BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9545_g1_i1 len=315 path=[293:0-314]

Length=315
                                                                      Score     E

ref|XP_002523562.1|  hypothetical protein RCOM_1407360                  110   4e-26   Ricinus communis
ref|XP_009778965.1|  PREDICTED: B3 domain-containing protein Os01...    106   7e-25   
ref|XP_009778964.1|  PREDICTED: B3 domain-containing protein Os01...    106   1e-24   
ref|XP_009778963.1|  PREDICTED: B3 domain-containing protein Os01...    107   1e-24   
ref|XP_009612762.1|  PREDICTED: B3 domain-containing protein Os01...    105   2e-24   
ref|XP_009612763.1|  PREDICTED: B3 domain-containing protein Os01...    104   3e-24   
ref|XP_004166609.1|  PREDICTED: B3 domain-containing protein Os01...    102   4e-24   
ref|XP_008456113.1|  PREDICTED: B3 domain-containing protein Os01...    104   5e-24   
ref|XP_007042395.1|  AP2/B3-like transcriptional factor family pr...    103   6e-24   
ref|XP_008456112.1|  PREDICTED: B3 domain-containing protein Os01...    104   7e-24   
ref|XP_009778966.1|  PREDICTED: B3 domain-containing protein Os01...    103   1e-23   
emb|CBI32429.3|  unnamed protein product                                102   2e-23   
ref|XP_004140801.1|  PREDICTED: B3 domain-containing protein Os01...  99.8    3e-23   
emb|CDO97163.1|  unnamed protein product                                103   3e-23   
ref|XP_002282068.2|  PREDICTED: B3 domain-containing protein Os01...    102   4e-23   Vitis vinifera
ref|XP_007202224.1|  hypothetical protein PRUPE_ppa008558mg           99.8    1e-22   
ref|XP_008241504.1|  PREDICTED: B3 domain-containing protein Os01...    100   1e-22   
gb|KGN57545.1|  hypothetical protein Csa_3G207940                       100   2e-22   
ref|XP_007047229.1|  AP2/B3-like transcriptional factor family pr...  97.8    6e-22   
emb|CAN67499.1|  hypothetical protein VITISV_019679                     100   9e-22   Vitis vinifera
ref|XP_008373165.1|  PREDICTED: B3 domain-containing protein Os01...  97.8    9e-22   
ref|XP_002307261.1|  hypothetical protein POPTR_0005s18090g           97.8    1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_008236548.1|  PREDICTED: B3 domain-containing protein Os01...  97.4    1e-21   
ref|XP_007047230.1|  AP2/B3-like transcriptional factor family pr...  98.2    1e-21   
ref|XP_007047227.1|  AP2/B3-like transcriptional factor family pr...  98.2    1e-21   
ref|XP_007047228.1|  AP2/B3-like transcriptional factor family pr...  98.2    1e-21   
ref|XP_010058476.1|  PREDICTED: B3 domain-containing protein Os01...  95.5    4e-21   
gb|KDP31917.1|  hypothetical protein JCGZ_12378                       96.3    6e-21   
gb|KCW73036.1|  hypothetical protein EUGRSUZ_E01478                   94.4    7e-21   
ref|XP_002313111.1|  hypothetical protein POPTR_0009s10610g           95.5    8e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010107958.1|  B3 domain-containing protein                     97.4    8e-21   
ref|XP_009344645.1|  PREDICTED: B3 domain-containing protein Os01...  93.2    1e-20   
ref|XP_007199172.1|  hypothetical protein PRUPE_ppa021390mg           94.0    1e-20   
ref|XP_010068473.1|  PREDICTED: B3 domain-containing protein Os01...  95.5    1e-20   
ref|XP_009344646.1|  PREDICTED: B3 domain-containing protein Os01...  94.4    2e-20   
gb|KCW63795.1|  hypothetical protein EUGRSUZ_G01458                   94.7    2e-20   
ref|XP_003516780.1|  PREDICTED: B3 domain-containing protein Os01...  93.2    2e-20   
ref|XP_004240808.1|  PREDICTED: B3 domain-containing protein Os01...  94.0    2e-20   
ref|XP_007200257.1|  hypothetical protein PRUPE_ppa015021mg           92.8    3e-20   
ref|XP_006573914.1|  PREDICTED: B3 domain-containing protein Os01...  92.4    4e-20   
gb|EYU42669.1|  hypothetical protein MIMGU_mgv1a006218mg              92.4    4e-20   
gb|KHN30413.1|  B3 domain-containing protein                          93.2    4e-20   
ref|XP_009344651.1|  PREDICTED: B3 domain-containing protein Os01...  94.7    5e-20   
gb|EYU42668.1|  hypothetical protein MIMGU_mgv1a006218mg              92.4    6e-20   
gb|KDO42473.1|  hypothetical protein CISIN_1g036935mg                 92.4    7e-20   
ref|XP_006423042.1|  hypothetical protein CICLE_v10030084mg           91.7    7e-20   
ref|XP_008457832.1|  PREDICTED: B3 domain-containing protein Os01...  92.4    9e-20   
gb|EYU42667.1|  hypothetical protein MIMGU_mgv1a006218mg              92.4    1e-19   
ref|XP_008349878.1|  PREDICTED: uncharacterized protein LOC103413166  93.6    2e-19   
ref|XP_009803081.1|  PREDICTED: B3 domain-containing protein Os01...  92.4    2e-19   
gb|KHG01596.1|  hypothetical protein F383_20813                       92.8    2e-19   
ref|XP_008457831.1|  PREDICTED: B3 domain-containing protein Os01...  92.0    2e-19   
ref|XP_008236526.1|  PREDICTED: B3 domain-containing protein Os01...  90.9    2e-19   
ref|XP_006380708.1|  hypothetical protein POPTR_0007s11170g           89.4    4e-19   
ref|XP_008373163.1|  PREDICTED: B3 domain-containing protein Os01...  89.7    4e-19   
ref|XP_011000328.1|  PREDICTED: B3 domain-containing protein Os01...  90.9    5e-19   
ref|XP_011000320.1|  PREDICTED: B3 domain-containing protein Os01...  90.9    5e-19   
ref|XP_002324684.1|  hypothetical protein POPTR_0018s13750g           90.1    5e-19   Populus trichocarpa [western balsam poplar]
gb|KDO42478.1|  hypothetical protein CISIN_1g011928mg                 89.4    5e-19   
ref|XP_011000335.1|  PREDICTED: B3 domain-containing protein Os01...  90.5    5e-19   
ref|XP_006380709.1|  hypothetical protein POPTR_0007s11170g           90.9    5e-19   
ref|XP_010269238.1|  PREDICTED: B3 domain-containing protein Os01...  90.1    7e-19   
ref|XP_010070338.1|  PREDICTED: B3 domain-containing protein Os01...  90.5    7e-19   
ref|XP_011010191.1|  PREDICTED: B3 domain-containing protein Os01...  90.5    8e-19   
ref|XP_002310730.2|  hypothetical protein POPTR_0007s11170g           90.5    8e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010269230.1|  PREDICTED: B3 domain-containing protein Os01...  90.1    9e-19   
ref|XP_011010190.1|  PREDICTED: B3 domain-containing protein Os01...  90.1    9e-19   
ref|XP_008236547.1|  PREDICTED: B3 domain-containing protein Os01...  87.8    1e-18   
gb|KDO42477.1|  hypothetical protein CISIN_1g011928mg                 89.4    1e-18   
ref|XP_011092583.1|  PREDICTED: B3 domain-containing protein Os01...  89.0    1e-18   
ref|XP_010070516.1|  PREDICTED: B3 domain-containing protein Os01...  90.1    1e-18   
ref|XP_009594239.1|  PREDICTED: B3 domain-containing protein Os01...  90.1    1e-18   
gb|KDO42474.1|  hypothetical protein CISIN_1g011928mg                 89.4    1e-18   
ref|XP_006487086.1|  PREDICTED: B3 domain-containing protein Os01...  89.4    1e-18   
ref|XP_006423043.1|  hypothetical protein CICLE_v10028399mg           89.4    1e-18   
ref|XP_007201917.1|  hypothetical protein PRUPE_ppa026741m1g          87.0    1e-18   
gb|KDO42475.1|  hypothetical protein CISIN_1g011928mg                 89.4    1e-18   
ref|XP_006487085.1|  PREDICTED: B3 domain-containing protein Os01...  89.4    1e-18   
ref|XP_006423044.1|  hypothetical protein CICLE_v10028399mg           89.4    1e-18   
gb|KDO42476.1|  hypothetical protein CISIN_1g011928mg                 89.4    2e-18   
ref|XP_011017695.1|  PREDICTED: B3 domain-containing protein Os01...  89.0    2e-18   
gb|KCW55292.1|  hypothetical protein EUGRSUZ_I01218                   87.8    2e-18   
ref|XP_011092580.1|  PREDICTED: B3 domain-containing protein Os01...  89.0    2e-18   
ref|XP_002518782.1|  conserved hypothetical protein                   89.0    3e-18   Ricinus communis
ref|XP_004148056.1|  PREDICTED: B3 domain-containing protein Os01...  89.0    3e-18   
ref|XP_008339962.1|  PREDICTED: B3 domain-containing protein Os01...  89.0    3e-18   
ref|XP_007155931.1|  hypothetical protein PHAVU_003G244400g           88.6    3e-18   
ref|XP_010028536.1|  PREDICTED: B3 domain-containing protein Os01...  87.8    4e-18   
gb|EYU42671.1|  hypothetical protein MIMGU_mgv1a007604mg              87.4    5e-18   
ref|XP_004289224.1|  PREDICTED: B3 domain-containing protein Os01...  88.2    6e-18   
ref|XP_010094372.1|  B3 domain-containing protein                     87.4    9e-18   
ref|XP_009366999.1|  PREDICTED: B3 domain-containing protein Os01...  87.0    1e-17   
gb|KDP42311.1|  hypothetical protein JCGZ_01635                       86.7    2e-17   
ref|XP_006339907.1|  PREDICTED: B3 domain-containing protein Os01...  86.3    3e-17   
ref|XP_009375697.1|  PREDICTED: B3 domain-containing protein Os01...  85.5    5e-17   
gb|EYU39334.1|  hypothetical protein MIMGU_mgv1a005357mg              85.5    5e-17   
gb|EYU26113.1|  hypothetical protein MIMGU_mgv1a025604mg              83.6    5e-17   
gb|KDO79252.1|  hypothetical protein CISIN_1g010160mg                 84.3    7e-17   
gb|KDO79250.1|  hypothetical protein CISIN_1g010160mg                 84.3    9e-17   
ref|XP_006425869.1|  hypothetical protein CICLE_v10025376mg           84.3    9e-17   
ref|XP_004232039.1|  PREDICTED: B3 domain-containing protein Os01...  84.7    9e-17   
emb|CAN61149.1|  hypothetical protein VITISV_029172                   84.7    1e-16   Vitis vinifera
gb|KDO79249.1|  hypothetical protein CISIN_1g010160mg                 84.3    1e-16   
ref|XP_006425870.1|  hypothetical protein CICLE_v10025376mg           84.3    1e-16   
emb|CBI21437.3|  unnamed protein product                              84.3    1e-16   
ref|XP_011005880.1|  PREDICTED: B3 domain-containing protein Os01...  83.2    1e-16   
ref|XP_011005878.1|  PREDICTED: B3 domain-containing protein Os01...  83.6    2e-16   
ref|XP_011005877.1|  PREDICTED: B3 domain-containing protein Os01...  83.2    3e-16   
ref|XP_011005879.1|  PREDICTED: B3 domain-containing protein Os01...  83.2    3e-16   
ref|XP_004509148.1|  PREDICTED: B3 domain-containing protein Os01...  83.2    3e-16   
ref|XP_008361398.1|  PREDICTED: B3 domain-containing protein Os01...  83.2    3e-16   
gb|EYU42672.1|  hypothetical protein MIMGU_mgv1a024973mg              82.4    3e-16   
ref|XP_004509147.1|  PREDICTED: B3 domain-containing protein Os01...  83.2    3e-16   
emb|CDP02488.1|  unnamed protein product                              83.2    4e-16   
gb|EYU42670.1|  hypothetical protein MIMGU_mgv1a009633mg              80.9    5e-16   
ref|XP_004294825.1|  PREDICTED: B3 domain-containing protein Os01...  80.1    6e-16   
ref|XP_006384419.1|  hypothetical protein POPTR_0004s14900g           82.0    7e-16   
gb|EYU37691.1|  hypothetical protein MIMGU_mgv1a020275mg              80.5    7e-16   
ref|XP_011000257.1|  PREDICTED: B3 domain-containing protein Os01...  82.0    8e-16   
ref|XP_011006478.1|  PREDICTED: B3 domain-containing protein Os01...  82.0    8e-16   
ref|XP_011000251.1|  PREDICTED: B3 domain-containing protein Os01...  82.0    8e-16   
ref|XP_011006479.1|  PREDICTED: B3 domain-containing protein Os01...  82.0    8e-16   
gb|EYU44388.1|  hypothetical protein MIMGU_mgv1a005456mg              82.0    8e-16   
ref|XP_010688082.1|  PREDICTED: B3 domain-containing protein Os01...  81.3    1e-15   
ref|XP_010688083.1|  PREDICTED: B3 domain-containing protein Os01...  81.3    2e-15   
ref|XP_010688081.1|  PREDICTED: B3 domain-containing protein Os01...  81.3    2e-15   
gb|EPS62319.1|  hypothetical protein M569_12471                       80.5    2e-15   
emb|CDP16162.1|  unnamed protein product                              79.7    4e-15   
ref|XP_008236549.1|  PREDICTED: B3 domain-containing protein Os01...  79.7    5e-15   
gb|EYU26120.1|  hypothetical protein MIMGU_mgv1a0207362mg             77.0    6e-15   
gb|EYU26123.1|  hypothetical protein MIMGU_mgv1a0231452mg             77.0    9e-15   
ref|XP_007199321.1|  hypothetical protein PRUPE_ppa023470mg           77.0    1e-14   
ref|XP_007042393.1|  AP2/B3-like transcriptional factor family pr...  77.8    1e-14   
ref|XP_004293243.1|  PREDICTED: B3 domain-containing protein Os01...  77.4    4e-14   
ref|XP_011099150.1|  PREDICTED: B3 domain-containing protein Os01...  77.4    4e-14   
ref|XP_003638142.1|  B3 domain-containing protein                     77.0    4e-14   
ref|XP_002313110.1|  hypothetical protein POPTR_0009s10620g           77.0    5e-14   Populus trichocarpa [western balsam poplar]
gb|KHN26467.1|  B3 domain-containing protein                          76.3    8e-14   
ref|XP_003551033.1|  PREDICTED: B3 domain-containing protein Os01...  76.3    8e-14   
ref|XP_010666632.1|  PREDICTED: B3 domain-containing protein Os01...  72.8    2e-13   
ref|XP_002310788.1|  hypothetical protein POPTR_0007s12380g           71.6    3e-13   Populus trichocarpa [western balsam poplar]
emb|CDM82532.1|  unnamed protein product                              72.0    2e-12   
emb|CDM82531.1|  unnamed protein product                              72.0    2e-12   
ref|XP_010999982.1|  PREDICTED: B3 domain-containing protein Os01...  68.2    8e-12   
ref|XP_004971466.1|  PREDICTED: B3 domain-containing protein Os01...  69.7    2e-11   
ref|XP_010666631.1|  PREDICTED: B3 domain-containing protein Os01...  67.8    6e-11   
ref|XP_006643962.1|  PREDICTED: LOW QUALITY PROTEIN: B3 domain-co...  68.2    6e-11   
ref|XP_010666629.1|  PREDICTED: B3 domain-containing protein Os01...  67.8    7e-11   
gb|EMT26046.1|  B3 domain-containing protein                          68.2    8e-11   
ref|XP_008385749.1|  PREDICTED: B3 domain-containing protein Os01...  67.0    1e-10   
ref|XP_008385747.1|  PREDICTED: B3 domain-containing protein Os01...  67.0    1e-10   
ref|XP_009339453.1|  PREDICTED: B3 domain-containing protein Os01...  65.9    3e-10   
ref|XP_009339452.1|  PREDICTED: B3 domain-containing protein Os01...  65.9    3e-10   
ref|XP_008359237.1|  PREDICTED: B3 domain-containing protein Os01...  65.5    4e-10   
ref|XP_002459887.1|  hypothetical protein SORBIDRAFT_02g013060        65.1    6e-10   Sorghum bicolor [broomcorn]
ref|XP_009349898.1|  PREDICTED: B3 domain-containing protein Os01...  65.1    8e-10   
ref|XP_009349897.1|  PREDICTED: B3 domain-containing protein Os01...  65.1    8e-10   
ref|XP_010666642.1|  PREDICTED: B3 domain-containing protein Os01...  63.5    1e-09   
gb|EEC70251.1|  hypothetical protein OsI_01044                        64.3    1e-09   Oryza sativa Indica Group [Indian rice]
gb|EMT14114.1|  B3 domain-containing protein                          63.9    2e-09   
dbj|BAD81380.1|  unknown protein                                      63.5    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042515.1|  Os01g0234100                                     63.5    3e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEE54186.1|  hypothetical protein OsJ_01011                        63.5    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010240699.1|  PREDICTED: B3 domain-containing protein Os01...  63.2    3e-09   
gb|EYU37692.1|  hypothetical protein MIMGU_mgv1a008064mg              62.4    5e-09   
ref|XP_010233026.1|  PREDICTED: B3 domain-containing protein Os01...  62.4    6e-09   
gb|EMT06248.1|  B3 domain-containing protein                          58.5    1e-07   
ref|XP_006383239.1|  hypothetical protein POPTR_0005s12780g           55.5    2e-07   
gb|EYU24349.1|  hypothetical protein MIMGU_mgv1a025934mg              48.9    1e-04   
gb|EPS67917.1|  hypothetical protein M569_06854                       47.8    4e-04   



>ref|XP_002523562.1| hypothetical protein RCOM_1407360 [Ricinus communis]
 gb|EEF38757.1| hypothetical protein RCOM_1407360 [Ricinus communis]
Length=529

 Score =   110 bits (276),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHESL+ G+N+KLIAG I+ETVNIADAIRA+ LTT  +  + WD TL   EQ
Sbjct  382  LCCSQNAFLHESLIKGINFKLIAGIISETVNIADAIRASNLTTSSDEFDTWDKTLNASEQ  441

Query  182  FGIQVGFLRDRISKLVRLSGD  244
            FG++VGFLR R+S+LV L+ D
Sbjct  442  FGMKVGFLRARLSQLVSLAFD  462



>ref|XP_009778965.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X3 [Nicotiana sylvestris]
Length=459

 Score =   106 bits (265),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++K++LH+ LL GLN KL AG ITETVNIADAIRA+ ++T  + LE WD TL+G E 
Sbjct  317  LCCTQKSFLHDHLLSGLNCKLAAGMITETVNIADAIRASNISTSRDYLEAWDNTLKGFEC  376

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G++VGFLR R++KLV LS +
Sbjct  377  LGMEVGFLRARLNKLVSLSSE  397



>ref|XP_009778964.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Nicotiana sylvestris]
Length=498

 Score =   106 bits (265),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++K++LH+ LL GLN KL AG ITETVNIADAIRA+ ++T  + LE WD TL+G E 
Sbjct  356  LCCTQKSFLHDHLLSGLNCKLAAGMITETVNIADAIRASNISTSRDYLEAWDNTLKGFEC  415

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G++VGFLR R++KLV LS +
Sbjct  416  LGMEVGFLRARLNKLVSLSSE  436



>ref|XP_009778963.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Nicotiana sylvestris]
Length=530

 Score =   107 bits (266),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++K++LH+ LL GLN KL AG ITETVNIADAIRA+ ++T  + LE WD TL+G E 
Sbjct  388  LCCTQKSFLHDHLLSGLNCKLAAGMITETVNIADAIRASNISTSRDYLEAWDNTLKGFEC  447

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G++VGFLR R++KLV LS +
Sbjct  448  LGMEVGFLRARLNKLVSLSSE  468



>ref|XP_009612762.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++K++LH+ LL GLN KL AG ITETVNIADAIRA+ ++T  + LE W++TL+G E 
Sbjct  350  LCCTQKSFLHDHLLGGLNCKLAAGMITETVNIADAIRASNISTSRDYLETWNSTLKGFEC  409

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G++VGFLR R++KLV LS +
Sbjct  410  LGMEVGFLRARLNKLVSLSSE  430



>ref|XP_009612763.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Nicotiana 
tomentosiformis]
Length=443

 Score =   104 bits (259),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++K++LHE LL GLN KL AG ITETVNIADAIRA++++   + LE WD TL+G E 
Sbjct  301  LCCTQKSFLHEHLLGGLNCKLAAGMITETVNIADAIRASKISIPRDFLETWDNTLKGFEC  360

Query  182  FGIQVGFLRDRISKLVRLS  238
             G++VGFLR R+ KL+ +S
Sbjct  361  LGMEVGFLRARLGKLINMS  379



>ref|XP_004166609.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Cucumis 
sativus]
Length=229

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K++LH+ +L+GLNYKL++G I+ET+NIADAI+A+++TT  E L  WD TL   E 
Sbjct  84   LCCSQKSFLHDHILEGLNYKLVSGIISETINIADAIKASKVTTSQEHLVTWDKTLTAFEG  143

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR RI++L+ LS
Sbjct  144  LGMNVGFLRVRINQLLTLS  162



>ref|XP_008456113.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Cucumis melo]
Length=465

 Score =   104 bits (259),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K++LH+ +L+GLNYKL++G I+ETVNIADAIRA+++TT  E L  WD TL   E 
Sbjct  320  LCCSQKSFLHDHILEGLNYKLVSGIISETVNIADAIRASKVTTSQEHLVTWDKTLTAFEG  379

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR RI++L+ LS
Sbjct  380  LGMNVGFLRVRINQLLTLS  398



>ref|XP_007042395.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma 
cacao]
 gb|EOX98226.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma 
cacao]
Length=465

 Score =   103 bits (258),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K++LH+ LL+GLNYKL+AG I ETVNIADAIRAA+LTT       WD TL+  E 
Sbjct  323  LCCSQKSFLHDHLLEGLNYKLVAGVIAETVNIADAIRAAKLTTSHHNFLTWDQTLKSFEG  382

Query  182  FGIQVGFLRDRISKLVRLS  238
             G++VG LR R+ +L+ LS
Sbjct  383  LGMKVGMLRSRLDRLMNLS  401



>ref|XP_008456112.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Cucumis melo]
Length=493

 Score =   104 bits (259),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K++LH+ +L+GLNYKL++G I+ETVNIADAIRA+++TT  E L  WD TL   E 
Sbjct  348  LCCSQKSFLHDHILEGLNYKLVSGIISETVNIADAIRASKVTTSQEHLVTWDKTLTAFEG  407

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR RI++L+ LS
Sbjct  408  LGMNVGFLRVRINQLLTLS  426



>ref|XP_009778966.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Nicotiana 
sylvestris]
Length=448

 Score =   103 bits (256),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++K++LH+ LL GLN KL AG ITETVNIADAIRA++++   + L+ WD TL+G E 
Sbjct  306  LCCTQKSFLHDHLLGGLNCKLAAGMITETVNIADAIRASKISIPRDYLDTWDNTLKGFEC  365

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G++VGFLR R+SKL+ +S D
Sbjct  366  LGMKVGFLRARLSKLISMSCD  386



>emb|CBI32429.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K YLH+ LLDGLNYKL AG I+ETVNIADAIRA++LTT  +   +W  TL+  ++
Sbjct  221  LCCSQKTYLHDHLLDGLNYKLAAGIISETVNIADAIRASKLTTSRDNFSIWSKTLKAFQE  280

Query  182  FGIQVGFLRDRISKLV  229
             G+ VGFLR R+ +L+
Sbjct  281  LGMNVGFLRARLDQLM  296



>ref|XP_004140801.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Cucumis 
sativus]
Length=229

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K++LH+ +L+GLNYKL++G I+ET+NIADAI+A+++T   E L  WD TL   E 
Sbjct  84   LCCSQKSFLHDHILEGLNYKLVSGIISETINIADAIKASKVTISQEHLVTWDKTLTAFEG  143

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR RI++L+ LS
Sbjct  144  LGMNVGFLRVRINQLLTLS  162



>emb|CDO97163.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   103 bits (258),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ L+ GLN KL AG I+ETVNIADAIRAA+LTT CE L+ WD TL+  E 
Sbjct  600  LCCSQNSFLHDHLIKGLNCKLAAGIISETVNIADAIRAAKLTTSCEYLQTWDKTLKAFED  659

Query  182  FGIQVGFLRDRISKLVRL  235
             G+ V FLR RI  L+ L
Sbjct  660  MGMAVEFLRARIKALISL  677



>ref|XP_002282068.2| PREDICTED: B3 domain-containing protein Os01g0234100-like [Vitis 
vinifera]
Length=463

 Score =   102 bits (253),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K YLH+ LLDGLNYKL AG I+ETVNIADAIRA++LTT  +   +W  TL+  ++
Sbjct  321  LCCSQKTYLHDHLLDGLNYKLAAGIISETVNIADAIRASKLTTSRDNFSIWSKTLKAFQE  380

Query  182  FGIQVGFLRDRISKLV  229
             G+ VGFLR R+ +L+
Sbjct  381  LGMNVGFLRARLDQLM  396



>ref|XP_007202224.1| hypothetical protein PRUPE_ppa008558mg [Prunus persica]
 gb|EMJ03423.1| hypothetical protein PRUPE_ppa008558mg [Prunus persica]
Length=327

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE+ ++G+N+KL+ GAI+ETVNIADAIRA +LTT  +    WD  L+  E 
Sbjct  180  LCCSQNAFLHENFVEGMNHKLVVGAISETVNIADAIRACKLTTTRDDFVSWDKYLKAFEL  239

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLRDR+ +L  LS D
Sbjct  240  LGMNVGFLRDRLCRLANLSND  260



>ref|XP_008241504.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Prunus 
mume]
Length=497

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE++++G+N+KL+ GAI+ETVNIADAI+A +LTT  +    WD  L+  E 
Sbjct  350  LCCSQNAFLHENVVEGMNHKLVVGAISETVNIADAIKACKLTTTWDDFVSWDKYLKAFEL  409

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLRDR+ +L  LS D
Sbjct  410  LGMNVGFLRDRLCRLANLSND  430



>gb|KGN57545.1| hypothetical protein Csa_3G207940 [Cucumis sativus]
Length=482

 Score =   100 bits (248),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K++LH+ +L+GLNYKL++G I+ET+NIADAI+A+++T   E L  WD TL   E 
Sbjct  337  LCCSQKSFLHDHILEGLNYKLVSGIISETINIADAIKASKVTISQEHLVTWDKTLTAFEG  396

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR RI++L+ LS
Sbjct  397  LGMNVGFLRVRINQLLTLS  415



>ref|XP_007047229.1| AP2/B3-like transcriptional factor family protein isoform 3 [Theobroma 
cacao]
 gb|EOX91386.1| AP2/B3-like transcriptional factor family protein isoform 3 [Theobroma 
cacao]
Length=382

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LHE+++ G+N+KLI G I+ETVNIADAIRA +LTT  +  + WD TL+  + 
Sbjct  235  LCCSQNSFLHENIIQGINFKLIVGTISETVNIADAIRACKLTTSQDEFDSWDKTLKAFDL  294

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ +LV L+
Sbjct  295  LGMNVGFLRTRLRRLVNLA  313



>emb|CAN67499.1| hypothetical protein VITISV_019679 [Vitis vinifera]
Length=930

 Score =   100 bits (248),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K YLH+ LLDGLNYKL AG I+ETVNIADAIRA++LTT  +   +W  TL+  ++
Sbjct  465  LCCSQKTYLHDHLLDGLNYKLAAGIISETVNIADAIRASKLTTSRDNFSIWSKTLKAFQE  524

Query  182  FGIQVGFLRDRISKLV  229
             G+ V FLR R+ +L+
Sbjct  525  LGMNVSFLRARLDQLM  540



>ref|XP_008373165.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Malus 
domestica]
Length=436

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K++LHE LL+GLN KLIAG I+ETVNIADAIRA ++TT  + L  WD TL+    
Sbjct  311  LCCSQKSFLHEQLLEGLNCKLIAGVISETVNIADAIRACKITTPEDYLSTWDKTLKAFGD  370

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ V FLR R+ +L  L+
Sbjct  371  LGMNVRFLRARLDQLTSLA  389



>ref|XP_002307261.1| hypothetical protein POPTR_0005s18090g [Populus trichocarpa]
 gb|EEE94257.1| hypothetical protein POPTR_0005s18090g [Populus trichocarpa]
Length=456

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++ A+LH++L+ G+N+KLIAG I+ETVNIADA+RA  LTT  +    WD  L+  E 
Sbjct  309  LCCNQNAFLHDNLIKGVNFKLIAGIISETVNIADAMRACTLTTSRDKFATWDKALKASEL  368

Query  182  FGIQVGFLRDRISKLVRLSGD  244
            FG+ VGFLR R+S+L+ L+ D
Sbjct  369  FGMNVGFLRARLSRLLSLAFD  389



>ref|XP_008236548.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Prunus 
mume]
Length=439

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+KA+LHE LL+GLN KLIAG I+ETVNIADAIRA ++TT       W  TL+  E 
Sbjct  309  LCCSQKAFLHEHLLEGLNCKLIAGVISETVNIADAIRACKITTTEGDFSTWSKTLKAFED  368

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+  GFLR R+ +L  L+ +
Sbjct  369  LGMNAGFLRARLDRLASLASE  389



>ref|XP_007047230.1| AP2/B3-like transcriptional factor family protein isoform 4 [Theobroma 
cacao]
 gb|EOX91387.1| AP2/B3-like transcriptional factor family protein isoform 4 [Theobroma 
cacao]
Length=488

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LHE+++ G+N+KLI G I+ETVNIADAIRA +LTT  +  + WD TL+  + 
Sbjct  341  LCCSQNSFLHENIIQGINFKLIVGTISETVNIADAIRACKLTTSQDEFDSWDKTLKAFDL  400

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ +LV L+
Sbjct  401  LGMNVGFLRTRLRRLVNLA  419



>ref|XP_007047227.1| AP2/B3-like transcriptional factor family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91384.1| AP2/B3-like transcriptional factor family protein isoform 1 [Theobroma 
cacao]
Length=491

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LHE+++ G+N+KLI G I+ETVNIADAIRA +LTT  +  + WD TL+  + 
Sbjct  344  LCCSQNSFLHENIIQGINFKLIVGTISETVNIADAIRACKLTTSQDEFDSWDKTLKAFDL  403

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ +LV L+
Sbjct  404  LGMNVGFLRTRLRRLVNLA  422



>ref|XP_007047228.1| AP2/B3-like transcriptional factor family protein isoform 2 [Theobroma 
cacao]
 gb|EOX91385.1| AP2/B3-like transcriptional factor family protein isoform 2 [Theobroma 
cacao]
Length=520

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LHE+++ G+N+KLI G I+ETVNIADAIRA +LTT  +  + WD TL+  + 
Sbjct  373  LCCSQNSFLHENIIQGINFKLIVGTISETVNIADAIRACKLTTSQDEFDSWDKTLKAFDL  432

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ +LV L+
Sbjct  433  LGMNVGFLRTRLRRLVNLA  451



>ref|XP_010058476.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Eucalyptus 
grandis]
Length=365

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC SRK +LH  LL+GL+ KL AG I+ETVNIADAIR AR+TT  E   VW  TL+  E 
Sbjct  229  LCRSRKTFLHARLLEGLHCKLAAGIISETVNIADAIRGARITTSTEDFSVWATTLKAFED  288

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ +L+ LS
Sbjct  289  LGMDVGFLRARLGRLISLS  307



>gb|KDP31917.1| hypothetical protein JCGZ_12378 [Jatropha curcas]
Length=497

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LH +L+ G+N+KLIAG I+ETVNI+DAIRA  LTT  +  + WD TL+  E 
Sbjct  350  LCCSQNAFLHANLIKGINFKLIAGIISETVNISDAIRACNLTTSHDEFDTWDKTLKASEH  409

Query  182  FGIQVGFLRDRISKLVRLSGD  244
            FG+ VGFL  ++ +LV L+ D
Sbjct  410  FGMSVGFLLAKLRRLVCLAFD  430



>gb|KCW73036.1| hypothetical protein EUGRSUZ_E01478 [Eucalyptus grandis]
Length=337

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC SRK +LH  LL+GL+ KL AG I+ETVNIADAIR AR+TT  E   VW  TL+  E 
Sbjct  202  LCRSRKTFLHARLLEGLHCKLAAGIISETVNIADAIRGARITTSTEDFSVWATTLKAFED  261

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ +L+ LS
Sbjct  262  LGMDVGFLRARLGRLISLS  280



>ref|XP_002313111.1| hypothetical protein POPTR_0009s10610g [Populus trichocarpa]
 gb|EEE87066.1| hypothetical protein POPTR_0009s10610g [Populus trichocarpa]
Length=439

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LLDGLN KL+ G ++ET+NIADAIRA++LT   E   +W+ TL+  E 
Sbjct  298  LCCSQNSFLHDHLLDGLNCKLVVGMLSETINIADAIRASKLTNSLESFAIWEKTLKAFEG  357

Query  182  FGIQVGFLRDRISKLVRLSG  241
             G+ VGFL  R+ +L+ LS 
Sbjct  358  LGMNVGFLLARLGQLMHLSA  377



>ref|XP_010107958.1| B3 domain-containing protein [Morus notabilis]
 gb|EXC17358.1| B3 domain-containing protein [Morus notabilis]
Length=867

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+KA+LH+ L+DGLN KL+AG I ET NIA+AIRA+++TT  +    WD TL+  E 
Sbjct  726  LCCSQKAFLHKHLIDGLNCKLVAGIILETTNIANAIRASKITTPVDDFATWDKTLKAFEG  785

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+++ FLRDR+  L+ L+ +
Sbjct  786  LGMKIEFLRDRLDGLINLASE  806



>ref|XP_009344645.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Pyrus 
x bretschneideri]
Length=246

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE L++GLN KL+AG I+ETVNIADAIRA + TT       WD TL+  + 
Sbjct  105  LCCSQNAFLHEQLIEGLNCKLVAGVISETVNIADAIRACKRTTSKGNFSTWDTTLKAFDD  164

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+  L  L+
Sbjct  165  LGMNVGFLRARLDHLASLA  183



>ref|XP_007199172.1| hypothetical protein PRUPE_ppa021390mg [Prunus persica]
 gb|EMJ00371.1| hypothetical protein PRUPE_ppa021390mg [Prunus persica]
Length=366

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE LL+GLN KLIAG I+ETVNIADAIRA ++TT       W  TL+  E 
Sbjct  236  LCCSQNAFLHEHLLEGLNCKLIAGVISETVNIADAIRACKITTTEGDFSTWSKTLKAFED  295

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+  GFLR R+ +L  L+ +
Sbjct  296  LGMNSGFLRVRLDRLASLASE  316



>ref|XP_010068473.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Eucalyptus 
grandis]
Length=526

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+K+YLH  LL+GLNYKL AG I+ETVN+ADAIRA+R+ T  +  ++W+ TL+  + 
Sbjct  385  LCRSQKSYLHGRLLEGLNYKLAAGIISETVNLADAIRASRIVTSMKEFDIWNKTLKAFQD  444

Query  182  FGIQVGFLRDRISKLVRLS  238
             G++VGFLR R+ +L+ L+
Sbjct  445  MGMEVGFLRARLERLLELA  463



>ref|XP_009344646.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Pyrus 
x bretschneideri]
 ref|XP_009344647.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Pyrus 
x bretschneideri]
Length=436

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH  LL+GLN KLIAG I+ETVNIADAIRA ++TT  + L  WD TL+  + 
Sbjct  310  LCCSQNSFLHGQLLEGLNCKLIAGVISETVNIADAIRACKITTPEDYLSTWDKTLKAFDD  369

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ V FLR R+ +L  L+
Sbjct  370  LGMNVRFLRARLDQLASLA  388



>gb|KCW63795.1| hypothetical protein EUGRSUZ_G01458 [Eucalyptus grandis]
Length=477

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+K+YLH  LL+GLNYKL AG I+ETVN+ADAIRA+R+ T  +  ++W+ TL+  + 
Sbjct  336  LCRSQKSYLHGRLLEGLNYKLAAGIISETVNLADAIRASRIVTSMKEFDIWNKTLKAFQD  395

Query  182  FGIQVGFLRDRISKLVRLS  238
             G++VGFLR R+ +L+ L+
Sbjct  396  MGMEVGFLRARLERLLELA  414



>ref|XP_003516780.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Glycine max]
Length=361

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS++++LH+ LL+GLN KL AG I+ET+NIADAI+A+ LTT  + L +WD TL+  E 
Sbjct  220  LCCSQRSFLHDHLLEGLNTKLAAGIISETINIADAIKASNLTTSPDSLVIWDKTLKAFET  279

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ V FL  R+ +L++L+
Sbjct  280  MGMNVSFLLIRLDQLMKLA  298



>ref|XP_004240808.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Solanum 
lycopersicum]
Length=445

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC ++ ++LH+ LL GLN KL AG ITETVNIADAIRA    T  E L+ WD TL+G E 
Sbjct  303  LCRAQNSFLHDHLLAGLNVKLAAGMITETVNIADAIRACESWTPREYLDTWDNTLKGFEC  362

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLR RISKL  LS +
Sbjct  363  LGMNVGFLRARISKLDSLSSE  383



>ref|XP_007200257.1| hypothetical protein PRUPE_ppa015021mg [Prunus persica]
 gb|EMJ01456.1| hypothetical protein PRUPE_ppa015021mg [Prunus persica]
Length=359

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LHE LLDGLN KL+AG I+ETVNIADAIRA  +TT       WD TL+  + 
Sbjct  218  LCCSQNSFLHEHLLDGLNCKLVAGVISETVNIADAIRACNITTPEGNFSTWDQTLKAFQG  277

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ +GFL  R+ +LV L+
Sbjct  278  LGMNIGFLLARLDQLVSLA  296



>ref|XP_006573914.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Glycine max]
Length=342

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS++++LH+ LL+GLN KL AG I+ET+NIADAI+A+ LTT  + L +WD TL+  E 
Sbjct  201  LCCSQRSFLHDHLLEGLNTKLAAGIISETINIADAIKASNLTTSPDSLVIWDKTLKAFET  260

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ V FL  R+ +L++L+
Sbjct  261  MGMNVSFLLIRLDQLMKLA  279



>gb|EYU42669.1| hypothetical protein MIMGU_mgv1a006218mg [Erythranthe guttata]
Length=346

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+  +LHE+LL GLN KL+AG I+ETVNIADA+RA + +T  E LE WD TL+  E 
Sbjct  203  LCKSQNTFLHENLLQGLNSKLVAGMISETVNIADAVRACKASTAHEHLESWDRTLKAFED  262

Query  182  FGIQVGFLRDRISKLVRL  235
             G+ VG +R RI++LV L
Sbjct  263  LGMAVGPVRGRINELVSL  280



>gb|KHN30413.1| B3 domain-containing protein [Glycine soja]
Length=425

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS++++LH+ LL+GLN KL AG I+ET+NIADAI+A+ LTT  + L +WD TL+  E 
Sbjct  284  LCCSQRSFLHDHLLEGLNTKLAAGIISETINIADAIKASNLTTSPDSLVIWDKTLKAFET  343

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ V FL  R+ +L++L+
Sbjct  344  MGMNVSFLLIRLDQLMKLA  362



>ref|XP_009344651.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Pyrus 
x bretschneideri]
Length=714

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE L++GLN KL+AG I+ETVNIADAIRA + TT       WD TL+  + 
Sbjct  573  LCCSQNAFLHEQLIEGLNCKLVAGVISETVNIADAIRACKRTTSKGNFSTWDTTLKAFDD  632

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+  L  L+
Sbjct  633  LGMNVGFLRARLDHLASLA  651



>gb|EYU42668.1| hypothetical protein MIMGU_mgv1a006218mg [Erythranthe guttata]
Length=392

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+  +LHE+LL GLN KL+AG I+ETVNIADA+RA + +T  E LE WD TL+  E 
Sbjct  249  LCKSQNTFLHENLLQGLNSKLVAGMISETVNIADAVRACKASTAHEHLESWDRTLKAFED  308

Query  182  FGIQVGFLRDRISKLVRL  235
             G+ VG +R RI++LV L
Sbjct  309  LGMAVGPVRGRINELVSL  326



>gb|KDO42473.1| hypothetical protein CISIN_1g036935mg, partial [Citrus sinensis]
Length=399

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH S+LDGLN KLI+G I+ET+NI DAIRA++LTT  +  + WD TL+  + 
Sbjct  258  LCCSQNSFLHNSVLDGLNCKLISGMISETINITDAIRASKLTTPHDNFDTWDKTLKAFKM  317

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFL  R+ +L+ L+
Sbjct  318  MGMNVGFLLIRLDQLMNLA  336



>ref|XP_006423042.1| hypothetical protein CICLE_v10030084mg, partial [Citrus clementina]
 gb|ESR36282.1| hypothetical protein CICLE_v10030084mg, partial [Citrus clementina]
Length=354

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH S+LDGLN KLI+G I+ET+NI DAIRA++LTT  +  + WD TL+  + 
Sbjct  213  LCCSQNSFLHNSVLDGLNCKLISGMISETINITDAIRASKLTTPHDNFDTWDKTLKAFKM  272

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFL  R+ +L+ L+
Sbjct  273  MGMNVGFLLIRLDQLMNLA  291



>ref|XP_008457832.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Cucumis melo]
Length=437

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+  +LHE+L+ G+N KL+ G I+ET+ IADAI+A+ L+T  +    WD TLR  + 
Sbjct  290  LCCSQNMFLHENLIQGMNRKLVIGVISETITIADAIKASDLSTSRDEFSAWDKTLRAFQL  349

Query  182  FGIQVGFLRDRISKLVRLS  238
            FG+ VGFLR+R+ +L  L+
Sbjct  350  FGMNVGFLRNRLHRLANLA  368



>gb|EYU42667.1| hypothetical protein MIMGU_mgv1a006218mg [Erythranthe guttata]
Length=452

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+  +LHE+LL GLN KL+AG I+ETVNIADA+RA + +T  E LE WD TL+  E 
Sbjct  309  LCKSQNTFLHENLLQGLNSKLVAGMISETVNIADAVRACKASTAHEHLESWDRTLKAFED  368

Query  182  FGIQVGFLRDRISKLVRL  235
             G+ VG +R RI++LV L
Sbjct  369  LGMAVGPVRGRINELVSL  386



>ref|XP_008349878.1| PREDICTED: uncharacterized protein LOC103413166 [Malus domestica]
Length=1014

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE L++GLN KL+AG I+ETVNIADAIRA ++TT       WD TL+  + 
Sbjct  873  LCCSQNAFLHEQLIEGLNCKLVAGVISETVNIADAIRACKITTSKGNFSTWDTTLKAFDD  932

Query  182  FGIQVGFLRDRISKLVRL  235
             G+ VGFL  R+  L  L
Sbjct  933  LGMNVGFLSARLDHLTSL  950



>ref|XP_009803081.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Nicotiana 
sylvestris]
Length=530

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++ A+LH+ LL GL+ KL+AG I E VNIADAIRA +LTT     ++WD +L+  E 
Sbjct  383  LCCNKSAFLHDRLLQGLHCKLVAGVIFEVVNIADAIRACKLTTKRTEFDIWDKSLKSFEL  442

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLR R+  LV L+ D
Sbjct  443  LGMNVGFLRTRLRWLVSLAFD  463



>gb|KHG01596.1| hypothetical protein F383_20813 [Gossypium arboreum]
Length=596

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE+++ G+++K   G I+ETVNIADAIR  +LTT  +  + WD TL+  E 
Sbjct  449  LCCSQNAFLHENIIQGISFKFKVGIISETVNIADAIRTCKLTTSRDEFDSWDRTLKAFEL  508

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ +LV L+
Sbjct  509  LGMNVGFLRTRLHRLVNLA  527



>ref|XP_008457831.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Cucumis melo]
Length=488

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+  +LHE+L+ G+N KL+ G I+ET+ IADAI+A+ L+T  +    WD TLR  + 
Sbjct  341  LCCSQNMFLHENLIQGMNRKLVIGVISETITIADAIKASDLSTSRDEFSAWDKTLRAFQL  400

Query  182  FGIQVGFLRDRISKLVRLS  238
            FG+ VGFLR+R+ +L  L+
Sbjct  401  FGMNVGFLRNRLHRLANLA  419



>ref|XP_008236526.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Prunus 
mume]
Length=415

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LHE LL+GLN KL+AG I+ETVNIADAIRA  +TT       WD TL+  + 
Sbjct  274  LCCSQTSFLHEHLLEGLNCKLVAGVISETVNIADAIRACNITTPEGNFSTWDQTLKAFQG  333

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ +GFL  R+ +LV L+
Sbjct  334  LGMNIGFLLARLDQLVSLA  352



>ref|XP_006380708.1| hypothetical protein POPTR_0007s11170g [Populus trichocarpa]
 gb|ERP58505.1| hypothetical protein POPTR_0007s11170g [Populus trichocarpa]
Length=286

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LH++L+ G+N KLIAG I+ETVNIADA+RA  L T  +    WD  L+  E 
Sbjct  139  LCCSQNAFLHDNLIKGVNLKLIAGIISETVNIADAMRACTLNTSRDEFATWDKALKASEL  198

Query  182  FGIQVGFLRDRISKLVRLSGD  244
            FG+ VGFLR ++  L+ L+ D
Sbjct  199  FGMNVGFLRSKLGLLLSLAFD  219



>ref|XP_008373163.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Malus 
domestica]
 ref|XP_008373164.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Malus 
domestica]
Length=366

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTT-GCELLEVWDATLRGIE  178
            LCCS+ ++LHE L++GLN KLI+GAI+ET+NIADAIR+  +TT GC     W  TL+  E
Sbjct  225  LCCSQNSFLHELLIEGLNCKLISGAISETINIADAIRSCSVTTLGCN-FSAWYKTLKAFE  283

Query  179  QFGIQVGFLRDRISKLVRLSG  241
              G+ VGFLR R+ +LV L+ 
Sbjct  284  GLGMNVGFLRTRLDQLVSLAS  304



>ref|XP_011000328.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Populus euphratica]
Length=465

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LLDGLN KL+ G ++ET++IADAI A++LT   E   +W+ TL+  E 
Sbjct  324  LCCSQNSFLHDHLLDGLNCKLVVGMLSETIHIADAITASKLTASLESFAIWEKTLKAFEG  383

Query  182  FGIQVGFLRDRISKLVRLSG  241
             G+ VGFL  R+ +L+ LS 
Sbjct  384  LGMNVGFLLARLGQLMHLSA  403



>ref|XP_011000320.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Populus euphratica]
Length=466

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LLDGLN KL+ G ++ET++IADAI A++LT   E   +W+ TL+  E 
Sbjct  325  LCCSQNSFLHDHLLDGLNCKLVVGMLSETIHIADAITASKLTASLESFAIWEKTLKAFEG  384

Query  182  FGIQVGFLRDRISKLVRLSG  241
             G+ VGFL  R+ +L+ LS 
Sbjct  385  LGMNVGFLLARLGQLMHLSA  404



>ref|XP_002324684.1| hypothetical protein POPTR_0018s13750g [Populus trichocarpa]
 gb|EEF03249.1| hypothetical protein POPTR_0018s13750g [Populus trichocarpa]
Length=404

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K +LHE+ ++GLN KLIAG I+ET+NIADAIRA+++TT  +    W+ TL+    
Sbjct  263  LCCSQKCFLHENFIEGLNCKLIAGIISETINIADAIRASKVTTSYDNFTTWEKTLKAFLG  322

Query  182  FGIQVGFLRDRISKLVRLSG  241
             G++V FL  R+ +L+ LS 
Sbjct  323  LGMKVDFLLARLEQLINLSA  342



>gb|KDO42478.1| hypothetical protein CISIN_1g011928mg [Citrus sinensis]
Length=346

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LL  +N KL A  IT+TVNIA+AIRA  L+T     E+WD TL+G E 
Sbjct  199  LCCSQNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEIWDKTLKGFEL  258

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+++L+ L+
Sbjct  259  LGMNVGFLRARLNRLMSLA  277



>ref|XP_011000335.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X3 [Populus euphratica]
Length=460

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LLDGLN KL+ G ++ET++IADAI A++LT   E   +W+ TL+  E 
Sbjct  319  LCCSQNSFLHDHLLDGLNCKLVVGMLSETIHIADAITASKLTASLESFAIWEKTLKAFEG  378

Query  182  FGIQVGFLRDRISKLVRLSG  241
             G+ VGFL  R+ +L+ LS 
Sbjct  379  LGMNVGFLLARLGQLMHLSA  398



>ref|XP_006380709.1| hypothetical protein POPTR_0007s11170g [Populus trichocarpa]
 gb|ERP58506.1| hypothetical protein POPTR_0007s11170g [Populus trichocarpa]
Length=475

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LH++L+ G+N KLIAG I+ETVNIADA+RA  L T  +    WD  L+  E 
Sbjct  328  LCCSQNAFLHDNLIKGVNLKLIAGIISETVNIADAMRACTLNTSRDEFATWDKALKASEL  387

Query  182  FGIQVGFLRDRISKLVRLSGD  244
            FG+ VGFLR ++  L+ L+ D
Sbjct  388  FGMNVGFLRSKLGLLLSLAFD  408



>ref|XP_010269238.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Nelumbo nucifera]
Length=453

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGC-ELLEVWDATLRGIE  178
            LCCS+KA+LH++LL+G+N  L +G I+ETVNIADAIRA +LTT   + L  WD +L+  E
Sbjct  305  LCCSQKAFLHDNLLEGINCLLSSGVISETVNIADAIRACKLTTASKDDLMKWDKSLQAFE  364

Query  179  QFGIQVGFLRDRISKLVRLS  238
              G+ VGFLR R++ LV L+
Sbjct  365  YLGMNVGFLRSRLNCLVDLA  384



>ref|XP_010070338.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Eucalyptus 
grandis]
 gb|KCW59024.1| hypothetical protein EUGRSUZ_H01651 [Eucalyptus grandis]
Length=498

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+  +LHE+LL G+NYKLI G I ETV++ADA+RA ++TT  E  E WD TL+  + 
Sbjct  351  LCRSQNVFLHENLLKGMNYKLIVGIICETVHVADAVRACKITTTREEFETWDKTLKAFKI  410

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGF+R R+ +LV L+
Sbjct  411  LGMNVGFVRARLKQLVGLA  429



>ref|XP_011010191.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Populus euphratica]
Length=475

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LH++L+ G+N KLIAG I+ETVNIADA+RA  L T  +    WD  L+  E 
Sbjct  328  LCCSQNAFLHDNLIKGVNLKLIAGIISETVNIADAMRACTLNTSRDEFATWDKALKASEL  387

Query  182  FGIQVGFLRDRISKLVRLSGD  244
            FG+ VGFLR ++  L+ L+ D
Sbjct  388  FGMNVGFLRAKLGLLLSLAFD  408



>ref|XP_002310730.2| hypothetical protein POPTR_0007s11170g [Populus trichocarpa]
 gb|EEE91180.2| hypothetical protein POPTR_0007s11170g [Populus trichocarpa]
Length=477

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LH++L+ G+N KLIAG I+ETVNIADA+RA  L T  +    WD  L+  E 
Sbjct  330  LCCSQNAFLHDNLIKGVNLKLIAGIISETVNIADAMRACTLNTSRDEFATWDKALKASEL  389

Query  182  FGIQVGFLRDRISKLVRLSGD  244
            FG+ VGFLR ++  L+ L+ D
Sbjct  390  FGMNVGFLRSKLGLLLSLAFD  410



>ref|XP_010269230.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Nelumbo nucifera]
Length=488

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGC-ELLEVWDATLRGIE  178
            LCCS+KA+LH++LL+G+N  L +G I+ETVNIADAIRA +LTT   + L  WD +L+  E
Sbjct  340  LCCSQKAFLHDNLLEGINCLLSSGVISETVNIADAIRACKLTTASKDDLMKWDKSLQAFE  399

Query  179  QFGIQVGFLRDRISKLVRLS  238
              G+ VGFLR R++ LV L+
Sbjct  400  YLGMNVGFLRSRLNCLVDLA  419



>ref|XP_011010190.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Populus euphratica]
Length=477

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LH++L+ G+N KLIAG I+ETVNIADA+RA  L T  +    WD  L+  E 
Sbjct  330  LCCSQNAFLHDNLIKGVNLKLIAGIISETVNIADAMRACTLNTSRDEFATWDKALKASEL  389

Query  182  FGIQVGFLRDRISKLVRLSGD  244
            FG+ VGFLR ++  L+ L+ D
Sbjct  390  FGMNVGFLRAKLGLLLSLAFD  410



>ref|XP_008236547.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Prunus 
mume]
Length=249

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LHE LL+GLN KLI G I+ET+NIADAI+A ++TT       W+ TL   E 
Sbjct  145  LCCSQNSFLHEHLLEGLNCKLIVGVISETINIADAIKACKITTSEGYFSTWNKTLIAFEG  204

Query  182  FGIQVGFLRDRISKL  226
             G+ VGFLR R+ +L
Sbjct  205  LGMNVGFLRARLDQL  219



>gb|KDO42477.1| hypothetical protein CISIN_1g011928mg [Citrus sinensis]
Length=416

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LL  +N KL A  IT+TVNIA+AIRA  L+T     E+WD TL+G E 
Sbjct  269  LCCSQNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEIWDKTLKGFEL  328

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+++L+ L+
Sbjct  329  LGMNVGFLRARLNRLMSLA  347



>ref|XP_011092583.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Sesamum indicum]
Length=379

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+ ++LHE ++ GLN KL AG I ET+NIADAIR A    G    E WD TL+  + 
Sbjct  237  LCRSQSSFLHEKVIPGLNSKLAAGMILETINIADAIRVANPNMGSNHFESWDKTLKAFDD  296

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR RI KLV LS
Sbjct  297  LGMTVGFLRARIHKLVSLS  315



>ref|XP_010070516.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Eucalyptus 
grandis]
 gb|KCW59322.1| hypothetical protein EUGRSUZ_H02009 [Eucalyptus grandis]
Length=498

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+  +LHE+LL G+NYKLI G I ETV++ADA+RA ++TT  E  E WD TL+  + 
Sbjct  351  LCRSQNVFLHENLLKGMNYKLIVGIICETVHVADAVRACKITTTREEFETWDKTLKAFKI  410

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGF+R R+ +LV L+
Sbjct  411  LGMNVGFVRARLKQLVGLA  429



>ref|XP_009594239.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Nicotiana 
tomentosiformis]
Length=528

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++ A+LH+ LL GL+ KL+AG I E VNIADAIRA +LTT     ++W+ +L+  E 
Sbjct  381  LCCNKSAFLHDRLLQGLHCKLVAGVIFEVVNIADAIRACKLTTQRMEFDIWEKSLKSFEL  440

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLR R+  LV L+ D
Sbjct  441  LGMNVGFLRTRLRWLVSLAFD  461



>gb|KDO42474.1| hypothetical protein CISIN_1g011928mg [Citrus sinensis]
Length=444

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LL  +N KL A  IT+TVNIA+AIRA  L+T     E+WD TL+G E 
Sbjct  297  LCCSQNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEIWDKTLKGFEL  356

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+++L+ L+
Sbjct  357  LGMNVGFLRARLNRLMSLA  375



>ref|XP_006487086.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Citrus sinensis]
Length=444

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LL  +N KL A  IT+TVNIA+AIRA  L+T     E+WD TL+G E 
Sbjct  297  LCCSQNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEIWDKTLKGFEL  356

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+++L+ L+
Sbjct  357  LGMNVGFLRARLNRLMSLA  375



>ref|XP_006423043.1| hypothetical protein CICLE_v10028399mg [Citrus clementina]
 gb|ESR36283.1| hypothetical protein CICLE_v10028399mg [Citrus clementina]
Length=444

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LL  +N KL A  IT+TVNIA+AIRA  L+T     E+WD TL+G E 
Sbjct  297  LCCSQNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEIWDKTLKGFEL  356

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+++L+ L+
Sbjct  357  LGMNVGFLRARLNRLMSLA  375



>ref|XP_007201917.1| hypothetical protein PRUPE_ppa026741m1g, partial [Prunus persica]
 gb|EMJ03116.1| hypothetical protein PRUPE_ppa026741m1g, partial [Prunus persica]
Length=221

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LHE LL+GLN KLI G  +ET+NIADAIRA ++TT       W+ TL   E 
Sbjct  123  LCCSQNSFLHEHLLEGLNCKLIVGVTSETINIADAIRACKITTSEGYFSTWNKTLIAFEG  182

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ +L  L+
Sbjct  183  LGMNVGFLRARLDQLAILA  201



>gb|KDO42475.1| hypothetical protein CISIN_1g011928mg [Citrus sinensis]
Length=458

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LL  +N KL A  IT+TVNIA+AIRA  L+T     E+WD TL+G E 
Sbjct  311  LCCSQNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEIWDKTLKGFEL  370

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+++L+ L+
Sbjct  371  LGMNVGFLRARLNRLMSLA  389



>ref|XP_006487085.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Citrus sinensis]
Length=458

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LL  +N KL A  IT+TVNIA+AIRA  L+T     E+WD TL+G E 
Sbjct  311  LCCSQNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEIWDKTLKGFEL  370

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+++L+ L+
Sbjct  371  LGMNVGFLRARLNRLMSLA  389



>ref|XP_006423044.1| hypothetical protein CICLE_v10028399mg [Citrus clementina]
 gb|ESR36284.1| hypothetical protein CICLE_v10028399mg [Citrus clementina]
Length=458

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LL  +N KL A  IT+TVNIA+AIRA  L+T     E+WD TL+G E 
Sbjct  311  LCCSQNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEIWDKTLKGFEL  370

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+++L+ L+
Sbjct  371  LGMNVGFLRARLNRLMSLA  389



>gb|KDO42476.1| hypothetical protein CISIN_1g011928mg [Citrus sinensis]
Length=475

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LL  +N KL A  IT+TVNIA+AIRA  L+T     E+WD TL+G E 
Sbjct  328  LCCSQNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEIWDKTLKGFEL  387

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+++L+ L+
Sbjct  388  LGMNVGFLRARLNRLMSLA  406



>ref|XP_011017695.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Populus euphratica]
Length=433

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K +LHE+ ++GLN KLIAG I+ET+NIADAIRA++++T  +    W+ TL+    
Sbjct  292  LCCSQKCFLHENFIEGLNCKLIAGIISETINIADAIRASKVSTSYDNFTTWEKTLKAFLG  351

Query  182  FGIQVGFLRDRISKLVRLSG  241
             G++V FL  R+ +L+ LS 
Sbjct  352  LGMKVDFLLARLEQLINLSA  371



>gb|KCW55292.1| hypothetical protein EUGRSUZ_I01218 [Eucalyptus grandis]
Length=374

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+  +LH++LL  +NYKL A  I+ETVNIADAI+A+ L+T    LE+WD TL G E 
Sbjct  233  LCSSQNGFLHDNLLKSINYKLAAEMISETVNIADAIKASNLSTSRADLEMWDKTLEGFEL  292

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G++VGFLR R+ ++  ++ +
Sbjct  293  LGMKVGFLRARLDQIKNVASE  313



>ref|XP_011092580.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Sesamum indicum]
 ref|XP_011092581.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Sesamum indicum]
Length=459

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+ ++LHE ++ GLN KL AG I ET+NIADAIR A    G    E WD TL+  + 
Sbjct  317  LCRSQSSFLHEKVIPGLNSKLAAGMILETINIADAIRVANPNMGSNHFESWDKTLKAFDD  376

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR RI KLV LS
Sbjct  377  LGMTVGFLRARIHKLVSLS  395



>ref|XP_002518782.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43707.1| conserved hypothetical protein [Ricinus communis]
Length=470

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LHE+LL  +NYKL    I  TVNI++AIRA++L+       VWD TL+G E 
Sbjct  324  LCCSQNSFLHENLLKSINYKLATEIIIGTVNISEAIRASKLSCSNADFAVWDKTLKGFEL  383

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+S+L+ L+
Sbjct  384  LGMNVGFLRSRLSRLMTLA  402



>ref|XP_004148056.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Cucumis 
sativus]
 ref|XP_004161736.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Cucumis 
sativus]
 gb|KGN62009.1| hypothetical protein Csa_2G285930 [Cucumis sativus]
Length=501

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+  +LHE+L+ G+N KL+ G I+ET+ IA+AI+A+ L+T  +    WD TLR  + 
Sbjct  354  LCCSQNMFLHENLIQGMNRKLVTGVISETITIANAIKASDLSTSRDEYSAWDKTLRAFQL  413

Query  182  FGIQVGFLRDRISKLVRLS  238
            FG+ VGFLR R+ +L  L+
Sbjct  414  FGMNVGFLRTRLHRLANLA  432



>ref|XP_008339962.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Malus 
domestica]
Length=473

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+KA+LHE+++ G+N  LI GAI+ETVNIAD+I+A ++TT  +    WD  L   E 
Sbjct  326  LCRSQKAFLHENVIKGMNPNLIIGAISETVNIADSIKACKVTTXRDDFVSWDKYLTAFEL  385

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLRDRI +L  L+ D
Sbjct  386  LGMNVGFLRDRICRLANLADD  406



>ref|XP_007155931.1| hypothetical protein PHAVU_003G244400g [Phaseolus vulgaris]
 gb|ESW27925.1| hypothetical protein PHAVU_003G244400g [Phaseolus vulgaris]
Length=483

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE+L+ G+NYKLIAG I+ETVNIADAIR + + T       WD TL   E 
Sbjct  336  LCCSQHAFLHENLIKGMNYKLIAGIISETVNIADAIRVSVICTPRFEFANWDKTLLAFEH  395

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ V FLR R+ +LV ++
Sbjct  396  LGMNVEFLRIRLRRLVSIA  414



>ref|XP_010028536.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Eucalyptus 
grandis]
Length=423

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+  +LH++LL  +NYKL A  I+ETVNIADAI+A+ L+T    LE+WD TL G E 
Sbjct  282  LCSSQNGFLHDNLLKSINYKLAAEMISETVNIADAIKASNLSTSRADLEMWDKTLEGFEL  341

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G++VGFLR R+ ++  ++ +
Sbjct  342  LGMKVGFLRARLDQIKNVASE  362



>gb|EYU42671.1| hypothetical protein MIMGU_mgv1a007604mg [Erythranthe guttata]
Length=402

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC SR  +LHE+L+ GLN KL    I+ET+ IADAIRA    T   L+E WD TL+G E+
Sbjct  260  LCKSRNMFLHENLVQGLNGKLAVEMISETIRIADAIRAVDSKTAPGLMEGWDKTLKGFEE  319

Query  182  FGIQVGFLRDRISKLVRL  235
             G+ VGFLR RI KL+R+
Sbjct  320  IGMVVGFLRVRIRKLIRV  337



>ref|XP_004289224.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Fragaria 
vesca subsp. vesca]
Length=557

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE+++ G +YKLI GAI ETV+I DAI+A ++TT  +    WD  LR  E 
Sbjct  410  LCCSQNAFLHENVMKGTDYKLIVGAIVETVHIVDAIKACQITTTQDDFVCWDRYLRAFEL  469

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGF+R R+ +L  L+ D
Sbjct  470  LGMNVGFIRVRLCRLANLAFD  490



>ref|XP_010094372.1| B3 domain-containing protein [Morus notabilis]
 gb|EXB55909.1| B3 domain-containing protein [Morus notabilis]
Length=494

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LH+ ++ G+N KLI G ITETV+IA+AI+   LTT  +    WD +L+  E 
Sbjct  346  LCCSQNAFLHDDVIKGMNKKLIVGTITETVHIANAIKVCTLTTSRDDFSAWDKSLKAFEL  405

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+S+L  L+
Sbjct  406  LGMNVGFLRARLSQLAGLA  424



>ref|XP_009366999.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Pyrus 
x bretschneideri]
Length=472

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+KA+LHE+++ G+N  LI GAI+ETVNIAD+I+A ++TT  +    WD  L   E 
Sbjct  325  LCRSQKAFLHENVIKGMNPNLIIGAISETVNIADSIKACKVTTSRDDFVSWDKYLTAFEL  384

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFL DRI +L  L+ D
Sbjct  385  LGMNVGFLHDRICRLANLADD  405



>gb|KDP42311.1| hypothetical protein JCGZ_01635 [Jatropha curcas]
Length=466

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH++LL  +NYKL A  I  TVNI++AIRA+ L+       VWD TL+G E 
Sbjct  320  LCCSQSSFLHDNLLKSINYKLAAEIIIGTVNISEAIRASTLSNSHADFAVWDKTLKGFEL  379

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+++L+ L+
Sbjct  380  LGMNVGFLRSRLNRLMSLA  398



>ref|XP_006339907.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Solanum 
tuberosum]
Length=526

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LH+ LL GL+ KL+AG I E VNIAD +RA +LTT  +  + W+ +L+  E 
Sbjct  379  LCCSKNAFLHDRLLQGLHCKLVAGMIFEVVNIADMVRACKLTTPRKEFDKWEKSLKSFEL  438

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLR R+  L+ L+ D
Sbjct  439  LGMNVGFLRTRLRWLLSLAFD  459



>ref|XP_009375697.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Pyrus 
x bretschneideri]
Length=501

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+KA+LHE+++ G+N+ LI GAI+ETVNIAD+I+A ++T   +    WD  L   E 
Sbjct  354  LCRSQKAFLHENVIKGMNHNLIIGAISETVNIADSIKACKVTALRDDFVSWDKYLTAFEL  413

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLR+R+ +L  L+ D
Sbjct  414  LGMNVGFLRERVCRLANLADD  434



>gb|EYU39334.1| hypothetical protein MIMGU_mgv1a005357mg [Erythranthe guttata]
Length=487

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC ++  +LH+ LL GL  KL  G I ETVNIADAIR  +LTT  E  EVW+ +LR  E 
Sbjct  340  LCSTKNVFLHDCLLPGLYVKLAGGIIVETVNIADAIRGCKLTTSKEEFEVWEKSLRSFEL  399

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLR  +S+L  ++ D
Sbjct  400  LGLNVGFLRVHLSRLFDIAFD  420



>gb|EYU26113.1| hypothetical protein MIMGU_mgv1a025604mg [Erythranthe guttata]
Length=327

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+  +LHE+L+ GLN KL AG I+ETVNIADAIRA+  TT  E LE WD TL+  E 
Sbjct  186  LCRSQNTFLHENLVRGLNTKLAAGIISETVNIADAIRAS--TTPHEHLESWDKTLKAFED  243

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VG LR RI +++ L  D
Sbjct  244  LGMSVGPLRARIREMMSLYRD  264



>gb|KDO79252.1| hypothetical protein CISIN_1g010160mg [Citrus sinensis]
Length=433

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE+L  G+N+KLI G I+E VNIADA+RA + TT  +   +WD TL+  E 
Sbjct  286  LCCSQNAFLHENLAQGINFKLIVGTISEIVNIADALRACKFTTSRDEFAMWDKTLKAFEL  345

Query  182  FGIQVGF  202
             G+ VGF
Sbjct  346  LGMSVGF  352



>gb|KDO79250.1| hypothetical protein CISIN_1g010160mg [Citrus sinensis]
 gb|KDO79251.1| hypothetical protein CISIN_1g010160mg [Citrus sinensis]
Length=453

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE+L  G+N+KLI G I+E VNIADA+RA + TT  +   +WD TL+  E 
Sbjct  306  LCCSQNAFLHENLAQGINFKLIVGTISEIVNIADALRACKFTTSRDEFAMWDKTLKAFEL  365

Query  182  FGIQVGF  202
             G+ VGF
Sbjct  366  LGMSVGF  372



>ref|XP_006425869.1| hypothetical protein CICLE_v10025376mg [Citrus clementina]
 gb|ESR39109.1| hypothetical protein CICLE_v10025376mg [Citrus clementina]
Length=453

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE+L  G+N+KLI G I+E VNIADA+RA + TT  +   +WD TL+  E 
Sbjct  306  LCCSQNAFLHENLAQGINFKLIVGTISEIVNIADALRACKFTTSRDEFAMWDKTLKAFEL  365

Query  182  FGIQVGF  202
             G+ VGF
Sbjct  366  LGMSVGF  372



>ref|XP_004232039.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Solanum 
lycopersicum]
Length=526

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LH+ LL GL+ KL+AG I E VNIAD +RA +L+T  +  + W+ +L+  E 
Sbjct  379  LCCSKNAFLHDRLLQGLHCKLVAGMIFEVVNIADMVRACKLSTPRKEFDKWEKSLKSFEL  438

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLR R+  L+ L+ D
Sbjct  439  LGMNVGFLRTRLRWLLSLAFD  459



>emb|CAN61149.1| hypothetical protein VITISV_029172 [Vitis vinifera]
Length=554

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE +++GLN +LIA  I++TV IADA+RA +LTT       W+ TL+  E 
Sbjct  407  LCCSQNAFLHEKIVEGLNCRLIAEIISQTVQIADALRACKLTTSRVEFTNWERTLKAFEV  466

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFL+ R+  LV L+ D
Sbjct  467  LGMNVGFLQARLDHLVSLAFD  487



>gb|KDO79249.1| hypothetical protein CISIN_1g010160mg [Citrus sinensis]
Length=516

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE+L  G+N+KLI G I+E VNIADA+RA + TT  +   +WD TL+  E 
Sbjct  369  LCCSQNAFLHENLAQGINFKLIVGTISEIVNIADALRACKFTTSRDEFAMWDKTLKAFEL  428

Query  182  FGIQVGF  202
             G+ VGF
Sbjct  429  LGMSVGF  435



>ref|XP_006425870.1| hypothetical protein CICLE_v10025376mg [Citrus clementina]
 ref|XP_006466621.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Citrus 
sinensis]
 gb|ESR39110.1| hypothetical protein CICLE_v10025376mg [Citrus clementina]
Length=516

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE+L  G+N+KLI G I+E VNIADA+RA + TT  +   +WD TL+  E 
Sbjct  369  LCCSQNAFLHENLAQGINFKLIVGTISEIVNIADALRACKFTTSRDEFAMWDKTLKAFEL  428

Query  182  FGIQVGF  202
             G+ VGF
Sbjct  429  LGMSVGF  435



>emb|CBI21437.3| unnamed protein product [Vitis vinifera]
Length=508

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE +++GLN +LIA  I++TV IADA+RA +LTT       W+ TL+  E 
Sbjct  361  LCCSQNAFLHEKIVEGLNCRLIAEIISQTVQIADALRACKLTTSRVEFTNWERTLKAFEV  420

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFL+ R+  LV L+ D
Sbjct  421  LGMNVGFLQARLDHLVSLAFD  441



>ref|XP_011005880.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X4 [Populus euphratica]
 ref|XP_011005881.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X4 [Populus euphratica]
Length=386

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++ ++LH++L+ G+N+KLIAG I+ETVNIADA+RA  LTT  +    WD  L+  E 
Sbjct  239  LCCNQNSFLHDNLIKGVNFKLIAGIISETVNIADAMRACTLTTSRDKFATWDKALKASEL  298

Query  182  FGIQVGF  202
            FG+ VGF
Sbjct  299  FGMNVGF  305



>ref|XP_011005878.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Populus euphratica]
Length=473

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++ ++LH++L+ G+N+KLIAG I+ETVNIADA+RA  LTT  +    WD  L+  E 
Sbjct  326  LCCNQNSFLHDNLIKGVNFKLIAGIISETVNIADAMRACTLTTSRDKFATWDKALKASEL  385

Query  182  FGIQVGF  202
            FG+ VGF
Sbjct  386  FGMNVGF  392



>ref|XP_011005877.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Populus euphratica]
Length=475

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++ ++LH++L+ G+N+KLIAG I+ETVNIADA+RA  LTT  +    WD  L+  E 
Sbjct  328  LCCNQNSFLHDNLIKGVNFKLIAGIISETVNIADAMRACTLTTSRDKFATWDKALKASEL  387

Query  182  FGIQVGF  202
            FG+ VGF
Sbjct  388  FGMNVGF  394



>ref|XP_011005879.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X3 [Populus euphratica]
Length=453

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC++ ++LH++L+ G+N+KLIAG I+ETVNIADA+RA  LTT  +    WD  L+  E 
Sbjct  306  LCCNQNSFLHDNLIKGVNFKLIAGIISETVNIADAMRACTLTTSRDKFATWDKALKASEL  365

Query  182  FGIQVGF  202
            FG+ VGF
Sbjct  366  FGMNVGF  372



>ref|XP_004509148.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Cicer arietinum]
Length=458

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S++AYLHE+L+ GLNYKL++G I ETV+IADAI+ + ++T       WD TL   E 
Sbjct  311  LCYSQQAYLHENLIKGLNYKLVSGIICETVHIADAIKVSVISTPRVEFSSWDKTLLAFEH  370

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ V FLR R+ +LV ++
Sbjct  371  LGMNVQFLRVRLRRLVSIA  389



>ref|XP_008361398.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Malus 
domestica]
Length=501

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+KA+LHE+++ G+N+ +I GAI+ETVNIAD+I A ++T   +    WD  L   E 
Sbjct  354  LCRSQKAFLHENVIKGMNHNMIIGAISETVNIADSIEACKVTALRDDFVSWDKYLTAFEL  413

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLR+R+ +L  L+ +
Sbjct  414  LGMNVGFLRERVCRLANLADB  434



>gb|EYU42672.1| hypothetical protein MIMGU_mgv1a024973mg [Erythranthe guttata]
Length=394

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+  +LHE+++ GLN KL    I+E + IAD+IRAA   TG + +E WD TL+  E 
Sbjct  251  LCKSQNMFLHENIVQGLNGKLAVEMISELIKIADSIRAADSKTGTDRMEGWDKTLKAFED  310

Query  182  FGIQVGFLRDRISKLVRL  235
             G+ VGFLR RI KL+R+
Sbjct  311  LGMVVGFLRVRIRKLIRV  328



>ref|XP_004509147.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Cicer arietinum]
Length=479

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S++AYLHE+L+ GLNYKL++G I ETV+IADAI+ + ++T       WD TL   E 
Sbjct  332  LCYSQQAYLHENLIKGLNYKLVSGIICETVHIADAIKVSVISTPRVEFSSWDKTLLAFEH  391

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ V FLR R+ +LV ++
Sbjct  392  LGMNVQFLRVRLRRLVSIA  410



>emb|CDP02488.1| unnamed protein product [Coffea canephora]
Length=585

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+  +LHE  L GL+ KL AG I E VN A+AIRA ++TT  +  E W+ +LR  E 
Sbjct  438  LCCSKNVFLHERFLPGLHCKLAAGMIFEAVNTAEAIRACKVTTSRKEFEKWEKSLRSFEL  497

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ +L+ ++
Sbjct  498  LGMNVGFLRARMRRLLSMA  516



>gb|EYU42670.1| hypothetical protein MIMGU_mgv1a009633mg [Erythranthe guttata]
Length=336

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC SR  +LHE+L+ GLN KL A  I+ET+ IADAIRA    T    +E WD TL+  E 
Sbjct  194  LCKSRNMFLHENLVQGLNGKLAAEMISETIKIADAIRAVDSKTAPARMEGWDKTLKAFED  253

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR RI +L+ +S
Sbjct  254  LGMVVGFLRVRIHELLSIS  272



>ref|XP_004294825.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Fragaria 
vesca subsp. vesca]
Length=221

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTG-CELLEVWDATLRGIE  178
            LC S+ ++LHE +L+ LN  L+AG I+ETVN++D IRA ++TT  C+ L  WD TL+  E
Sbjct  80   LCRSQNSFLHEHILEPLNSNLVAGVISETVNLSDVIRAGKITTSECDFL-TWDKTLQASE  138

Query  179  QFGIQVGFLRDRISKLVRLSG  241
               + VGFLR R+ KL  L+ 
Sbjct  139  ILDMNVGFLRARLDKLASLAS  159



>ref|XP_006384419.1| hypothetical protein POPTR_0004s14900g [Populus trichocarpa]
 gb|ERP62216.1| hypothetical protein POPTR_0004s14900g [Populus trichocarpa]
Length=476

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+ ++LH +LL+ +N+KL A  I  TV+I++ IR++RL++      VWD TL+G E 
Sbjct  330  LCRSQNSFLHSNLLNSINHKLAAEIIIGTVDISEEIRSSRLSSSHADYGVWDKTLKGFEM  389

Query  182  FGIQVGFLRDRISKLVRLS  238
            FG+ VGFLR+R+S+L+ L+
Sbjct  390  FGMNVGFLRERLSRLMSLA  408



>gb|EYU37691.1| hypothetical protein MIMGU_mgv1a020275mg, partial [Erythranthe 
guttata]
Length=339

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS++ +LH+ L++GL+ KL    I+ET NI++A+R+A ++T    LE W+ TL+  E 
Sbjct  198  LCCSQRMFLHDHLINGLSTKLAVVMISETTNISEAVRSADVSTSLHHLECWEKTLKAFED  257

Query  182  FGIQVGFLRDRISKLVRL  235
             G+ VGF+R+R+ KL+ +
Sbjct  258  LGMAVGFIRNRLHKLLEI  275



>ref|XP_011000257.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Populus euphratica]
Length=467

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+ ++LH  LL+ +N+KL A  I  TV+I++ IR++RL++      VWD TL+G E 
Sbjct  321  LCRSQNSFLHSKLLNSINHKLAAEIIIGTVDISEEIRSSRLSSSHADYGVWDKTLKGFEM  380

Query  182  FGIQVGFLRDRISKLVRLS  238
            FG+ VGFLR+R+S+L+ L+
Sbjct  381  FGMNVGFLRERLSRLMNLA  399



>ref|XP_011006478.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Populus euphratica]
Length=476

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+ ++LH  LL+ +N+KL A  I  TV+I++ IR++RL++      VWD TL+G E 
Sbjct  330  LCRSQNSFLHSKLLNSINHKLAAEIIIGTVDISEEIRSSRLSSSHADYGVWDKTLKGFEM  389

Query  182  FGIQVGFLRDRISKLVRLS  238
            FG+ VGFLR+R+S+L+ L+
Sbjct  390  FGMNVGFLRERLSRLMNLA  408



>ref|XP_011000251.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Populus euphratica]
Length=476

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+ ++LH  LL+ +N+KL A  I  TV+I++ IR++RL++      VWD TL+G E 
Sbjct  330  LCRSQNSFLHSKLLNSINHKLAAEIIIGTVDISEEIRSSRLSSSHADYGVWDKTLKGFEM  389

Query  182  FGIQVGFLRDRISKLVRLS  238
            FG+ VGFLR+R+S+L+ L+
Sbjct  390  FGMNVGFLRERLSRLMNLA  408



>ref|XP_011006479.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Populus euphratica]
Length=477

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+ ++LH  LL+ +N+KL A  I  TV+I++ IR++RL++      VWD TL+G E 
Sbjct  331  LCRSQNSFLHSKLLNSINHKLAAEIIIGTVDISEEIRSSRLSSSHADYGVWDKTLKGFEM  390

Query  182  FGIQVGFLRDRISKLVRLS  238
            FG+ VGFLR+R+S+L+ L+
Sbjct  391  FGMNVGFLRERLSRLMNLA  409



>gb|EYU44388.1| hypothetical protein MIMGU_mgv1a005456mg [Erythranthe guttata]
Length=483

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+ AYLHE LL GL  KL  G I +T+ IAD I++  LTT  +  EVW+ +LR  E 
Sbjct  336  LCSSKNAYLHERLLPGLYTKLACGIIDQTIKIADCIKSCNLTTPRKDFEVWEKSLRSFEL  395

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G+ VGFLR R++ L+ L+ D
Sbjct  396  LGLNVGFLRARLNHLLTLAFD  416



>ref|XP_010688082.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=508

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARL-TTGCELLEVWDATLRGIE  178
            LCC  +++LHE+ L GLN  L+ G I+ET+NIADAI++ +  +T  E L++W+ TL+G E
Sbjct  366  LCCCERSFLHETFLKGLNCNLVVGIISETINIADAIKSWKNGSTSHEDLQIWEKTLKGFE  425

Query  179  QFGIQVGFLRDRISKLVRLSGD  244
              G++VGFL  RI++L+  S +
Sbjct  426  LLGMKVGFLLARINQLLGRSSE  447



>ref|XP_010688083.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=508

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARL-TTGCELLEVWDATLRGIE  178
            LCC  +++LHE+ L GLN  L+ G I+ET+NIADAI++ +  +T  E L++W+ TL+G E
Sbjct  366  LCCCERSFLHETFLKGLNCNLVVGIISETINIADAIKSWKNGSTSHEDLQIWEKTLKGFE  425

Query  179  QFGIQVGFLRDRISKLVRLSGD  244
              G++VGFL  RI++L+  S +
Sbjct  426  LLGMKVGFLLARINQLLGRSSE  447



>ref|XP_010688081.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=509

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARL-TTGCELLEVWDATLRGIE  178
            LCC  +++LHE+ L GLN  L+ G I+ET+NIADAI++ +  +T  E L++W+ TL+G E
Sbjct  367  LCCCERSFLHETFLKGLNCNLVVGIISETINIADAIKSWKNGSTSHEDLQIWEKTLKGFE  426

Query  179  QFGIQVGFLRDRISKLVRLSGD  244
              G++VGFL  RI++L+  S +
Sbjct  427  LLGMKVGFLLARINQLLGRSSE  448



>gb|EPS62319.1| hypothetical protein M569_12471 [Genlisea aurea]
Length=486

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLT-TGCELLEVWDATLRGIE  178
            LCC+R  +LH+ LL GL  KL +  I ET+NIAD+IRA +L  T  E  EVW+ +LR  E
Sbjct  338  LCCTRNQFLHDHLLPGLYRKLASSMIVETLNIADSIRACKLVDTPREDFEVWEKSLRSFE  397

Query  179  QFGIQVGFLRDRISKLVRLS  238
              G+ VGFLR R+ +L  L+
Sbjct  398  LLGLDVGFLRARLQELSSLA  417



>emb|CDP16162.1| unnamed protein product [Coffea canephora]
Length=417

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARL-TTGCELLEVWDATLRGIE  178
            LCCS+K+ LH+ L+  ++ KL AG I+ETV IADAIRAA + TT C  +  WD TL+G E
Sbjct  272  LCCSKKSGLHDGLVKCIDKKLAAGIISETVKIADAIRAAEITTTSCNDVRRWDQTLKGFE  331

Query  179  QFGIQVGFLRDRISKLV  229
              G+ V FLR  I  ++
Sbjct  332  GMGMNVAFLRAAIKNIL  348



>ref|XP_008236549.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Prunus 
mume]
Length=458

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCSR ++LH+ LL  +N KL A  ITET NIA+AIRA +L+      E+W+ TL   E 
Sbjct  356  LCCSRGSFLHDHLLKSINSKLAAEIITETTNIANAIRARKLSASHADYEMWEKTLNAFEL  415

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFL  R+ +L+  S
Sbjct  416  LGMDVGFLHARLKRLLSAS  434



>gb|EYU26120.1| hypothetical protein MIMGU_mgv1a0207362mg, partial [Erythranthe 
guttata]
Length=196

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS++ +L + L++GL+ KL    I+ET NI++A+R+A ++T    LE W+ T +  E 
Sbjct  54   LCCSQRMFLLDHLINGLSTKLAVVMISETTNISEAVRSADVSTSLHHLECWEKTFKAFED  113

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGF+R+R+ KL+ +S
Sbjct  114  LGMAVGFIRNRLHKLLEIS  132



>gb|EYU26123.1| hypothetical protein MIMGU_mgv1a0231452mg, partial [Erythranthe 
guttata]
Length=253

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS++ +L + L++GL+ KL    I+ET NI++A+R+A ++T    LE W+ T +  E 
Sbjct  111  LCCSQRMFLLDHLINGLSTKLAVVMISETTNISEAVRSADVSTSLHHLECWEKTFKAFED  170

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGF+R+R+ KL+ +S
Sbjct  171  LGMAVGFIRNRLHKLLEIS  189



>ref|XP_007199321.1| hypothetical protein PRUPE_ppa023470mg [Prunus persica]
 gb|EMJ00520.1| hypothetical protein PRUPE_ppa023470mg [Prunus persica]
Length=330

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCSR ++LH+ LL  +N KL A  ITET NIA+AIRA +L+      E+W+ TL   E 
Sbjct  206  LCCSRGSFLHDHLLKSINSKLAAEIITETTNIANAIRARKLSASHTDYEMWEKTLNAFEL  265

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFL  ++ +L+  S
Sbjct  266  LGMDVGFLNAQLERLLSPS  284



>ref|XP_007042393.1| AP2/B3-like transcriptional factor family protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007042394.1| AP2/B3-like transcriptional factor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX98224.1| AP2/B3-like transcriptional factor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX98225.1| AP2/B3-like transcriptional factor family protein, putative isoform 
1 [Theobroma cacao]
Length=408

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+ LL  ++ KL A  IT+TVNIA+A++  +L++      +WD TL+G E 
Sbjct  262  LCCSQNSFLHDHLLKSISSKLAAEIITQTVNIAEAVKGCKLSSFQADYSLWDKTLKGFEL  321

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+++L  L+
Sbjct  322  LGMNVGFLRARLNRLKTLA  340



>ref|XP_004293243.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Fragaria 
vesca subsp. vesca]
Length=502

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 2/82 (2%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTG-CELLEVWDATLRGIE  178
            LC S+ ++LH+ +++ LN  L+ G ITETVNIADA+++ ++TT  CE  + W+ TL   E
Sbjct  406  LCSSQSSHLHQHVVESLNSHLVVGLITETVNIADAVKSCKITTKECE-FQTWEKTLEASE  464

Query  179  QFGIQVGFLRDRISKLVRLSGD  244
              G+ VGFLR R+ +L  L+ +
Sbjct  465  ILGMNVGFLRIRVRRLASLAAE  486



>ref|XP_011099150.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Sesamum 
indicum]
Length=505

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LH+ +L GL  KL AG I ET+NIAD IR  +L T  +  EVW+ +LR  E 
Sbjct  358  LCCSKNAFLHDRVLPGLYSKLAAGMIVETINIADVIRGCKLNTPRKDFEVWEKSLRSFEL  417

Query  182  FGIQVGF  202
             G+ VGF
Sbjct  418  LGLNVGF  424



>ref|XP_003638142.1| B3 domain-containing protein [Medicago truncatula]
 ref|XP_003638738.1| B3 domain-containing protein [Medicago truncatula]
Length=456

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S++ +LH++++ GL+YKLIAG I+E VNIADAI+ + ++T       WD TL   E 
Sbjct  308  LCYSQQVFLHDNVIKGLHYKLIAGIISEIVNIADAIKVSVISTPRVEFSNWDKTLLAFEH  367

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ V FLR R+ +LV ++
Sbjct  368  LGMNVEFLRVRLRRLVSIA  386



>ref|XP_002313110.1| hypothetical protein POPTR_0009s10620g [Populus trichocarpa]
 gb|EEE87065.1| hypothetical protein POPTR_0009s10620g [Populus trichocarpa]
Length=476

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC S+ ++LH +LL+ +N+KL    I  TV+I++ IR+++L++      VWD TL+G E 
Sbjct  330  LCRSQSSFLHSNLLNSINHKLAVEIIIGTVDISEGIRSSKLSSSQADYGVWDKTLKGFEL  389

Query  182  FGIQVGFLRDRISKLVRLS  238
             G++VGFLR+R+S+L+ L+
Sbjct  390  LGMKVGFLRERLSRLMSLA  408



>gb|KHN26467.1| B3 domain-containing protein [Glycine soja]
Length=472

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE+L+ G+NYKLIAG I ETVNIADAI  + + T       WD TL   E 
Sbjct  325  LCCSQHAFLHENLIKGMNYKLIAGIILETVNIADAIEVSVICTPRAEFSNWDKTLLAFEH  384

Query  182  FGIQVGF  202
             G+ V F
Sbjct  385  LGMDVEF  391



>ref|XP_003551033.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Glycine 
max]
Length=480

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ A+LHE+L+ G+NYKLIAG I ETVNIADAI  + + T       WD TL   E 
Sbjct  333  LCCSQHAFLHENLIKGMNYKLIAGIILETVNIADAIEVSVICTPRAEFSNWDKTLLAFEH  392

Query  182  FGIQVGF  202
             G+ V F
Sbjct  393  LGMDVEF  399



>ref|XP_010666632.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=211

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+   LH+ L   +N+ L+ G I ETV IADA+R   L+T  +   +WD TL  +E 
Sbjct  64   LCCSQNGLLHDHLPKWMNHILVQGIIIETVTIADALRQCELSTSKDTFVLWDKTLNALEL  123

Query  182  FGIQVGFLR---DRISKLVR  232
             G+ +GFLR   DR+ K+V 
Sbjct  124  LGMNIGFLRAHLDRLQKIVH  143



>ref|XP_002310788.1| hypothetical protein POPTR_0007s12380g [Populus trichocarpa]
 gb|EEE91238.1| hypothetical protein POPTR_0007s12380g [Populus trichocarpa]
Length=171

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K +LH+ L++ LN KL  G I ET+NIADAI+ + +TT  +  + W+ TL+  + 
Sbjct  94   LCCSQKRFLHDHLVECLNCKLDVGMIAETINIADAIKVSTVTTLQDSFKKWEKTLKAFQG  153

Query  182  FGIQVGFLRDRISKLVRL  235
             G+ VGFL  R+ +   L
Sbjct  154  LGMNVGFLLARLEQQKNL  171



>emb|CDM82532.1| unnamed protein product [Triticum aestivum]
Length=480

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARL-TTGCELLEVWDATLRGIE  178
            LCC++K++LH+ LL GLN  L+ GAI ET++IA+ IRA +     C+   VW   L+ ++
Sbjct  338  LCCAQKSFLHKELLKGLNLTLVVGAIMETIDIAEGIRACKARAPSCKHFVVWKKNLQALK  397

Query  179  QFGIQVGFLRDRISKLVRL  235
              G+ V FL  R+  L+ L
Sbjct  398  LLGMNVDFLLKRVDDLLSL  416



>emb|CDM82531.1| unnamed protein product [Triticum aestivum]
Length=480

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARL-TTGCELLEVWDATLRGIE  178
            LCC++K++LH+ LL GLN  L+ GAI ET++IA+ IRA +     C+   VW   L+ ++
Sbjct  338  LCCAQKSFLHKELLKGLNLTLVVGAIMETIDIAEGIRACKARAPSCKHFVVWKKNLQALK  397

Query  179  QFGIQVGFLRDRISKLVRL  235
              G+ V FL  R+  L+ L
Sbjct  398  LLGMNVDFLLKRVDDLLSL  416



>ref|XP_010999982.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Populus 
euphratica]
Length=195

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCSRK +LH+ +++ LN KL+ G + ET+NIAD IRA   +T  E    W+ TL+  + 
Sbjct  100  LCCSRKCFLHDHVIEDLNCKLVGGMLAETINIADGIRAPAFSTFQENFAAWEKTLKAFQG  159

Query  182  FGIQVGFLRDRISKLVRL  235
             GI    L +    L+RL
Sbjct  160  IGISAKLL-EVTETLIRL  176



>ref|XP_004971466.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Setaria 
italica]
Length=478

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGC-ELLEVWDATLRGIE  178
            LCCS+ ++LH++LL  LN  L+ G I ET++IA+ IRA +      E L +W  TL  +E
Sbjct  330  LCCSQNSFLHKNLLKQLNLTLVVGVIMETISIAEGIRACKAQASSREDLLIWKKTLVSLE  389

Query  179  QFGIQVGFLRDRISKLVRLSGD  244
              G+ VGFL  RI+ L+ L+ +
Sbjct  390  LLGMNVGFLLKRINGLLGLTAE  411



>ref|XP_010666631.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=406

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC R  +LH  LL+G+N  LIAG I ETVN+A A+++  L T      +WD  L+ ++ 
Sbjct  211  LCC-RNEFLHIHLLEGINPFLIAGIIIETVNVALAMKSCELHTSKNEFSIWDEKLKSLKI  269

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G++VGFL   +  L R++ D
Sbjct  270  LGMEVGFLVSHLDNLQRVAYD  290



>ref|XP_006643962.1| PREDICTED: LOW QUALITY PROTEIN: B3 domain-containing protein 
Os01g0234100-like [Oryza brachyantha]
Length=501

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGC-ELLEVWDATLRGIE  178
            LCCS+K++LH+ LL  LN KL+ G I ET+ IA+ IRA ++ T   E   +W  TL   +
Sbjct  353  LCCSQKSFLHKHLLRQLNLKLVVGVIMETIIIAEGIRACKVNTSSHEDFLIWKKTLESFQ  412

Query  179  QFGIQVGFLRDRISKLVRLSG  241
              G+ V FL  R+  L+ L+ 
Sbjct  413  LLGMNVVFLLKRVDDLLGLAA  433



>ref|XP_010666629.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=457

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCC R  +LH  LL+G+N  LIAG I ETVN+A A+++  L T      +WD  L+ ++ 
Sbjct  262  LCC-RNEFLHIHLLEGINPFLIAGIIIETVNVALAMKSCELHTSKNEFSIWDEKLKSLKI  320

Query  182  FGIQVGFLRDRISKLVRLSGD  244
             G++VGFL   +  L R++ D
Sbjct  321  LGMEVGFLVSHLDNLQRVAYD  341



>gb|EMT26046.1| B3 domain-containing protein [Aegilops tauschii]
Length=607

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRA--ARLTTGCELLEVWDATLRGI  175
            LCC++K++LH+ LL GLN  L+ GAI ET++IA+ IRA  AR+ +  + + VW   L+ +
Sbjct  465  LCCAQKSFLHKDLLKGLNITLVVGAIMETIDIAEGIRACKARVPSRKDFV-VWKKNLQAL  523

Query  176  EQFGIQVGFLRDRISKLVRL  235
            +  G+ V FL  R+  L+ L
Sbjct  524  KLLGMNVDFLLKRVDGLLSL  543



>ref|XP_008385749.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Malus domestica]
Length=497

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH++LL  ++ KL A  ITET NIA+AIRA +L        + + TL   E 
Sbjct  357  LCCSQGSFLHDNLLKSIDSKLAAEIITETTNIANAIRACKLPPSRADYVMQEKTLHAFEL  416

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ + + ++
Sbjct  417  LGMDVGFLRARLKQCLSIA  435



>ref|XP_008385747.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Malus domestica]
Length=500

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH++LL  ++ KL A  ITET NIA+AIRA +L        + + TL   E 
Sbjct  360  LCCSQGSFLHDNLLKSIDSKLAAEIITETTNIANAIRACKLPPSRADYVMQEKTLHAFEL  419

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ + + ++
Sbjct  420  LGMDVGFLRARLKQCLSIA  438



>ref|XP_009339453.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Pyrus x bretschneideri]
Length=497

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+++L  ++ KL A  ITET NIA+AIRA +L        + + TL   E 
Sbjct  357  LCCSQGSFLHDNILKSIDSKLAAEIITETTNIANAIRACKLPPSRADCVMQEKTLHAFEL  416

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ + + ++
Sbjct  417  LGMDVGFLRARLKRCLSVA  435



>ref|XP_009339452.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Pyrus x bretschneideri]
Length=500

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+++L  ++ KL A  ITET NIA+AIRA +L        + + TL   E 
Sbjct  360  LCCSQGSFLHDNILKSIDSKLAAEIITETTNIANAIRACKLPPSRADCVMQEKTLHAFEL  419

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ + + ++
Sbjct  420  LGMDVGFLRARLKRCLSVA  438



>ref|XP_008359237.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Malus 
domestica]
Length=458

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH++LL  ++ KL A  ITET NIA+AIRA +L        + + TL   E 
Sbjct  318  LCCSQGSFLHDNLLKSIDSKLAAEIITETTNIANAIRACKLPPSRADYVMQEKTLHAFEL  377

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGFLR R+ + + ++
Sbjct  378  LGMDVGFLRARLKQCLSIA  396



>ref|XP_002459887.1| hypothetical protein SORBIDRAFT_02g013060 [Sorghum bicolor]
 gb|EER96408.1| hypothetical protein SORBIDRAFT_02g013060 [Sorghum bicolor]
Length=447

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGC-ELLEVWDATLRGIE  178
            LCCS+K+ LH  LL  L   L+AG I ETV+IAD IRA +      E   VW  TL   E
Sbjct  297  LCCSQKSLLHGHLLKQLQPTLVAGVIMETVSIADGIRACKAEASSREDFLVWKKTLESFE  356

Query  179  QFGIQVGFLRDRISKLV  229
              G+ V FL +R++ L+
Sbjct  357  LLGMNVAFLLNRVNGLL  373



>ref|XP_009349898.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Pyrus x bretschneideri]
Length=498

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+++L  ++ KL A  ITET NIA+AIRA +L        + + TL   E 
Sbjct  358  LCCSQGSFLHDNILKSIDSKLAAEIITETTNIANAIRACKLPPSRADCVMQEKTLHAFEL  417

Query  182  FGIQVGFLRDRI  217
             G+ VGFLR R+
Sbjct  418  LGMDVGFLRARL  429



>ref|XP_009349897.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Pyrus x bretschneideri]
Length=501

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+ ++LH+++L  ++ KL A  ITET NIA+AIRA +L        + + TL   E 
Sbjct  361  LCCSQGSFLHDNILKSIDSKLAAEIITETTNIANAIRACKLPPSRADCVMQEKTLHAFEL  420

Query  182  FGIQVGFLRDRI  217
             G+ VGFLR R+
Sbjct  421  LGMDVGFLRARL  432



>ref|XP_010666642.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Beta 
vulgaris subsp. vulgaris]
Length=316

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 36/86 (42%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDG----LNYKLIAGAIT----ETVNIADAIRAARLTTGCELLEVWD  157
            LCCS+ A+LH  LL G    LNY++I  AI     ETV+IA+A++  +L+T      +W+
Sbjct  120  LCCSQNAFLHAHLLKGINPTLNYQIITEAIKRIIFETVSIANALKTCKLSTFLYKCSLWE  179

Query  158  ATLRGIEQFGIQVGFLRDRISKLVRL  235
             TL   E  G+ VGFL  R+  L  L
Sbjct  180  DTLNAYEGLGMNVGFLLARLHHLRSL  205



>gb|EEC70251.1| hypothetical protein OsI_01044 [Oryza sativa Indica Group]
Length=495

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARL-TTGCELLEVWDATLRGIE  178
            LCC++K++LH  LL  L+  L+ G I ET+NIA+ IRA    T+  E   +W  TL+  +
Sbjct  347  LCCAQKSFLHRHLLRQLSLTLVVGVIMETINIAEGIRACGAGTSSQEDFLIWKKTLQSFD  406

Query  179  QFGIQVGFLRDRISKLVRL  235
              G+ V FL  R+  L+ L
Sbjct  407  LLGMNVAFLLKRVDDLLGL  425



>gb|EMT14114.1| B3 domain-containing protein [Aegilops tauschii]
Length=662

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/82 (44%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRA--ARLTTGCELLEVWDATLRGI  175
            LCC+++++LH+ LL  +N  L  G I ET NIA+ IRA  AR ++  E   VW  TL   
Sbjct  524  LCCAQESFLHKDLLKQINLTLAVGVIMETTNIAEGIRACEARASSH-EDFVVWKKTLEAF  582

Query  176  EQFGIQVGFLRDRISKLVRLSG  241
            E  G+ V FL  RI  L+ LS 
Sbjct  583  ELLGMNVKFLLKRIDGLLSLSA  604



>dbj|BAD81380.1| unknown protein [Oryza sativa Japonica Group]
Length=473

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARL-TTGCELLEVWDATLRGIE  178
            LCC++K++LH  LL  L+  L+ G I ET+NIA+ IRA    T+  E   +W  TL+  +
Sbjct  325  LCCAQKSFLHRHLLRQLSLTLVVGVIMETINIAEGIRACGAGTSSQEDFLIWKKTLQSFD  384

Query  179  QFGIQVGFLRDRISKLVRL  235
              G+ V FL  R+  ++ L
Sbjct  385  LLGMNVAFLLKRVDDILGL  403



>ref|NP_001042515.1| Os01g0234100 [Oryza sativa Japonica Group]
 sp|Q0JP99.1|Y1341_ORYSJ RecName: Full=B3 domain-containing protein Os01g0234100 [Oryza 
sativa Japonica Group]
 dbj|BAF04429.1| Os01g0234100 [Oryza sativa Japonica Group]
Length=495

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARL-TTGCELLEVWDATLRGIE  178
            LCC++K++LH  LL  L+  L+ G I ET+NIA+ IRA    T+  E   +W  TL+  +
Sbjct  347  LCCAQKSFLHRHLLRQLSLTLVVGVIMETINIAEGIRACGAGTSSQEDFLIWKKTLQSFD  406

Query  179  QFGIQVGFLRDRISKLVRL  235
              G+ V FL  R+  ++ L
Sbjct  407  LLGMNVAFLLKRVDDILGL  425



>gb|EEE54186.1| hypothetical protein OsJ_01011 [Oryza sativa Japonica Group]
Length=521

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARL-TTGCELLEVWDATLRGIE  178
            LCC++K++LH  LL  L+  L+ G I ET+NIA+ IRA    T+  E   +W  TL+  +
Sbjct  340  LCCAQKSFLHRHLLRQLSLTLVVGVIMETINIAEGIRACGAGTSSQEDFLIWKKTLQSFD  399

Query  179  QFGIQVGFLRDRISKLVRL  235
              G+ V FL  R+  ++ L
Sbjct  400  LLGMNVAFLLKRVDDILGL  418



>ref|XP_010240699.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Brachypodium 
distachyon]
Length=539

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LC ++K++LH++LL  +N  L  G I ETVNIA+ IRA+R ++  E   +W   L   E 
Sbjct  387  LCQAQKSFLHKNLLKKINPTLALGVIIETVNIAEGIRASRASSH-EDFSLWKKILESFEI  445

Query  182  FGIQVGFLRDRISKLVRL  235
             G+ V F+R R+  L+ L
Sbjct  446  LGMDVTFMRKRVDDLLGL  463



>gb|EYU37692.1| hypothetical protein MIMGU_mgv1a008064mg [Erythranthe guttata]
Length=386

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 11/79 (14%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS++             KL    I+ET NI++A+R+A ++T    LE W+ TL+  E 
Sbjct  255  LCCSQRIT-----------KLAVVMISETTNISEAVRSADVSTSLHHLECWEKTLKAFED  303

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGF+R+R+ KL+ +S
Sbjct  304  LGMAVGFIRNRLHKLLEIS  322



>ref|XP_010233026.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Brachypodium 
distachyon]
Length=587

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARL-TTGCELLEVWDATLRGIE  178
            LC ++K++LH++LL  +N  L  G I ET+NIA+ IRA +  T+  E   +W  TL   E
Sbjct  439  LCRAQKSFLHKNLLKQINLTLAVGVIMETINIAEGIRACKAHTSSREDFVIWKKTLESFE  498

Query  179  QFGIQVGFLRDRISKLVRL  235
              G+ V FL  R+ +L+ L
Sbjct  499  LLGMNVAFLLKRMDQLLGL  517



>gb|EMT06248.1| B3 domain-containing protein [Aegilops tauschii]
Length=644

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGC--ELLEVWDATLRGI  175
            LC +RKA+LH  L   +N  L  G I ET +IA  IR+   T+    E L  W  TL   
Sbjct  493  LCGARKAFLHRRLPKHINPTLATGVIAETASIAKGIRSYPTTSSSSFEDLAAWKKTLESF  552

Query  176  EQFGIQVGFLRDRISKLVRL  235
            E  G+ V F+R R+ +L+ L
Sbjct  553  ELLGMDVSFMRKRVDELLFL  572



>ref|XP_006383239.1| hypothetical protein POPTR_0005s12780g [Populus trichocarpa]
 gb|ERP61036.1| hypothetical protein POPTR_0005s12780g [Populus trichocarpa]
Length=182

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEV  151
            LCCSRK +LH+ +++ LN KL+ G + ET+NIA  IRA   TT  E L++
Sbjct  129  LCCSRKCFLHDHIIEDLNCKLVGGMLAETINIAAGIRAPTFTTFQENLQL  178



>gb|EYU24349.1| hypothetical protein MIMGU_mgv1a025934mg [Erythranthe guttata]
Length=278

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEV  151
            LC S+  +LHE L+ GLN KL A  I+ETV IA+ IRA    TG   +E+
Sbjct  169  LCKSQNMFLHEKLVRGLNGKLAAEMISETVKIANTIRAVNPMTGPARMEI  218



>gb|EPS67917.1| hypothetical protein M569_06854, partial [Genlisea aurea]
Length=339

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 11/79 (14%)
 Frame = +2

Query  2    LCCSRKAYLHESLLDGLNYKLIAGAITETVNIADAIRAARLTTGCELLEVWDATLRGIEQ  181
            LCCS+K           N  ++   I ETV IADAIR++ L+     LE W+ TL+  + 
Sbjct  215  LCCSQKI---------CNLAIVM--IAETVVIADAIRSSSLSISLHQLECWEKTLKAFDD  263

Query  182  FGIQVGFLRDRISKLVRLS  238
             G+ VGF+R R+ +L+ LS
Sbjct  264  LGMVVGFMRSRLHRLIGLS  282



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510229923304