjct  78   KPSPIPAGFHALGHYAQPNSRPLFGHVLVVRAAASGTGTGSAQQLLAPPLDYTLVWSS  135



>gb|EEE67462.1| hypothetical protein OsJ_24853 [Oryza sativa Japonica Group]
Length=538

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 60/119 (50%), Positives = 76/119 (64%), Gaps = 7/119 (6%)
 Frame = -1

Query  345  MGNIPTLPIDTTFKLPSPLPTWPSG---GGFGSGYIDLGGLQVCQISNLKKIWRSYEGGP  175
            M +   LPI+T F LP+PLP+WPS    GGF  G IDLGGL+V Q++   K+W +   G 
Sbjct  1    MASTAALPIETAFSLPAPLPSWPSSVSDGGFAKGSIDLGGLEVRQVTTFAKVWST---GQ  57

Query  174  NNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGEILKPPTDYTLVWSS  1
            +  GAT F P  +P GF  LG YAQ N++PL G VLV +D + G +L PP DY  VWSS
Sbjct  58   DGGGATFFRPEQVPAGFSALGHYAQRNDRPLFGHVLVARDVSGGGLLAPPLDYAPVWSS  116



>gb|EEC82315.1| hypothetical protein OsI_26592 [Oryza sativa Indica Group]
Length=538

 Score =   112 bits (280),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 60/119 (50%), Positives = 76/119 (64%), Gaps = 7/119 (6%)
 Frame = -1

Query  345  MGNIPTLPIDTTFKLPSPLPTWPSG---GGFGSGYIDLGGLQVCQISNLKKIWRSYEGGP  175
            M +   LPI+T F LP+PLP+WPS    GGF  G IDLGGL+V Q++   K+W +   G 
Sbjct  1    MASTAALPIETAFSLPAPLPSWPSSVSDGGFAKGSIDLGGLEVRQVTTFAKVWST---GQ  57

Query  174  NNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGEILKPPTDYTLVWSS  1
            +  GAT F P  +P GF  LG YAQ N++PL G VLV +D + G +L PP DY  VWSS
Sbjct  58   DGGGATFFRPEQVPAGFSALGHYAQRNDRPLFGHVLVARDVSGGGLLAPPLDYAPVWSS  116



>ref|XP_007149125.1| hypothetical protein PHAVU_005G043100g [Phaseolus vulgaris]
 gb|ESW21119.1| hypothetical protein PHAVU_005G043100g [Phaseolus vulgaris]
Length=580

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 77/118 (65%), Gaps = 8/118 (7%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISN----LKKIWRSYEGGPNNVG  163
             LPIDT F++P  +      G F SG IDLGGLQV + S     L K+W  Y+GG ++ G
Sbjct  49   ALPIDTVFRIPVDVSNSWGPGNFSSGIIDLGGLQVYEASTSRSTLTKVWGGYQGGADDHG  108

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE----ILKPPTDYTLVWSS  1
             +++EP+ IP+GF MLGSY QPNN+PL GW LV KD +      ILK P +YTL+WSS
Sbjct  109  FSVYEPTGIPEGFFMLGSYCQPNNKPLFGWNLVAKDVSANTSNPILKKPVNYTLIWSS  166



>emb|CDX85337.1| BnaC07g26480D [Brassica napus]
Length=982

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = -1

Query  288  PTWPSGGGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNVGATIFEPSSIPDGFC  121
            P  P    FG G IDLGGL+V Q+S      K++WR+YEGG +N+G +IFEP+++P  F 
Sbjct  458  PILPHEVHFGKGTIDLGGLEVKQVSISKTTAKRVWRTYEGGRDNMGFSIFEPTNLPANFF  517

Query  120  MLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
             LG YAQPNNQ L GW+LV +D +G  L+PP DY  VW++
Sbjct  518  KLGFYAQPNNQKLFGWILVARDVSGSNLRPPVDYIEVWNT  557



>gb|AES66087.2| DUF946 family protein [Medicago truncatula]
Length=590

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 71/109 (65%), Gaps = 4/109 (4%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            PID TFKLP    +   G  F +  IDLG L V Q S   K+W +YE GP++ GA+++EP
Sbjct  52   PIDHTFKLPIAQTSSSEGTSFANTVIDLGELHVMQASTFSKVWGAYESGPDDQGASVYEP  111

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE----ILKPPTDYTLV  10
            + +  G+ MLGSY+QPNN+PL G+VL  KD +G      LKPP DYTLV
Sbjct  112  TGLRYGYSMLGSYSQPNNKPLFGYVLAAKDISGSTTNGTLKPPVDYTLV  160



>ref|XP_010435678.1| PREDICTED: uncharacterized protein LOC104719438, partial [Camelina 
sativa]
Length=365

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 73/112 (65%), Gaps = 9/112 (8%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNV  166
            +LP+DT FK PS LP  PS    FG G IDLGGL+V Q+S      K++WR+YEG    +
Sbjct  55   SLPVDTAFKFPSALPVIPSDKSDFGKGRIDLGGLEVIQVSISTSTSKQVWRTYEG----M  110

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            G TI++P ++P  F  LG YAQPNN+ L GWVL  +D +G+ L+PP  Y  V
Sbjct  111  GLTIYQPINLPPSFFTLGFYAQPNNRQLFGWVLAARDVSGDSLRPPVGYIAV  162



>ref|XP_010675107.1| PREDICTED: uncharacterized protein LOC104891150 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=605

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            TL I+++F LPSPLP+WP G GF SG +D GGL V +++   K+W +Y+GGP++ GAT F
Sbjct  65   TLNIESSFNLPSPLPSWPPGNGFASGTMDFGGLVVAEVTTFDKVWATYDGGPDDQGATFF  124

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNN---GEILKPPTDYTLVWSS  1
            EP+ +P+GF +LG Y+Q NN+PL G VLVGKD +      LK P DY LVWSS
Sbjct  125  EPTGLPEGFFLLGYYSQSNNRPLYGRVLVGKDTSNPANPALKWPIDYALVWSS  177



>ref|XP_010485352.1| PREDICTED: uncharacterized protein LOC104763705 [Camelina sativa]
Length=584

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 73/112 (65%), Gaps = 9/112 (8%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNV  166
            +LP+DT FK PS LP  PSG   FG G IDLGGL+V Q+S      K +WR+YEG    +
Sbjct  55   SLPVDTAFKFPSALPVIPSGKSNFGKGRIDLGGLEVIQVSISTSTSKIVWRTYEG----M  110

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            G TI++P ++P  F  LG YAQPNN+ L GWVL  +D +G+ L+PP  Y  V
Sbjct  111  GLTIYQPINLPPSFFTLGFYAQPNNRQLFGWVLAARDVSGDSLRPPVGYIAV  162



>emb|CDY14902.1| BnaA02g22440D [Brassica napus]
Length=569

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 68/115 (59%), Gaps = 0/115 (0%)
 Frame = -1

Query  345  MGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNV  166
            +   P+L    TF LP+ LP WPSG GF SG I+LG L+V +I++ + IWR       N 
Sbjct  12   LTEFPSLKQPQTFSLPASLPHWPSGQGFASGRINLGDLEVAEITSFELIWRYVSPRDKNK  71

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
              + + P ++PD F  LG Y QP++  L G+VLV KD     L  P DYTLVWSS
Sbjct  72   SVSFYRPDNLPDSFHCLGHYCQPDSHLLRGFVLVAKDIVKSALAKPLDYTLVWSS  126



>emb|CDX96930.1| BnaC02g30680D [Brassica napus]
Length=569

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 67/115 (58%), Gaps = 0/115 (0%)
 Frame = -1

Query  345  MGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNV  166
            +   P+L    TF LP+ LP WPSG GF SG I+LG L+V +I++ + IWR       N 
Sbjct  12   LTEFPSLKQPQTFSLPASLPHWPSGQGFASGRINLGDLEVAEITSFELIWRYVSPRDKNK  71

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
              + + P ++PD F  LG Y QP+   L G+VLV +D     L  P DYTLVWSS
Sbjct  72   SVSFYRPDNLPDSFHCLGHYCQPDTHLLRGFVLVARDIVKSALAKPLDYTLVWSS  126



>ref|XP_002880101.1| hypothetical protein ARALYDRAFT_483550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56360.1| hypothetical protein ARALYDRAFT_483550 [Arabidopsis lyrata subsp. 
lyrata]
Length=564

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 71/118 (60%), Gaps = 9/118 (8%)
 Frame = -1

Query  336  IPTLPIDTTFKLPSPLPTWPSG---GGFGSGYIDLGGLQVCQISNLKKIWR------SYE  184
            +  LP+DT FK PSP+PT+  G     F    + L  L +  + N +  W        + 
Sbjct  20   LKALPVDTAFKFPSPMPTFSQGLYYHQFLLISLALSQLVMMVLRNEQLTWVVVSKLVKFR  79

Query  183  GGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
             GP+N+GAT FEPSSIP GFC+LG YAQPNN+ L GWVL  +D +   LKPP DYTLV
Sbjct  80   RGPDNLGATFFEPSSIPSGFCILGYYAQPNNRKLFGWVLTARDLSSNTLKPPVDYTLV  137



>ref|XP_004963802.1| PREDICTED: uncharacterized protein LOC101761210 [Setaria italica]
Length=941

 Score =   105 bits (263),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 57/113 (50%), Positives = 69/113 (61%), Gaps = 9/113 (8%)
 Frame = -1

Query  321  IDTTFKLPSPLPTWPSG-GGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            ++T F  P+ +P+WPS  G F  G IDLGGL+V Q+S   K+W +   G    GAT F P
Sbjct  407  VETHFAPPASMPSWPSSDGAFAKGAIDLGGLEVRQVSTFAKVWSTSRDG---AGATFFRP  463

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE-----ILKPPTDYTLVWSS  1
            S IP GF  LG YAQ N++PL G VLV +D         IL PP DYTLVWSS
Sbjct  464  SPIPAGFSALGHYAQRNDRPLFGHVLVARDTTSHDTAAPILAPPRDYTLVWSS  516



>ref|XP_010496432.1| PREDICTED: uncharacterized protein LOC104773502 [Camelina sativa]
Length=584

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 73/112 (65%), Gaps = 9/112 (8%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSG-GGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNV  166
            +LP+DT FK PS LP  PSG   FG G IDLGGL+V Q+S      K++WR+YEG    +
Sbjct  55   SLPVDTAFKFPSALPEIPSGNSSFGKGRIDLGGLEVIQVSISTSTSKQVWRTYEG----M  110

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
            G TI++P ++P  F  LG YAQ NN+ L GWVL  +D +G+ L+PP  Y  V
Sbjct  111  GLTIYQPINLPPSFFTLGFYAQLNNRQLFGWVLAARDVSGDSLRPPVGYIAV  162



>ref|XP_009111945.1| PREDICTED: uncharacterized protein LOC103837336 [Brassica rapa]
Length=570

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = -1

Query  327  LPIDTTFKLPSPLP-TWPSGGGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNVG  163
            LP++T F  P PLP T P  G FG G IDLGGL+V Q+S      +++W +YEGG +N+G
Sbjct  31   LPVETIFTFPGPLPNTLPDEGDFGKGIIDLGGLEVAQVSISNSTAQRVWSTYEGGGDNMG  90

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
             +IFEP ++P  F  LG YAQPNNQ L G +LV +  N   L PP DY  V
Sbjct  91   FSIFEPINLPPNFFKLGFYAQPNNQKLFGSILVARSVNLSNLLPPEDYLEV  141



>emb|CDY19950.1| BnaA09g03010D [Brassica napus]
Length=570

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = -1

Query  327  LPIDTTFKLPSPLP-TWPSGGGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNVG  163
            LP++T F  P PLP T P  G FG G IDLGGL+V Q+S      +++W +YEGG +N+G
Sbjct  31   LPVETIFTFPGPLPNTLPDEGDFGKGIIDLGGLEVAQVSISNSTAQRVWSTYEGGGDNMG  90

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
             +IFEP ++P  F  LG YAQPNNQ L G +LV +  N   L PP DY  V
Sbjct  91   FSIFEPINLPPNFFKLGFYAQPNNQKLFGSILVARSVNLSNLLPPEDYLEV  141



>emb|CDX86305.1| BnaA06g30220D [Brassica napus]
Length=544

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 66/92 (72%), Gaps = 4/92 (4%)
 Frame = -1

Query  264  FGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQP  97
            FG G IDLGGL+V Q+S      K++WR+YEGG +++G +IFEP ++P  F  +G YAQP
Sbjct  28   FGKGTIDLGGLEVKQVSISNTTAKRVWRTYEGGRDSMGFSIFEPINLPANFFKIGFYAQP  87

Query  96   NNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            NNQ L GW+LV +D +G  L+PP DY  VW++
Sbjct  88   NNQKLFGWILVARDVSGRSLRPPVDYIEVWNT  119



>ref|XP_006299211.1| hypothetical protein CARUB_v10015358mg [Capsella rubella]
 gb|EOA32109.1| hypothetical protein CARUB_v10015358mg [Capsella rubella]
Length=581

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 74/110 (67%), Gaps = 10/110 (9%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLP--TWPSGGGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNN  169
            +LP+DT FK PS  P  T  +GG FG G IDLGGL+V Q+S      +++WR+YEG    
Sbjct  50   SLPVDTAFKFPSASPAITPSAGGNFGKGRIDLGGLEVVQVSISASTSQRVWRTYEG----  105

Query  168  VGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDY  19
            +G TIF+P+++P  F  LG YAQPN++ L GWVLV +D +G  L+PP  Y
Sbjct  106  MGLTIFQPTNLPPSFFSLGFYAQPNDRQLFGWVLVARDVSGNSLRPPVGY  155



>emb|CDY00059.1| BnaC09g02420D [Brassica napus]
Length=570

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPT-WPSGGGFGSGYIDLGGLQVCQIS----NLKKIWRSYEGGPNNVG  163
            LP++T F  P PLPT  P  G FG G IDLGGL+V Q+S      +++W +YEGG +N+G
Sbjct  31   LPVETIFTFPGPLPTTLPDEGDFGKGIIDLGGLEVAQVSISNSTAQRVWSTYEGGGDNMG  90

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLV  10
             +IFEP ++P  F  LG YAQPNNQ L G +LV +  N   L PP DY  V
Sbjct  91   FSIFEPINLPPNFFKLGFYAQPNNQKLFGSILVARSVNLSNLLPPEDYFEV  141



>gb|EYU40301.1| hypothetical protein MIMGU_mgv1a018219mg, partial [Erythranthe 
guttata]
Length=464

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 61/80 (76%), Gaps = 7/80 (9%)
 Frame = -1

Query  219  ISNLKKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-----  55
            +S   KIW + EGGP+N+GAT FEPSSIP+GF MLG Y+QPNN+PLSG VLVGKD     
Sbjct  1    VSKFNKIWAALEGGPSNLGATFFEPSSIPEGFSMLGCYSQPNNKPLSGHVLVGKDVTTNN  60

Query  54   --NNGEILKPPTDYTLVWSS  1
              NN   LKPPTDYTLVWSS
Sbjct  61   NNNNNAALKPPTDYTLVWSS  80



>ref|XP_010684871.1| PREDICTED: uncharacterized protein LOC104899394 [Beta vulgaris 
subsp. vulgaris]
Length=561

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 73/118 (62%), Gaps = 5/118 (4%)
 Frame = -1

Query  339  NIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
            +I   P  TTF LP+PLP WP G GF +G I+LG L+V QI+  + IW S+    N  G 
Sbjct  18   SIAMCPSFTTFLLPAPLPHWPKGRGFANGNINLGELEVVQITRFEFIWGSHLSHDNRKGI  77

Query  159  TIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD----NNGE-ILKPPTDYTLVWSS  1
            + ++P  +P GF  LG Y QPN++PL+G+VLV KD    N G   L  P DY LVW+S
Sbjct  78   SFYKPLGLPKGFYGLGHYCQPNDKPLNGYVLVAKDVVSHNRGSPALVMPVDYYLVWNS  135



>ref|XP_010918943.1| PREDICTED: uncharacterized protein LOC105043187 [Elaeis guineensis]
Length=561

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 9/110 (8%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSP+P WP G GF  G I +G L+V +++  + IW  +    N  GAT ++PS IPD
Sbjct  25   FSLPSPIPEWPEGEGFAEGKICIGELEVVKVTKFQSIWSCFSSSAN--GATFYQPSEIPD  82

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD-------NNGEILKPPTDYTLVWSS  1
            GF  LG Y QPN+QPL G+VLV ++        +   L+ P DYTLVWSS
Sbjct  83   GFVSLGHYGQPNDQPLHGFVLVVRELTDSKATTDLPALQKPLDYTLVWSS  132



>ref|XP_009395601.1| PREDICTED: uncharacterized protein LOC103980787 [Musa acuminata 
subsp. malaccensis]
Length=563

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 67/115 (58%), Gaps = 7/115 (6%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            P   +F LPSP+P WP  G F  G I +G L+V QI+N K+IW  +     + GA  +EP
Sbjct  20   PEPESFSLPSPIPEWPQSGAFAKGRICIGELEVVQITNFKRIWSCFSSKEKSKGAVFYEP  79

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN-------NGEILKPPTDYTLVWSS  1
              IP+GF   G Y Q  +QPL G+VLV ++N       +   L+ P DYTLVWSS
Sbjct  80   LEIPNGFFSFGHYGQRCDQPLHGFVLVARENAEFQSVADLPALQKPLDYTLVWSS  134



>ref|XP_009123923.1| PREDICTED: uncharacterized protein LOC103848849 [Brassica rapa]
Length=569

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 67/115 (58%), Gaps = 0/115 (0%)
 Frame = -1

Query  345  MGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNV  166
            +   P L    TF LP+ LP WPSG GF SG I+LG L+V +I++ + IWR       N 
Sbjct  12   LTEFPPLKQPQTFSLPASLPHWPSGQGFASGRINLGDLEVAEITSFELIWRYVSPRDKNK  71

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
              + + P ++P+ F  LG Y QP++  L G+VLV +D     L  P DYTLVWSS
Sbjct  72   SVSFYRPDNLPNSFHCLGHYCQPDSHLLRGFVLVARDIVKSALAKPLDYTLVWSS  126



>emb|CAN77840.1| hypothetical protein VITISV_015561 [Vitis vinifera]
Length=569

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 74/123 (60%), Gaps = 15/123 (12%)
 Frame = -1

Query  327  LPIDT-TFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            LP DT TF LP+P+PTWP G GF SG I+LG L+V QIS  + +W S        G T F
Sbjct  16   LPPDTKTFSLPAPIPTWPQGQGFASGVINLGELEVFQISRFEFVWGSNLSQDKKKGVTFF  75

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD---NNGEI-----------LKPPTDYTL  13
            +P  IP+GF  LG Y Q N+QPL G+VLV ++   +N E+           L+ P DYTL
Sbjct  76   KPVGIPNGFFSLGDYCQSNDQPLQGFVLVAREVACSNPEVAQICNLDKSPPLQKPLDYTL  135

Query  12   VWS  4
            +WS
Sbjct  136  LWS  138



>ref|XP_007143957.1| hypothetical protein PHAVU_007G116800g [Phaseolus vulgaris]
 gb|ESW15951.1| hypothetical protein PHAVU_007G116800g [Phaseolus vulgaris]
Length=558

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 73/129 (57%), Gaps = 7/129 (5%)
 Frame = -1

Query  369  FGVEEL*VMGNIP--TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIW  196
            FG + L     +P  T P    F LPSPLP WP GG F SG I LG ++V ++   +K+W
Sbjct  2    FGCKSLLCWDCVPEFTDPDPLPFSLPSPLPQWPQGGSFASGRICLGEIEVLKVEKFEKVW  61

Query  195  RSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPT---  25
            R       ++G T + P  IP+GF  LG Y Q N+QPL G+VLV ++ N  +L+ P    
Sbjct  62   RCTGLRGKSLGFTFYRPLEIPEGFFCLGYYCQSNDQPLRGYVLVARETNASVLESPALEK  121

Query  24   --DYTLVWS  4
               Y+LVWS
Sbjct  122  PLGYSLVWS  130



>ref|XP_004155688.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101223927 
[Cucumis sativus]
Length=555

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 17/114 (15%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I LG ++V +IS LKK+WR  +      GA  ++P +IPD
Sbjct  26   FSLPSPLPKWPPGKGFSTGRISLGEIEVYKISKLKKVWRCSQ------GAVFYKPQAIPD  79

Query  129  GFCMLGSYAQPNNQPLSGWVLVGK--------DNNGE---ILKPPTDYTLVWSS  1
            GF  LG Y QP++ PL G+VLV +        DN+      LK P +YTL+WSS
Sbjct  80   GFFCLGHYCQPSDHPLRGYVLVARGASEVDHVDNSVRESPALKRPVNYTLIWSS  133



>ref|XP_004142542.1| PREDICTED: uncharacterized protein LOC101216081 [Cucumis sativus]
Length=555

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 17/114 (15%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I LG ++V +IS LKK+WR  +      GA  ++P +IPD
Sbjct  26   FSLPSPLPKWPPGKGFSTGRISLGEIEVYKISKLKKVWRCSQ------GAVFYKPQAIPD  79

Query  129  GFCMLGSYAQPNNQPLSGWVLVGK--------DNNGE---ILKPPTDYTLVWSS  1
            GF  LG Y QP++ PL G+VLV +        DN+      LK P +YTL+WSS
Sbjct  80   GFFCLGHYCQPSDHPLRGYVLVARGASEVDHVDNSVRESPALKRPVNYTLIWSS  133



>ref|XP_002873898.1| hypothetical protein ARALYDRAFT_909860 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50157.1| hypothetical protein ARALYDRAFT_909860 [Arabidopsis lyrata subsp. 
lyrata]
Length=553

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 8/111 (7%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I+LG +QV +++   ++W+       +  A+ ++P  IP+
Sbjct  25   FSLPSPLPRWPQGSGFATGRINLGEIQVVKVTEFDRVWKCGRSRGKSSCASFYKPVGIPE  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGK--------DNNGEILKPPTDYTLVWSS  1
            GF  LG Y QPNNQPL G+VL  +        D++   LK P +Y+LVWSS
Sbjct  85   GFHCLGHYCQPNNQPLRGFVLAARANEPGHLADDHRPPLKKPVNYSLVWSS  135



>ref|XP_003595837.1| hypothetical protein MTR_2g062380 [Medicago truncatula]
 gb|ABN08111.1| Protein of unknown function DUF946, plant [Medicago truncatula]
 gb|AES66088.1| DUF946 family protein [Medicago truncatula]
Length=560

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 68/95 (72%), Gaps = 3/95 (3%)
 Frame = -1

Query  276  SGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQP  97
            +G  F +  IDLG L V Q S   K+W +YEGGP+N GA+++EP+ +  G+ MLGSY+QP
Sbjct  39   TGTSFANTIIDLGELHVMQASTFSKVWGTYEGGPDNQGASVYEPTGLRYGYSMLGSYSQP  98

Query  96   NNQPLSGWVLVGKDNNGE---ILKPPTDYTLVWSS  1
            N++PL G+VLV KD +G+    LKPP DY+LV ++
Sbjct  99   NSKPLFGYVLVAKDISGKTNGTLKPPVDYSLVLNT  133



>emb|CBI37192.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 15/123 (12%)
 Frame = -1

Query  327  LPIDT-TFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            LP DT TF LP+P+PTWP G GF SG I+LG L+V QIS  + +W S        G T +
Sbjct  16   LPPDTKTFSLPAPIPTWPQGQGFASGVINLGELEVFQISRFEFVWGSNLSQDKKKGVTFY  75

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD---NNGEI-----------LKPPTDYTL  13
            +P  IP+GF  LG Y Q N+QPL G+VLV ++   +N E+           L+ P DYTL
Sbjct  76   KPVGIPNGFFSLGHYCQSNDQPLQGFVLVAREVACSNPEVAQICNLDKSPPLQKPLDYTL  135

Query  12   VWS  4
            +WS
Sbjct  136  LWS  138



>ref|XP_002272156.1| PREDICTED: uncharacterized protein LOC100259944 [Vitis vinifera]
Length=569

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 15/123 (12%)
 Frame = -1

Query  327  LPIDT-TFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            LP DT TF LP+P+PTWP G GF SG I+LG L+V QIS  + +W S        G T +
Sbjct  16   LPPDTKTFSLPAPIPTWPQGQGFASGVINLGELEVFQISRFEFVWGSNLSQDKKKGVTFY  75

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD---NNGEI-----------LKPPTDYTL  13
            +P  IP+GF  LG Y Q N+QPL G+VLV ++   +N E+           L+ P DYTL
Sbjct  76   KPVGIPNGFFSLGHYCQSNDQPLQGFVLVAREVACSNPEVAQICNLDKSPPLQKPLDYTL  135

Query  12   VWS  4
            +WS
Sbjct  136  LWS  138



>ref|XP_008443774.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103487283 
[Cucumis melo]
Length=555

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 17/114 (15%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I LG ++V +IS LKK+WR  +      GA  ++P +IPD
Sbjct  26   FSLPSPLPKWPPGKGFSTGRISLGEIEVYKISKLKKVWRCSQ------GAVFYKPQAIPD  79

Query  129  GFCMLGSYAQPNNQPLSGWVLVGK--------DNNGE---ILKPPTDYTLVWSS  1
            GF  LG Y QP++ PL G+VLV +        DN+      LK P +YTL+WSS
Sbjct  80   GFFCLGHYCQPSDNPLKGYVLVARGVSEVDHVDNSVRESPALKRPVNYTLIWSS  133



>gb|KDO60351.1| hypothetical protein CISIN_1g045952mg [Citrus sinensis]
Length=569

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 68/118 (58%), Gaps = 14/118 (12%)
 Frame = -1

Query  312  TFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIP  133
            TF LP+PLPTWP G GF SG I+LG ++VC+IS    IW           AT +EP+ IP
Sbjct  22   TFSLPAPLPTWPQGQGFASGRINLGEIEVCRISRFNFIWSCNLLQSKKKSATFYEPAGIP  81

Query  132  DGFCMLGSYAQPNNQPLSGWVLVGKD---NNGE-----------ILKPPTDYTLVWSS  1
            DGF  LG Y Q +++PL G+VLV +D   +  E            L+ P DYTLVW S
Sbjct  82   DGFYSLGHYCQFDSRPLRGFVLVARDLASSEAEGAHTSNLFKSPALQKPLDYTLVWCS  139



>ref|XP_006443731.1| hypothetical protein CICLE_v10019502mg [Citrus clementina]
 ref|XP_006479438.1| PREDICTED: uncharacterized protein LOC102613175 [Citrus sinensis]
 gb|ESR56971.1| hypothetical protein CICLE_v10019502mg [Citrus clementina]
Length=569

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 68/118 (58%), Gaps = 14/118 (12%)
 Frame = -1

Query  312  TFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIP  133
            TF LP+PLPTWP G GF SG I+LG ++VC+IS    IW           AT +EP+ IP
Sbjct  22   TFSLPAPLPTWPQGQGFASGRINLGEIEVCRISRFNFIWSCNLLQSKKKSATFYEPAGIP  81

Query  132  DGFCMLGSYAQPNNQPLSGWVLVGKD---NNGE-----------ILKPPTDYTLVWSS  1
            DGF  LG Y Q +++PL G+VLV +D   +  E            L+ P DYTLVW S
Sbjct  82   DGFYSLGHYCQFDSRPLRGFVLVARDLASSEAEGAHTSNLFKSPALQKPLDYTLVWCS  139



>ref|XP_010691350.1| PREDICTED: uncharacterized protein LOC104904693 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=575

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 74/136 (54%), Gaps = 13/136 (10%)
 Frame = -1

Query  369  FGVEEL*VMGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRS  190
            F    +    +I   P  TTF LP+ LP WP G GF +G I+LG LQV +I+  + +W S
Sbjct  9    FACHRIDANNSINLSPSFTTFLLPAQLPNWPDGQGFATGTINLGELQVAEITRFEFVWGS  68

Query  189  YEGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDN-------------N  49
            +       G + ++P  IP+GF  LG Y QPN +PL+G+VLV KD+             +
Sbjct  69   HLSHDKRKGISFYKPLGIPEGFFCLGHYCQPNGKPLNGYVLVAKDSLSHSRVSTDSEAIS  128

Query  48   GEILKPPTDYTLVWSS  1
               L  P DYT+VW+S
Sbjct  129  SAALAMPVDYTIVWNS  144



>gb|KHN14825.1| hypothetical protein glysoja_020998 [Glycine soja]
Length=560

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 7/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP GG F SG I LG ++V +++N +K+WR       ++G T + P  IP+
Sbjct  24   FSLPSPLPQWPQGGSFASGRICLGEIEVVKVNNFEKVWRCTSLNGKSLGFTFYRPLEIPE  83

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE-------ILKPPTDYTLVWS  4
            GF  LG Y Q N+QPL G+VLV ++ + +        L+ P +Y+L+WS
Sbjct  84   GFFCLGYYCQSNHQPLRGYVLVARETSFDASVLESPALEKPLNYSLIWS  132



>ref|XP_003536134.1| PREDICTED: uncharacterized protein LOC100788778 [Glycine max]
Length=560

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 7/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP GG F SG I LG ++V +++N +K+WR       ++G T + P  IP+
Sbjct  24   FSLPSPLPQWPQGGSFASGRICLGEIEVIKVNNFEKVWRCTSLNGKSLGFTFYRPLEIPE  83

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE-------ILKPPTDYTLVWS  4
            GF  LG Y Q N+QPL G+VLV ++ + +        L+ P +Y+L+WS
Sbjct  84   GFFCLGYYCQSNHQPLRGYVLVARETSFDASVLESPALEKPLNYSLIWS  132



>ref|XP_003556481.1| PREDICTED: uncharacterized protein LOC100814522 [Glycine max]
 gb|KHN14717.1| hypothetical protein glysoja_038126 [Glycine soja]
Length=559

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 66/109 (61%), Gaps = 7/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP GG F  G I LG ++V +++  +K+WR       ++G T + P  IP+
Sbjct  23   FSLPSPLPQWPQGGSFACGRICLGEIEVIKVNKFEKVWRCTSLNGKSLGFTFYRPLEIPE  82

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE-------ILKPPTDYTLVWS  4
            GF  LG Y Q N+QPL G+VLV +D + +        L+ P +Y+L+WS
Sbjct  83   GFFCLGHYCQSNDQPLRGYVLVARDTSSDASTLESPALEKPLNYSLIWS  131



>ref|XP_009120969.1| PREDICTED: uncharacterized protein LOC103845831 [Brassica rapa]
Length=549

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 7/110 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWR-SYEGGPNNVGATIFEPSSIP  133
            F LPSPLP WP G GF +G I+LG +QV +++   ++W+ S   G  +  A+ ++P  IP
Sbjct  25   FSLPSPLPRWPQGTGFATGKINLGEIQVVKVTEFDRVWKCSKTRGGKSRCASFYKPVGIP  84

Query  132  DGFCMLGSYAQPNNQPLSGWVLVGKDNNGE------ILKPPTDYTLVWSS  1
            +GF  LG Y Q NNQPL G+VL  + N+ +       LK P +YTLVWSS
Sbjct  85   EGFHCLGHYCQQNNQPLRGFVLAAQANDPDHHADRPALKKPVNYTLVWSS  134



>ref|XP_006408193.1| hypothetical protein EUTSA_v10020390mg [Eutrema salsugineum]
 gb|ESQ49646.1| hypothetical protein EUTSA_v10020390mg [Eutrema salsugineum]
Length=570

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I+LGGL+V +I+   K+W S      +  AT +    +P+
Sbjct  28   FSLPSPLPCWPQGQGFATGRINLGGLEVAKITKFHKVWSSDSSHGKSKRATFYRADEVPE  87

Query  129  GFCMLGSYAQPNNQPLSGWVLVGK-------DNNGEILKPPTDYTLVWSS  1
            GF  LG Y QP +QPL G+VL  +       D++   LK P  Y+LVWS+
Sbjct  88   GFHCLGHYCQPTDQPLRGYVLAARASKPVNADDDLPPLKKPLSYSLVWST  137



>emb|CDP03796.1| unnamed protein product [Coffea canephora]
Length=605

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 67/121 (55%), Gaps = 13/121 (11%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            P   +F LP+PLP WP GGGF  G I LG L+VC ++  + IW     G    G + ++P
Sbjct  20   PQPESFSLPAPLPDWPQGGGFADGTIKLGVLEVCHVTKFELIWGCNLSGDKKKGFSFYKP  79

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-NNGEI------------LKPPTDYTLVWS  4
              IPDGF  LG Y Q N +P  G+VLV ++  N E+            L+ P DYTLVWS
Sbjct  80   VGIPDGFFSLGHYCQSNEKPFRGFVLVAREVFNSELGDPSIDNLHLPALRSPEDYTLVWS  139

Query  3    S  1
            S
Sbjct  140  S  140



>ref|XP_007050164.1| Vacuolar protein sorting-associated protein YPR157W [Theobroma 
cacao]
 gb|EOX94321.1| Vacuolar protein sorting-associated protein YPR157W [Theobroma 
cacao]
Length=568

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 66/117 (56%), Gaps = 13/117 (11%)
 Frame = -1

Query  312  TFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIP  133
            TF LP+PLP WP G GF SG I+LG L+V +IS  + IW S        G T +EP  IP
Sbjct  22   TFSLPAPLPQWPQGQGFASGKINLGELEVVKISRFEFIWSSNLLRDKKKGVTFYEPVGIP  81

Query  132  DGFCMLGSYAQPNNQPLSGWVLVGKDN-------------NGEILKPPTDYTLVWSS  1
            DGF  LG Y Q N+QPL G+VLV ++              +   L+ P D +LVWSS
Sbjct  82   DGFYSLGHYCQSNDQPLRGYVLVAREKPFKSEAAHFSACVSSPALREPLDCSLVWSS  138



>emb|CDX92605.1| BnaA10g16440D [Brassica napus]
Length=549

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 69/110 (63%), Gaps = 7/110 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWR-SYEGGPNNVGATIFEPSSIP  133
            F LPSPLP WP G GF +G I+LG ++V +++   ++W+ S   G  +  A+ ++P  IP
Sbjct  25   FSLPSPLPRWPQGTGFATGKINLGEIEVVKVTEFDRVWKCSKSRGGKSRCASFYKPVGIP  84

Query  132  DGFCMLGSYAQPNNQPLSGWVLVGKDNNGE------ILKPPTDYTLVWSS  1
            +GF  LG Y Q NNQPL G+VL  + N+ +       LK P +YTLVWSS
Sbjct  85   EGFHCLGHYCQQNNQPLRGFVLAAQANDPDHHADRPALKKPVNYTLVWSS  134



>ref|NP_197350.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK96703.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68343.1| At5g18490 [Arabidopsis thaliana]
 gb|AED92570.1| uncharacterized protein AT5G18490 [Arabidopsis thaliana]
Length=553

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 8/111 (7%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I LG +QV +++   ++W+          A+ ++P  IP+
Sbjct  25   FSLPSPLPQWPQGRGFATGRISLGEIQVVKVTEFDRVWKCGTSRGKLRCASFYKPVGIPE  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGK--------DNNGEILKPPTDYTLVWSS  1
            GF  LG Y QPNNQPL G+VL  +        D++   LK P +Y+LVWSS
Sbjct  85   GFHCLGHYCQPNNQPLRGFVLAARANKPGHLADDHRPPLKKPLNYSLVWSS  135



>ref|XP_003595836.1| Vacuolar protein sorting-associated protein [Medicago truncatula]
 gb|ABN08112.1| Protein of unknown function DUF946, plant [Medicago truncatula]
Length=621

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 4/93 (4%)
 Frame = -1

Query  276  SGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPDGFCMLGSYAQP  97
            +G  F +  IDLG L V Q S   K+W +YE GP++ GA+++EP+ +  G+ MLGSY+QP
Sbjct  99   TGTSFANTVIDLGELHVMQASTFSKVWGAYESGPDDQGASVYEPTGLRYGYSMLGSYSQP  158

Query  96   NNQPLSGWVLVGKDNNGE----ILKPPTDYTLV  10
            NN+PL G+VL  KD +G      LKPP DYTLV
Sbjct  159  NNKPLFGYVLAAKDISGSTTNGTLKPPVDYTLV  191



>gb|KHN43170.1| Glycogenin-1 [Glycine soja]
Length=1248

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 64/109 (59%), Gaps = 6/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP+PLP WP G GF SG I LG L+V ++S  +++W        + G   ++P  IPD
Sbjct  23   FSLPAPLPQWPQGDGFASGRISLGRLEVLKVSKFERVWSCPSSHGKSQGFVFYKPLEIPD  82

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE------ILKPPTDYTLVWSS  1
            GF  LG Y Q N+QPL G VLV ++   E       LK P +Y+L+WS+
Sbjct  83   GFFCLGHYCQSNDQPLRGHVLVARETCSEPELESPALKKPINYSLIWSA  131



>ref|XP_006400398.1| hypothetical protein EUTSA_v10013152mg [Eutrema salsugineum]
 gb|ESQ41851.1| hypothetical protein EUTSA_v10013152mg [Eutrema salsugineum]
Length=555

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 10/112 (9%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWR---SYEGGPNNVGATIFEPSS  139
            F LPSPLP WP G GF +G I+LG ++V +++   ++W+   S   G +   A+ ++P  
Sbjct  25   FLLPSPLPRWPQGTGFATGRINLGEIEVVKVTEFDRVWKCGTSSSRGKSKC-ASFYKPVG  83

Query  138  IPDGFCMLGSYAQPNNQPLSGWVLVGK------DNNGEILKPPTDYTLVWSS  1
            IP+GF  LG Y QPNNQPL G+VL  +      D++   LK P  YTLVWSS
Sbjct  84   IPEGFHCLGHYCQPNNQPLRGFVLAARANDPDHDHHRHPLKKPLKYTLVWSS  135



>gb|KHG12486.1| Vacuolar sorting-associated protein 62 [Gossypium arboreum]
Length=569

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 68/124 (55%), Gaps = 15/124 (12%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LP    F LPSP+P WP G GF +G I+LG L+V +I+  + +W          GAT ++
Sbjct  22   LPQPQPFSLPSPIPDWPPGQGFATGKINLGELEVVKITKFESVWSCDSLHGKAKGATFYK  81

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEI---------------LKPPTDYTL  13
            P  I DGF  LG Y QPN+QPL G+VLV ++  G                 LK P +Y+L
Sbjct  82   PVGIRDGFFCLGYYCQPNDQPLRGYVLVAREREGSTPEVYRNYDSDSDFPALKKPVNYSL  141

Query  12   VWSS  1
            +WSS
Sbjct  142  IWSS  145



>gb|KDO53065.1| hypothetical protein CISIN_1g008314mg [Citrus sinensis]
Length=570

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 66/119 (55%), Gaps = 16/119 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSP+P WP G GF +G I+LG L+V +I+ L+ IW     G    G T ++P  IPD
Sbjct  25   FSLPSPIPQWPQGTGFATGKINLGELEVFKITKLESIWNYNVLGGEAKGVTFYKPGEIPD  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE----------------ILKPPTDYTLVWSS  1
            GF  LG Y QPN+QPL G +LV +D                     L+ P +YTLVWS+
Sbjct  85   GFYCLGYYCQPNDQPLRGHLLVARDAAASSRTEAGSTDKITLHHPALRKPLNYTLVWST  143



>ref|XP_003590981.1| hypothetical protein MTR_1g080370 [Medicago truncatula]
 ref|XP_003590985.1| hypothetical protein MTR_1g080410 [Medicago truncatula]
 gb|AES61232.1| pre-mRNA processing protein PRP39, putative [Medicago truncatula]
 gb|AES61236.1| pre-mRNA processing protein PRP39, putative [Medicago truncatula]
Length=560

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 62/112 (55%), Gaps = 11/112 (10%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP GGGF  G I LG ++V +++  +K+WR        +G T + P  IPD
Sbjct  23   FSLPSPLPQWPQGGGFAGGRISLGKIEVTKVNKFEKVWRCTNSNGKALGFTFYRPLEIPD  82

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE-----------ILKPPTDYTLVW  7
            GF  LG Y   N+QPL G VLV ++   +            LK P +Y+L+W
Sbjct  83   GFSCLGYYCHSNDQPLRGHVLVARETTSKSQADCSESESPALKKPLNYSLIW  134



>gb|AAM64724.1| unknown [Arabidopsis thaliana]
Length=553

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 8/111 (7%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I+LG +QV  ++   ++W+          A+ ++P  IP+
Sbjct  25   FSLPSPLPQWPQGRGFATGRINLGEIQVVNVTEFDRVWKCGTSRGKLRCASFYKPVGIPE  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNN-GEI-------LKPPTDYTLVWSS  1
            GF  LG Y QPNNQPL G+VL  + N  G +       LK P +Y+LVWSS
Sbjct  85   GFHCLGHYCQPNNQPLRGFVLAARANEPGHLADDHLPPLKKPLNYSLVWSS  135



>ref|XP_010454091.1| PREDICTED: uncharacterized protein LOC104735910 [Camelina sativa]
Length=556

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 66/112 (59%), Gaps = 8/112 (7%)
 Frame = -1

Query  312  TFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIP  133
            +F LP PLP WP G GF +G I+LG ++V +++   ++W+          A+ ++P  IP
Sbjct  25   SFSLPLPLPRWPQGSGFATGRINLGEIEVVKVTEFDRVWKCGTSRGKTRCASFYKPLGIP  84

Query  132  DGFCMLGSYAQPNNQPLSGWVLVGKDNNGEI--------LKPPTDYTLVWSS  1
            DGF  LG Y QP+N+PL G+VL  + NN           LK P +Y+LVWSS
Sbjct  85   DGFHCLGHYCQPSNEPLRGFVLAARANNPHHNAYDHLPPLKQPVNYSLVWSS  136



>ref|XP_006403160.1| hypothetical protein EUTSA_v10003172mg [Eutrema salsugineum]
 gb|ESQ44613.1| hypothetical protein EUTSA_v10003172mg [Eutrema salsugineum]
Length=564

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = -1

Query  345  MGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNV  166
            +   P L    TF LP+ LP WPSG GF S  I+LG L+V +I+    +WR      NN 
Sbjct  12   LREFPPLKEPETFSLPASLPQWPSGQGFASRRINLGELEVAEITTFDFVWRYISPRDNNK  71

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
              + ++P++IP+ F  LG Y   ++  L G+VLV ++   + L  P DYTLVWSS
Sbjct  72   SVSFYKPNNIPENFHCLGHYCHSDSNLLRGFVLVAREVVAKSLAKPLDYTLVWSS  126



>ref|XP_007147203.1| hypothetical protein PHAVU_006G104300g [Phaseolus vulgaris]
 gb|ESW19197.1| hypothetical protein PHAVU_006G104300g [Phaseolus vulgaris]
Length=563

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 6/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP+PLP WP G GF  G I LG L+V +I   +++W S      + G   ++P  IPD
Sbjct  27   FSLPAPLPQWPQGAGFARGRISLGSLEVLKIRKFERVWSSPRSRGKSQGFVFYKPLEIPD  86

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE------ILKPPTDYTLVWSS  1
             F  LG Y Q N+QPL G VLV ++ + E       L+ P +Y+L+WS+
Sbjct  87   DFFCLGHYCQSNDQPLRGHVLVARETSSEPEAESPALRKPINYSLIWSA  135



>ref|XP_006437467.1| hypothetical protein CICLE_v10031092mg [Citrus clementina]
 gb|ESR50707.1| hypothetical protein CICLE_v10031092mg [Citrus clementina]
Length=570

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 66/119 (55%), Gaps = 16/119 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSP+P WP G GF +G I+LG L+V +I+ L+ IW     G    G T ++P  IPD
Sbjct  25   FSLPSPIPQWPQGKGFATGKINLGELEVFKITKLESIWSCNVLGGEAKGVTFYKPGEIPD  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE----------------ILKPPTDYTLVWSS  1
            GF  LG Y QPN++PL G +LV +D                     L+ P +YTLVWS+
Sbjct  85   GFYCLGYYCQPNDRPLRGHLLVARDAAASSRTEAGSTDKITLHHPALRKPLNYTLVWST  143



>ref|NP_001048935.1| Os03g0142900 [Oryza sativa Japonica Group]
 gb|ABF93920.1| pre-mRNA processing protein PRP39, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10849.1| Os03g0142900 [Oryza sativa Japonica Group]
 gb|EAZ25539.1| hypothetical protein OsJ_09364 [Oryza sativa Japonica Group]
 dbj|BAG90269.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00013.1| unnamed protein product [Oryza sativa Japonica Group]
Length=548

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 65/110 (59%), Gaps = 14/110 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F+LP+PLP WP GG F  G I +G L+V  I+  + IW          GAT +EP  IPD
Sbjct  25   FQLPAPLPDWPQGGDFSKGTICIGELEVASITKFQSIWSC-------SGATFYEPQEIPD  77

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD-------NNGEILKPPTDYTLVWSS  1
            GF  LG YAQ N++PL G++LV ++       N    L+ P DYTLVW+S
Sbjct  78   GFHCLGHYAQQNDRPLQGFLLVAREAASCQSINLKPALEKPLDYTLVWTS  127



>ref|XP_006484620.1| PREDICTED: uncharacterized protein LOC102609992 [Citrus sinensis]
Length=570

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 66/119 (55%), Gaps = 16/119 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSP+P WP G GF +G I+LG L+V +I+ L+ IW     G    G T ++P  IPD
Sbjct  25   FSLPSPIPQWPQGKGFATGKINLGELEVFKITKLESIWSCNVLGGEAKGVTFYKPGEIPD  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE----------------ILKPPTDYTLVWSS  1
            GF  LG Y QPN++PL G +LV +D                     L+ P +YTLVWS+
Sbjct  85   GFYCLGYYCQPNDRPLRGHLLVARDAAASSRTEAGSTDKITLHHPALRKPLNYTLVWST  143



>ref|XP_010674262.1| PREDICTED: uncharacterized protein LOC104890460 [Beta vulgaris 
subsp. vulgaris]
Length=546

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 68/107 (64%), Gaps = 4/107 (4%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP+ LP WP G GF +G I+LG L+V +I+  + +W       N+ G T ++P +IPD
Sbjct  25   FSLPAHLPQWPQGEGFATGKINLGELEVAKITKFESVWSCNPSRRNSKGVTFYKPVAIPD  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLVWSS  1
            GF  LG Y Q N++PL G+VLV ++    ++   LK P +++LVWSS
Sbjct  85   GFFCLGHYCQSNDRPLWGFVLVAREVKQSSDSPALKRPHNFSLVWSS  131



>gb|AFK13836.1| putative pre-mRNA processing protein PRP39 [Beta vulgaris subsp. 
vulgaris]
Length=578

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 68/107 (64%), Gaps = 4/107 (4%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP+ LP WP G GF +G I+LG L+V +I+  + +W       N+ G T ++P +IPD
Sbjct  57   FSLPAHLPQWPQGEGFATGKINLGELEVAKITKFESVWSCNPSRRNSKGVTFYKPFAIPD  116

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD----NNGEILKPPTDYTLVWSS  1
            GF  LG Y Q N++PL G+VLV ++    ++   LK P +++LVWSS
Sbjct  117  GFFCLGHYCQSNDRPLWGFVLVAREVKQSSDSPALKRPRNFSLVWSS  163



>ref|XP_010936079.1| PREDICTED: vacuolar protein sorting-associated protein 62-like 
[Elaeis guineensis]
Length=562

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 6/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP P+P WP G GF  G I +G L++ +I+  + IW        + GAT F+P  +PD
Sbjct  25   FSLPLPVPQWPKGEGFAQGKICIGELELVEITKFQSIWSCMSSEDKSKGATFFKPVGLPD  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD----NNGEI--LKPPTDYTLVWSS  1
            GF  LG YAQ N+QPL G+VL  ++    N  ++  L+ P DY LVWSS
Sbjct  85   GFLSLGHYAQTNDQPLRGFVLAARESLACNVADLPALQKPIDYMLVWSS  133



>ref|XP_003538659.2| PREDICTED: uncharacterized protein LOC100811439 [Glycine max]
 gb|KHN35126.1| hypothetical protein glysoja_004892 [Glycine soja]
Length=601

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (58%), Gaps = 17/125 (14%)
 Frame = -1

Query  342  GNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVG  163
            GN  TLP   TF LPSPLP WP G GF SG ++LG ++VC+++  + +W S  G P    
Sbjct  54   GNTITLP--QTFSLPSPLPQWPQGQGFASGIVNLGEIEVCKVTGFEFVWNSNIGKP----  107

Query  162  ATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-----------NNGEILKPPTDYT  16
               ++P  IPDGF +LG Y QP+++PL G+VL  ++           +    LK P DY 
Sbjct  108  VAFYKPVRIPDGFRILGHYCQPSDKPLRGFVLGVREVETASSETSNCHTLPALKNPLDYM  167

Query  15   LVWSS  1
            LVW S
Sbjct  168  LVWCS  172



>ref|XP_010091803.1| hypothetical protein L484_015871 [Morus notabilis]
 gb|EXB46011.1| hypothetical protein L484_015871 [Morus notabilis]
Length=571

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 65/117 (56%), Gaps = 14/117 (12%)
 Frame = -1

Query  312  TFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIP  133
            TF LP+PLP WP G GF SG I +G L+V +++  + IW        N G + ++P+ IP
Sbjct  24   TFSLPAPLPKWPQGKGFASGRISIGELEVFKVTRFEFIWCYNLSQDKNKGFSFYKPAEIP  83

Query  132  DGFCMLGSYAQPNNQPLSGWVLVGKDNNGE--------------ILKPPTDYTLVWS  4
            DGF  LG + QPNNQPL G++LV ++                  +L  P DY LVWS
Sbjct  84   DGFHSLGHFCQPNNQPLRGFLLVAREVASHMPESCHASNTAKLPVLCEPLDYVLVWS  140



>gb|KDP23733.1| hypothetical protein JCGZ_23566 [Jatropha curcas]
Length=573

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 66/118 (56%), Gaps = 15/118 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP+P+P WP G GF +G I+LG L+V +I+  +++W       N  G T + P  IPD
Sbjct  27   FSLPAPIPEWPQGKGFATGSINLGELEVFKINQFERVWSCSLLRGNQKGVTFYRPVGIPD  86

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE---------------ILKPPTDYTLVWSS  1
             F  LG Y Q N+QPL G+VLV +D N +                LK P +Y+LVWS+
Sbjct  87   DFYCLGHYCQSNDQPLRGYVLVARDTNIQKPEVGQFSGPKSDSPALKKPLNYSLVWST  144



>gb|KHN25608.1| hypothetical protein glysoja_018182 [Glycine soja]
Length=586

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 17/121 (14%)
 Frame = -1

Query  330  TLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIF  151
            TLP   TF LPSP+P WP G GF SG ++LGG++VC+++  + +W S  G P       +
Sbjct  43   TLP--QTFSLPSPIPQWPQGQGFASGIVNLGGIEVCKVTGFEFVWNSNIGKP----VAFY  96

Query  150  EPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD---------NNGEI--LKPPTDYTLVWS  4
            +P  IPDGF +LG Y Q +++PL G+VLV ++         N  ++  LK P DY LVW 
Sbjct  97   KPVGIPDGFHILGHYCQSSDKPLRGFVLVVREVETASSETSNRDKLTALKNPLDYMLVWC  156

Query  3    S  1
            S
Sbjct  157  S  157



>ref|XP_008796406.1| PREDICTED: uncharacterized protein LOC103711872 [Phoenix dactylifera]
Length=562

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 64/109 (59%), Gaps = 6/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSP+P WP G GF  G I +G L+V +I+  + IW          GAT F+P  +PD
Sbjct  25   FSLPSPIPQWPKGEGFAQGKIYIGELEVVEITKFQSIWSCISLEDKGKGATFFKPVGLPD  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDN------NGEILKPPTDYTLVWSS  1
            GF  LG YAQ ++QPL G+VL  +++      +   L+ P DY LVWSS
Sbjct  85   GFFSLGHYAQTDDQPLHGFVLAARESFACNVTDLPALQKPIDYMLVWSS  133



>gb|KFK26090.1| hypothetical protein AALP_AA8G201500 [Arabis alpina]
Length=556

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 67/111 (60%), Gaps = 8/111 (7%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I+LG ++V +++   ++W+  +    +  A+ ++P  IP+
Sbjct  25   FSLPSPLPRWPKGRGFATGRINLGEIEVVKVTEFDRVWKCGKSRGKSRCASFYKPVGIPE  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGK--------DNNGEILKPPTDYTLVWSS  1
            GF  LG Y QPN+Q L G+VL  +        DN+   LK P +Y LVWSS
Sbjct  85   GFHCLGHYCQPNDQLLRGFVLAARANKSDHHADNDRPPLKKPVNYFLVWSS  135



>ref|XP_010102201.1| hypothetical protein L484_024482 [Morus notabilis]
 gb|EXB93144.1| hypothetical protein L484_024482 [Morus notabilis]
Length=568

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 15/118 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP+WP G GF +G I LGG++V +I+  +++W        + G + ++P+ IP+
Sbjct  24   FSLPSPLPSWPKGQGFATGRISLGGIEVEKITKFERVWNCAPVRGKSKGVSFYKPAEIPE  83

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNG---EI------------LKPPTDYTLVWSS  1
            GF  LG Y Q N+QPL G+VLV ++      E+            LK P +YTL+WSS
Sbjct  84   GFSCLGYYCQRNDQPLRGYVLVAREATSPKPEVGCFDNPALESPELKKPINYTLLWSS  141



>gb|KHG05685.1| Vacuolar sorting-associated protein 62 [Gossypium arboreum]
Length=560

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 65/116 (56%), Gaps = 14/116 (12%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP+PLP WP G GF SG ++LG L+V +IS  K IW S        G T ++P  IPD
Sbjct  23   FSLPAPLPQWPHGQGFASGKLNLGELEVVKISRFKFIWSS-NLEDKKKGVTFYKPVGIPD  81

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE-------------ILKPPTDYTLVWSS  1
            GF +LG Y Q N+QPL G+VLV ++   +              L+ P DYTL W S
Sbjct  82   GFYILGHYCQSNDQPLRGFVLVAREAPSKSEATDFSTRVTSPALREPLDYTLAWKS  137



>ref|XP_002884442.1| hypothetical protein ARALYDRAFT_477694 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60701.1| hypothetical protein ARALYDRAFT_477694 [Arabidopsis lyrata subsp. 
lyrata]
Length=567

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 65/109 (60%), Gaps = 6/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP+WP G GF +G I+LG ++V +I+   ++W S      +  AT +    IP+
Sbjct  26   FSLPSPLPSWPQGKGFATGRINLGEIEVVKITKFHRVWSSDSLHDKSKRATFYRAEEIPE  85

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD----NNGEI--LKPPTDYTLVWSS  1
            GF  LG Y QP +QPL G+VL  +     N  ++  LK P  Y+LVWS+
Sbjct  86   GFHCLGHYCQPTDQPLRGYVLAARASKAVNADDLPPLKKPVSYSLVWSA  134



>ref|XP_006854359.1| hypothetical protein AMTR_s00039p00159460 [Amborella trichopoda]
 gb|ERN15826.1| hypothetical protein AMTR_s00039p00159460 [Amborella trichopoda]
Length=577

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 68/118 (58%), Gaps = 15/118 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSP+P+WP G GF  G + LG L+V ++++ +K+W        + GAT + P  IP+
Sbjct  28   FSLPSPIPSWPPGKGFAQGRMCLGKLEVYRVTDFEKVWSCNLVKGKSKGATFYRPIGIPN  87

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD---------------NNGEILKPPTDYTLVWSS  1
            GF  LG YAQPN+QPL G+VLV KD                +   L+ P +YTLVW S
Sbjct  88   GFFCLGHYAQPNDQPLRGFVLVAKDLSTPEPKLGQSPKRVTDLPALQKPLNYTLVWGS  145



>ref|XP_002465876.1| hypothetical protein SORBIDRAFT_01g047420 [Sorghum bicolor]
 gb|EER92874.1| hypothetical protein SORBIDRAFT_01g047420 [Sorghum bicolor]
Length=551

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 14/110 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F+LP+PLP WP GG F  G I +G L V  I+  + IW   +       AT +EP  IPD
Sbjct  25   FQLPAPLPDWPQGGDFAKGTICIGELDVVNITKFRNIWTCSD-------ATFYEPEGIPD  77

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD-------NNGEILKPPTDYTLVWSS  1
            GF  LG YAQ N++PL G++LV ++       N+   L+ P DY+LVW+S
Sbjct  78   GFHCLGHYAQQNDRPLQGFLLVAREVASHQVINSKPALEKPLDYSLVWTS  127



>gb|KFK37858.1| hypothetical protein AALP_AA3G038300 [Arabis alpina]
Length=567

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 64/109 (59%), Gaps = 6/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I+LG ++V +I+   ++W S      +  AT +    IP+
Sbjct  26   FSLPSPLPCWPQGQGFATGRINLGDIEVVKITKFHRLWSSDSSHGKSKRATFYRAEEIPE  85

Query  129  GFCMLGSYAQPNNQPLSGWVLV----GKDNNGEI--LKPPTDYTLVWSS  1
            GF  LG Y QP +QPL G+VL     G  N  ++  LK P  Y+LVWS+
Sbjct  86   GFHCLGHYCQPTDQPLRGYVLAARASGSANADDLPPLKKPVSYSLVWST  134



>ref|XP_011080117.1| PREDICTED: uncharacterized protein LOC105163463 [Sesamum indicum]
Length=604

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 63/120 (53%), Gaps = 12/120 (10%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            P    F LP P+P WP G GF +  I LG L+VCQI+  + IW          G + ++P
Sbjct  55   PESEYFSLPDPIPQWPPGSGFATSRITLGELEVCQITKFQYIWGCNLSKDGKQGVSFYKP  114

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKD------------NNGEILKPPTDYTLVWSS  1
              IPDGF  LG Y Q N +PL G+VLV ++             N   L+ P DY+LVWSS
Sbjct  115  IGIPDGFFCLGHYCQSNEKPLRGFVLVAREAAKQQDCCTLKSENMPALQNPVDYSLVWSS  174



>ref|XP_009397900.1| PREDICTED: uncharacterized protein LOC103982643 [Musa acuminata 
subsp. malaccensis]
Length=564

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 68/114 (60%), Gaps = 14/114 (12%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWR----SYEGGPNNVGATIFEPS  142
            F LP P+P WP GGGF  G I  G L+V +I+  ++IW     S E G    GA  ++PS
Sbjct  25   FSLPFPIPKWPQGGGFAKGSICTGELEVLKITKFERIWSCRLSSLEEGK---GALFYKPS  81

Query  141  SIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNG-------EILKPPTDYTLVWSS  1
            +IP+G+  LG YAQP NQPL G+VLV ++N           L+ P DY LVWSS
Sbjct  82   AIPNGYFSLGHYAQPCNQPLHGFVLVVRENADFQPGSSLPALREPLDYKLVWSS  135



>ref|XP_007030349.1| Vacuolar protein sorting-associated protein 62 [Theobroma cacao]
 gb|EOY10851.1| Vacuolar protein sorting-associated protein 62 [Theobroma cacao]
Length=600

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 68/124 (55%), Gaps = 15/124 (12%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LP    F LPSP+P WP G GF +G I+LG L+V QI+  + +W        + G T ++
Sbjct  53   LPRPQPFSLPSPIPEWPPGQGFATGKINLGELEVVQITKFESVWSCNLLRGKSKGVTFYK  112

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVG---------------KDNNGEILKPPTDYTL  13
            P  IPDGF  LG Y QPN+QPL G+VLV                 D++   L  P +Y+L
Sbjct  113  PVGIPDGFFCLGHYCQPNDQPLRGYVLVACERVASSTEVYCDYDSDSDLPALTKPVNYSL  172

Query  12   VWSS  1
            +WS+
Sbjct  173  IWST  176



>ref|XP_006651028.1| PREDICTED: uncharacterized protein LOC102705992 [Oryza brachyantha]
Length=548

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 73/131 (56%), Gaps = 16/131 (12%)
 Frame = -1

Query  372  GFGVEEL*VMGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWR  193
            GFG       G+   LP    F+LP+PLP WP GG F  G I +G L+V  I+  + IW 
Sbjct  6    GFGCGPAGAAGDEVRLP--EPFQLPAPLPDWPQGGDFSKGTICIGELEVASITEFQSIWS  63

Query  192  SYEGGPNNVGATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD-------NNGEILK  34
                     GAT +EP  +PDGF  LG YAQ N++PL G++LV ++       ++   L+
Sbjct  64   C-------SGATFYEPQEVPDGFYCLGHYAQQNDRPLQGFLLVAREAASLQSIDHRPPLE  116

Query  33   PPTDYTLVWSS  1
             P +YTLVW+S
Sbjct  117  KPLNYTLVWTS  127



>ref|XP_010463914.1| PREDICTED: uncharacterized protein LOC104744543 [Camelina sativa]
Length=569

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 62/109 (57%), Gaps = 6/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I+LG + V +I+ L K+W S      +  AT +    IP 
Sbjct  26   FSLPSPLPCWPEGNGFATGIINLGVIDVVKITKLHKVWSSDSSHGKSKRATFYRAEEIPH  85

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD----NNGEI--LKPPTDYTLVWSS  1
            GF  LG Y QP +QPL G+VL  +     N   +  LK P  Y+LVWS+
Sbjct  86   GFHCLGHYCQPTDQPLRGYVLAARASETINVDHLPPLKKPVSYSLVWSA  134



>emb|CBI22319.3| unnamed protein product [Vitis vinifera]
Length=350

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP+P+P WP G GF +G I+LG + V +I+  ++IW   +      G T ++P  IPD
Sbjct  23   FSLPAPIPEWPRGQGFATGQINLGEIVVLKITQFERIWSCNQLHGKTTGVTFYKPVGIPD  82

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGEILKPPTDYTLVWSS  1
            GF  LG Y QPN+Q L G+VLV +D     LK  +   +VW++
Sbjct  83   GFFSLGHYCQPNDQALRGYVLVAQDAAASRLKVGSYPFIVWNA  125



>ref|XP_010414155.1| PREDICTED: uncharacterized protein LOC104700315 [Camelina sativa]
Length=567

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 62/109 (57%), Gaps = 6/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I+LG + V +I+ L ++W S      +  AT +    IP+
Sbjct  26   FSLPSPLPCWPQGNGFATGIINLGEIDVVKITKLHRVWSSDSSHGKSKRATFYRAVEIPE  85

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD------NNGEILKPPTDYTLVWSS  1
            GF  LG Y QP + PL G+VL  +       ++   LK P  Y+LVWS+
Sbjct  86   GFHCLGHYCQPTDHPLRGYVLAARASETINVDDLPALKKPVSYSLVWSA  134



>gb|KHG15512.1| Vacuolar sorting-associated protein 62 [Gossypium arboreum]
Length=572

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 69/124 (56%), Gaps = 15/124 (12%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LP    F LPSP+P WP G GFG+G I+LG L+V +I+  +++W          G T ++
Sbjct  27   LPQPQPFFLPSPIPEWPLGQGFGTGKINLGELEVVKITEFERVWSCSLLRGKAEGVTFYK  86

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGK---------------DNNGEILKPPTDYTL  13
            P  IPDGF  LG Y QPN+Q L G+VLV +               D +   L+ P +Y+L
Sbjct  87   PVGIPDGFFCLGYYCQPNDQLLRGYVLVARERVASSTEVYCDYDSDTDFPALRKPVNYSL  146

Query  12   VWSS  1
            +WS+
Sbjct  147  IWST  150



>ref|NP_199208.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09055.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL24350.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13309.1| unknown protein [Arabidopsis thaliana]
 gb|AED95036.1| uncharacterized protein AT5G43950 [Arabidopsis thaliana]
Length=566

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -1

Query  345  MGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNV  166
            +   P L    TF LP+ LP WPSG GFG G I+LG L+V +I++ + +WR      N  
Sbjct  12   LKEYPPLKEPETFSLPASLPQWPSGQGFGLGRINLGELEVAEITSFEFVWRYCSRRDNKK  71

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGE---ILKPPTDYTLVWSS  1
              + ++P  +P+ F  LG Y Q ++  L G++LV +  N      L  P DYTLVWSS
Sbjct  72   SVSFYKPDKLPEDFHCLGHYCQSDSHLLRGFLLVARQVNKSSEPALVQPLDYTLVWSS  129



>ref|XP_008218354.1| PREDICTED: uncharacterized protein LOC103318717 isoform X1 [Prunus 
mume]
Length=570

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 64/118 (54%), Gaps = 15/118 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G + LG ++V QI+  + IW        + G T + P+ IPD
Sbjct  26   FSLPSPLPHWPQGRGFATGRMCLGEIEVIQITKFESIWSCNLLHGKSKGVTFYRPAGIPD  85

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE---------------ILKPPTDYTLVWSS  1
             F  LG Y QPN+QPL G+VLV +D                    L+ P +Y+LVW++
Sbjct  86   DFFCLGYYCQPNDQPLRGYVLVARDTVATRLEDGCTQDLVLELPALRKPVNYSLVWNA  143



>ref|XP_010542907.1| PREDICTED: vacuolar protein sorting-associated protein 62 [Tarenaya 
hassleriana]
Length=573

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 70/126 (56%), Gaps = 13/126 (10%)
 Frame = -1

Query  345  MGNIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNV  166
            +  +P L    TF LP+P+P WP G GF +G I LG L+V +ISN K +WR       +V
Sbjct  12   LSELPPLTDPETFSLPAPMPQWPPGQGFAAGRIRLGELEVTKISNFKLVWRYRASQDKSV  71

Query  165  GATIFEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGK--DNNGE---------ILKPPTDY  19
              + + P  +P+GF  LG Y Q ++QPL  +VL  +  D++G+          L  P DY
Sbjct  72   --SFYRPVGVPEGFHCLGHYCQYDSQPLRNFVLAAREVDSSGQEASSSKPPPALAEPIDY  129

Query  18   TLVWSS  1
             LVWSS
Sbjct  130  KLVWSS  135



>gb|EYU46397.1| hypothetical protein MIMGU_mgv1a003803mg [Erythranthe guttata]
Length=563

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 61/111 (55%), Gaps = 8/111 (7%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP P+P WP G GF +  I LG L+VCQI+  + +W          G + ++P SIPD
Sbjct  23   FSLPDPIPHWPQGSGFATSRIGLGELEVCQITRFEFVWGCNLSTDGKRGVSFYKPISIPD  82

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE--------ILKPPTDYTLVWSS  1
            GF  LG Y Q N  PL G+VLV ++   +         L  P DY+L+WSS
Sbjct  83   GFFCLGHYCQSNENPLRGFVLVAREMTTQNSSCYNMPSLSKPVDYSLMWSS  133



>ref|XP_007204992.1| hypothetical protein PRUPE_ppa003496mg [Prunus persica]
 gb|EMJ06191.1| hypothetical protein PRUPE_ppa003496mg [Prunus persica]
Length=570

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 64/118 (54%), Gaps = 15/118 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G + LG ++V QI+  + IW        + G T + P+ IPD
Sbjct  26   FSLPSPLPHWPQGRGFATGRMCLGEIEVIQITKFESIWSCNLLHGKSKGVTFYRPAGIPD  85

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE---------------ILKPPTDYTLVWSS  1
             F  LG Y QPN+QPL G+VLV +D                    L+ P +Y+LVW++
Sbjct  86   DFFCLGYYCQPNDQPLRGYVLVARDTVATSLEDGCTQDSVLELPALRKPVNYSLVWNA  143



>gb|ACN26628.1| unknown [Zea mays]
 tpg|DAA43316.1| TPA: hypothetical protein ZEAMMB73_151042 [Zea mays]
Length=552

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 14/110 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F+LP+PLP WP GG F  G I +G + V  I+  + IW   +       AT +EP  IPD
Sbjct  25   FQLPAPLPEWPQGGDFAKGTICIGEVDVTSITKFRSIWTCSD-------ATFYEPEGIPD  77

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD-------NNGEILKPPTDYTLVWSS  1
            GF  LG YAQ N++PL G++LV ++       +    L+ P+DY+LVW+S
Sbjct  78   GFHCLGHYAQQNDRPLQGFLLVAREVASHQVIDTKPALEKPSDYSLVWTS  127



>ref|XP_010475050.1| PREDICTED: uncharacterized protein LOC104754534 [Camelina sativa]
 ref|XP_010475051.1| PREDICTED: uncharacterized protein LOC104754534 [Camelina sativa]
Length=577

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 65/114 (57%), Gaps = 10/114 (9%)
 Frame = -1

Query  315  TTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSS-  139
             TF LPSP+P WP G GFGSG I+LG L+V +I+N + IWR Y     N   + ++P   
Sbjct  22   VTFSLPSPIPQWPPGQGFGSGTINLGKLEVIKITNFEFIWR-YRSTEKNKSISFYKPKGL  80

Query  138  IPDGFCMLGSYAQPNNQPLSGWVLVGKD--------NNGEILKPPTDYTLVWSS  1
            +P  F  LG Y Q ++ PL G+VLV +D             L  P D+TLVWSS
Sbjct  81   LPTNFHCLGHYCQSDSHPLRGYVLVARDLVDSLEQEEQKPALVEPVDFTLVWSS  134



>ref|NP_001145283.1| uncharacterized protein LOC100278579 [Zea mays]
 gb|ACG46509.1| hypothetical protein [Zea mays]
Length=552

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 14/110 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F+LP+PLP WP GG F  G I +G + V  I+  + IW           AT +EP  IPD
Sbjct  25   FQLPAPLPEWPQGGDFAKGTICIGEVDVTSITKFRSIWTC-------SNATFYEPEGIPD  77

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD-------NNGEILKPPTDYTLVWSS  1
            GF  LG YAQ N++PL G++LV ++       +    L+ P+DY+LVW+S
Sbjct  78   GFXCLGHYAQQNDRPLQGFLLVAREVASHQVIDTKPALEKPSDYSLVWTS  127



>ref|XP_010485809.1| PREDICTED: uncharacterized protein LOC104764063 [Camelina sativa]
Length=567

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = -1

Query  303  LPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPDGF  124
            LPSPLP WP G GF +G I+LG + V +I+ L ++W S      +  AT +    IP+GF
Sbjct  28   LPSPLPCWPQGNGFATGIINLGEIDVVKITKLHRVWSSDSSHGKSKRATFYRAEEIPEGF  87

Query  123  CMLGSYAQPNNQPLSGWVLVGKD------NNGEILKPPTDYTLVWSS  1
              LG Y QP ++PL G+VL  +       +N   LK P  Y+LVWS+
Sbjct  88   HCLGHYCQPTDKPLRGYVLAARASETISVDNLPPLKKPVSYSLVWSA  134



>ref|NP_566224.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF26779.1|AC016829_3 unknown protein [Arabidopsis thaliana]
 gb|AAK96617.1| AT3g04350/T6K12_3 [Arabidopsis thaliana]
 gb|AAM47376.1| AT3g04350/T6K12_3 [Arabidopsis thaliana]
 gb|AEE74069.1| uncharacterized protein AT3G04350 [Arabidopsis thaliana]
Length=567

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 62/109 (57%), Gaps = 6/109 (6%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP+PLP+WP G GF +G I LG ++V +I+   ++W S      +  AT +    IP+
Sbjct  26   FSLPAPLPSWPQGKGFATGRISLGEIEVVKITKFHRVWSSDSSHDKSKRATFYRADDIPE  85

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGEI------LKPPTDYTLVWSS  1
            GF  LG Y QP +QPL G+VL  + +          LK P  Y+LVWS+
Sbjct  86   GFHCLGHYCQPTDQPLRGYVLAARTSKAVNADDFPPLKKPVSYSLVWSA  134



>ref|XP_004495588.1| PREDICTED: uncharacterized protein LOC101489287 [Cicer arietinum]
Length=563

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 62/113 (55%), Gaps = 11/113 (10%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP PLP WP G GF  G + LG ++V +++  + +WRS      ++G T + P  IPD
Sbjct  23   FSLPQPLPQWPQGSGFAGGRMSLGRIEVAKVNKFEIVWRSTNLNGKSLGFTFYRPLEIPD  82

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE-----------ILKPPTDYTLVWS  4
            GF  LG Y Q N QPL G VLV ++   +            LK P +Y+L+WS
Sbjct  83   GFSCLGYYCQSNEQPLRGHVLVARETFSKPQADCSASESPALKKPLNYSLMWS  135



>ref|XP_010457440.1| PREDICTED: uncharacterized protein LOC104738921 [Camelina sativa]
Length=572

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 67/119 (56%), Gaps = 7/119 (6%)
 Frame = -1

Query  339  NIPTLPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGA  160
            ++P L    TF LPSP+P WP G GFGSG I+LG LQV +I++ + IWR Y     N   
Sbjct  14   DLPPLKDPVTFSLPSPIPQWPPGKGFGSGTINLGKLQVIKITDFEFIWR-YRSTEKNKSI  72

Query  159  TIFEPSS-IPDGFCMLGSYAQPNNQPLSGWVLVGKD-----NNGEILKPPTDYTLVWSS  1
            + ++P   +P  F  L  Y Q ++ PL G+VL  +D          L  P D+TLVWSS
Sbjct  73   SFYKPKGLLPTNFHCLSHYCQSDSHPLRGYVLAARDLLEQEEQKPALVEPVDFTLVWSS  131



>ref|XP_003558835.1| PREDICTED: uncharacterized protein LOC100834654 [Brachypodium 
distachyon]
Length=550

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 63/110 (57%), Gaps = 14/110 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F+LP+PLP WP GG F  G I +G L+V  I+  + IW          GAT +EP  +P 
Sbjct  26   FQLPAPLPAWPQGGDFAKGTICIGELEVVNITKFQNIWSC-------SGATFYEPKEVPG  78

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD-------NNGEILKPPTDYTLVWSS  1
            GF  LG YAQ N++PL G +LV ++       N    L+ P DYTLVW++
Sbjct  79   GFHCLGHYAQQNDRPLQGSLLVAREVASYQLMNREPALEKPLDYTLVWTN  128



>ref|XP_008388738.1| PREDICTED: uncharacterized protein LOC103451082 [Malus domestica]
Length=570

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 63/118 (53%), Gaps = 15/118 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I LG ++V Q++  + IW        + G T + P+ IPD
Sbjct  29   FSLPSPLPHWPQGEGFAAGRIRLGEIEVIQVTKFESIWSCSLLRGKSRGVTFYRPAGIPD  88

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGEI---------------LKPPTDYTLVWSS  1
             F  LG Y Q N+QPL G+VLV ++    +               LK P  Y+LVW++
Sbjct  89   DFFCLGYYCQRNDQPLRGYVLVARETVARMVDDGCTRGSALELPALKRPVSYSLVWNA  146



>ref|XP_004985743.1| PREDICTED: uncharacterized protein LOC101775810 [Setaria italica]
Length=551

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 63/110 (57%), Gaps = 14/110 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP+ LP WP GG F  G I +GGL V  I+  + IW          GA+ +EP  +PD
Sbjct  25   FHLPATLPKWPQGGDFAKGTICIGGLDVVNITKFRSIWSC-------SGASFYEPEGVPD  77

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGEI-------LKPPTDYTLVWSS  1
            GF  LG YAQ N++PL G++LV ++    +       L+ P DY+LVW++
Sbjct  78   GFHCLGHYAQQNDRPLQGFLLVAREAASHLLISSKPALEKPLDYSLVWTN  127



>ref|XP_008459966.1| PREDICTED: uncharacterized protein LOC103498924 [Cucumis melo]
 ref|XP_008459967.1| PREDICTED: uncharacterized protein LOC103498924 [Cucumis melo]
Length=571

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 65/124 (52%), Gaps = 16/124 (13%)
 Frame = -1

Query  327  LPIDT--TFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATI  154
            LP D    F LPSP P WP GGGF SG   LG ++V +I+    IW        N G T 
Sbjct  17   LPSDEPDHFSLPSPTPEWPQGGGFASGIASLGEIEVLKITQFVSIWGCNLSRRGNNGFTF  76

Query  153  FEPSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEI--------------LKPPTDYT  16
            + P  IP+GF  LG Y QPN++PL G++LV ++ +G                L  P D+T
Sbjct  77   YRPLRIPEGFHCLGHYCQPNDRPLHGYLLVAREVDGYFQESDHISNIVKLPALVEPIDFT  136

Query  15   LVWS  4
            L+WS
Sbjct  137  LIWS  140



>ref|XP_010036155.1| PREDICTED: uncharacterized protein LOC104425227 [Eucalyptus grandis]
 gb|KCW47689.1| hypothetical protein EUGRSUZ_K01427 [Eucalyptus grandis]
Length=566

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 63/116 (54%), Gaps = 13/116 (11%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP+P+P WP G  F SG I+LG ++VC++   + IW          G + + P +IPD
Sbjct  25   FSLPAPIPEWPPGHEFASGSINLGEIEVCKVKRFEFIWGWDWSSDERKGVSFYRPVAIPD  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKD-------------NNGEILKPPTDYTLVWSS  1
            GF  LG Y Q N++PL G+VLV ++                  LK P DYTL+WSS
Sbjct  85   GFFSLGHYCQSNDRPLRGFVLVAREVISSGIKPPECTSGKSPALKEPVDYTLIWSS  140



>ref|XP_010262454.1| PREDICTED: uncharacterized protein LOC104600975 [Nelumbo nucifera]
Length=569

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 67/124 (54%), Gaps = 15/124 (12%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LP    F LP+P+  WP G GFG+G I LG ++V +I+  + IW          G   ++
Sbjct  17   LPEPELFSLPAPIREWPEGQGFGTGRICLGEIEVIKITKFESIWSCNFLNDKRNGIIFYK  76

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKD---NNGEI------------LKPPTDYTL  13
            P+ IPD F  LG Y QPN+QPL G+VLV +D   +  E+            L+ P DY L
Sbjct  77   PTGIPDDFYSLGHYCQPNDQPLRGFVLVARDVATHETEVGHLCNMFEEFPALRKPLDYIL  136

Query  12   VWSS  1
            VWS+
Sbjct  137  VWST  140



>ref|XP_002263468.1| PREDICTED: uncharacterized protein LOC100263054 [Vitis vinifera]
 emb|CAN61465.1| hypothetical protein VITISV_005001 [Vitis vinifera]
Length=568

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 64/119 (54%), Gaps = 16/119 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LP+P+P WP G GF +G I+LG + V +I+  ++IW   +      G T ++P  IPD
Sbjct  23   FSLPAPIPEWPRGQGFATGQINLGEIVVLKITQFERIWSCNQLHGKTTGVTFYKPVGIPD  82

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGEILK----------------PPTDYTLVWSS  1
            GF  LG Y QPN+Q L G+VLV +D     LK                 P  YTL+W++
Sbjct  83   GFFSLGHYCQPNDQALRGYVLVAQDAAASRLKVGSVHDSPLGDSPALIRPLSYTLMWNT  141



>ref|XP_011014100.1| PREDICTED: uncharacterized protein LOC105117968 isoform X2 [Populus 
euphratica]
Length=568

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 65/116 (56%), Gaps = 8/116 (7%)
 Frame = -1

Query  324  PIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEP  145
            P   TF LPSPLP W  G GF SG I+LG ++  +IS  + IW S        G + ++P
Sbjct  25   PEPDTFSLPSPLPDWSQGRGFASGRINLGKIEALKISRFEFIWSSNLLQDKKKGVSFYKP  84

Query  144  SSIPDGFCMLGSYAQPNNQPLSGWVLVGKD--------NNGEILKPPTDYTLVWSS  1
              +P+GF  LG Y Q NN+PL G+VLV ++         N   L  P DYTLVWSS
Sbjct  85   VGVPNGFYSLGHYCQFNNKPLWGFVLVVREVACFEPEAANSPTLLKPVDYTLVWSS  140



>ref|XP_009343782.1| PREDICTED: vacuolar protein sorting-associated protein 62-like 
[Pyrus x bretschneideri]
Length=564

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 62/115 (54%), Gaps = 15/115 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I LG ++V QI+  + IW        + G T + P+ IPD
Sbjct  25   FSLPSPLPHWPQGKGFATGRIRLGEIEVTQITKFESIWSCNLLRGKSRGVTFYRPAGIPD  84

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE---------------ILKPPTDYTLV  10
            GF  LG Y QPN+QPL G+VLV ++                    L+ P +Y+LV
Sbjct  85   GFFCLGYYCQPNDQPLQGYVLVARETVARRAEDGCTQDSALELPALEKPVNYSLV  139



>ref|XP_009379740.1| PREDICTED: uncharacterized protein LOC103968124 [Pyrus x bretschneideri]
Length=568

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 65/118 (55%), Gaps = 15/118 (13%)
 Frame = -1

Query  309  FKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFEPSSIPD  130
            F LPSPLP WP G GF +G I LG ++V Q++  + IW        ++G T + P+ IPD
Sbjct  27   FSLPSPLPHWPQGEGFATGRIRLGEIEVIQVTKFESIWSCSLLRGKSMGVTFYRPAGIPD  86

Query  129  GFCMLGSYAQPNNQPLSGWVLVGKDNNGE---------------ILKPPTDYTLVWSS  1
             F  LG Y Q N+QPL G+VLV ++   +                LK P +Y+LVW++
Sbjct  87   DFFCLGYYCQRNDQPLRGYVLVVRETVAKRVEDGCTRGSALEFPALKKPVNYSLVWNA  144



>ref|XP_002319114.1| hypothetical protein POPTR_0013s04580g [Populus trichocarpa]
 gb|EEE95037.1| hypothetical protein POPTR_0013s04580g [Populus trichocarpa]
Length=573

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 67/123 (54%), Gaps = 14/123 (11%)
 Frame = -1

Query  327  LPIDTTFKLPSPLPTWPSGGGFGSGYIDLGGLQVCQISNLKKIWRSYEGGPNNVGATIFE  148
            LP    F LP+PLP WP G GF +G I+LG ++V +I+  + +W        + G + + 
Sbjct  23   LPDPQPFSLPAPLPIWPQGQGFAAGRINLGEIEVAKITKFESVWSCGLLRGKSKGVSFYR  82

Query  147  PSSIPDGFCMLGSYAQPNNQPLSGWVLVGKDNNGEI--------------LKPPTDYTLV  10
            P  IP+GF  LG Y Q N+QPL G+VLVG D+N                 L+ P +Y+L+
Sbjct  83   PVGIPEGFHCLGYYCQSNDQPLRGYVLVGCDSNAHKPEVGHIHDSEVDSPLRKPLNYSLI  142

Query  9    WSS  1
            W S
Sbjct  143  WGS  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506240637208