BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9539_g1_i1 len=940 path=[918:0-939]

Length=940
                                                                      Score     E

ref|XP_007161568.1|  hypothetical protein PHAVU_001G080500g             309   4e-101   
ref|XP_009613332.1|  PREDICTED: protein YLS9-like                       302   3e-98    
ref|XP_010086788.1|  hypothetical protein L484_006211                   301   3e-98    
emb|CDP19803.1|  unnamed protein product                                301   4e-98    
ref|XP_011046093.1|  PREDICTED: protein YLS9-like                       301   6e-98    
gb|KDP45825.1|  hypothetical protein JCGZ_17432                         299   7e-97    
ref|XP_009792297.1|  PREDICTED: protein YLS9-like                       298   1e-96    
ref|XP_004234340.1|  PREDICTED: protein YLS9                            295   1e-95    
ref|XP_006351537.1|  PREDICTED: uncharacterized protein LOC102578226    295   2e-95    
ref|XP_008240413.1|  PREDICTED: uncharacterized protein LOC103338918    290   3e-93    
ref|XP_006372637.1|  hypothetical protein POPTR_0017s03470g             289   4e-93    
ref|XP_002519591.1|  conserved hypothetical protein                     289   5e-93    Ricinus communis
emb|CBI26408.3|  unnamed protein product                                283   5e-91    
ref|XP_007210859.1|  hypothetical protein PRUPE_ppa015087mg             285   5e-91    
ref|XP_011072085.1|  PREDICTED: protein YLS9                            283   6e-91    
ref|XP_002263732.2|  PREDICTED: protein YLS9                            284   7e-91    Vitis vinifera
ref|XP_007029347.1|  Late embryogenesis abundant hydroxyproline-r...    282   1e-90    
ref|XP_009356081.1|  PREDICTED: protein YLS9                            278   2e-88    
ref|XP_003536181.1|  PREDICTED: protein YLS9-like                       275   7e-88    
ref|XP_004495489.1|  PREDICTED: uncharacterized protein LOC101514344    272   1e-86    
ref|XP_003556419.1|  PREDICTED: uncharacterized protein LOC100780820    270   9e-86    
gb|KEH42881.1|  late embryogenesis abundant hydroxyproline-rich g...    270   1e-85    
ref|XP_008375075.1|  PREDICTED: uncharacterized protein LOC103438306    269   6e-85    
gb|KHN14748.1|  hypothetical protein glysoja_020921                     265   2e-84    
ref|XP_002305694.2|  hypothetical protein POPTR_0004s06570g             265   6e-84    Populus trichocarpa [western balsam poplar]
ref|XP_011035414.1|  PREDICTED: uncharacterized protein LOC105133228    263   7e-84    
ref|XP_006441484.1|  hypothetical protein CICLE_v10023307mg             264   1e-83    
gb|KDO55969.1|  hypothetical protein CISIN_1g047356mg                   264   1e-83    
ref|XP_004299452.1|  PREDICTED: uncharacterized protein LOC101308869    266   1e-83    
ref|XP_006478147.1|  PREDICTED: uncharacterized protein LOC102625449    265   3e-83    
gb|EYU22309.1|  hypothetical protein MIMGU_mgv1a012723mg                251   2e-78    
ref|XP_009113430.1|  PREDICTED: protein YLS9                            250   1e-77    
gb|KGN50557.1|  hypothetical protein Csa_5G182130                       244   6e-76    
ref|XP_006392516.1|  hypothetical protein EUTSA_v10023892mg             243   2e-75    
ref|XP_008461681.1|  PREDICTED: uncharacterized protein LOC103500225    242   5e-75    
ref|XP_010037035.1|  PREDICTED: protein YLS9                            240   3e-74    
gb|KCW48675.1|  hypothetical protein EUGRSUZ_K02330                     240   3e-74    
ref|XP_008800413.1|  PREDICTED: protein YLS9-like                       238   3e-73    
ref|XP_010246772.1|  PREDICTED: protein YLS9-like                       236   2e-72    
ref|XP_010531819.1|  PREDICTED: protein YLS9                            234   5e-72    
ref|XP_009127449.1|  PREDICTED: protein YLS9                            234   6e-72    
ref|XP_006848655.1|  hypothetical protein AMTR_s00171p00061900          233   2e-71    
emb|CDY72163.1|  BnaCnng76260D                                          233   2e-71    
gb|KFK41014.1|  hypothetical protein AALP_AA2G074000                    233   3e-71    
emb|CDY16419.1|  BnaA02g12230D                                          232   3e-71    
ref|XP_010248776.1|  PREDICTED: protein YLS9-like                       232   4e-71    
ref|XP_010062341.1|  PREDICTED: protein YLS9                            232   8e-71    
ref|XP_010511195.1|  PREDICTED: protein YLS9-like                       230   3e-70    
ref|XP_010687265.1|  PREDICTED: protein YLS9-like                       229   4e-70    
ref|XP_002263161.1|  PREDICTED: protein YLS9                            229   1e-69    Vitis vinifera
ref|XP_002894589.1|  hypothetical protein ARALYDRAFT_892695             228   1e-69    
ref|XP_010470348.1|  PREDICTED: protein YLS9-like                       228   1e-69    
ref|XP_010414901.1|  PREDICTED: protein YLS9-like                       228   2e-69    
ref|XP_009144668.1|  PREDICTED: protein YLS9-like                       228   3e-69    
ref|XP_007146942.1|  hypothetical protein PHAVU_006G083600g             224   3e-68    
emb|CDP01715.1|  unnamed protein product                                224   4e-68    
ref|XP_010689475.1|  PREDICTED: protein YLS9-like                       226   6e-68    
ref|XP_010450459.1|  PREDICTED: protein YLS9-like                       223   1e-67    
ref|XP_006302753.1|  hypothetical protein CARUB_v10020873mg             222   2e-67    
ref|XP_007201354.1|  hypothetical protein PRUPE_ppa010199mg             222   4e-67    
ref|XP_009598493.1|  PREDICTED: protein YLS9-like                       222   5e-67    
gb|KDO64296.1|  hypothetical protein CISIN_1g045040mg                   221   6e-67    
ref|XP_008235165.1|  PREDICTED: protein YLS9-like                       222   6e-67    
ref|XP_010435523.1|  PREDICTED: protein YLS9-like                       220   2e-66    
ref|XP_009784223.1|  PREDICTED: protein YLS9-like                       220   2e-66    
ref|XP_006429731.1|  hypothetical protein CICLE_v10012533mg             220   3e-66    
ref|XP_011096911.1|  PREDICTED: protein YLS9                            219   4e-66    
ref|XP_006350456.1|  PREDICTED: protein NDR1-like                       219   4e-66    
ref|XP_010440807.1|  PREDICTED: protein YLS9-like                       219   6e-66    
ref|XP_010908302.1|  PREDICTED: protein YLS9-like                       219   8e-66    
ref|XP_006302605.1|  hypothetical protein CARUB_v10020710mg             220   8e-66    
gb|KFK35622.1|  hypothetical protein AALP_AA4G015200                    217   2e-65    
ref|XP_008813411.1|  PREDICTED: protein YLS9-like                       217   3e-65    
ref|XP_006285529.1|  hypothetical protein CARUB_v10006971mg             216   7e-65    
ref|XP_006391539.1|  hypothetical protein EUTSA_v10019035mg             216   7e-65    
ref|XP_009400299.1|  PREDICTED: protein YLS9-like                       216   7e-65    
emb|CDY26995.1|  BnaC06g12110D                                          218   1e-64    
ref|XP_010917454.1|  PREDICTED: protein YLS9-like                       216   1e-64    
ref|XP_002870497.1|  hypothetical protein ARALYDRAFT_330253             215   2e-64    
gb|EAY79014.1|  hypothetical protein OsI_34123                          215   2e-64    Oryza sativa Indica Group [Indian rice]
gb|EYU25653.1|  hypothetical protein MIMGU_mgv1a020532mg                214   4e-64    
ref|XP_010108943.1|  hypothetical protein L484_027138                   214   4e-64    
ref|XP_009339806.1|  PREDICTED: protein YLS9                            214   5e-64    
ref|NP_175856.1|  late embryogenesis abundant hydroxyproline-rich...    214   5e-64    Arabidopsis thaliana [mouse-ear cress]
ref|NP_198513.1|  NDR1/HIN1-like 25                                     214   5e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802758.1|  PREDICTED: protein YLS9-like                       214   6e-64    
ref|XP_008376206.1|  PREDICTED: protein YLS9-like                       213   9e-64    
ref|XP_010315726.1|  PREDICTED: protein YLS9-like                       213   2e-63    
ref|XP_011030182.1|  PREDICTED: protein YLS9-like                       212   3e-63    
ref|XP_002318799.2|  NDR1/HIN1-LIKE 25 family protein                   212   4e-63    Populus trichocarpa [western balsam poplar]
gb|KDP46951.1|  hypothetical protein JCGZ_07968                         211   5e-63    
ref|XP_010935586.1|  PREDICTED: protein YLS9-like                       210   1e-62    
ref|XP_002321933.1|  hypothetical protein POPTR_0015s12720g             210   2e-62    Populus trichocarpa [western balsam poplar]
ref|XP_010551645.1|  PREDICTED: protein YLS9-like                       210   2e-62    
gb|KHN18621.1|  Putative syntaxin-24                                    208   8e-62    
ref|XP_003553153.1|  PREDICTED: protein YLS9                            208   9e-62    
ref|XP_002888443.1|  hypothetical protein ARALYDRAFT_894159             208   1e-61    
ref|XP_009613605.1|  PREDICTED: protein YLS9-like                       207   3e-61    
ref|NP_564862.1|  late embryogenesis abundant (LEA) hydroxyprolin...    207   3e-61    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11640.1|  unnamed protein product                                206   4e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011048775.1|  PREDICTED: protein YLS9-like                       206   7e-61    
gb|KHN24686.1|  Putative syntaxin-24                                    206   8e-61    
ref|XP_006405958.1|  hypothetical protein EUTSA_v10028131mg             205   1e-60    
ref|NP_001239877.1|  uncharacterized protein LOC100778798               205   1e-60    
ref|XP_003538353.1|  PREDICTED: protein YLS9-like                       205   2e-60    
gb|ACU21028.1|  unknown                                                 204   4e-60    Glycine max [soybeans]
ref|XP_004306186.1|  PREDICTED: protein NDR1-like                       204   7e-60    
ref|XP_004500420.1|  PREDICTED: uncharacterized protein LOC101493957    202   1e-59    
emb|CDY53530.1|  BnaCnng25340D                                          202   2e-59    
ref|XP_007141987.1|  hypothetical protein PHAVU_008G242900g             202   2e-59    
ref|XP_009139699.1|  PREDICTED: protein YLS9                            202   2e-59    
ref|XP_003544951.1|  PREDICTED: protein YLS9                            202   3e-59    
ref|XP_002530555.1|  conserved hypothetical protein                     201   6e-59    Ricinus communis
ref|XP_007020018.1|  NDR1/HIN1-like 25, putative                        199   2e-58    
gb|AAF23842.1|AC007234_14  F1E22.7                                      199   3e-58    Arabidopsis thaliana [mouse-ear cress]
emb|CDY38564.1|  BnaA05g12930D                                          207   6e-58    
ref|XP_004982769.1|  PREDICTED: uncharacterized protein LOC101757821    198   1e-57    
emb|CDX74604.1|  BnaA04g07850D                                          197   2e-57    
ref|XP_010511116.1|  PREDICTED: protein YLS9-like                       196   3e-57    
ref|XP_010415112.1|  PREDICTED: protein YLS9-like                       195   1e-56    
ref|XP_004232659.1|  PREDICTED: protein YLS9                            194   2e-56    
ref|XP_010940382.1|  PREDICTED: protein YLS9-like                       193   4e-56    
ref|XP_009799970.1|  PREDICTED: protein YLS9-like                       193   8e-56    
dbj|BAJ85346.1|  predicted protein                                      191   4e-55    
ref|XP_010667864.1|  PREDICTED: protein YLS9-like                       190   8e-55    
ref|XP_009418272.1|  PREDICTED: protein YLS9-like                       189   1e-54    
ref|XP_003616105.1|  hypothetical protein MTR_5g076170                  190   1e-54    
gb|AFK46819.1|  unknown                                                 189   2e-54    
ref|XP_004490745.1|  PREDICTED: protein NDR1-like                       187   1e-53    
gb|ABC86702.1|  harpin-induced protein-like                             183   3e-53    Coffea arabica [arabica coffee]
ref|XP_008449868.1|  PREDICTED: protein YLS9-like                       184   1e-52    
gb|AFK35063.1|  unknown                                                 183   5e-52    
gb|KCW57916.1|  hypothetical protein EUGRSUZ_H00662                     180   2e-51    
ref|XP_009386692.1|  PREDICTED: protein YLS9-like                       179   9e-51    
ref|XP_010234855.1|  PREDICTED: protein YLS9-like                       179   1e-50    
ref|XP_009392242.1|  PREDICTED: protein YLS9-like                       178   3e-50    
ref|XP_004161918.1|  PREDICTED: uncharacterized LOC101205367            177   3e-50    
ref|XP_004147714.1|  PREDICTED: uncharacterized protein LOC101205367    176   4e-50    
gb|ABK24926.1|  unknown                                                 177   2e-49    Picea sitchensis
ref|NP_001147622.1|  NHL25                                              173   3e-48    Zea mays [maize]
gb|EAZ16506.1|  hypothetical protein OsJ_31978                          169   4e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004164514.1|  PREDICTED: protein NDR1-like                       171   3e-47    
ref|XP_004149663.1|  PREDICTED: protein NDR1-like                       171   3e-47    
ref|XP_010529003.1|  PREDICTED: protein YLS9                            169   6e-47    
ref|XP_009406139.1|  PREDICTED: protein YLS9-like                       170   6e-47    
tpg|DAA49515.1|  TPA: NHL25                                             169   3e-46    
gb|EPS70084.1|  hypothetical protein M569_04680                         166   3e-46    
ref|NP_001151435.1|  NHL25                                              169   3e-46    Zea mays [maize]
ref|NP_001169317.1|  uncharacterized protein LOC100383182               167   1e-45    Zea mays [maize]
gb|ABK25808.1|  unknown                                                 165   7e-45    Picea sitchensis
ref|XP_002467031.1|  hypothetical protein SORBIDRAFT_01g018550          159   2e-42    Sorghum bicolor [broomcorn]
gb|ABK26349.1|  unknown                                                 158   3e-42    Picea sitchensis
ref|XP_002448773.1|  hypothetical protein SORBIDRAFT_06g032920          157   3e-42    Sorghum bicolor [broomcorn]
gb|ABK26597.1|  unknown                                                 157   3e-42    Picea sitchensis
ref|XP_004960074.1|  PREDICTED: uncharacterized protein LOC101769159    156   7e-42    
ref|XP_003580823.1|  PREDICTED: protein YLS9-like                       155   1e-41    
ref|XP_008797780.1|  PREDICTED: protein YLS9-like                       154   2e-41    
dbj|BAJ99714.1|  predicted protein                                      155   3e-41    
ref|XP_010942560.1|  PREDICTED: protein YLS9-like                       153   8e-41    
ref|XP_003577187.1|  PREDICTED: uncharacterized protein LOC100833518    151   3e-40    
ref|XP_006841672.1|  hypothetical protein AMTR_s00003p00244400          152   3e-40    
ref|XP_002454018.1|  hypothetical protein SORBIDRAFT_04g023155          150   6e-40    Sorghum bicolor [broomcorn]
ref|XP_006836205.1|  hypothetical protein AMTR_s00101p00083450          148   2e-38    
ref|XP_002460968.1|  hypothetical protein SORBIDRAFT_02g038356          144   4e-38    Sorghum bicolor [broomcorn]
ref|XP_006659297.1|  PREDICTED: protein YLS9-like                       145   1e-37    
ref|XP_003571637.1|  PREDICTED: protein YLS9                            144   4e-37    
ref|XP_002444561.1|  hypothetical protein SORBIDRAFT_07g023796          140   7e-37    Sorghum bicolor [broomcorn]
gb|KDP42899.1|  hypothetical protein JCGZ_23841                         144   8e-37    
ref|NP_001170455.1|  uncharacterized protein LOC100384448               143   9e-37    Zea mays [maize]
tpg|DAA35350.1|  TPA: hypothetical protein ZEAMMB73_623168              142   1e-36    
ref|XP_010038643.1|  PREDICTED: uncharacterized protein LOC104427219    142   1e-36    
ref|NP_001275940.1|  protein NDR1-like                                  142   1e-36    
ref|XP_008366385.1|  PREDICTED: protein NDR1-like                       143   2e-36    
ref|XP_002461441.1|  hypothetical protein SORBIDRAFT_02g002730          140   2e-36    Sorghum bicolor [broomcorn]
ref|XP_006661063.1|  PREDICTED: uncharacterized protein LOC102715330    142   2e-36    
ref|NP_001054263.1|  Os04g0677300                                       142   2e-36    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956347.1|  PREDICTED: uncharacterized protein LOC101756013    140   4e-36    
ref|XP_002462092.1|  hypothetical protein SORBIDRAFT_02g017900          139   7e-36    Sorghum bicolor [broomcorn]
ref|NP_001061545.1|  Os08g0324200                                       140   8e-36    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062721.1|  Os09g0267400                                       139   8e-36    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ06534.1|  hypothetical protein OsI_28780                          140   9e-36    Oryza sativa Indica Group [Indian rice]
ref|XP_008231176.1|  PREDICTED: uncharacterized protein LOC103330379    140   1e-35    
ref|XP_004963560.1|  PREDICTED: uncharacterized protein LOC101778109    141   1e-35    
ref|NP_001136657.1|  uncharacterized protein LOC100216786               137   3e-35    Zea mays [maize]
ref|XP_009606975.1|  PREDICTED: protein YLS9-like                       137   6e-35    
gb|AAS90599.1|  unknown pollen protein                                  137   8e-35    Petunia integrifolia subsp. inflata
ref|XP_007205722.1|  hypothetical protein PRUPE_ppa010043mg             137   1e-34    
gb|EAZ43981.1|  hypothetical protein OsJ_28602                          139   2e-34    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002313615.1|  harpin-induced family protein                      137   3e-34    Populus trichocarpa [western balsam poplar]
ref|XP_003617084.1|  Avr9/Cf-9 rapidly elicited protein                 136   3e-34    
ref|XP_010245322.1|  PREDICTED: protein YLS9-like                       135   4e-34    
ref|XP_010922964.1|  PREDICTED: protein YLS9                            136   5e-34    
ref|XP_009788478.1|  PREDICTED: protein YLS9-like                       136   5e-34    
dbj|BAK05673.1|  predicted protein                                      134   1e-33    
emb|CDP14749.1|  unnamed protein product                                134   1e-33    
ref|XP_004243338.1|  PREDICTED: protein YLS9-like                       133   2e-33    
ref|XP_006371581.1|  hypothetical protein POPTR_0019s13360g             132   3e-33    
ref|XP_003519484.1|  PREDICTED: uncharacterized protein LOC100789647    133   7e-33    
ref|XP_011043555.1|  PREDICTED: protein YLS9-like                       132   1e-32    
ref|XP_002517954.1|  conserved hypothetical protein                     131   1e-32    Ricinus communis
ref|XP_003545485.1|  PREDICTED: uncharacterized protein LOC100800...    132   1e-32    
gb|EAZ08367.1|  hypothetical protein OsI_30624                          134   2e-32    Oryza sativa Indica Group [Indian rice]
ref|XP_007141573.1|  hypothetical protein PHAVU_008G207300g             132   2e-32    
ref|XP_010243135.1|  PREDICTED: protein YLS9-like                       131   3e-32    
ref|XP_009350715.1|  PREDICTED: protein YLS9-like                       131   4e-32    
ref|XP_004491178.1|  PREDICTED: uncharacterized protein LOC101511...    130   6e-32    
ref|XP_006357497.1|  PREDICTED: uncharacterized protein LOC102600286    129   6e-32    
gb|EMT15576.1|  hypothetical protein F775_11436                         129   7e-32    
ref|XP_010521605.1|  PREDICTED: uncharacterized protein LOC104800491    130   7e-32    
ref|XP_009768528.1|  PREDICTED: uncharacterized protein LOC104219533    129   9e-32    
gb|EMS64527.1|  hypothetical protein TRIUR3_33050                       130   1e-31    
ref|XP_010093832.1|  hypothetical protein L484_022546                   128   4e-31    
ref|XP_007016676.1|  Late embryogenesis abundant (LEA) hydroxypro...    128   4e-31    
emb|CDP19130.1|  unnamed protein product                                128   5e-31    
ref|XP_002319911.1|  hypothetical protein POPTR_0013s13940g             127   7e-31    Populus trichocarpa [western balsam poplar]
ref|XP_006470441.1|  PREDICTED: protein YLS9-like                       127   7e-31    
gb|KDP24159.1|  hypothetical protein JCGZ_25816                         126   1e-30    
ref|XP_006446378.1|  hypothetical protein CICLE_v10016351mg             126   2e-30    
ref|XP_008786759.1|  PREDICTED: uncharacterized protein LOC103704991    126   2e-30    
ref|XP_006648662.1|  PREDICTED: uncharacterized protein LOC102720493    125   2e-30    
gb|KDO66384.1|  hypothetical protein CISIN_1g025262mg                   125   3e-30    
ref|XP_010928131.1|  PREDICTED: uncharacterized protein LOC105049989    124   3e-30    
ref|XP_009361555.1|  PREDICTED: protein YLS9-like                       125   5e-30    
ref|XP_010557487.1|  PREDICTED: uncharacterized protein LOC104826475    125   5e-30    
ref|XP_002273485.1|  PREDICTED: protein YLS9                            125   6e-30    Vitis vinifera
ref|XP_010236796.1|  PREDICTED: protein YLS9-like                       123   6e-30    
ref|XP_010904739.1|  PREDICTED: protein YLS9-like                       124   1e-29    
gb|EYU26144.1|  hypothetical protein MIMGU_mgv1a013252mg                123   2e-29    
ref|XP_004246717.1|  PREDICTED: protein YLS9-like                       124   2e-29    
ref|XP_011080512.1|  PREDICTED: uncharacterized protein LOC105163758    122   4e-29    
ref|XP_002440103.1|  hypothetical protein SORBIDRAFT_09g026065          119   7e-29    Sorghum bicolor [broomcorn]
ref|XP_008792445.1|  PREDICTED: protein YLS9                            122   7e-29    
ref|XP_010689677.1|  PREDICTED: uncharacterized protein LOC104903352    121   7e-29    
gb|EMS54995.1|  hypothetical protein TRIUR3_27489                       122   9e-29    
gb|KEH35108.1|  late embryogenesis abundant hydroxyproline-rich g...    122   9e-29    
ref|XP_009341739.1|  PREDICTED: protein YLS9-like                       121   1e-28    
ref|XP_007146082.1|  hypothetical protein PHAVU_006G011100g             120   2e-28    
ref|XP_009628620.1|  PREDICTED: protein YLS9                            121   2e-28    
gb|AFK38883.1|  unknown                                                 120   2e-28    
ref|XP_008359184.1|  PREDICTED: protein NDR1-like                       120   2e-28    
ref|XP_006447341.1|  hypothetical protein CICLE_v10018129mg             120   2e-28    
emb|CDX77067.1|  BnaC04g38620D                                          120   3e-28    
gb|KDO40292.1|  hypothetical protein CISIN_1g045712mg                   120   4e-28    
ref|XP_008230436.1|  PREDICTED: uncharacterized protein LOC103329716    119   4e-28    
ref|XP_011100344.1|  PREDICTED: protein YLS9-like                       119   4e-28    
ref|XP_011045499.1|  PREDICTED: uncharacterized protein LOC105140389    119   5e-28    
gb|EAY85185.1|  hypothetical protein OsI_06544                          121   6e-28    Oryza sativa Indica Group [Indian rice]
ref|XP_009390664.1|  PREDICTED: protein YLS9-like                       119   7e-28    
ref|XP_004228470.1|  PREDICTED: protein YLS9                            119   7e-28    
ref|XP_006408666.1|  hypothetical protein EUTSA_v10002079mg             119   8e-28    
ref|XP_007215860.1|  hypothetical protein PRUPE_ppa010455mg             118   1e-27    
ref|XP_006294822.1|  hypothetical protein CARUB_v10023872mg             118   2e-27    
gb|KFK32426.1|  hypothetical protein AALP_AA6G240400                    118   2e-27    
emb|CDY48196.1|  BnaA04g15600D                                          117   3e-27    
ref|XP_009407590.1|  PREDICTED: uncharacterized protein LOC103990238    117   3e-27    
ref|XP_009140759.1|  PREDICTED: uncharacterized protein LOC103864750    117   3e-27    
ref|XP_011016840.1|  PREDICTED: protein YLS9-like                       116   4e-27    
ref|XP_002879043.1|  hypothetical protein ARALYDRAFT_481588             117   4e-27    
ref|XP_010417852.1|  PREDICTED: uncharacterized protein LOC104703524    117   5e-27    
ref|XP_009779546.1|  PREDICTED: protein YLS9                            117   6e-27    
ref|XP_002879057.1|  predicted protein                                  115   6e-27    
ref|XP_010689396.1|  PREDICTED: uncharacterized protein LOC104903108    117   6e-27    
ref|NP_001275943.1|  uncharacterized protein LOC102589097               117   6e-27    
emb|CDX83252.1|  BnaA03g22540D                                          116   7e-27    
ref|XP_010031644.1|  PREDICTED: protein YLS9                            115   2e-26    
ref|XP_004501974.1|  PREDICTED: uncharacterized protein LOC101512221    115   3e-26    
ref|XP_006384760.1|  harpin-induced family protein                      114   6e-26    
ref|XP_008455332.1|  PREDICTED: uncharacterized protein LOC103495521    113   7e-26    
ref|XP_010510819.1|  PREDICTED: uncharacterized protein LOC104787024    113   1e-25    
ref|XP_009133912.1|  PREDICTED: uncharacterized protein LOC103858334    113   1e-25    
ref|XP_003593474.1|  Avr9/Cf-9 rapidly elicited protein                 112   2e-25    
ref|XP_010473096.1|  PREDICTED: uncharacterized protein LOC104752606    112   4e-25    
ref|NP_565634.1|  late embryogenesis abundant hydroxyproline-rich...    111   6e-25    Arabidopsis thaliana [mouse-ear cress]
gb|EPS64711.1|  hypothetical protein M569_10066                         110   6e-25    
ref|XP_010045133.1|  PREDICTED: protein YLS9                            110   9e-25    
ref|XP_011090235.1|  PREDICTED: protein YLS9                            110   1e-24    
emb|CDY38543.1|  BnaC03g26540D                                          110   2e-24    
ref|XP_002453886.1|  hypothetical protein SORBIDRAFT_04g020620          109   2e-24    Sorghum bicolor [broomcorn]
ref|XP_010657352.1|  PREDICTED: uncharacterized protein LOC104880896    108   2e-24    
ref|NP_197612.1|  late embryogenesis abundant hydroxyproline-rich...    109   3e-24    
ref|XP_010520485.1|  PREDICTED: protein YLS9                            108   5e-24    
ref|XP_010543927.1|  PREDICTED: protein YLS9-like                       107   7e-24    
gb|KGN43603.1|  hypothetical protein Csa_7G047380                       107   8e-24    
gb|EPS62090.1|  hypothetical protein M569_12704                         107   9e-24    
ref|XP_006357558.1|  PREDICTED: uncharacterized protein LOC102592609    106   1e-23    
gb|EAY85996.1|  hypothetical protein OsI_07357                          105   5e-23    
ref|XP_009399795.1|  PREDICTED: uncharacterized protein LOC103984095    104   9e-23    
gb|EYU35997.1|  hypothetical protein MIMGU_mgv1a019041mg                102   1e-21    
ref|NP_001046923.2|  Os02g0507900                                       100   2e-21    
gb|EYU46133.1|  hypothetical protein MIMGU_mgv1a011654mg                101   2e-21    
ref|XP_007219637.1|  hypothetical protein PRUPE_ppa025011mg           97.1    3e-21    
gb|ABK21017.1|  unknown                                                 100   4e-21    
gb|KGN45526.1|  hypothetical protein Csa_7G451320                       100   4e-21    
emb|CDY09101.1|  BnaA02g05270D                                          100   5e-21    
gb|AII99861.1|  late embryogenesis abundant protein                   99.0    9e-21    
ref|XP_009383262.1|  PREDICTED: protein YLS9-like                     99.4    1e-20    
gb|EAZ13909.1|  hypothetical protein OsJ_03834                        98.6    1e-20    
gb|AAV92895.1|  Avr9/Cf-9 rapidly elicited protein 76                 95.9    2e-20    
ref|XP_004970318.1|  PREDICTED: uncharacterized protein LOC101778...  99.0    2e-20    
ref|XP_009600669.1|  PREDICTED: protein YLS9                          98.2    2e-20    
ref|XP_011000802.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  98.2    2e-20    
emb|CAN73939.1|  hypothetical protein VITISV_031601                     102   3e-20    
ref|XP_009785480.1|  PREDICTED: protein YLS9                          97.1    5e-20    
ref|XP_010242024.1|  PREDICTED: uncharacterized protein LOC104586473  97.1    5e-20    
ref|XP_008462352.1|  PREDICTED: protein YLS9                          97.1    5e-20    
ref|NP_001044593.1|  Os01g0812100                                     97.8    5e-20    
gb|ACJ85044.1|  unknown                                               95.1    6e-20    
gb|KFK26363.1|  hypothetical protein AALP_AA8G238900                  96.7    9e-20    
ref|XP_003603154.1|  hypothetical protein MTR_3g104460                96.3    1e-19    
gb|EAY76236.1|  hypothetical protein OsI_04172                        96.7    1e-19    
ref|XP_006385444.1|  hypothetical protein POPTR_0003s04560g           95.9    1e-19    
ref|XP_004141682.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin C...  99.8    2e-19    
ref|XP_004171597.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin C...  99.8    2e-19    
ref|XP_007136830.1|  hypothetical protein PHAVU_009G077900g           95.5    3e-19    
gb|AFK43468.1|  unknown                                               94.7    3e-19    
ref|XP_002871969.1|  hypothetical protein ARALYDRAFT_489023           94.4    6e-19    
ref|XP_010925448.1|  PREDICTED: uncharacterized protein LOC105047981  94.0    6e-19    
ref|XP_009409354.1|  PREDICTED: uncharacterized protein LOC103991581  93.6    6e-19    
ref|XP_009126503.1|  PREDICTED: uncharacterized protein LOC103851400  94.4    6e-19    
ref|XP_010424211.1|  PREDICTED: uncharacterized protein LOC104709267  94.0    7e-19    
gb|ADN34111.1|  chaperonin-60 kDa protein                             97.4    8e-19    
ref|XP_003522249.1|  PREDICTED: protein NDR1-like                     93.2    1e-18    
ref|XP_008449864.1|  PREDICTED: uncharacterized protein LOC103491613  92.8    1e-18    
ref|XP_003526008.1|  PREDICTED: protein NDR1-like                     92.8    1e-18    
emb|CDO97911.1|  unnamed protein product                              92.4    2e-18    
ref|XP_008451090.1|  PREDICTED: protein YLS9-like                     92.8    2e-18    
ref|XP_004144152.1|  PREDICTED: protein NDR1-like                     92.4    2e-18    
ref|XP_009401524.1|  PREDICTED: protein YLS9-like                     92.4    2e-18    
ref|XP_010493233.1|  PREDICTED: uncharacterized protein LOC104770498  92.4    3e-18    
ref|XP_010037307.1|  PREDICTED: protein YLS9-like                     91.3    3e-18    
ref|XP_009126502.1|  PREDICTED: uncharacterized protein LOC103851399  92.4    3e-18    
emb|CDY09100.1|  BnaA02g05260D                                        92.0    5e-18    
ref|XP_010059131.1|  PREDICTED: protein YLS9                          90.1    6e-18    
gb|KGN59198.1|  hypothetical protein Csa_3G779020                     90.1    7e-18    
ref|XP_010558918.1|  PREDICTED: protein YLS9-like                     90.1    8e-18    
gb|KFK36490.1|  hypothetical protein AALP_AA4G131400                  90.1    9e-18    
ref|XP_010654527.1|  PREDICTED: protein NDR1                          90.1    1e-17    
ref|XP_006290054.1|  hypothetical protein CARUB_v10003689mg           90.1    1e-17    
ref|XP_006342981.1|  PREDICTED: uncharacterized protein LOC102587456  90.1    1e-17    
ref|XP_004291724.1|  PREDICTED: uncharacterized protein LOC101301071  89.4    1e-17    
ref|XP_008357935.1|  PREDICTED: uncharacterized protein LOC103421668  88.2    2e-17    
ref|XP_007043548.1|  Late embryogenesis abundant hydroxyproline-r...  88.2    2e-17    
gb|ABK22201.1|  unknown                                               89.0    3e-17    
emb|CBI35953.3|  unnamed protein product                              89.7    3e-17    
emb|CDX79648.1|  BnaC03g19840D                                        87.8    5e-17    
ref|XP_009131838.1|  PREDICTED: uncharacterized protein LOC103856481  88.6    5e-17    
ref|XP_010242226.1|  PREDICTED: protein YLS9-like                     88.2    5e-17    
ref|XP_004487379.1|  PREDICTED: uncharacterized protein LOC101496139  86.3    6e-17    
ref|XP_004168046.1|  PREDICTED: putative syntaxin-24-like             87.4    6e-17    
ref|XP_009396768.1|  PREDICTED: protein NDR1-like                     87.0    6e-17    
ref|XP_008392357.1|  PREDICTED: protein YLS9-like                     87.0    7e-17    
ref|XP_004149664.1|  PREDICTED: uncharacterized protein LOC101202799  87.8    7e-17    
ref|XP_010516805.1|  PREDICTED: protein YLS9                          87.0    9e-17    
ref|XP_004235596.1|  PREDICTED: protein YLS9                          87.4    1e-16    
ref|XP_004303498.1|  PREDICTED: putative syntaxin-24-like             87.0    1e-16    
emb|CDP06857.1|  unnamed protein product                              87.4    1e-16    
gb|KEH35109.1|  late embryogenesis abundant protein                   85.1    1e-16    
ref|XP_006294947.1|  hypothetical protein CARUB_v10024001mg           87.0    1e-16    
ref|XP_010509528.1|  PREDICTED: protein YLS9-like                     86.7    1e-16    
ref|NP_181142.1|  protein NDR1/HIN1-like 10                           86.7    1e-16    
ref|XP_006400683.1|  hypothetical protein EUTSA_v10015699mg           87.8    1e-16    
gb|EEC72818.1|  hypothetical protein OsI_06529                        88.2    1e-16    
ref|XP_004303499.1|  PREDICTED: putative syntaxin-24-like             86.7    1e-16    
ref|XP_011012902.1|  PREDICTED: uncharacterized protein LOC105117058  87.0    1e-16    
ref|XP_002879585.1|  yellow-leaf-specific gene 9                      86.7    1e-16    
ref|XP_010505123.1|  PREDICTED: protein YLS9-like                     85.9    2e-16    
dbj|BAD11071.1|  hin1 like protein                                    85.5    3e-16    
ref|XP_010464907.1|  PREDICTED: protein YLS9-like                     85.9    3e-16    
ref|XP_006369295.1|  hypothetical protein POPTR_0001s20790g           85.9    3e-16    
ref|XP_009341064.1|  PREDICTED: protein YLS9-like                     85.9    3e-16    
ref|XP_010646788.1|  PREDICTED: uncharacterized protein LOC104878321  85.9    3e-16    
ref|XP_009366755.1|  PREDICTED: protein YLS9-like                     85.1    3e-16    
ref|XP_007203168.1|  hypothetical protein PRUPE_ppa025058mg           85.1    3e-16    
gb|KHN02175.1|  Putative syntaxin-24                                  85.1    3e-16    
ref|XP_006644886.1|  PREDICTED: uncharacterized protein LOC102721597  86.7    3e-16    
ref|XP_010924999.1|  PREDICTED: LOW QUALITY PROTEIN: protein YLS9     85.9    3e-16    
dbj|BAK05887.1|  predicted protein                                    85.9    4e-16    
ref|XP_004165481.1|  PREDICTED: uncharacterized protein LOC101223891  85.1    4e-16    
ref|XP_003564453.1|  PREDICTED: protein YLS9-like                     86.3    4e-16    
gb|ABR17004.1|  unknown                                               85.5    4e-16    
ref|XP_008243457.1|  PREDICTED: protein YLS9                          85.1    5e-16    
ref|XP_006299547.1|  hypothetical protein CARUB_v10015721mg           85.1    5e-16    
ref|XP_007149868.1|  hypothetical protein PHAVU_005G105400g           85.1    5e-16    
ref|XP_006339160.1|  PREDICTED: putative syntaxin-24-like             84.7    5e-16    
gb|EYU21371.1|  hypothetical protein MIMGU_mgv1a012005mg              85.5    5e-16    
emb|CDX88825.1|  BnaA03g08240D                                        85.9    6e-16    
emb|CDY13357.1|  BnaC06g14000D                                        81.3    6e-16    
ref|NP_001065651.2|  Os11g0130400                                     85.1    6e-16    
gb|KFK38531.1|  hypothetical protein AALP_AA3G126100                  84.7    7e-16    
ref|XP_008391331.1|  PREDICTED: protein YLS9                          84.7    8e-16    
ref|XP_008228291.1|  PREDICTED: uncharacterized protein LOC103327702  83.6    8e-16    
ref|XP_007027942.1|  Late embryogenesis abundant (LEA) hydroxypro...  84.3    9e-16    
gb|KEH35110.1|  late embryogenesis abundant protein                   84.0    9e-16    
ref|XP_011016843.1|  PREDICTED: protein YLS9-like                     84.0    9e-16    
ref|XP_004303500.1|  PREDICTED: putative syntaxin-24-like             84.0    1e-15    
ref|XP_001784866.1|  predicted protein                                84.7    1e-15    
ref|XP_003545799.1|  PREDICTED: uncharacterized protein At1g08160     83.6    1e-15    
dbj|BAK01664.1|  predicted protein                                    84.7    1e-15    
ref|XP_006854680.1|  hypothetical protein AMTR_s00030p00215650        84.0    1e-15    
ref|XP_004292794.1|  PREDICTED: uncharacterized protein LOC101307667  84.3    1e-15    
ref|XP_008241416.1|  PREDICTED: protein YLS9-like                     83.2    1e-15    
gb|ABK23490.1|  unknown                                               83.2    2e-15    
ref|XP_002456518.1|  hypothetical protein SORBIDRAFT_03g037700        84.3    2e-15    
gb|EYU18129.1|  hypothetical protein MIMGU_mgv1a012715mg              83.6    2e-15    
gb|AAF88022.1|AF264698_1  NDR1/HIN1-Like protein 2                    83.6    2e-15    
ref|XP_010248447.1|  PREDICTED: uncharacterized protein LOC104591349  83.6    2e-15    
ref|XP_010039105.1|  PREDICTED: protein YLS9-like                     82.8    2e-15    
ref|XP_007202513.1|  hypothetical protein PRUPE_ppa010862mg           83.2    2e-15    
ref|XP_008807076.1|  PREDICTED: uncharacterized protein At1g08160...  82.4    2e-15    
ref|XP_004141425.1|  PREDICTED: uncharacterized protein LOC101215036  83.6    2e-15    
ref|XP_002322795.2|  syringolide-induced protein B13-1-9              82.8    2e-15    
ref|XP_009408859.1|  PREDICTED: uncharacterized protein LOC103991221  83.2    2e-15    
ref|XP_008369765.1|  PREDICTED: protein YLS9-like                     82.4    2e-15    
ref|XP_006407426.1|  hypothetical protein EUTSA_v10021416mg           83.2    3e-15    
ref|XP_004159232.1|  PREDICTED: putative syntaxin-24-like             82.8    3e-15    
ref|XP_008339474.1|  PREDICTED: protein YLS9-like                     82.8    3e-15    
ref|XP_008452726.1|  PREDICTED: protein YLS9                          82.8    4e-15    
ref|XP_008241417.1|  PREDICTED: protein YLS9-like                     82.0    4e-15    
ref|XP_010102585.1|  hypothetical protein L484_003960                 82.8    4e-15    
ref|XP_007202865.1|  hypothetical protein PRUPE_ppa015573mg           81.6    4e-15    
gb|KHN33629.1|  Hypothetical protein glysoja_005671                   81.3    5e-15    
ref|XP_010040816.1|  PREDICTED: protein YLS9-like                     81.6    5e-15    
ref|XP_008447609.1|  PREDICTED: protein YLS9-like                     82.0    6e-15    
ref|XP_007215896.1|  hypothetical protein PRUPE_ppa010684mg           82.0    6e-15    
ref|NP_001274967.1|  hin1-like protein                                81.6    6e-15    
ref|XP_010456417.1|  PREDICTED: protein YLS9-like                     81.3    6e-15    
ref|XP_001783833.1|  predicted protein                                81.3    7e-15    
tpg|DAA57165.1|  TPA: NHL25                                           82.8    7e-15    
ref|XP_004136508.1|  PREDICTED: putative syntaxin-24-like             81.3    8e-15    
ref|XP_006430081.1|  hypothetical protein CICLE_v10012678mg           81.3    8e-15    
ref|NP_566395.1|  NDR1/HIN1-Like protein 2                            81.6    9e-15    
ref|XP_010037311.1|  PREDICTED: protein YLS9-like                     81.3    9e-15    
gb|AAF62403.1|AF212183_1  harpin inducing protein                     81.3    9e-15    
gb|EYU18130.1|  hypothetical protein MIMGU_mgv1a012830mg              81.3    1e-14    
ref|XP_006339161.1|  PREDICTED: putative syntaxin-24-like             81.3    1e-14    
ref|XP_010037308.1|  PREDICTED: protein YLS9-like                     81.3    1e-14    
gb|KCW90470.1|  hypothetical protein EUGRSUZ_A02597                   80.5    1e-14    
ref|XP_009374728.1|  PREDICTED: protein YLS9-like                     80.1    1e-14    
ref|XP_010037309.1|  PREDICTED: protein YLS9-like                     80.9    1e-14    
dbj|BAE94402.1|  Hairpin-induced family protein                       80.5    1e-14    
gb|KFK25034.1|  hypothetical protein AALP_AA8G058100                  81.3    1e-14    
ref|XP_008462616.1|  PREDICTED: protein YLS9-like                     81.3    1e-14    
ref|XP_002308441.2|  syringolide-induced protein B13-1-9              80.9    1e-14    
ref|XP_010491191.1|  PREDICTED: protein YLS9-like                     80.1    2e-14    
ref|XP_010509614.1|  PREDICTED: protein YLS9-like                     80.5    2e-14    
emb|CDM83234.1|  unnamed protein product                              81.3    2e-14    
dbj|BAD22534.1|  harpin inducing protein 1-like 18                    80.1    2e-14    
ref|XP_006340415.1|  PREDICTED: uncharacterized protein LOC102583250  80.5    2e-14    
ref|XP_010423353.1|  PREDICTED: protein YLS9-like                     79.7    3e-14    
gb|KFK36451.1|  hypothetical protein AALP_AA4G126100                  81.6    3e-14    
ref|XP_011080120.1|  PREDICTED: uncharacterized protein LOC105163464  80.1    3e-14    
ref|XP_011072521.1|  PREDICTED: protein YLS9                          80.1    3e-14    
ref|XP_003574440.1|  PREDICTED: uncharacterized protein LOC100828817  80.1    4e-14    
ref|XP_009410785.1|  PREDICTED: uncharacterized protein LOC103992701  80.1    4e-14    
ref|XP_004146821.1|  PREDICTED: uncharacterized protein LOC101205214  79.7    4e-14    
ref|XP_010497776.1|  PREDICTED: protein YLS9-like                     79.7    4e-14    
ref|XP_006595450.1|  PREDICTED: protein YLS9-like                     79.3    4e-14    
tpg|DAA57166.1|  TPA: NHL25, mRNA                                     81.6    5e-14    
ref|XP_002884855.1|  hypothetical protein ARALYDRAFT_478510           79.3    5e-14    
ref|NP_181089.1|  late embryogenesis abundant hydroxyproline-rich...  79.3    5e-14    
ref|NP_001066053.1|  Os12g0127200                                     79.7    6e-14    
ref|XP_010505052.1|  PREDICTED: protein YLS9-like                     79.3    6e-14    
ref|XP_002532540.1|  syntaxin, plant, putative                        79.0    6e-14    
ref|XP_006854681.1|  hypothetical protein AMTR_s00030p00216100        79.0    6e-14    
ref|XP_006481584.1|  PREDICTED: protein YLS9-like                     79.0    6e-14    
dbj|BAJ94013.1|  predicted protein                                    78.6    6e-14    
dbj|BAD22533.1|  harpin inducing protein 1-like 9                     79.0    6e-14    
gb|AAU21296.1|  HIN1-like protein                                     78.6    7e-14    
emb|CDX70963.1|  BnaC03g10470D                                        79.7    8e-14    
ref|XP_010246801.1|  PREDICTED: protein YLS9-like                     78.2    9e-14    
ref|XP_001761890.1|  predicted protein                                78.2    1e-13    
ref|XP_004249411.1|  PREDICTED: protein YLS9-like                     78.2    1e-13    
ref|XP_011046869.1|  PREDICTED: protein YLS9-like                     78.2    1e-13    
ref|XP_002862710.1|  hypothetical protein ARALYDRAFT_497322           78.6    1e-13    
ref|XP_004297588.1|  PREDICTED: protein NDR1-like                     78.6    1e-13    
gb|EMT25990.1|  hypothetical protein F775_06853                       79.0    1e-13    
ref|XP_006410703.1|  hypothetical protein EUTSA_v10017735mg           78.2    1e-13    
ref|XP_009599460.1|  PREDICTED: protein YLS9-like                     78.2    1e-13    
ref|XP_008377685.1|  PREDICTED: uncharacterized protein LOC103440764  78.6    1e-13    
emb|CDP10611.1|  unnamed protein product                              77.8    1e-13    
gb|KHN36622.1|  hypothetical protein glysoja_001353                   79.0    2e-13    
gb|EMS52142.1|  hypothetical protein TRIUR3_06942                     77.4    2e-13    
gb|KEH39103.1|  late embryogenesis abundant protein                   77.4    2e-13    
ref|XP_008442908.1|  PREDICTED: protein YLS9                          77.4    2e-13    
ref|XP_004485684.1|  PREDICTED: uncharacterized protein At1g08160...  77.0    2e-13    
ref|XP_004501469.1|  PREDICTED: uncharacterized protein LOC101512541  77.8    2e-13    
ref|XP_008442907.1|  PREDICTED: protein YLS9-like                     77.0    2e-13    
ref|XP_004504122.1|  PREDICTED: uncharacterized protein LOC101495472  77.8    3e-13    
ref|NP_001147210.1|  NHL25                                            78.2    3e-13    
ref|XP_008393637.1|  PREDICTED: uncharacterized protein LOC103455821  77.4    3e-13    
ref|XP_010915257.1|  PREDICTED: uncharacterized protein LOC105040437  77.4    3e-13    
ref|XP_004960000.1|  PREDICTED: uncharacterized protein LOC101775764  76.6    3e-13    
ref|XP_010262977.1|  PREDICTED: protein YLS9-like                     77.4    3e-13    
ref|XP_010454436.1|  PREDICTED: uncharacterized protein LOC104736193  77.8    3e-13    
ref|XP_008350192.1|  PREDICTED: protein YLS9-like                     76.6    3e-13    
gb|ADE76149.1|  unknown                                               76.6    3e-13    
ref|XP_007148273.1|  hypothetical protein PHAVU_006G194400g           76.3    3e-13    
ref|XP_011098105.1|  PREDICTED: uncharacterized protein LOC105176839  77.0    4e-13    
ref|XP_006826736.1|  hypothetical protein AMTR_s00136p00047510        76.6    4e-13    
ref|XP_007159643.1|  hypothetical protein PHAVU_002G255000g           76.6    5e-13    



>ref|XP_007161568.1| hypothetical protein PHAVU_001G080500g [Phaseolus vulgaris]
 gb|ESW33562.1| hypothetical protein PHAVU_001G080500g [Phaseolus vulgaris]
Length=249

 Score =   309 bits (791),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 202/249 (81%), Gaps = 10/249 (4%)
 Frame = +1

Query  112  MSEHQRIRIHpev-eapppptrplvprGSFRSEKGDP--------STQAWQPQKSKRSCC  264
            M++HQR+RIHP   EAPPPPT PLVP GS RSEKG P        S  A   +  KRSC 
Sbjct  1    MADHQRLRIHPMEGEAPPPPTTPLVPPGSSRSEKGIPLHHPPLLRSVPAVYSKPRKRSCF  60

Query  265  CKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFN  444
            CKCM WT+S+ V+L +I+AA  GILYL+F+PK+P YSVD LRISDLR+N  D+SLYAKF+
Sbjct  61   CKCMCWTISLFVLLLVILAATIGILYLVFKPKLPDYSVDTLRISDLRLN-FDMSLYAKFD  119

Query  445  VKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYG  624
            VKITA NPNKKIGIYYE+G ++SVWY  T+LC+GSLP+ YQGHQN TVL V+LSGQ Q G
Sbjct  120  VKITANNPNKKIGIYYEKGGKISVWYTNTRLCEGSLPQFYQGHQNKTVLNVSLSGQVQSG  179

Query  625  NTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIK  804
            +TL++ALQ+ QQTGR+PLDLK+  P+ IK+GRLKLMKV +LG+C+L+V+SLS+N+LISIK
Sbjct  180  STLMTALQQQQQTGRIPLDLKVHAPIAIKLGRLKLMKVKVLGECLLVVDSLSSNNLISIK  239

Query  805  ASTCKFKLK  831
            AS CKF++K
Sbjct  240  ASNCKFRMK  248



>ref|XP_009613332.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
Length=255

 Score =   302 bits (773),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 188/230 (82%), Gaps = 17/230 (7%)
 Frame = +1

Query  190  GSFRSEKGDPS-------TQAW---------QPQKSKRSCCCKCMWWTVSVIVVLFIIIA  321
            GSF+SEKGD S        Q +         +P   KRSC CKC+ WT+S+I++L IIIA
Sbjct  26   GSFKSEKGDTSQLQQPIINQPFTRTVPVMYPRPHNKKRSCFCKCICWTISLIILLLIIIA  85

Query  322  ACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERG  501
               GILYL+F+PKIP+YSVDNLRISDLR+N  D+SLYA+FNV+ITA NPNKKIGIYYE+G
Sbjct  86   TIGGILYLVFKPKIPQYSVDNLRISDLRLN-FDMSLYARFNVRITAVNPNKKIGIYYEKG  144

Query  502  SRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLD  681
            SRLSVWYK T+LC+GS+P+ YQGHQN TVL+VAL+GQSQYGNTL+SA+QEA QTGR+PLD
Sbjct  145  SRLSVWYKNTQLCEGSIPKFYQGHQNRTVLDVALTGQSQYGNTLMSAIQEAAQTGRIPLD  204

Query  682  LKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            LKI +PV +K+G+LKL KV ILGDC+LIV+SLS NSL+ IKASTCKF LK
Sbjct  205  LKIKVPVSVKLGKLKLRKVKILGDCLLIVDSLSANSLVRIKASTCKFGLK  254



>ref|XP_010086788.1| hypothetical protein L484_006211 [Morus notabilis]
 ref|XP_010086792.1| hypothetical protein L484_006215 [Morus notabilis]
 gb|EXB23628.1| hypothetical protein L484_006211 [Morus notabilis]
 gb|EXB23632.1| hypothetical protein L484_006215 [Morus notabilis]
Length=250

 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/250 (62%), Positives = 195/250 (78%), Gaps = 11/250 (4%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGD-----PSTQAWQPQ-----KSKRSC  261
            M++HQR RIHP  +    PT PLVPRG+  S+KG      P  Q   P         RSC
Sbjct  1    MADHQRQRIHPAADVVALPTTPLVPRGTSPSDKGIRIQHLPPLQRAMPAIRATPTKNRSC  60

Query  262  CCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKF  441
            CCKC+ WT+S+IV+L I IAA AGILYL+F+PK+P YS+DNLRISDLR+N  D++LYAKF
Sbjct  61   CCKCVCWTISLIVLLLIAIAATAGILYLVFKPKLPNYSIDNLRISDLRLN-FDMTLYAKF  119

Query  442  NVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQY  621
            +V  TA NPNKKIGIYY++G +LSVWY  TKLC+GSLP  YQGHQN T+L VAL+GQSQ+
Sbjct  120  DVIFTANNPNKKIGIYYKKGGKLSVWYTKTKLCEGSLPVFYQGHQNKTMLNVALTGQSQH  179

Query  622  GNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISI  801
            GNTL++ALQE QQ GR+PLDLK+  P+ I++G+L+L KV +LG+C+L+V+SLSTN+LISI
Sbjct  180  GNTLMTALQEQQQMGRIPLDLKVHAPMAIRLGKLQLRKVKVLGECLLVVDSLSTNNLISI  239

Query  802  KASTCKFKLK  831
            KAS CKF+LK
Sbjct  240  KASNCKFRLK  249



>emb|CDP19803.1| unnamed protein product [Coffea canephora]
Length=251

 Score =   301 bits (772),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 185/226 (82%), Gaps = 14/226 (6%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAWQPQ------------KSKRSCCCKCMWWTVSVIVVLFIIIAACAG  333
            GS RSEKGDP+    QPQ               +SCCCK + WT+S+I++L II+ A A 
Sbjct  27   GSVRSEKGDPAI-LHQPQIQENIPLMHSKPPKNKSCCCKFLCWTISLILILLIILGATAA  85

Query  334  ILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLS  513
            ILY++FQPKIP+YSVDNLRISDLR+N  DLSLYAKFN++ITA NPNKKIGIYYE+GS LS
Sbjct  86   ILYVVFQPKIPQYSVDNLRISDLRLN-FDLSLYAKFNLRITADNPNKKIGIYYEKGSHLS  144

Query  514  VWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKID  693
            VWYK+T LCQG+LP+ YQGHQN TVL VAL+GQ+QYG+TLL+ALQE  QTGR+PLDLKID
Sbjct  145  VWYKSTDLCQGTLPKFYQGHQNKTVLNVALTGQAQYGSTLLAALQEEAQTGRIPLDLKID  204

Query  694  MPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            +PV IK+G+LK+ KV +LG CMLIV+SLSTNSLISIKA TCKF+LK
Sbjct  205  VPVSIKLGKLKMRKVRVLGSCMLIVDSLSTNSLISIKARTCKFRLK  250



>ref|XP_011046093.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=262

 Score =   301 bits (771),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/229 (66%), Positives = 179/229 (78%), Gaps = 16/229 (7%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAWQP-----------QKSK----RSCCCKCMWWTVSVIVVLFIIIAA  324
            G  RSEKG  S +  QP           Q SK    RSCCCKC+ WTV ++V+L  I+ A
Sbjct  34   GLARSEKGGSSQRQQQPPLPLRTMPAAMQSSKPQKTRSCCCKCVCWTVGLLVLLLAIVGA  93

Query  325  CAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGS  504
             AGILYL+F+PKIP YSVD+L ISDLR+N  D+SLYAKF+VKITA NPNKKIGIYYE+G 
Sbjct  94   TAGILYLVFKPKIPNYSVDSLSISDLRLN-FDMSLYAKFDVKITANNPNKKIGIYYEKGG  152

Query  505  RLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDL  684
             LSVWY  TKLC+GS+P  YQGHQN T L+V+L+GQ+QYG+TLL ALQE QQTGR+PLDL
Sbjct  153  LLSVWYTNTKLCEGSIPRFYQGHQNITKLDVSLTGQAQYGSTLLRALQEQQQTGRIPLDL  212

Query  685  KIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            K+D PV IK+GRLKL KV I GDC+L+V+SLSTN+LISIKAS CKFKLK
Sbjct  213  KVDAPVSIKLGRLKLRKVTIWGDCLLVVDSLSTNNLISIKASNCKFKLK  261



>gb|KDP45825.1| hypothetical protein JCGZ_17432 [Jatropha curcas]
Length=267

 Score =   299 bits (765),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 173/205 (84%), Gaps = 1/205 (0%)
 Frame = +1

Query  217  PSTQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRIS  396
            P+T   +PQK+++SCCCKC+ WT+ +I  + I+I A AGILYLIFQPKIPKYSV +LRIS
Sbjct  63   PATIYPEPQKTRKSCCCKCICWTIGIIFFVLILIGAIAGILYLIFQPKIPKYSVYSLRIS  122

Query  397  DLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQ  576
            DLR+N  D SLYAKF+VKITA NPNKKIGIYYE+G  LSVWY  T+LC GS+P+ YQGH+
Sbjct  123  DLRLN-FDASLYAKFDVKITANNPNKKIGIYYEKGGHLSVWYGETRLCAGSIPKFYQGHR  181

Query  577  NTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDC  756
            N T L+V+LSGQ+QYG+TL+ ALQE QQTG++PLDLK+D PV +K GRLKL KV ILGDC
Sbjct  182  NVTKLDVSLSGQTQYGSTLMQALQEQQQTGQIPLDLKVDAPVAVKFGRLKLRKVRILGDC  241

Query  757  MLIVNSLSTNSLISIKASTCKFKLK  831
             L+V+SL+TN++ISIKAS CKF+LK
Sbjct  242  NLVVDSLTTNNIISIKASNCKFRLK  266



>ref|XP_009792297.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
Length=262

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 189/229 (83%), Gaps = 17/229 (7%)
 Frame = +1

Query  193  SFRSEKGDPS-------TQAW---------QPQKSKRSCCCKCMWWTVSVIVVLFIIIAA  324
            SF+SEKGDPS        Q +         +P   KRSC CKC+ WT+S+I++L IIIAA
Sbjct  34   SFKSEKGDPSQLQQPITNQPFTRTVPVMYPRPHNKKRSCFCKCICWTISLIILLLIIIAA  93

Query  325  CAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGS  504
              GILYL+F+PKIP+YSVDNLRISDLR+N  D+SLYA+FNV+ITA NPNKKIGIYYE+GS
Sbjct  94   IGGILYLVFKPKIPQYSVDNLRISDLRLN-FDMSLYARFNVRITAVNPNKKIGIYYEKGS  152

Query  505  RLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDL  684
            RLSVWYK T+LCQGS+P+ YQGHQN TVL+VAL+GQSQYGNTL+SA+QEA QTGR+PLDL
Sbjct  153  RLSVWYKNTQLCQGSIPKFYQGHQNKTVLDVALTGQSQYGNTLMSAIQEAAQTGRIPLDL  212

Query  685  KIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            KI +PV +K+G+LKL KV ILGDC+LIV+SLS NSL+ IKASTCKF LK
Sbjct  213  KIKVPVSVKLGKLKLRKVKILGDCLLIVDSLSANSLVRIKASTCKFGLK  261



>ref|XP_004234340.1| PREDICTED: protein YLS9 [Solanum lycopersicum]
Length=259

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 172/259 (66%), Positives = 205/259 (79%), Gaps = 20/259 (8%)
 Frame = +1

Query  112  MSEHQRIR--IHpeveapppptrplvprGSFRSEKGDPSTQAWQPQ--------------  243
            M+E+QRI   +  E   P   TRPLVPRGSF+SEKGDP+    QP               
Sbjct  1    MTENQRIHPVVDMEAPPPTRTTRPLVPRGSFKSEKGDPTRLFQQPTVNQPVRRTTPVMYS  60

Query  244  ---KSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNP  414
                 KRSC CKC+ WT+S+I++L IIIAA AGILYL+F+PKIP+YSVDNLRISDLR+N 
Sbjct  61   RPPTKKRSCICKCICWTISLIILLLIIIAAIAGILYLVFKPKIPQYSVDNLRISDLRLN-  119

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
             D+SLYA+FNV+ITA NPNKKIGIYYE+GS LSVWYK T+LC+GSLP+ YQGHQN TVL+
Sbjct  120  FDMSLYARFNVRITAVNPNKKIGIYYEKGSHLSVWYKNTQLCKGSLPKFYQGHQNRTVLD  179

Query  595  VALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNS  774
            VAL+GQS+YGNTL+SA+QEA QTGR+PLDLKI +PV +K+GRLKL KV ILGDC+LIV+S
Sbjct  180  VALTGQSEYGNTLMSAIQEAAQTGRIPLDLKIQVPVSVKLGRLKLRKVKILGDCLLIVDS  239

Query  775  LSTNSLISIKASTCKFKLK  831
            LS NSL+ IKASTCKF LK
Sbjct  240  LSANSLVRIKASTCKFGLK  258



>ref|XP_006351537.1| PREDICTED: uncharacterized protein LOC102578226 [Solanum tuberosum]
Length=258

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/258 (67%), Positives = 208/258 (81%), Gaps = 19/258 (7%)
 Frame = +1

Query  112  MSEHQRIR--IHpeveapppptrplvprGSFRSEKGDPS-------TQAWQ---------  237
            M+E+QRI   +  E   P   TRPLVPRGSF+SEKGDP+        Q ++         
Sbjct  1    MTENQRIHPVVDMEAPPPTRTTRPLVPRGSFKSEKGDPTRLQQPTVNQPFRRTVPVMYSR  60

Query  238  PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPL  417
            P   KRSC CKC+ WT+S+I++L IIIAA AGILYL+F+PKIP+YSVDNLRISDLR+N  
Sbjct  61   PPTKKRSCFCKCICWTISLIILLLIIIAAIAGILYLVFKPKIPQYSVDNLRISDLRLN-F  119

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
            D+SLYA+FNV+ITA NPNKKIGIYYE+GS LSVWYK T+LC+GSLP+ YQGHQN TVL+V
Sbjct  120  DMSLYARFNVRITAVNPNKKIGIYYEKGSHLSVWYKNTQLCKGSLPKFYQGHQNRTVLDV  179

Query  598  ALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            AL+GQSQYGNTL+SA+QEA QTGR+PLDLKI +PV +K+G+LKL KV ILGDC+LIV+SL
Sbjct  180  ALTGQSQYGNTLMSAIQEAAQTGRIPLDLKIQVPVSVKLGKLKLRKVKILGDCLLIVDSL  239

Query  778  STNSLISIKASTCKFKLK  831
            STNSL+ IK+STCKF LK
Sbjct  240  STNSLVRIKSSTCKFGLK  257



>ref|XP_008240413.1| PREDICTED: uncharacterized protein LOC103338918 [Prunus mume]
Length=285

 Score =   290 bits (743),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 173/201 (86%), Gaps = 5/201 (2%)
 Frame = +1

Query  241  QKSKRSCCC----KCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRV  408
            ++S  +C C    +CM+ T+ ++V +FIII A AGILYLIFQPK+P YSVD+L+ISDLR+
Sbjct  85   KRSTSTCSCTCWSRCMYCTIGILVFVFIIIGATAGILYLIFQPKLPNYSVDSLKISDLRL  144

Query  409  NPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTV  588
            N LD++LYAKF+VKITA NPNKKIGI+YE+G RLSVWY  TKLCQG+LP+ YQGHQN T+
Sbjct  145  N-LDMTLYAKFDVKITANNPNKKIGIHYEQGGRLSVWYTNTKLCQGTLPKFYQGHQNKTL  203

Query  589  LEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIV  768
            L VAL+GQ+QYGNTL++ALQ+ QQTGR+PLDLK+D PV I++GRLKLMKV ILG+C+L+V
Sbjct  204  LNVALTGQTQYGNTLMNALQQQQQTGRIPLDLKVDAPVAIQLGRLKLMKVWILGECLLVV  263

Query  769  NSLSTNSLISIKASTCKFKLK  831
            +SL+ N+LISIKA+ C F+LK
Sbjct  264  DSLTANNLISIKANNCSFRLK  284



>ref|XP_006372637.1| hypothetical protein POPTR_0017s03470g [Populus trichocarpa]
 gb|ERP50434.1| hypothetical protein POPTR_0017s03470g [Populus trichocarpa]
Length=255

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 183/222 (82%), Gaps = 10/222 (5%)
 Frame = +1

Query  190  GSFRSEKGDP--------STQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYL  345
            GS +S++  P        + Q+ +PQK+ RSCCCKC+ WTV ++V+L +I+ A AGILYL
Sbjct  35   GSSQSQQQPPLPLRTMPAAMQSSKPQKT-RSCCCKCVCWTVGLLVLLLVIVGATAGILYL  93

Query  346  IFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYK  525
            +F+PKIP YSVD+L ISDLR+N  D+SLYAKF+VKITA NPNKKIGIYYE+G  LSVWY 
Sbjct  94   VFKPKIPNYSVDSLSISDLRLN-FDMSLYAKFDVKITANNPNKKIGIYYEKGGLLSVWYT  152

Query  526  TTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVR  705
             TKLC GS+P+ YQGHQN T L+V+L+GQ+QYG+TLL ALQE QQTGR+PLDLK+D PV 
Sbjct  153  NTKLCAGSIPKFYQGHQNITKLDVSLTGQTQYGSTLLRALQEQQQTGRIPLDLKVDAPVS  212

Query  706  IKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            IK+GRLKL KV ILGDC+L+V+SLSTN+LISIKAS C+FKLK
Sbjct  213  IKLGRLKLRKVTILGDCLLVVDSLSTNNLISIKASNCRFKLK  254



>ref|XP_002519591.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42802.1| conserved hypothetical protein [Ricinus communis]
Length=267

 Score =   289 bits (739),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 166/193 (86%), Gaps = 1/193 (1%)
 Frame = +1

Query  253  RSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLY  432
            RSC CKC+ WT+ +I+ L +II A AGILYLIFQPKIPKYSVD+LRISDLR+N  D++LY
Sbjct  75   RSCFCKCICWTICLILFLLVIIGAIAGILYLIFQPKIPKYSVDSLRISDLRLN-FDMTLY  133

Query  433  AKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQ  612
            AKFNVKITA NPNKKIGIYY++G +LSVWY  T LC GS+P  YQGH+NTT L+V+LSGQ
Sbjct  134  AKFNVKITANNPNKKIGIYYDKGGQLSVWYIDTMLCAGSIPTFYQGHRNTTKLDVSLSGQ  193

Query  613  SQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSL  792
            SQYG+TL++ALQE QQTG +PLDLK+  PV +K+GRLKL KV ILGDC+L+V+SL+TN+L
Sbjct  194  SQYGSTLMTALQEQQQTGSIPLDLKVSAPVAVKLGRLKLRKVRILGDCLLVVDSLTTNNL  253

Query  793  ISIKASTCKFKLK  831
            +SIK S CKF+LK
Sbjct  254  LSIKTSNCKFRLK  266



>emb|CBI26408.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   283 bits (724),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 156/251 (62%), Positives = 199/251 (79%), Gaps = 14/251 (6%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQP-----------QKSKRS  258
            M++HQ+I  HP V+   PPT PLVPRGSFRSEKGDP      P           +  KRS
Sbjct  1    MADHQKI--HPVVDPEAPPTEPLVPRGSFRSEKGDPFQHPPDPPLQRTIPVIHSKPPKRS  58

Query  259  CCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAK  438
            CCCKCM WT+S++V+L +I+ A AG+LYL+FQPK+PKYSVD+LRI+D ++N  D++LYAK
Sbjct  59   CCCKCMCWTISLLVLLLVIVGAIAGVLYLVFQPKLPKYSVDSLRITDFQLN-YDMTLYAK  117

Query  439  FNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQ  618
            F++KI A NPNKKIGIYYE+G +LSVWY  TKLC GSLP+ YQGHQNTTVL V L+GQ+Q
Sbjct  118  FDMKIKANNPNKKIGIYYEKGGKLSVWYTNTKLCHGSLPKFYQGHQNTTVLNVVLTGQTQ  177

Query  619  YGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLIS  798
            YG+TL++ALQE QQ  R+PLDLK+D+PV IK+G+LKL KV  L +C+L+V+SLS N+LIS
Sbjct  178  YGSTLMTALQEQQQKRRIPLDLKVDVPVAIKLGKLKLKKVRFLVECLLVVDSLSANNLIS  237

Query  799  IKASTCKFKLK  831
            I+AS C+F+LK
Sbjct  238  IRASDCRFRLK  248



>ref|XP_007210859.1| hypothetical protein PRUPE_ppa015087mg [Prunus persica]
 gb|EMJ12058.1| hypothetical protein PRUPE_ppa015087mg [Prunus persica]
Length=285

 Score =   285 bits (728),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 171/201 (85%), Gaps = 5/201 (2%)
 Frame = +1

Query  241  QKSKRSCCC----KCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRV  408
            ++S  +C C    +CM+ T+ ++V +FIII A AG+LYLIF PK+P YSVD+L+ISDLR+
Sbjct  85   KRSTSTCSCTCWSRCMYCTIGILVFVFIIIGATAGLLYLIFHPKLPNYSVDSLKISDLRL  144

Query  409  NPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTV  588
            N LD++LYAKF+VKITA NPNKKIGI+YE+G RLSVWY   KLCQG+LP+ YQGHQN T+
Sbjct  145  N-LDMTLYAKFDVKITANNPNKKIGIHYEQGGRLSVWYTNMKLCQGTLPKFYQGHQNKTL  203

Query  589  LEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIV  768
            L VAL+GQ+QYGNTL++ALQ+ QQTGR+PLDLK+D PV I++GRLKL KV ILG+C+L+V
Sbjct  204  LNVALTGQTQYGNTLMNALQQQQQTGRIPLDLKVDAPVAIQLGRLKLRKVRILGECLLVV  263

Query  769  NSLSTNSLISIKASTCKFKLK  831
            +SL+ N+LISIKA+ C+F+LK
Sbjct  264  DSLTANNLISIKANNCRFRLK  284



>ref|XP_011072085.1| PREDICTED: protein YLS9 [Sesamum indicum]
Length=253

 Score =   283 bits (724),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 165/254 (65%), Positives = 196/254 (77%), Gaps = 16/254 (6%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSF-RSEKGDPSTQ-------------AWQPQKS  249
            M++HQRI         PPPTR   P+ S  RSEKGDP                A +P K 
Sbjct  1    MADHQRIHPLVTDVEAPPPTRHPAPQASLVRSEKGDPGQHQVPLGHAVAAMPPALKPPK-  59

Query  250  KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL  429
            +R+C CKC+ WT+S+++VL II+ A AGILYL+FQPK+PKYSVDNLRISDL +N  DLSL
Sbjct  60   RRNCWCKCLCWTLSLLIVLLIIVGATAGILYLVFQPKLPKYSVDNLRISDLTLN-FDLSL  118

Query  430  YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSG  609
            YA+FNV+ITA+NPNKKIGIYYE+GS LSVWYK T LCQGS+P  YQGHQN TVL VAL+G
Sbjct  119  YARFNVRITAENPNKKIGIYYEKGSHLSVWYKNTNLCQGSIPRFYQGHQNRTVLNVALTG  178

Query  610  QSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNS  789
            Q+QYG TLL ALQE QQTGR+PLDLKID+PV IK+G+LKL KV ++G CMLIV+SLSTNS
Sbjct  179  QNQYGRTLLEALQEQQQTGRIPLDLKIDVPVSIKLGKLKLKKVRVVGTCMLIVDSLSTNS  238

Query  790  LISIKASTCKFKLK  831
            LI+IKASTC F +K
Sbjct  239  LINIKASTCNFGVK  252



>ref|XP_002263732.2| PREDICTED: protein YLS9 [Vitis vinifera]
Length=288

 Score =   284 bits (727),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 200/257 (78%), Gaps = 14/257 (5%)
 Frame = +1

Query  94   GGAGRNMSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQP-----------  240
             G    M++HQ+I  HP V+   PPT PLVPRGSFRSEKGDP      P           
Sbjct  34   AGIDMLMADHQKI--HPVVDPEAPPTEPLVPRGSFRSEKGDPFQHPPDPPLQRTIPVIHS  91

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +  KRSCCCKCM WT+S++V+L +I+ A AG+LYL+FQPK+PKYSVD+LRI+D ++N  D
Sbjct  92   KPPKRSCCCKCMCWTISLLVLLLVIVGAIAGVLYLVFQPKLPKYSVDSLRITDFQLN-YD  150

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
            ++LYAKF++KI A NPNKKIGIYYE+G +LSVWY  TKLC GSLP+ YQGHQNTTVL V 
Sbjct  151  MTLYAKFDMKIKANNPNKKIGIYYEKGGKLSVWYTNTKLCHGSLPKFYQGHQNTTVLNVV  210

Query  601  LSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLS  780
            L+GQ+QYG+TL++ALQE QQ  R+PLDLK+D+PV IK+G+LKL KV  L +C+L+V+SLS
Sbjct  211  LTGQTQYGSTLMTALQEQQQKRRIPLDLKVDVPVAIKLGKLKLKKVRFLVECLLVVDSLS  270

Query  781  TNSLISIKASTCKFKLK  831
             N+LISI+AS C+F+LK
Sbjct  271  ANNLISIRASDCRFRLK  287



>ref|XP_007029347.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family [Theobroma cacao]
 gb|EOY09849.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family [Theobroma cacao]
Length=248

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 180/223 (81%), Gaps = 12/223 (5%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAWQPQKS----------KRSCCCKCMWWTVSVIVVLFIIIAACAGIL  339
            GS  SEKG P  Q   PQ++          KRSCCCKC+ WT+S+IV+L II+ A  GIL
Sbjct  26   GSATSEKGSP-VQHRLPQRTIPVIHTRPPKKRSCCCKCICWTISLIVLLLIILGATVGIL  84

Query  340  YLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVW  519
            YL F+PK+PKYS+D+LRISDLR+N  D++LYAKF+VKITA NPNKKIGIYYE+G RLSVW
Sbjct  85   YLAFRPKLPKYSIDSLRISDLRLN-FDMTLYAKFDVKITANNPNKKIGIYYEQGGRLSVW  143

Query  520  YKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMP  699
            Y  +KLCQGSLP+ YQGHQN T L+V L+GQ++ G+TL+SALQE QQTG++PLDLK+D P
Sbjct  144  YTNSKLCQGSLPKFYQGHQNITKLDVVLTGQTEAGSTLMSALQEQQQTGQIPLDLKVDAP  203

Query  700  VRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
            V IK+G+LK+ KV ILGDC L+V+SLS N++ISIKAS CKF+L
Sbjct  204  VAIKLGKLKMRKVRILGDCKLVVDSLSANNIISIKASNCKFRL  246



>ref|XP_009356081.1| PREDICTED: protein YLS9 [Pyrus x bretschneideri]
Length=279

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = +1

Query  214  DPSTQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRI  393
            +P  QA  P+K     CC+CMWWT+ +++++ III A AGILYLIF PK+P YSVD+L+I
Sbjct  74   NPVIQANPPKKRSSCTCCRCMWWTMGILLLVLIIIGATAGILYLIFHPKLPNYSVDSLKI  133

Query  394  SDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGH  573
            SDL +N LD++LYAKF+VKITA NPNKKIGIYYE+G RLSVWY  T+LCQG LP+ YQGH
Sbjct  134  SDLTLN-LDMTLYAKFDVKITANNPNKKIGIYYEKGGRLSVWYTNTRLCQGMLPKFYQGH  192

Query  574  QNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGD  753
            QN T+L V L+GQ+QYG+TL++ALQ+ QQTGR+PL LK++ PV IK+G+LKL KV ILG+
Sbjct  193  QNKTLLNVDLTGQTQYGSTLMNALQQQQQTGRIPLVLKVNAPVAIKLGKLKLRKVTILGE  252

Query  754  CMLIVNSLSTNSLISIKASTCKFKLK  831
            C+L+V+SLS N+LISIKA+ C+F++K
Sbjct  253  CLLVVDSLSANNLISIKANNCRFRMK  278



>ref|XP_003536181.1| PREDICTED: protein YLS9-like [Glycine max]
Length=252

 Score =   275 bits (704),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 197/252 (78%), Gaps = 13/252 (5%)
 Frame = +1

Query  112  MSEHQRIRIH-peveapppptrplvprGSFRSEKG---------DPSTQAWQPQKSKRSC  261
            M++HQR+RIH  E EAPPPPT PLVP GS RSEKG           +  A  P   KRS 
Sbjct  1    MADHQRLRIHPMEGEAPPPPTTPLVPPGSSRSEKGVPLHHPPPLPRAMPAAYPTPHKRSS  60

Query  262  CCKCMW--WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYA  435
             C C    WT+ ++V+L II AA  GILYL+FQPK+P YSVD LRISDLR+N  D+SLYA
Sbjct  61   SCCCKCICWTIILVVLLLIIFAASVGILYLVFQPKLPDYSVDTLRISDLRLN-FDMSLYA  119

Query  436  KFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS  615
            KF+VKITA NPNKKIGIYYE+G +LSVWY  T+LC+GSLP+ YQGH+N TVL V+LSGQ 
Sbjct  120  KFDVKITATNPNKKIGIYYEKGGKLSVWYTNTRLCEGSLPQFYQGHENKTVLNVSLSGQV  179

Query  616  QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLI  795
            Q G+TL++ALQ+ QQTGR+PLDLK+  P+ IK+GRLKLMKV +LG+C+L+V+SLS+N+LI
Sbjct  180  QSGSTLMNALQQQQQTGRIPLDLKVHAPIAIKLGRLKLMKVRVLGECLLVVDSLSSNNLI  239

Query  796  SIKASTCKFKLK  831
            SIKAS CKF+LK
Sbjct  240  SIKASNCKFRLK  251



>ref|XP_004495489.1| PREDICTED: uncharacterized protein LOC101514344 [Cicer arietinum]
Length=241

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 186/241 (77%), Gaps = 2/241 (1%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvpr-GSFRSEKGDPSTQAWQPQKSKRSCCCKCMWWTV  288
            MS+HQR RIHP      P  R  +   GS RSEKG P      P + KRSC CKC+ WT+
Sbjct  1    MSDHQRQRIHPMDVEAKPHPRTPLVPPGSSRSEKGIPVPVHHPPPQRKRSCFCKCICWTL  60

Query  289  SVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNP  468
            S++V+L II+AA  G LY++F+PK+P YSVD LRISDLR+N  DLSLYAKF+VKIT++NP
Sbjct  61   SLLVLLLIILAATVGTLYIVFKPKLPNYSVDTLRISDLRLN-FDLSLYAKFDVKITSKNP  119

Query  469  NKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQ  648
            NKKIGIYYE+G +LSV Y  TKLC+G LPE YQGHQN TVL V+L+GQ Q GNTL++ALQ
Sbjct  120  NKKIGIYYEKGGKLSVLYTNTKLCEGFLPEFYQGHQNKTVLNVSLTGQVQSGNTLMAALQ  179

Query  649  EAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
            + QQTGR+PL+L I  PV IK+GRLKL KV +LG C L+V+SLSTN+L+SIKAS C F++
Sbjct  180  QQQQTGRIPLELDIHAPVAIKLGRLKLKKVKVLGQCQLVVDSLSTNNLVSIKASNCNFRM  239

Query  829  K  831
            K
Sbjct  240  K  240



>ref|XP_003556419.1| PREDICTED: uncharacterized protein LOC100780820 [Glycine max]
 gb|KHN05005.1| Hypothetical protein glysoja_013912 [Glycine soja]
Length=250

 Score =   270 bits (689),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 200/250 (80%), Gaps = 11/250 (4%)
 Frame = +1

Query  112  MSEHQRIRIHpev--eapppptrplvprGSFRSEKGDP--------STQAWQPQKSKRSC  261
            M++HQR+RIHP      PPPPT PLVP GS +SEK  P        +  A  P   KRSC
Sbjct  1    MADHQRLRIHPMEGEAPPPPPTTPLVPPGSSKSEKRIPLHHPPQLRAMPAAYPTAHKRSC  60

Query  262  CCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKF  441
            CCKC+ W ++++V+L II+AA  GILYL+F+PK+P YSVD LRISDLR+N  D+SLYA+F
Sbjct  61   CCKCICWIITLLVLLLIILAASVGILYLVFKPKLPDYSVDTLRISDLRLN-FDMSLYARF  119

Query  442  NVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQY  621
            +VKITA NPNKKIGIYY++G RLSVWY  T+LC+GSLP+ YQGH+N T+L V+LSGQ Q 
Sbjct  120  DVKITATNPNKKIGIYYKKGGRLSVWYTNTRLCEGSLPQFYQGHENKTMLNVSLSGQVQS  179

Query  622  GNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISI  801
            G+TL++ALQ+ QQTGR+PLDLK+  P+ IK+GRLKLMKV +LG+C+L+V+SLS+N+LISI
Sbjct  180  GSTLMNALQQQQQTGRIPLDLKVHAPIAIKLGRLKLMKVRVLGECLLVVDSLSSNNLISI  239

Query  802  KASTCKFKLK  831
            KAS CKF+LK
Sbjct  240  KASNCKFRLK  249



>gb|KEH42881.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Medicago truncatula]
Length=250

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 184/250 (74%), Gaps = 11/250 (4%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrpl-vprGSFRSEK---------GDPSTQAWQPQKSKRSC  261
            MS+HQR RIHP      P  R   VP GS RSEK            +  A    K K SC
Sbjct  1    MSDHQRQRIHPMNVETKPHPRTPLVPPGSSRSEKVIHVPPPILHQHAMPAINSSKPKISC  60

Query  262  CCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKF  441
             CKC+ WT+S++ +L IIIAA AG LYLIF+PK+P YSVD LRISDLR+N  DLSLYAKF
Sbjct  61   FCKCICWTISLLFLLLIIIAATAGALYLIFKPKLPNYSVDTLRISDLRLN-FDLSLYAKF  119

Query  442  NVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQY  621
            +VKITA NPNKKIGIYYE+G +LSV Y  TKLC+GSLP+ YQGHQN TVL V+L+GQ Q 
Sbjct  120  DVKITATNPNKKIGIYYEKGGKLSVLYTNTKLCEGSLPKFYQGHQNKTVLNVSLTGQVQS  179

Query  622  GNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISI  801
            GNTL++ALQ+ QQTGR+PLDL I  P+ IK GRLKL KV +LG C L+V+SLS+N+L+SI
Sbjct  180  GNTLMAALQQQQQTGRIPLDLNIHAPIAIKFGRLKLKKVKVLGRCQLVVDSLSSNNLVSI  239

Query  802  KASTCKFKLK  831
            KAS C FKLK
Sbjct  240  KASNCNFKLK  249



>ref|XP_008375075.1| PREDICTED: uncharacterized protein LOC103438306 [Malus domestica]
Length=279

 Score =   269 bits (687),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = +1

Query  238  PQKSKRSCC-CKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNP  414
            P K + SC  C+ MWWT+ +++++ III A AGILYLIF PK+P YSVD+L+ISDL +N 
Sbjct  81   PPKKRSSCTFCRFMWWTMGILLLVLIIIGATAGILYLIFHPKLPNYSVDSLKISDLTLN-  139

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
            L ++LYAKF+VKITA NPNKKIGIYYE+G RLSVWY  T+LCQG LP+ YQGHQN T+L 
Sbjct  140  LGMTLYAKFDVKITANNPNKKIGIYYEKGGRLSVWYTNTRLCQGMLPKFYQGHQNKTLLN  199

Query  595  VALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNS  774
            V L+GQ+QYG TL++ALQ+ QQTGR+PLDLK++ PV IK+G+LKL KV ILG+C+L+V+S
Sbjct  200  VDLTGQTQYGITLMNALQQQQQTGRIPLDLKVNAPVAIKLGKLKLRKVTILGECLLVVDS  259

Query  775  LSTNSLISIKASTCKFKLK  831
            LS N+LISIKA+ C+F++K
Sbjct  260  LSANNLISIKANNCRFRMK  278



>gb|KHN14748.1| hypothetical protein glysoja_020921, partial [Glycine soja]
Length=215

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = +1

Query  238  PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPL  417
            P K   SCCCKC+ WT+ ++V+L II AA  GILYL+FQPK+P YSVD LRISDLR+N  
Sbjct  18   PHKRSSSCCCKCICWTIILVVLLLIIFAASVGILYLVFQPKLPDYSVDTLRISDLRLN-F  76

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
            D+SLYAKF+VKITA NPNKKIGIYYE+G +LSVWY  T+LC+GSLP+ YQGH+N TVL V
Sbjct  77   DMSLYAKFDVKITATNPNKKIGIYYEKGGKLSVWYTNTRLCEGSLPQFYQGHENKTVLNV  136

Query  598  ALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            +LSGQ Q G+TL++ALQ+ QQTGR+PLDLK+  P+ IK+GRLKLMKV +LG+C+L+V+SL
Sbjct  137  SLSGQVQSGSTLMNALQQQQQTGRIPLDLKVHAPIAIKLGRLKLMKVRVLGECLLVVDSL  196

Query  778  STNSLISIKASTCKFKLK  831
            S+N+LISIKAS CKF+LK
Sbjct  197  SSNNLISIKASNCKFRLK  214



>ref|XP_002305694.2| hypothetical protein POPTR_0004s06570g [Populus trichocarpa]
 gb|EEE86205.2| hypothetical protein POPTR_0004s06570g [Populus trichocarpa]
Length=255

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 159/184 (86%), Gaps = 1/184 (1%)
 Frame = +1

Query  280  WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITA  459
            WTV ++V+L  I+ A AGILYL+F+PKIP YSVD+LRISDLR+N  D++LYA F+VKITA
Sbjct  72   WTVGLLVLLLGIVGATAGILYLVFKPKIPNYSVDSLRISDLRLN-FDMTLYATFDVKITA  130

Query  460  QNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLS  639
             NPNKKIGIYYE+G  LSVWY  TKLCQGS+P+ YQGHQN T L+V+L+GQ++YG+TL+ 
Sbjct  131  NNPNKKIGIYYEKGGLLSVWYTDTKLCQGSIPKFYQGHQNITKLDVSLTGQTRYGSTLMR  190

Query  640  ALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCK  819
             LQE QQTGR+PLDLKID PV IK+GRLKL KV ILG+C+L+VNSLSTN+LISIKAS CK
Sbjct  191  TLQEQQQTGRIPLDLKIDAPVSIKLGRLKLRKVRILGNCLLVVNSLSTNNLISIKASNCK  250

Query  820  FKLK  831
            F+LK
Sbjct  251  FRLK  254



>ref|XP_011035414.1| PREDICTED: uncharacterized protein LOC105133228 [Populus euphratica]
Length=203

 Score =   263 bits (672),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 159/184 (86%), Gaps = 1/184 (1%)
 Frame = +1

Query  280  WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITA  459
            WTV ++V+L  I+ A AGILYL+F+PKIP YSVD+LRISDLR+N  D++LYAKF++KITA
Sbjct  20   WTVGLLVLLLGIVGATAGILYLVFKPKIPNYSVDSLRISDLRLN-FDMTLYAKFDMKITA  78

Query  460  QNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLS  639
             NPNKKI IYYE+G  LSVWY  TKLCQGS+P+ YQGHQN T L+V+L+G++QYG+TL+ 
Sbjct  79   NNPNKKIVIYYEKGGLLSVWYTNTKLCQGSIPKFYQGHQNMTKLDVSLTGKTQYGSTLMR  138

Query  640  ALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCK  819
             LQE QQTGR+PLDLKID PV IK+GRLKL K+ ILGDC+L+VNSLSTN+LISIKAS CK
Sbjct  139  TLQEQQQTGRIPLDLKIDAPVSIKLGRLKLRKMRILGDCLLMVNSLSTNNLISIKASNCK  198

Query  820  FKLK  831
            F+LK
Sbjct  199  FRLK  202



>ref|XP_006441484.1| hypothetical protein CICLE_v10023307mg [Citrus clementina]
 gb|ESR54724.1| hypothetical protein CICLE_v10023307mg [Citrus clementina]
Length=241

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = +1

Query  238  PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPL  417
            P K  RSC CKC  WTVS++V+L II+AA  GILYLIFQPK+PKYSVD+LRI DLR+N L
Sbjct  44   PPKKSRSCFCKCFCWTVSILVLLLIILAAIGGILYLIFQPKLPKYSVDSLRIRDLRLN-L  102

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
            DL+LYA+F+VKITA NPNKKIGIYYE+G +LSVW +  KLC+G LP+ YQGHQN T L+V
Sbjct  103  DLTLYAQFDVKITANNPNKKIGIYYEKGGKLSVWDERAKLCEGFLPKFYQGHQNVTKLDV  162

Query  598  ALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            AL+GQ+QYG+TL+ A+QE QQTGR+PLDLK+D PV IK+G+LKL KV ILG C+L+V+SL
Sbjct  163  ALNGQTQYGSTLMKAIQEQQQTGRIPLDLKVDAPVAIKLGKLKLRKVKILGQCLLVVDSL  222

Query  778  STNSLISIKASTCKFKLK  831
            S N+ ISIKAS C F LK
Sbjct  223  SANNKISIKASNCSFNLK  240



>gb|KDO55969.1| hypothetical protein CISIN_1g047356mg [Citrus sinensis]
Length=241

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = +1

Query  238  PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPL  417
            P K  RSC CKC  WTVS++V+L II+AA  GILYL+FQPK+PKYSVD+LRI DLR+N L
Sbjct  44   PPKKSRSCFCKCFCWTVSILVLLLIILAAIGGILYLVFQPKLPKYSVDSLRIRDLRLN-L  102

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
            DL+LYA+F+VKITA NPNKKIGIYYE+G +LSVW +  KLC+G LP+ YQGHQN T L+V
Sbjct  103  DLTLYAQFDVKITANNPNKKIGIYYEKGGKLSVWDERAKLCEGFLPKFYQGHQNVTKLDV  162

Query  598  ALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            AL+GQ+QYG+TL+ A+QE QQTGR+PLDLK+D PV IK+G+LKL KV ILG C+L+V+SL
Sbjct  163  ALTGQTQYGSTLMKAIQEQQQTGRIPLDLKVDAPVAIKLGKLKLRKVKILGQCLLVVDSL  222

Query  778  STNSLISIKASTCKFKLK  831
            S N+ ISIKAS C F LK
Sbjct  223  SANNKISIKASNCSFNLK  240



>ref|XP_004299452.1| PREDICTED: uncharacterized protein LOC101308869 [Fragaria vesca 
subsp. vesca]
Length=295

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 171/200 (86%), Gaps = 2/200 (1%)
 Frame = +1

Query  235  QPQK-SKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVN  411
            QP+K S  S CC+C+ W +S+++++ III A AGILYLIF+PK+P YSV++L+ISDLR+N
Sbjct  96   QPEKRSSSSTCCRCICWALSILLLVLIIIGATAGILYLIFRPKLPSYSVNSLKISDLRLN  155

Query  412  PLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVL  591
             LD+SLYAKF+VKITA+NPNKKIGIYYE+G +LSVWY   +LC+G+LP+ YQGHQN TVL
Sbjct  156  -LDMSLYAKFDVKITAENPNKKIGIYYEQGGQLSVWYTNMRLCEGALPKFYQGHQNKTVL  214

Query  592  EVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
             VAL+GQ+QYG+TL++ALQ+ QQTG +PLDLK++ PV I++G LKL KV ILG C+L+V+
Sbjct  215  NVALTGQNQYGSTLMNALQQQQQTGSIPLDLKVNAPVAIELGTLKLRKVRILGKCLLVVD  274

Query  772  SLSTNSLISIKASTCKFKLK  831
            SL+TN+ ISIKA  C+F+LK
Sbjct  275  SLTTNNFISIKADNCRFRLK  294



>ref|XP_006478147.1| PREDICTED: uncharacterized protein LOC102625449 [Citrus sinensis]
Length=298

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = +1

Query  238  PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPL  417
            P K  RSC CKC  WTVS++V+L II+AA  GILYL+FQPK+PKYSVD+LRI DLR+N L
Sbjct  101  PPKKSRSCFCKCFCWTVSILVLLLIILAAIGGILYLVFQPKLPKYSVDSLRIRDLRLN-L  159

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
            DL+LYA+F+VKITA NPNKKIGIYYE+G +LSVW +  KLC+G LP+ YQGHQN T L+V
Sbjct  160  DLTLYAQFDVKITANNPNKKIGIYYEKGGKLSVWDERAKLCEGFLPKFYQGHQNVTKLDV  219

Query  598  ALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            AL+GQ+QYG+TLL A+QE QQTGR+PLDLK+D PV IK+G+LKL KV ILG C+L+V+SL
Sbjct  220  ALTGQTQYGSTLLKAIQEQQQTGRIPLDLKVDAPVAIKLGKLKLRKVKILGQCLLVVDSL  279

Query  778  STNSLISIKASTCKFKLK  831
            S N+ ISIKAS C F LK
Sbjct  280  SANNKISIKASNCSFNLK  297



>gb|EYU22309.1| hypothetical protein MIMGU_mgv1a012723mg [Erythranthe guttata]
Length=242

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 159/225 (71%), Gaps = 31/225 (14%)
 Frame = +1

Query  193  SFRSEKGDPSTQ------------AWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGI  336
            +FRSEKG+P+                       +C CKC+ WT+S+++ L II+ A AGI
Sbjct  36   TFRSEKGNPARNQVPLGHLIAARPPPLAPPKSGNCLCKCLCWTLSLLIFLLIIVGATAGI  95

Query  337  LYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSV  516
            LYL+FQPKIPKYSVD+LRISDL +N  DLSLYA+FNVKITA+NPNKKIGIYYE+GS LSV
Sbjct  96   LYLVFQPKIPKYSVDDLRISDLTLN-FDLSLYARFNVKITAENPNKKIGIYYEKGSHLSV  154

Query  517  WYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDM  696
            WYK T LCQGS+P  YQGHQN T                  A  E QQT R+PLDLKID+
Sbjct  155  WYKNTNLCQGSIPRFYQGHQNKT------------------AFNEQQQTRRIPLDLKIDV  196

Query  697  PVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            PV IK+G+LKL KV I+G CMLIV++LSTNSLISIKASTC F LK
Sbjct  197  PVSIKLGKLKLNKVRIMGTCMLIVDNLSTNSLISIKASTCNFGLK  241



>ref|XP_009113430.1| PREDICTED: protein YLS9 [Brassica rapa]
Length=269

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 157/197 (80%), Gaps = 1/197 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +  KR+ CC+   W +S++++  I +A    ++Y +F PKIP+Y V++LR+S+L +N LD
Sbjct  73   RNKKRNLCCRIFCWGLSLLIIGLIALAVAITVIYFVFHPKIPQYEVNSLRVSNLGIN-LD  131

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
            LSL A F V+ITA+NPN+KIGIYYE+G RL VWY  TKLC+G +P+ YQGH+N T L V 
Sbjct  132  LSLSALFKVEITARNPNEKIGIYYEKGGRLQVWYTKTKLCEGPIPKFYQGHRNVTRLNVD  191

Query  601  LSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLS  780
            L+G++Q+GNT+LSALQ+ QQTGRVPLDLK+D PV +K+G+LKL KV ILG+C ++V+SLS
Sbjct  192  LAGRAQFGNTVLSALQQQQQTGRVPLDLKVDAPVSVKLGKLKLRKVRILGNCKIVVDSLS  251

Query  781  TNSLISIKASTCKFKLK  831
            TN+ I+IKAS CKF+LK
Sbjct  252  TNNRINIKASDCKFRLK  268



>gb|KGN50557.1| hypothetical protein Csa_5G182130 [Cucumis sativus]
Length=239

 Score =   244 bits (623),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = +1

Query  238  PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPL  417
            P K +RSC C+C+ +T  +I++L II+ A  GILYL+F+PKIP +S+D+L ISDLR+N  
Sbjct  42   PPKKRRSCLCRCLCYTFCLILLLLIILGAVIGILYLVFKPKIPTFSIDSLNISDLRLN-F  100

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
            D+SLYA+F+VKIT  NPN+KIGIYYE+G  LSVWY   KLC+GSLP  Y GH+N T L+V
Sbjct  101  DMSLYARFDVKITTYNPNEKIGIYYEKGGVLSVWYTENKLCEGSLPAFYHGHRNKTALDV  160

Query  598  ALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
             L+G++ YG+TL+SAL E QQTGR+PL L+   PV +K+G++KL KV ILG+C+L+V+SL
Sbjct  161  VLTGRTVYGSTLMSALVEQQQTGRIPLQLQAVAPVAVKMGKMKLKKVKILGNCLLVVDSL  220

Query  778  STNSLISIKASTCKFKLK  831
            + N+ I+IKAS CKF+LK
Sbjct  221  TANNAITIKASNCKFRLK  238



>ref|XP_006392516.1| hypothetical protein EUTSA_v10023892mg [Eutrema salsugineum]
 gb|ESQ29802.1| hypothetical protein EUTSA_v10023892mg [Eutrema salsugineum]
Length=241

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +  K++ CCKC  W +S+++  FI +A    ++Y +F PK+P+Y V++LR+++L +N LD
Sbjct  45   RNKKQNLCCKCFCWALSLLITAFIALAVAIAVIYFVFHPKLPQYEVNSLRVTNLGIN-LD  103

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
            LSL A F V+ITA+NPNKKIGIYY+ G R+ VWY   KLC+G +P+ Y GH N T L V 
Sbjct  104  LSLSALFKVEITARNPNKKIGIYYKNGGRIGVWYTKIKLCEGPIPKFYHGHHNVTKLNVD  163

Query  601  LSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLS  780
            L+G++QYGN++LSALQ+ QQTG VPLDLK+D PV IK+G LKL K+ ILG C L+V+SLS
Sbjct  164  LTGRAQYGNSILSALQQQQQTGHVPLDLKVDAPVAIKLGNLKLKKIQILGKCKLVVDSLS  223

Query  781  TNSLISIKASTCKFKLK  831
            TN+ I+IKAS C FKLK
Sbjct  224  TNNRINIKASDCSFKLK  240



>ref|XP_008461681.1| PREDICTED: uncharacterized protein LOC103500225 [Cucumis melo]
Length=238

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 159/202 (79%), Gaps = 1/202 (0%)
 Frame = +1

Query  226  QAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLR  405
            Q   P K +RS  C+C+ ++  +I+++ II+ A  GILYL+F+PKIP +S+D+L ISDLR
Sbjct  37   QIILPPKKRRSYLCRCLCYSFCLILLILIILGAVIGILYLVFKPKIPTFSIDSLNISDLR  96

Query  406  VNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTT  585
            +N  D+SLYA+F+VKIT  NPN+KIGIYYE+G  LSVWY   KLC+GSLPE Y GH+N T
Sbjct  97   LN-FDMSLYARFDVKITTYNPNEKIGIYYEKGGVLSVWYTENKLCEGSLPEFYHGHRNKT  155

Query  586  VLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLI  765
             L+V L+G++ YG+TL+SAL E QQTGR+PL L+   PV +K+G++KL KV ILG+C+L+
Sbjct  156  ALDVVLTGRTVYGSTLMSALVEQQQTGRIPLQLRAVAPVAVKMGKMKLKKVKILGNCLLV  215

Query  766  VNSLSTNSLISIKASTCKFKLK  831
            V+SL+ N+ I+IKAS CKF+LK
Sbjct  216  VDSLTANNAITIKASNCKFRLK  237



>ref|XP_010037035.1| PREDICTED: protein YLS9 [Eucalyptus grandis]
Length=260

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 182/250 (73%), Gaps = 13/250 (5%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQA----------WQPQKSKRSC  261
            M+++QRI  HP V      T PLVP  S  SEKG    +A          +   + ++ C
Sbjct  13   MADNQRI--HPAVPVATSATAPLVPPSSSVSEKGTQVHRASPLQGGGPVIFAKPRKRKGC  70

Query  262  CCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKF  441
            CC+ +   +S+++++ I+I   A ++Y +FQPK+P+YSVD L+IS LR+N  DL+LYA+F
Sbjct  71   CCRLLCGLISLLLLILILIGIVAAVIYFVFQPKLPQYSVDRLQISALRLN-FDLTLYAQF  129

Query  442  NVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQY  621
            +VKITA NPNKKIGIYYE+G RLSVWY   KLC+GSLP  YQGHQNTT L++ L+GQS+ 
Sbjct  130  DVKITATNPNKKIGIYYEKGGRLSVWYSNDKLCEGSLPRFYQGHQNTTRLDITLTGQSES  189

Query  622  GNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISI  801
            G+T+++ALQ+ QQTG++PLDLK+D PV +K+G +KL KV ILG C L+V+SLSTNS+ISI
Sbjct  190  GSTIMAALQQQQQTGQIPLDLKVDAPVSVKLGTMKLRKVKILGRCSLVVDSLSTNSMISI  249

Query  802  KASTCKFKLK  831
            KAS C F +K
Sbjct  250  KASNCSFGMK  259



>gb|KCW48675.1| hypothetical protein EUGRSUZ_K02330 [Eucalyptus grandis]
Length=248

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 182/250 (73%), Gaps = 13/250 (5%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQA----------WQPQKSKRSC  261
            M+++QRI  HP V      T PLVP  S  SEKG    +A          +   + ++ C
Sbjct  1    MADNQRI--HPAVPVATSATAPLVPPSSSVSEKGTQVHRASPLQGGGPVIFAKPRKRKGC  58

Query  262  CCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKF  441
            CC+ +   +S+++++ I+I   A ++Y +FQPK+P+YSVD L+IS LR+N  DL+LYA+F
Sbjct  59   CCRLLCGLISLLLLILILIGIVAAVIYFVFQPKLPQYSVDRLQISALRLN-FDLTLYAQF  117

Query  442  NVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQY  621
            +VKITA NPNKKIGIYYE+G RLSVWY   KLC+GSLP  YQGHQNTT L++ L+GQS+ 
Sbjct  118  DVKITATNPNKKIGIYYEKGGRLSVWYSNDKLCEGSLPRFYQGHQNTTRLDITLTGQSES  177

Query  622  GNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISI  801
            G+T+++ALQ+ QQTG++PLDLK+D PV +K+G +KL KV ILG C L+V+SLSTNS+ISI
Sbjct  178  GSTIMAALQQQQQTGQIPLDLKVDAPVSVKLGTMKLRKVKILGRCSLVVDSLSTNSMISI  237

Query  802  KASTCKFKLK  831
            KAS C F +K
Sbjct  238  KASNCSFGMK  247



>ref|XP_008800413.1| PREDICTED: protein YLS9-like [Phoenix dactylifera]
Length=251

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 173/253 (68%), Gaps = 16/253 (6%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQPQ-------------KSK  252
            M+E QRI  HP     P    PLVP    RS+KGDP+     P              K +
Sbjct  1    MAEQQRI--HPVDVEAPSQAAPLVPPELSRSDKGDPAVAGQHPPHRRTIPVAHSRPPKRR  58

Query  253  RSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLY  432
            RSCCCKC+ WT+  I++L +++AA  GILYLIF PK+PKYSVD LR+S   V+  +L+ +
Sbjct  59   RSCCCKCLCWTILTIIILIVLVAATLGILYLIFDPKLPKYSVDRLRVSTFSVD-NNLTAH  117

Query  433  AKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQ  612
            A F+V +TA+NPNKKIGIYYE GS LSVWY    LC+G  PE YQGH+NTTVL V L+G+
Sbjct  118  AGFDVTVTAENPNKKIGIYYEGGSHLSVWYSGFSLCEGEFPEFYQGHRNTTVLTVVLTGE  177

Query  613  SQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSL  792
            +Q G+T ++ALQ+ QQTG VPL+ K D+PVR+K+G LKL KV     C L+V+SL+ N+ 
Sbjct  178  AQLGSTEMTALQQQQQTGMVPLNFKGDVPVRVKLGSLKLWKVTSRVRCSLVVDSLTANNQ  237

Query  793  ISIKASTCKFKLK  831
            I I++S+CKF+LK
Sbjct  238  IQIRSSSCKFRLK  250



>ref|XP_010246772.1| PREDICTED: protein YLS9-like [Nelumbo nucifera]
Length=249

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 175/252 (69%), Gaps = 16/252 (6%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQP-----------QKSKR-  255
            M++HQRI     V+    PT PL+ R S RSEKGDP    + P           +  KR 
Sbjct  1    MADHQRIH---PVDLEARPTAPLMSRDSSRSEKGDPLQHDFPPPPLRTFPVSHSKPPKRG  57

Query  256  SCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYA  435
            +CCC+ + WT  ++ ++ I ++    ILY++FQPKIP+YS+D L I+  ++N  D SL+A
Sbjct  58   NCCCRYLCWTFCLLSLVVISVSVAGVILYIVFQPKIPQYSIDRLSITSFQLN-FDGSLHA  116

Query  436  KFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS  615
            +F+V ITA+NPN+KIGIYYE GS+LSV+Y   KLC+GSLP  YQGH+N TVL VAL+GQ+
Sbjct  117  QFDVTITARNPNEKIGIYYEDGSQLSVYYTDAKLCEGSLPVFYQGHRNKTVLVVALTGQA  176

Query  616  QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLI  795
              G+TL+SAL   QQTGR+PL+LK  +PVR+K+G LKL KV  L  C L+V+SL+ N L+
Sbjct  177  PDGSTLMSALATQQQTGRIPLNLKARVPVRVKLGELKLNKVKFLVRCDLVVDSLTANGLV  236

Query  796  SIKASTCKFKLK  831
            SI+ S+CKF L+
Sbjct  237  SIRTSSCKFGLR  248



>ref|XP_010531819.1| PREDICTED: protein YLS9 [Tarenaya hassleriana]
Length=248

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 156/206 (76%), Gaps = 2/206 (1%)
 Frame = +1

Query  217  PSTQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRIS  396
            P + + + ++  ++  C+C  W + ++V   + +     ++YL+F+PK+P+Y VD+LR+S
Sbjct  43   PPSSSPKARRKNQNFLCRCFCWILVLLVTALVTLGISIAVIYLVFRPKLPQYDVDSLRVS  102

Query  397  DLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQ  576
            +LR+N LDL+LYA+F+VKITA+NPN+KIGIYYE+G  L VWY  TKLC+G +P  YQG +
Sbjct  103  NLRIN-LDLTLYAEFDVKITARNPNEKIGIYYEKGGHLGVWYAKTKLCEGPIPRFYQGKR  161

Query  577  NTTVLEVALSGQSQYGNTLLSALQEAQQT-GRVPLDLKIDMPVRIKVGRLKLMKVGILGD  753
            N T L+V L G +QYGN ++SAL++ Q+T GRVPLDL++D PV +++G+LK+ +V ILG 
Sbjct  162  NVTKLDVTLKGTAQYGNAIMSALKQQQETSGRVPLDLEVDAPVAVRLGKLKMRRVRILGK  221

Query  754  CMLIVNSLSTNSLISIKASTCKFKLK  831
            C L+V+SLS N+ I+IKAS C+F LK
Sbjct  222  CKLVVDSLSENNRINIKASDCRFGLK  247



>ref|XP_009127449.1| PREDICTED: protein YLS9 [Brassica rapa]
Length=248

 Score =   234 bits (597),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 159/222 (72%), Gaps = 12/222 (5%)
 Frame = +1

Query  199  RSEKGDPSTQAWQ----------PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLI  348
            RSE+GDPS +             P+K  RSCCC+C+ +T+ ++ +L + + A  GILYL+
Sbjct  27   RSEQGDPSKRTLTQRSTYAPLAPPRKRGRSCCCRCVCYTLCLLFLLVVAVGATIGILYLV  86

Query  349  FQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKT  528
             +PK+P YS+D L+++   +N  D SL   FNV ITA+NPN+KIGIYYE GS ++VWY  
Sbjct  87   LKPKLPDYSIDRLQLTQFALN-QDSSLSTAFNVTITAKNPNEKIGIYYEDGSEITVWYNE  145

Query  529  TKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDMPVR  705
            TKL +GSLP+ YQGH+NTTV++V +SGQSQ    ++S L+E QQ TG +PL L++D PVR
Sbjct  146  TKLSEGSLPKFYQGHENTTVIDVQMSGQSQDATGIMSTLEEQQQTTGNIPLRLRVDQPVR  205

Query  706  IKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            IK G+LKLM+V  L  C + V+SL+ N++I I++S+CKF+L+
Sbjct  206  IKFGKLKLMEVRFLVRCGVFVDSLAANNVIKIQSSSCKFRLR  247



>ref|XP_006848655.1| hypothetical protein AMTR_s00171p00061900 [Amborella trichopoda]
 gb|ERN10236.1| hypothetical protein AMTR_s00171p00061900 [Amborella trichopoda]
Length=248

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 156/221 (71%), Gaps = 12/221 (5%)
 Frame = +1

Query  202  SEKGDPSTQ-----------AWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLI  348
            SEKGDP  Q             +P K +++CCC+ + WT+  ++ L I+I    G LYLI
Sbjct  28   SEKGDPPKQFSPFHRTFPVMHSKPPK-RKNCCCRFLCWTMCFLITLIILIGITLGALYLI  86

Query  349  FQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKT  528
            F+PK+P+YSVD LRI+    NP D+SLY +F V ITA+NPNKKIGIYYE GS LSVWY  
Sbjct  87   FRPKLPEYSVDRLRITAFNFNPTDMSLYTQFAVTITAKNPNKKIGIYYEDGSHLSVWYSD  146

Query  529  TKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRI  708
            T+LC G+LP+ YQGHQNTTV+EVAL+GQ+Q G+ L +A+ E Q TG VPL  + D+PVRI
Sbjct  147  TRLCTGALPKFYQGHQNTTVMEVALAGQNQVGSGLQAAIAEQQSTGMVPLLFRGDVPVRI  206

Query  709  KVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            K G LKLMK+     C L+V+SLS N+ +SI+  +CKF+LK
Sbjct  207  KFGALKLMKITSKVRCNLVVDSLSANNQVSIRTGSCKFRLK  247



>emb|CDY72163.1| BnaCnng76260D [Brassica napus]
Length=248

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 160/222 (72%), Gaps = 12/222 (5%)
 Frame = +1

Query  199  RSEKGDPSTQAWQ----------PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLI  348
            RSE+GDP+               P+K  RSCCC+C+ +T+ + ++L + + A  GILYL+
Sbjct  27   RSEQGDPAKDVLTQRSTYVPLAPPRKRGRSCCCRCVCYTLCLFLLLVVAVGATIGILYLV  86

Query  349  FQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKT  528
            F+PK+P YS+D L+++   +N  D SL   FNV ITA+NPN+KIGIYYE GS+++VWY  
Sbjct  87   FKPKLPDYSIDRLQLTQFALN-QDSSLSTAFNVTITAKNPNEKIGIYYEDGSKITVWYNE  145

Query  529  TKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDMPVR  705
            TKL +GSLP+ YQGH+NTTV++V +SGQ+Q    +++ L+E QQ TG +PL L++D PVR
Sbjct  146  TKLSEGSLPKFYQGHENTTVIDVEMSGQTQDAAGIMTTLEEQQQTTGNIPLRLRVDQPVR  205

Query  706  IKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            IK G+LKLM+V  L  C + V+SL+ N++I I++S+CKF+L+
Sbjct  206  IKFGKLKLMEVRFLVRCGVFVDSLAPNNVIKIQSSSCKFRLR  247



>gb|KFK41014.1| hypothetical protein AALP_AA2G074000 [Arabis alpina]
Length=250

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 175/250 (70%), Gaps = 11/250 (4%)
 Frame = +1

Query  112  MSEHQRIR-IHpeveapppptrplvprGSFRSEKGDPSTQA--------WQPQKSKRSCC  264
            MS H +I  +H    +P  PT PLVPRG+ RSE GDPS             P+   RSCC
Sbjct  1    MSNHPKIHPLHDPEASPAHPTAPLVPRGASRSEHGDPSKDQRPHRFVPLAPPKNRGRSCC  60

Query  265  CKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFN  444
            C+C+ +T+  +++  + I A  GILYL+F+PK+P YS+D L+++    N  DLSL   FN
Sbjct  61   CRCVCYTLCFLLLFIVAIGATIGILYLVFKPKLPDYSIDRLQLTRFTPN-QDLSLSTAFN  119

Query  445  VKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYG  624
            V ITA+NPN+KIGIYYE GS+++VWY  TKL +GSLP+ YQGH+NTTV+ V ++G++Q  
Sbjct  120  VTITAKNPNQKIGIYYEDGSKITVWYLQTKLSEGSLPKFYQGHENTTVIYVEMTGETQDA  179

Query  625  NTLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISI  801
            + L ++LQE QQ TG +PL ++++ PVR+K G+LKLM+V  L  C + V+SL+TN+ I I
Sbjct  180  SGLRTSLQEQQQRTGNIPLRIRVNQPVRVKFGKLKLMEVRFLVRCDVFVDSLATNNAIKI  239

Query  802  KASTCKFKLK  831
            ++S+CKF+LK
Sbjct  240  QSSSCKFRLK  249



>emb|CDY16419.1| BnaA02g12230D [Brassica napus]
Length=248

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 159/222 (72%), Gaps = 12/222 (5%)
 Frame = +1

Query  199  RSEKGDPSTQAWQ----------PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLI  348
            RSE+GDP+ +             P+K  RSCCC+C+ +T+ ++ +L + + A  GILYL+
Sbjct  27   RSEQGDPAKRTLTQRSTYAPLAPPRKRGRSCCCRCVCYTLCLLFLLVVAVGATIGILYLV  86

Query  349  FQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKT  528
             +PK+P YS+D L+++   +N  D SL   FNV ITA+NPN+KIGIYYE GS ++VWY  
Sbjct  87   LKPKLPDYSIDRLQLTQFALN-QDSSLSTAFNVTITAKNPNEKIGIYYEDGSEITVWYNE  145

Query  529  TKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDMPVR  705
            TKL +GSLP+ YQGH+NTTV++V +SGQ+Q    ++S L+E QQ TG +PL L++D PVR
Sbjct  146  TKLSEGSLPKFYQGHENTTVIDVQMSGQTQDATGIMSTLEEQQQTTGNIPLRLRVDQPVR  205

Query  706  IKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            IK G+LKLM+V  L  C + V+SL+ N++I I++S+CKF+L+
Sbjct  206  IKFGKLKLMEVRFLVRCGVFVDSLAANNVIKIQSSSCKFRLR  247



>ref|XP_010248776.1| PREDICTED: protein YLS9-like [Nelumbo nucifera]
Length=247

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 171/250 (68%), Gaps = 14/250 (6%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQPQK----------SKRSC  261
            M++HQR+  HP      P    +    S RSEKG+P      P +           KRSC
Sbjct  1    MADHQRV--HPVDLEARPTAPLVSRESS-RSEKGEPIEHYPPPPRRTFPVSHSKPPKRSC  57

Query  262  CCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKF  441
            CC+C+ WT+S++++  I++A    ILYL+FQPK+PKYSVD L I+  + N  D SLYA+F
Sbjct  58   CCRCLCWTISLLILQVIVVAIAGAILYLVFQPKLPKYSVDRLLITSFQPNS-DGSLYAQF  116

Query  442  NVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQY  621
            NV ITA+NPNKKIGIYYE GS+LSV+Y  TKLC+GSLP+ YQGHQNTTVL VAL+GQ Q 
Sbjct  117  NVTITARNPNKKIGIYYEDGSQLSVYYTDTKLCEGSLPKFYQGHQNTTVLNVALTGQVQD  176

Query  622  GNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISI  801
            GN L+S L   QQTG +PL L+  +PV++K+G+LKL KV  L  C L+V+SL+ N  I I
Sbjct  177  GNALMSTLTAQQQTGSIPLRLRARVPVKVKLGKLKLKKVKFLVRCNLVVDSLAANGFIRI  236

Query  802  KASTCKFKLK  831
            + S+CKF+ +
Sbjct  237  RTSSCKFRFR  246



>ref|XP_010062341.1| PREDICTED: protein YLS9 [Eucalyptus grandis]
 gb|KCW69468.1| hypothetical protein EUGRSUZ_F02922 [Eucalyptus grandis]
Length=258

 Score =   232 bits (591),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 172/258 (67%), Gaps = 19/258 (7%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQ-----------------AWQP  240
            M++HQR+    + EAP  PT PLVP  + +S+ GDP+ +                   +P
Sbjct  1    MADHQRVHPAGDPEAPQAPTAPLVPPDASKSDNGDPAPRDNGYYPPPPVQRTIPVVHSRP  60

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
             K +RSCCCKC  WT S + +L + IA  AGIL+L+F+PK+PKYSVD L+I+       +
Sbjct  61   PKRRRSCCCKCFCWTFSFLALLIVAIAITAGILFLVFRPKLPKYSVDALQITQF-APANN  119

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
             SL A FNV ITA+NPNKKIGIYYE GSR++V Y   +LCQG+LP+ YQGH+NTTVL V 
Sbjct  120  GSLSASFNVNITARNPNKKIGIYYEGGSRITVLYDGEQLCQGALPKFYQGHRNTTVLVVP  179

Query  601  LSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            LSGQ+Q    LLS LQ  QQ TG +PL+L++  PVR+K+G+LKL KV     C L VN+L
Sbjct  180  LSGQTQNATGLLSQLQAEQQATGSIPLNLRVRQPVRVKLGKLKLFKVKFSVRCQLKVNNL  239

Query  778  STNSLISIKASTCKFKLK  831
            S +S I I +S+CKF+L+
Sbjct  240  SEDSSIRITSSSCKFRLR  257



>ref|XP_010511195.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=259

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 151/194 (78%), Gaps = 1/194 (1%)
 Frame = +1

Query  250  KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL  429
            K + CCK   W +S++ +  I +A    ++Y +F PK+P+Y V++LR+++L +N LDLSL
Sbjct  66   KGNLCCKIFCWVLSLLAIALIALAIGVAVVYFVFHPKLPRYEVNSLRVTNLGIN-LDLSL  124

Query  430  YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSG  609
             A+F V+ITA+NPNKKIGIYYE+G  + VWY  TKLC+G +P  YQGH+N T L V L+G
Sbjct  125  SAEFRVEITARNPNKKIGIYYEKGGHIGVWYDKTKLCEGPIPRFYQGHRNVTKLNVVLTG  184

Query  610  QSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNS  789
            ++Q GNT+LSALQ+ QQTGRVPLDLK+D PV +K+G+LK+ K+ ILG+C L+V+SLSTN+
Sbjct  185  RAQAGNTVLSALQQQQQTGRVPLDLKVDAPVAVKLGKLKMKKIRILGNCKLVVDSLSTNN  244

Query  790  LISIKASTCKFKLK  831
             I+IKAS C F++K
Sbjct  245  NINIKASDCSFRVK  258



>ref|XP_010687265.1| PREDICTED: protein YLS9-like [Beta vulgaris subsp. vulgaris]
Length=250

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 151/194 (78%), Gaps = 1/194 (1%)
 Frame = +1

Query  250  KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL  429
            +RSCCC+ +    S+++VL +++   A + YL+F PK+P YS+D LRI+D R+N LDLSL
Sbjct  57   RRSCCCRVICCIFSLLLVLLLVVGIFALVFYLVFHPKVPDYSIDRLRITDFRLN-LDLSL  115

Query  430  YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSG  609
            YA+FNV++TA+NPNKKIGIYYE+G ++SVWYK T LCQG  P  YQG  NTT  +V LSG
Sbjct  116  YARFNVRVTAKNPNKKIGIYYEKGGKMSVWYKDTNLCQGHFPAFYQGPLNTTATDVTLSG  175

Query  610  QSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNS  789
            Q+QYGNTL+ ALQ+ QQTG +PLDLK+D PV I+V  +KL KV  L DC L V++LS+ +
Sbjct  176  QNQYGNTLMQALQQQQQTGNIPLDLKVDQPVSIRVQSMKLGKVRFLVDCKLTVDNLSSTN  235

Query  790  LISIKASTCKFKLK  831
            LISIKAS+C+ ++K
Sbjct  236  LISIKASSCRIRVK  249



>ref|XP_002263161.1| PREDICTED: protein YLS9 [Vitis vinifera]
 emb|CBI24023.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 179/251 (71%), Gaps = 12/251 (5%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQ-----------AWQPQKSKRS  258
            M++ QRI    + EAP  PT PLVPRG+ +S++ DP+ Q             +P K KRS
Sbjct  1    MADPQRIHPAQDPEAPHTPTAPLVPRGASKSDRSDPTEQYPPFQRTIPVMHSKPPKKKRS  60

Query  259  CCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAK  438
            C CKC  WT+S++++L +IIA    IL+L+F+PK+PKYS+D LRI+ L +   D SL A 
Sbjct  61   CLCKCFCWTISLLLLLIVIIAIVVAILFLVFKPKLPKYSIDGLRITQLSLG-SDDSLSAT  119

Query  439  FNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQ  618
            F+V ITA+NPN KIGIYYE GS ++V+Y  T+LC+GSLP+ YQGHQNTTVL V L+GQ+Q
Sbjct  120  FDVNITARNPNTKIGIYYEGGSSITVFYTGTQLCEGSLPKFYQGHQNTTVLTVELTGQTQ  179

Query  619  YGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLIS  798
                LL+ LQE ++TG +PL LK+  PVRIK+G+LKLMK+     C L+V++L  N+ IS
Sbjct  180  NATGLLTTLQEQRETGSIPLTLKVKQPVRIKLGKLKLMKMKFRATCNLVVDNLDANNTIS  239

Query  799  IKASTCKFKLK  831
            IK+S+CKF+LK
Sbjct  240  IKSSSCKFRLK  250



>ref|XP_002894589.1| hypothetical protein ARALYDRAFT_892695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70848.1| hypothetical protein ARALYDRAFT_892695 [Arabidopsis lyrata subsp. 
lyrata]
Length=239

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 154/198 (78%), Gaps = 2/198 (1%)
 Frame = +1

Query  238  PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPL  417
            P K+ R+ CCK   W +S++V+  I +     ++Y +F PK+P+Y V++LR+++L +N L
Sbjct  43   PSKN-RNMCCKIFCWVLSLLVLAMIALGIAVTVVYFVFHPKLPRYEVNSLRVTNLGIN-L  100

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
            DLSL A+F V+ITA+NPNKKIGIYYE+G  + VWY  TKLC+G +P  YQGH+N T L V
Sbjct  101  DLSLSAEFRVEITARNPNKKIGIYYEKGGHIGVWYDKTKLCEGPIPRFYQGHRNVTKLNV  160

Query  598  ALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
             L+G++QYGNT+L+ALQ+ QQTGRVPLDLK+D PV +K+G+LK+ K+ ILG+C L+V+SL
Sbjct  161  GLTGRAQYGNTVLAALQQQQQTGRVPLDLKVDAPVAVKLGKLKMKKIRILGNCKLVVDSL  220

Query  778  STNSLISIKASTCKFKLK  831
            STN+ I+IKAS C FK K
Sbjct  221  STNNNINIKASDCSFKAK  238



>ref|XP_010470348.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=243

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 156/206 (76%), Gaps = 2/206 (1%)
 Frame = +1

Query  217  PSTQAWQPQKSKR-SCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRI  393
            P T      +SK+ + CCK   W +S++V+  I +A    ++Y +F PK+P+Y V++LR+
Sbjct  38   PITPPAAAMRSKKGNLCCKIFCWVLSLLVIALIALAIAVAVVYFVFHPKLPRYGVNSLRV  97

Query  394  SDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGH  573
            + L +N LDLSL A+F V+ITA+NPNK+IGIYYE+G  + VWY  TKLC+G +P  YQGH
Sbjct  98   TSLGIN-LDLSLSAEFRVQITARNPNKRIGIYYEKGGHIGVWYDKTKLCEGPIPRFYQGH  156

Query  574  QNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGD  753
            +N T L V L+G++Q GNT+LSALQ+ QQTGRVPLDLK+D PV +K+G+LK+ K+ ILG+
Sbjct  157  RNVTKLNVVLTGRAQAGNTVLSALQQQQQTGRVPLDLKVDAPVAVKLGKLKMKKIRILGN  216

Query  754  CMLIVNSLSTNSLISIKASTCKFKLK  831
            C L+V+SLSTN+ I+IKAS C FK+K
Sbjct  217  CKLVVDSLSTNNNINIKASDCSFKVK  242



>ref|XP_010414901.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=241

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 152/194 (78%), Gaps = 1/194 (1%)
 Frame = +1

Query  250  KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL  429
            K + CCK   W +S++V+  + +A    ++Y +F PK+P+Y V++LR+++L +N LDLSL
Sbjct  48   KGNLCCKIFCWVLSLLVIALVALAIAVAVVYFVFHPKLPRYEVNSLRVTNLGIN-LDLSL  106

Query  430  YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSG  609
             A+F V+ITA+NPNK+IGIYYE+G  + VWY  TKLC+G +P  YQGH+N T L V L+G
Sbjct  107  SAEFRVEITARNPNKRIGIYYEKGGHIGVWYDKTKLCEGPIPRFYQGHRNVTKLNVVLTG  166

Query  610  QSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNS  789
            ++Q GNT+LSALQ+ QQTGRVPLDLK+D PV +K+G+LK+ K+ ILG+C L+V+SLSTN+
Sbjct  167  RAQAGNTVLSALQQQQQTGRVPLDLKVDAPVAVKLGKLKMKKIRILGNCKLVVDSLSTNN  226

Query  790  LISIKASTCKFKLK  831
             I+IKAS C F++K
Sbjct  227  NINIKASDCSFRVK  240



>ref|XP_009144668.1| PREDICTED: protein YLS9-like [Brassica rapa]
Length=251

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 160/223 (72%), Gaps = 10/223 (4%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAWQ--------PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYL  345
            GS RSE GDP+ ++          P+K + SCCC+C+ +T+ VI +L +I+ A  GILYL
Sbjct  29   GSSRSEHGDPTKESVTQPPLLDTPPRKKRGSCCCRCVCYTLLVIFLLIVIVGAAVGILYL  88

Query  346  IFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYK  525
            +F+PK+P Y++D L+++   +N  D SL   FNV ITA+NPN+KIGIYYE GSR+SV Y 
Sbjct  89   VFRPKLPDYNIDRLQLTRFTLNQ-DSSLSTAFNVTITAKNPNEKIGIYYEDGSRISVLYM  147

Query  526  TTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDMPV  702
             T+L  GSLP+ YQGH+NTT++ V ++G +Q   +L++ LQE QQ TG +PL +++  PV
Sbjct  148  QTRLSNGSLPKFYQGHENTTIIFVEMTGYTQNATSLMATLQEQQQLTGSIPLRIRVIQPV  207

Query  703  RIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            RIK+G+LKLM+V  +  C + V+SL+ N++IS+++S CKF+ +
Sbjct  208  RIKLGKLKLMEVKFMVRCGVSVDSLAANNVISVRSSNCKFRFR  250



>ref|XP_007146942.1| hypothetical protein PHAVU_006G083600g [Phaseolus vulgaris]
 gb|ESW18936.1| hypothetical protein PHAVU_006G083600g [Phaseolus vulgaris]
Length=242

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 167/246 (68%), Gaps = 12/246 (5%)
 Frame = +1

Query  112  MSEHQRIR-IHpeveapppptrplvprGSFRSEKGDPS----TQAWQPQKSKRSCCCKCM  276
            M+EHQRI  +H       P         S++S++  P         +P K +RSCCC+ +
Sbjct  2    MAEHQRIHPVHDVEAPHRPLVPG----NSYKSDRVFPKRTFPAMHSKPPK-RRSCCCRFL  56

Query  277  WWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKIT  456
             WT+S++++L + I    GI+YL+F+PK+PKYSVD LRIS   V+  + +L A FNV IT
Sbjct  57   CWTLSILLILIVAIGITVGIIYLVFRPKLPKYSVDQLRISQFSVSDSN-TLSATFNVAIT  115

Query  457  AQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLL  636
            A NPNKKIGIYYE GS +S  Y  T+LC+GSLP+ YQGH+NTTVL+++L+G++Q  + L+
Sbjct  116  ATNPNKKIGIYYEGGSHISALYMDTQLCEGSLPKFYQGHRNTTVLDLSLTGEAQDASALM  175

Query  637  SALQEA-QQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            S +QE  QQT  +PLDLK++ PVR+K+G+LKL K+     C L+V++L  N+ ISI +S 
Sbjct  176  SRIQEQLQQTNNIPLDLKVNQPVRVKLGKLKLFKIKFRVRCKLLVDNLGANNDISISSSD  235

Query  814  CKFKLK  831
            CKF+ +
Sbjct  236  CKFRFR  241



>emb|CDP01715.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 130/252 (52%), Positives = 178/252 (71%), Gaps = 13/252 (5%)
 Frame = +1

Query  112  MSEHQRIRI--HpeveapppptrplvprGSFRSEKGDPSTQAWQPQK----------SKR  255
            M++HQRI     PE  AP   T PLV  G+ +SEKGDP    +QP +           KR
Sbjct  1    MADHQRIHPVRDPEAGAPQRTTVPLVSGGAPQSEKGDPEGNYYQPHQRTIPYSYSKPPKR  60

Query  256  SCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYA  435
            +CC KC+ WT+++I++L ++IA  AGI+YL+F+PK+PKYSVD+L I+ L +N  D SL+A
Sbjct  61   NCCKKCLCWTLALIILLILLIAISAGIIYLVFRPKLPKYSVDSLTITHLNLNN-DNSLFA  119

Query  436  KFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS  615
             FNV +TA+NPNKKIGIYYE GS L V++  T+LC+GSLP+ YQGH+NTTV+ V L+GQ+
Sbjct  120  TFNVNVTARNPNKKIGIYYEGGSDLRVYFTGTQLCEGSLPKFYQGHRNTTVMNVTLTGQT  179

Query  616  QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLI  795
            Q  N LL +LQ  +QTG +PL L+  +PVR+K+G LKLMK   L  C L V+SL+T++ I
Sbjct  180  QDANGLLQSLQAQEQTGNIPLYLRGKVPVRLKLGGLKLMKWKFLVRCWLNVDSLTTDNAI  239

Query  796  SIKASTCKFKLK  831
             I+ S CKF+ +
Sbjct  240  RIRDSRCKFRFR  251



>ref|XP_010689475.1| PREDICTED: protein YLS9-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = +1

Query  250  KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL  429
            +RSCCC+ +    S+++VL +++   A + YL+F PK+P YS+D LRI+D R+N LDLSL
Sbjct  57   RRSCCCRVICCIFSLLLVLLLVVGIFALVFYLVFHPKVPDYSIDRLRITDFRLN-LDLSL  115

Query  430  YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSG  609
            YA+FNV++TA+NPNKKIGIYYE+G ++SVWYK T LCQG  P  YQG  NTT  +V LSG
Sbjct  116  YARFNVRVTAKNPNKKIGIYYEKGGKMSVWYKDTNLCQGHFPAFYQGPLNTTATDVTLSG  175

Query  610  QSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNS  789
            Q+QYGNTL+ ALQ+ QQTG +PLDLK+D PV I+V  +KL KV  L DC L V++LS+ +
Sbjct  176  QNQYGNTLMQALQQQQQTGNIPLDLKVDQPVSIRVQSMKLGKVRFLVDCKLTVDNLSSTN  235

Query  790  LISIKASTC  816
            LISIKAS+C
Sbjct  236  LISIKASSC  244



>ref|XP_010450459.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=248

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 174/248 (70%), Gaps = 9/248 (4%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQP-------QKSKRSCCCK  270
            MS+ Q+I    + EAPP PT PLVPR S RSE GDP+     P       +K  RSC CK
Sbjct  1    MSDQQKIYPVSDPEAPPHPTAPLVPRDSSRSEHGDPTKSQQAPPLDPPRNKKGSRSCWCK  60

Query  271  CMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVK  450
            C+ +T+ VI +L +I+ A  GILYL+F+PK+P Y++D L+++  ++N  DLSL   FNV 
Sbjct  61   CVCYTLLVIFLLIVIVGAIVGILYLVFRPKVPDYNIDRLQLTRFQLN-QDLSLSTAFNVT  119

Query  451  ITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNT  630
            ITA+NPN+KIGIYYE GSR+SV Y  T L  GSLP+ YQGH+NTTV+ V ++G +Q   +
Sbjct  120  ITAKNPNEKIGIYYEDGSRISVLYMQTSLSNGSLPKFYQGHENTTVINVEMTGFNQNATS  179

Query  631  LLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKA  807
            L++ LQE Q+ TG VPL +++  PVRIK+G+LKLM+V +L  C + V+SL+ NS+I +K 
Sbjct  180  LMTILQEQQRLTGNVPLRIRVTQPVRIKLGKLKLMEVRVLVRCGVSVDSLAANSVIRVKN  239

Query  808  STCKFKLK  831
            S CK++ +
Sbjct  240  SNCKYRFR  247



>ref|XP_006302753.1| hypothetical protein CARUB_v10020873mg [Capsella rubella]
 gb|EOA35651.1| hypothetical protein CARUB_v10020873mg [Capsella rubella]
Length=240

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 156/197 (79%), Gaps = 1/197 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +  K + CCK + W +S++V+  I +A    ++Y +F PK+P+Y V++LR+++L +N LD
Sbjct  44   RNKKGNLCCKILCWVLSLLVIALIALAIAVAVVYFVFHPKLPRYEVNSLRVTNLGIN-LD  102

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
            LSL A+F V+ITA+NPN+KIGIYYE+G  + VWY  TKLC+G +P  YQGH+N T L VA
Sbjct  103  LSLSAEFRVEITARNPNEKIGIYYEKGGHIGVWYDKTKLCEGPIPRFYQGHRNVTKLNVA  162

Query  601  LSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLS  780
            L+G++QYGNT+L+ALQ+ QQTGRVPLDLK++ PV +K+G+LK+ K+ ILG+C L+V+SLS
Sbjct  163  LTGRAQYGNTILTALQQQQQTGRVPLDLKVNAPVAVKLGKLKMKKIRILGNCKLVVDSLS  222

Query  781  TNSLISIKASTCKFKLK  831
            TN+ I+IKAS C FK+K
Sbjct  223  TNNNINIKASDCSFKVK  239



>ref|XP_007201354.1| hypothetical protein PRUPE_ppa010199mg [Prunus persica]
 gb|EMJ02553.1| hypothetical protein PRUPE_ppa010199mg [Prunus persica]
Length=259

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 175/260 (67%), Gaps = 22/260 (8%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQ------------------  237
            M++HQRI        P     PLVP G+ +S++GDP+    Q                  
Sbjct  1    MADHQRI-YPDVEAPPAAAEAPLVPTGASKSDRGDPADYHHQGQHPPFPRRTIPVTHSKP  59

Query  238  -PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNP  414
             P + KRSC C+C+ WTVS+I++  I++A  AGI++L+F+PK+PK++VD L+I+   +N 
Sbjct  60   PPIRRKRSCLCRCLCWTVSLILLQIILVAITAGIIFLVFRPKLPKFTVDKLQITQFNLND  119

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
             D SL A F+V ITA+NPNKKIGIYYE GSRL+VWY  TKLC+G LP+ YQGH+NTT L 
Sbjct  120  -DQSLSATFDVSITARNPNKKIGIYYEGGSRLNVWYTGTKLCEGGLPKFYQGHRNTTQLV  178

Query  595  VALSGQSQYGNTLLSAL-QEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
            V L+GQ+   + LLS L Q+ QQTG VPL L++  PVRIK+G LKL KV  L  C L+V+
Sbjct  179  VQLTGQNPDASGLLSTLQQQQQQTGNVPLTLRVRQPVRIKLGGLKLPKVKFLVRCRLLVD  238

Query  772  SLSTNSLISIKASTCKFKLK  831
            S+S N+ I+I++S+CKF+ +
Sbjct  239  SVSANNDITIQSSSCKFRFR  258



>ref|XP_009598493.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
Length=255

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 156/225 (69%), Gaps = 12/225 (5%)
 Frame = +1

Query  190  GSFRSEKGDPSTQ---------AWQP--QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGI  336
            GS RSE GDP  Q          + P  Q  KRSCC KC+ W+  +  +L I++   A I
Sbjct  31   GSSRSENGDPERQQPPLRRSLTPYSPSKQPKKRSCCKKCLCWSCCLFFLLIILLGILAAI  90

Query  337  LYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSV  516
            +Y +FQPKIPKYSVD++RI+   +N  D+SL A FNV ITA+NPNKKIGIYYE GS LSV
Sbjct  91   IYFVFQPKIPKYSVDSMRITQFNIN-NDMSLSATFNVNITARNPNKKIGIYYENGSHLSV  149

Query  517  WYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDM  696
            WYK T LC+GSLP+ YQGH+NTTVL V ++GQ++    LL +LQ  QQ+G +PL+L++ +
Sbjct  150  WYKGTNLCEGSLPKFYQGHRNTTVLNVKMTGQTENATNLLQSLQVDQQSGTIPLNLRVKV  209

Query  697  PVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            PVRIK+G+LKL K   L  C L V+SLS +++I I+ + CK + +
Sbjct  210  PVRIKLGKLKLTKWKFLLKCRLNVDSLSQDNVIRIRDNKCKVRFR  254



>gb|KDO64296.1| hypothetical protein CISIN_1g045040mg [Citrus sinensis]
Length=255

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 162/225 (72%), Gaps = 15/225 (7%)
 Frame = +1

Query  199  RSEKGDPSTQAW-------------QPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGIL  339
            +S+ GDP+                 +P K KRSC CKCM WT+S++++L IIIAA  GIL
Sbjct  31   KSDHGDPAAAERYPPFQRTIPVMHSKPPKRKRSCLCKCMCWTISLLLILIIIIAATVGIL  90

Query  340  YLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVW  519
            +L F+PK+PK SVD +++S L ++  + SL A FNV ITA+NPN+KIGIYYE GSR++V+
Sbjct  91   WLAFKPKLPKISVDRMQVSQLNLSD-NSSLEATFNVTITARNPNEKIGIYYEGGSRINVY  149

Query  520  YKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDM  696
            Y  TKLC+GSLP+ YQGH+NTTVL + L+GQ++    L++ LQE QQ TG VPL+L++  
Sbjct  150  YTDTKLCEGSLPKFYQGHKNTTVLNIPLTGQTENATALVNTLQERQQRTGNVPLNLRVKQ  209

Query  697  PVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            PVRIK+G+LKLMKV     C L+VNSL+ ++ I I+ S+CKF+ +
Sbjct  210  PVRIKLGKLKLMKVNFRVRCRLVVNSLNPDNSIRIQDSSCKFRFR  254



>ref|XP_008235165.1| PREDICTED: protein YLS9-like [Prunus mume]
Length=259

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 174/260 (67%), Gaps = 22/260 (8%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQ------------------  237
            M++HQRI              PLVP G+ +S+KGDP+    Q                  
Sbjct  1    MADHQRI-YPDVEAPAAAAEAPLVPTGASKSDKGDPADYHHQGQYPPFPRRTIPVTHSKP  59

Query  238  -PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNP  414
             P + KRSC C+C+ WTVS+I++  I++A  AGI++L+F+PK+PK++VD L+I+   ++ 
Sbjct  60   PPIRRKRSCLCRCLCWTVSLILLQIIVVAITAGIIFLVFRPKLPKFTVDKLQITQFNLS-  118

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
             D SL A F+V ITA+NPNKKIGIYYE GSRL+VWY  TKLC+G LP+ YQGH+NTT L 
Sbjct  119  ADQSLSATFDVSITARNPNKKIGIYYEGGSRLNVWYTGTKLCEGGLPKFYQGHRNTTQLV  178

Query  595  VALSGQSQYGNTLLSAL-QEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
            V L+GQ+   + LLS L Q+ QQTG VPL L++  PVRIK+G LKL KV  L  C L+V+
Sbjct  179  VQLTGQNPDASGLLSTLQQQQQQTGNVPLTLRVRQPVRIKLGGLKLPKVKFLVRCRLLVD  238

Query  772  SLSTNSLISIKASTCKFKLK  831
            S+S N+ I+I++S+CKF+ +
Sbjct  239  SVSANNDITIQSSSCKFRFR  258



>ref|XP_010435523.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=248

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 174/247 (70%), Gaps = 9/247 (4%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPS-TQAWQP------QKSKRSCCCK  270
            MSE Q+I    + EAPP PT PLVPR S RSE GDP+ TQ   P      +K  RSC CK
Sbjct  1    MSEQQKIYPVSDPEAPPHPTAPLVPRDSSRSEHGDPTKTQQAPPLDRPRNKKGSRSCWCK  60

Query  271  CMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVK  450
            C+ + + VI +L +I+ A  GILYL+F+PK+P Y++D L+++  ++N  DLSL   FNV 
Sbjct  61   CVCYMLLVIFLLIVIVGAIVGILYLVFRPKVPDYNIDRLQLTRFQLN-QDLSLSTAFNVT  119

Query  451  ITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNT  630
            ITA+NPN+KIGIYYE GSR+SV Y  T L  GSLP+ YQGH+NTTV+ V ++G +Q   +
Sbjct  120  ITAKNPNEKIGIYYEDGSRISVLYMQTSLSNGSLPKFYQGHENTTVINVEMTGFNQNATS  179

Query  631  LLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKA  807
            L++ LQE Q+ TG +PL +++  PVRIK+G+LKLM+V +L  C + V+SL+ NS+I +K 
Sbjct  180  LMNILQEQQRLTGIIPLRIRVTQPVRIKLGKLKLMEVRVLVRCGVSVDSLAANSVIRVKN  239

Query  808  STCKFKL  828
            S CK+K 
Sbjct  240  SNCKYKF  246



>ref|XP_009784223.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
Length=253

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 157/225 (70%), Gaps = 12/225 (5%)
 Frame = +1

Query  190  GSFRSEKGDPSTQ---------AWQPQKS--KRSCCCKCMWWTVSVIVVLFIIIAACAGI  336
            GS RSE GDP  Q          + P K   KRSCC KC+ W+  ++ ++ I++   A I
Sbjct  29   GSSRSENGDPERQQPPLRRSLTPYSPSKPPKKRSCCKKCLCWSCCLLFLVIILLGILAAI  88

Query  337  LYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSV  516
            +Y +FQPKIPKYSVD++RI+   +N  D+SL A FNV ITA+NPNKKIGIYYE GS LSV
Sbjct  89   IYFVFQPKIPKYSVDSMRITQFNMN-NDMSLSATFNVNITARNPNKKIGIYYENGSHLSV  147

Query  517  WYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDM  696
            WYK T LC+G+LP+ YQGH+NTTVL V ++GQ++    LL +LQ  QQ+G +PL+L++ +
Sbjct  148  WYKGTNLCEGTLPKFYQGHRNTTVLNVKMTGQTENATNLLQSLQLDQQSGTIPLNLRVKV  207

Query  697  PVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            PVRIK+G+LKL K   L  C L V+SLS +++I I+ + CK + +
Sbjct  208  PVRIKLGKLKLTKWKFLLKCRLNVDSLSPDNVIRIRDNKCKVRFR  252



>ref|XP_006429731.1| hypothetical protein CICLE_v10012533mg [Citrus clementina]
 ref|XP_006481325.1| PREDICTED: protein YLS9-like [Citrus sinensis]
 gb|ESR42971.1| hypothetical protein CICLE_v10012533mg [Citrus clementina]
Length=256

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 162/226 (72%), Gaps = 16/226 (7%)
 Frame = +1

Query  199  RSEKGDPSTQAW-------------QPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGIL  339
            +S+ GDP+                 +P K KRSC CKCM WT+S++++L IIIAA  GIL
Sbjct  31   KSDHGDPAAAERYPPFQRTIPVMHSKPPKRKRSCLCKCMCWTISLLLILIIIIAATVGIL  90

Query  340  YLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVW  519
            +L F+PK+PK+SVD +++S L ++  + SL A FNV ITA+NPN+KIGIYYE GSR++V+
Sbjct  91   WLAFKPKLPKFSVDRMQVSQLNLSD-NSSLEATFNVTITARNPNEKIGIYYEGGSRINVY  149

Query  520  YKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDM  696
            Y  TKLC+GSLP+ YQGH+NTTVL + L+GQ++    L + LQE QQ TG VPL+L++  
Sbjct  150  YTDTKLCEGSLPKFYQGHKNTTVLNIPLTGQTENATALANTLQERQQRTGNVPLNLRVKQ  209

Query  697  PVRIKVGRLKLMKVGILGDCMLIVNSLS-TNSLISIKASTCKFKLK  831
            PVRIK+G+LKLMKV     C L+VNSL+  N+ I I+ S+CKF+ +
Sbjct  210  PVRIKLGKLKLMKVNFRVRCRLVVNSLNPDNNSIRIQDSSCKFRFR  255



>ref|XP_011096911.1| PREDICTED: protein YLS9 [Sesamum indicum]
Length=256

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 160/225 (71%), Gaps = 12/225 (5%)
 Frame = +1

Query  190  GSFRSEKGDPSTQ---------AWQPQKS--KRSCCCKCMWWTVSVIVVLFIIIAACAGI  336
            GS RSE GDP  Q          ++P K   +RSC  KC+ WT+++++V  II+   A I
Sbjct  32   GSSRSENGDPERQYPPPLRRGIPYEPLKPPRRRSCWKKCLCWTLALVIVQLIILGILAAI  91

Query  337  LYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSV  516
            +Y +FQPKIPKYSVD +RI+   +   D SL A FNV ITA+NPNKKIGIYYE GSRLSV
Sbjct  92   VYFVFQPKIPKYSVDAMRITQFNLG-NDNSLSATFNVNITARNPNKKIGIYYEGGSRLSV  150

Query  517  WYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDM  696
            WY  TKLC+GSLP+ YQGH+NTT+L + L+GQ+Q    LL +L+  QQTG +PL+L+  +
Sbjct  151  WYTGTKLCEGSLPKFYQGHRNTTLLSLTLAGQTQDAAGLLQSLRAEQQTGSIPLNLRARV  210

Query  697  PVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            PVR+K+G+LKLMK   L  C L+V+SL+ +++I I+ S+CKF+ +
Sbjct  211  PVRLKLGKLKLMKWKFLVRCRLVVDSLAADNVIRIRDSSCKFRFR  255



>ref|XP_006350456.1| PREDICTED: protein NDR1-like [Solanum tuberosum]
Length=259

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 154/228 (68%), Gaps = 15/228 (7%)
 Frame = +1

Query  190  GSFRSEKGDPSTQ--------------AWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAAC  327
            GS RSE GDP  Q                +P K KR CC +C+ W+  +  +L ++I   
Sbjct  32   GSSRSENGDPERQQPPPPLKRSLTPYSPLKPPKKKRGCCVRCLCWSCCLFFLLIVLIGIA  91

Query  328  AGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSR  507
            A ++YL+FQPK+PKYSVD++RI+   +N  D SL A FNV ITA+NPNK+IGIYYE GS 
Sbjct  92   AAVVYLVFQPKLPKYSVDSMRITQFNLN-TDTSLSATFNVNITARNPNKRIGIYYENGSH  150

Query  508  LSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLK  687
            LSVWYK T LC+G LP+ YQGH+NTT L V L+GQ+Q    LL  LQE QQ G++PL+++
Sbjct  151  LSVWYKGTNLCEGKLPKFYQGHRNTTQLNVHLTGQTQNATNLLQLLQEDQQKGKIPLNIR  210

Query  688  IDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            + +PVRIK+G+LKLMK   L  C L V++LS +++I I+ + CK + +
Sbjct  211  VKVPVRIKLGKLKLMKWKFLLKCSLNVDNLSPDNVIRIRDNKCKVRFR  258



>ref|XP_010440807.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=248

 Score =   219 bits (557),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 176/248 (71%), Gaps = 9/248 (4%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPS-TQAWQP------QKSKRSCCCK  270
            MS+ Q+I    + EAPP PT PLVPR S RSE GDP+ TQ   P      +K  RSC CK
Sbjct  1    MSDQQKIYPVSDPEAPPHPTAPLVPRDSSRSEHGDPAKTQQAPPLDPPRNKKGSRSCWCK  60

Query  271  CMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVK  450
            C+ +T+ VI +L +I+ A  GILYL+F+PK+P Y++D L+++  ++N  DLSL   FNV 
Sbjct  61   CVCYTLLVIFLLIVIVGAIVGILYLVFRPKVPDYNIDRLQLTWFQLN-QDLSLSTAFNVT  119

Query  451  ITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNT  630
            ITA+NPN+KIGIYYE GSR+SV Y  T L  GSLP+ YQGH+NTTV+ V ++G +Q   +
Sbjct  120  ITAKNPNEKIGIYYEDGSRISVLYMQTSLSNGSLPKFYQGHENTTVINVEMTGFNQNATS  179

Query  631  LLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKA  807
            L++ LQE Q+ TG +PL +++  PVRIK+G+LKLM+V +L  C + V+SL+ NS+I +K 
Sbjct  180  LMNILQEQQRLTGIIPLRIRVTQPVRIKLGKLKLMEVRVLVRCGVSVDSLAANSVIRVKN  239

Query  808  STCKFKLK  831
            S CK++ +
Sbjct  240  SNCKYRFR  247



>ref|XP_010908302.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=252

 Score =   219 bits (557),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 173/254 (68%), Gaps = 17/254 (7%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQ--------------PQKS  249
            M+EHQRI  HP     P P  PLVPRG  RS+KGDP+    Q              P K 
Sbjct  1    MAEHQRI--HPVDVEAPSPAAPLVPRGISRSDKGDPAAVGGQYPPYRRTIPVSHSRPPKR  58

Query  250  KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL  429
            +RSCCCKC+  T+  I++L I++AA  GILYLIF PK+PKYSVD L +S   V+  +L  
Sbjct  59   RRSCCCKCLCCTILTIIILIILVAATIGILYLIFNPKLPKYSVDRLTVSAFTVD-TNLKA  117

Query  430  YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSG  609
            +A F+V +TA+NPNK IGIYYE GS LSVWY    LC+G  PE YQGH+NTTVL V ++G
Sbjct  118  HASFDVTVTAENPNKGIGIYYEGGSHLSVWYSGFSLCEGVFPEFYQGHRNTTVLTVVMTG  177

Query  610  QSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNS  789
            ++Q G+T ++ALQ+ Q TG VPLD K D+PVR+K+G LKL KV     C L+V+SL+ N+
Sbjct  178  EAQLGSTEMAALQQQQTTGMVPLDFKGDVPVRLKLGSLKLWKVTSRVRCNLVVDSLTANN  237

Query  790  LISIKASTCKFKLK  831
             I I++S+CKF+LK
Sbjct  238  RIQIRSSSCKFRLK  251



>ref|XP_006302605.1| hypothetical protein CARUB_v10020710mg, partial [Capsella rubella]
 gb|EOA35503.1| hypothetical protein CARUB_v10020710mg, partial [Capsella rubella]
Length=304

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 122/255 (48%), Positives = 176/255 (69%), Gaps = 16/255 (6%)
 Frame = +1

Query  112  MSEHQRIR-IHpeveapppptrplvprGSFRSEKGDPSTQA---WQPQ----------KS  249
            MS+HQ+I  +H        PT PLVPRGS RSE+GDPS +     +PQ          K 
Sbjct  50   MSQHQKIYPVHDPEAPAARPTAPLVPRGSSRSEQGDPSKEDSLNQRPQRFLPLTPPKKKG  109

Query  250  KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL  429
             RSCCC C+ +T   +++L +++ A  GILYL+F+PK+P YS+D L+++   VN  D SL
Sbjct  110  SRSCCCTCVCYTFCFLLLLVVVVGATIGILYLVFKPKLPDYSIDRLQLTRFAVN-QDSSL  168

Query  430  YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSG  609
               FNV ITA+NPN+KIGIYYE GS+++VWY   +L  GSLP+ YQGH+NTTV+ V ++G
Sbjct  169  TTAFNVTITAKNPNEKIGIYYEDGSKITVWYLEHQLSNGSLPKFYQGHENTTVIYVEMTG  228

Query  610  QSQYGNTLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTN  786
            Q+Q   +L + L+E QQ TG +PL ++++ PVR+K G+LKL +V  L  C + V+SL+TN
Sbjct  229  QTQNALSLRTTLEEQQQRTGNIPLRIRVNQPVRVKFGKLKLFEVRFLVRCGVFVDSLATN  288

Query  787  SLISIKASTCKFKLK  831
            ++I I++S+CKF+L+
Sbjct  289  NVIKIQSSSCKFRLR  303



>gb|KFK35622.1| hypothetical protein AALP_AA4G015200 [Arabis alpina]
Length=226

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 157/195 (81%), Gaps = 1/195 (1%)
 Frame = +1

Query  247  SKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLS  426
            +KR+ CCKC+ W +S++V+  I +A    ++YL+F PK+P+Y VD+L++S+L +N LDLS
Sbjct  32   NKRNMCCKCLCWALSLLVIAVIALAVAVAVIYLVFHPKLPQYEVDSLQVSNLGIN-LDLS  90

Query  427  LYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALS  606
            L A+F V+ITA+NPN KIGIYYE+G  + VWY  TKLC+G +P  YQGH+N T L V L+
Sbjct  91   LSAEFKVEITARNPNDKIGIYYEKGGHIGVWYTKTKLCEGPIPRFYQGHRNVTKLNVGLT  150

Query  607  GQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTN  786
            G++QYGNT+L+ALQ+ QQTGRVPLDL++D PV +K+G+LKL K+ ILG+C L+V+SLSTN
Sbjct  151  GRAQYGNTVLTALQQQQQTGRVPLDLRVDAPVAVKLGKLKLKKIRILGNCKLVVDSLSTN  210

Query  787  SLISIKASTCKFKLK  831
            + I+IKAS C F+LK
Sbjct  211  NRINIKASDCSFRLK  225



>ref|XP_008813411.1| PREDICTED: protein YLS9-like [Phoenix dactylifera]
Length=249

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 137/186 (74%), Gaps = 1/186 (1%)
 Frame = +1

Query  274  MWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKI  453
            ++ T   IVVL I+I A AGILYLIF PKIPKYSVD L IS   V+   +++ A FNV +
Sbjct  64   LFCTTLTIVVLIILIGATAGILYLIFDPKIPKYSVDRLSISAFDVDS-SMTVRASFNVTV  122

Query  454  TAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTL  633
            TA+NPNKKIGIYYE GS LSV Y  + LC GS PE YQGH++TTVL + ++G++Q G+ L
Sbjct  123  TARNPNKKIGIYYEEGSYLSVRYTDSSLCNGSFPEFYQGHRSTTVLSIIMTGETQLGSGL  182

Query  634  LSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            L+ LQ  QQTG +PL  K D+PVR+K GRLKL KV     C L+VNSLS ++ ISIK+S+
Sbjct  183  LTELQRQQQTGTIPLLFKGDVPVRVKFGRLKLWKVTFGVRCNLVVNSLSASNQISIKSSS  242

Query  814  CKFKLK  831
            CKFKLK
Sbjct  243  CKFKLK  248



>ref|XP_006285529.1| hypothetical protein CARUB_v10006971mg [Capsella rubella]
 gb|EOA18427.1| hypothetical protein CARUB_v10006971mg [Capsella rubella]
Length=249

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 180/249 (72%), Gaps = 10/249 (4%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQP--------QKSKRSCCC  267
            MS+HQ+I    ++EAPP PT PLVPR S RSE GDP+    QP        +K  RSC C
Sbjct  1    MSDHQKIHPVSDLEAPPHPTVPLVPRDSSRSEHGDPTKTQQQPTPLDPQRKKKRSRSCWC  60

Query  268  KCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNV  447
            +C+ +T+ ++V+L +I+ A  GILYL+F+PK+P Y++D L+++  ++N  DLSL   FNV
Sbjct  61   RCLCYTLLILVLLIVIVGAIVGILYLVFKPKLPDYNIDRLQLTRFQLN-QDLSLSTAFNV  119

Query  448  KITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGN  627
             ITA+NPN+KIGIYYE GS++SV Y  TKL  GSLP+ YQGH+NTTV+ V ++G  Q   
Sbjct  120  TITAKNPNEKIGIYYENGSKISVLYMQTKLSNGSLPKFYQGHENTTVINVEMTGFDQNAT  179

Query  628  TLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIK  804
            +L++ LQ+ Q+ TG VPL +++  PVRIK+G+LKLM+V +L  C + VNSL+ NS+I ++
Sbjct  180  SLMNILQDQQRLTGNVPLRIRVTQPVRIKLGKLKLMEVRVLVRCGVSVNSLAANSVIRVQ  239

Query  805  ASTCKFKLK  831
            +S CK++++
Sbjct  240  SSNCKYRVR  248



>ref|XP_006391539.1| hypothetical protein EUTSA_v10019035mg [Eutrema salsugineum]
 gb|ESQ28825.1| hypothetical protein EUTSA_v10019035mg [Eutrema salsugineum]
Length=253

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 180/253 (71%), Gaps = 14/253 (6%)
 Frame = +1

Query  112  MSEHQRIR-IHpeveapppptrplvprGSFRSEKGDPS----TQAWQ-------PQKSKR  255
            MS H +I  +H        PT PLVPRGS RSE GDP+    TQ  Q       P+K  R
Sbjct  1    MSHHPKIHPLHDPEAPRTHPTAPLVPRGSSRSENGDPTKVPLTQRPQRFVPLAPPKKRGR  60

Query  256  SCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYA  435
            SCCC+C+ +T+ ++++L +++ A  GILYL+F+PK+P YS+D L+++   ++  D SL  
Sbjct  61   SCCCRCVCYTLCLLLLLVVVVGATIGILYLVFKPKLPDYSIDRLQLTRFVLS-QDSSLST  119

Query  436  KFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS  615
             FNV ITA+NPN+KIGIYYE GS+++VWY   KL +GSLP+ YQGH+NTTV+ V ++GQ+
Sbjct  120  AFNVTITAKNPNEKIGIYYEDGSKITVWYMEAKLSEGSLPKFYQGHENTTVIYVEMTGQT  179

Query  616  QYGNTLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSL  792
            Q  + L++ LQE QQ TG +PL ++++ PVR+K G+LKLM++  L  C ++V+SL+TN++
Sbjct  180  QDASGLMTTLQEQQQRTGNIPLRIRVNQPVRVKFGKLKLMELRFLVRCGVLVDSLATNNV  239

Query  793  ISIKASTCKFKLK  831
            I I++S+C F+LK
Sbjct  240  IKIQSSSCNFRLK  252



>ref|XP_009400299.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=253

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 151/219 (69%), Gaps = 9/219 (4%)
 Frame = +1

Query  199  RSEKGDPS--------TQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQ  354
            RSEKGDP             +P K  RSCCC+C+  T+  I++L + +AA  GILYL+F 
Sbjct  35   RSEKGDPEPYPRRTLPVAHSRPPKKHRSCCCRCLCCTICTIILLVVAVAATLGILYLVFD  94

Query  355  PKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTK  534
            PK+PKYSVD LR++   V+  +L+ +A F V +TA NPNK IGIYY  GSRL+V Y    
Sbjct  95   PKLPKYSVDRLRVTAFSVD-QNLTAHATFEVTVTATNPNKGIGIYYVSGSRLNVLYSGYD  153

Query  535  LCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKV  714
            LCQG+LPE YQGH+NTTVL V LSG  Q G+T+++ LQ+ QQTG VPLD K D+PVR+K+
Sbjct  154  LCQGTLPEFYQGHRNTTVLGVVLSGDVQLGSTVMNELQQQQQTGTVPLDFKGDVPVRVKL  213

Query  715  GRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            G LKL KV     C L+V+SL+ N+ I IK S+CKF LK
Sbjct  214  GGLKLWKVTSRVRCSLVVDSLTANNQIRIKNSSCKFSLK  252



>emb|CDY26995.1| BnaC06g12110D [Brassica napus]
Length=307

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 157/223 (70%), Gaps = 10/223 (4%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAWQ-------PQKSKR-SCCCKCMWWTVSVIVVLFIIIAACAGILYL  345
            GS RSE GDP+ ++         P++ KR SCCC+C+ +T+ VI +L +I+ A  GILYL
Sbjct  85   GSSRSEHGDPTKESVTQPPLLDTPRRKKRGSCCCRCVCYTLLVIFLLIVIVGAAVGILYL  144

Query  346  IFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYK  525
            +F+PK+P Y++D L ++    N  D SL   FNV ITA+NPN+KIGIYYE GSR+SV Y 
Sbjct  145  VFRPKLPDYNIDRLLLTRFTFN-QDSSLSTAFNVTITAKNPNEKIGIYYEDGSRISVLYM  203

Query  526  TTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDMPV  702
             T+L  GSLP+ YQGH+NTT++ V ++G ++   +L++ LQE Q+ T  +PL +++  PV
Sbjct  204  QTRLSNGSLPKFYQGHENTTIIFVEMTGYTRNATSLMATLQEQQRLTESIPLRIRVTQPV  263

Query  703  RIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            RIK+G+LKLM+V  +  C + V+SL+ N++I +++S CKF+ +
Sbjct  264  RIKLGKLKLMEVKFMVRCSVSVDSLAANNVIRVRSSNCKFRFR  306



>ref|XP_010917454.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=252

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 170/254 (67%), Gaps = 17/254 (7%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQ--------------PQKS  249
            M+EHQ+I  HP     P    PLVP    RS+KGDP+  A Q              P K 
Sbjct  1    MAEHQKI--HPVDVEAPSQAAPLVPPELSRSDKGDPAAVAGQYPPYRRTIPISHSRPPKR  58

Query  250  KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL  429
            +RSCCCKC+  T+   ++L I++AA  GILYLIF PK+PKYSVD L +S   V+  +L+ 
Sbjct  59   RRSCCCKCVCCTILTTIILIILVAATLGILYLIFDPKLPKYSVDRLAVSAFTVD-TNLTA  117

Query  430  YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSG  609
            +A F+V +TA+NPNK IGIYYE GS LSVWY    LC+G  PE YQGH+NTTVL V + G
Sbjct  118  HASFDVTVTAENPNKGIGIYYEGGSHLSVWYSGFSLCEGVFPEFYQGHRNTTVLTVVMKG  177

Query  610  QSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNS  789
            ++Q G+T ++ALQ+ Q TG VPLD K D+PVR+K+G LKL KV     C L+V+SL+ N+
Sbjct  178  EAQLGSTEMAALQQQQTTGMVPLDFKGDVPVRVKLGSLKLWKVTSRVRCNLVVDSLTANN  237

Query  790  LISIKASTCKFKLK  831
             I I++S+CKF+LK
Sbjct  238  RIQIRSSSCKFRLK  251



>ref|XP_002870497.1| hypothetical protein ARALYDRAFT_330253 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46756.1| hypothetical protein ARALYDRAFT_330253 [Arabidopsis lyrata subsp. 
lyrata]
Length=248

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 179/248 (72%), Gaps = 9/248 (4%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPS-TQAWQP------QKSKRSCCCK  270
            MS+HQ+I    + EAPP PT PLVPRGS RSE GDP+ TQ   P      +K  RSC C+
Sbjct  1    MSDHQKIHPVSDPEAPPHPTAPLVPRGSSRSEHGDPTKTQQAAPLDPPSKKKGSRSCWCR  60

Query  271  CMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVK  450
            C+ +T+ V+ +L +I+ A  GILYL+F+PK+P Y++D L+++  ++N  DLSL   FNV 
Sbjct  61   CVCYTLLVLFLLIVIVGAIVGILYLVFRPKLPDYNIDRLQLTRFQLN-QDLSLSTGFNVT  119

Query  451  ITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNT  630
            ITA+NPN+KIGIYYE GSR+SV Y  T+L  GSLP+ YQGH+NTT++ V ++G +Q   +
Sbjct  120  ITAKNPNEKIGIYYEDGSRISVLYMQTRLSNGSLPKFYQGHENTTIISVEMTGFNQNATS  179

Query  631  LLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKA  807
            +++ LQE Q+ TG +PL +++  PVRIK+G+LKLM+V  L  C + V+SL+ NS+I +++
Sbjct  180  VMTTLQEQQRLTGSIPLRIRVTQPVRIKLGKLKLMEVRFLVRCGVSVDSLAANSVIRVRS  239

Query  808  STCKFKLK  831
            S CK++ +
Sbjct  240  SNCKYRFR  247



>gb|EAY79014.1| hypothetical protein OsI_34123 [Oryza sativa Indica Group]
Length=266

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 169/266 (64%), Gaps = 27/266 (10%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvp---rGSFRSEKGDPSTQAWQP--------------  240
            M++HQR+RIHP         RP  P    GSFRS+KGDP+ Q  QP              
Sbjct  1    MADHQRMRIHPVDLEAGGRHRPTAPLVPGGSFRSDKGDPAAQPQQPPSHGHLPPPPPRRV  60

Query  241  ---------QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRI  393
                      K +R CCC+ +   +  +V+L ++ AA  G LYL+F PK P+YSVD L +
Sbjct  61   APPVPPLPPPKRRRGCCCRLICCVLVTVVLLAVLAAAAVGALYLVFDPKAPRYSVDRLSV  120

Query  394  SDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGH  573
            S+ +V+P  L+  A+F+V +TA NPN +IGIYYE GS LSVWY   +L +G+LP  YQGH
Sbjct  121  SEFQVDPT-LTATARFDVTVTATNPNARIGIYYEAGSSLSVWYDAHRLARGALPAFYQGH  179

Query  574  QNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGD  753
            +NTTVL V ++GQ+Q G  ++SALQ+AQ+TG VPL  + D+PVR+++G L+L KV     
Sbjct  180  RNTTVLAVVMAGQAQLGGAVMSALQDAQRTGAVPLVFRADVPVRVELGSLRLWKVTSRVR  239

Query  754  CMLIVNSLSTNSLISIKASTCKFKLK  831
            C L+V+SL  N+ ++IKAS CKF LK
Sbjct  240  CDLVVDSLGVNNPVNIKASNCKFSLK  265



>gb|EYU25653.1| hypothetical protein MIMGU_mgv1a020532mg [Erythranthe guttata]
Length=260

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 169/260 (65%), Gaps = 21/260 (8%)
 Frame = +1

Query  112  MSEHQRIR-IHpeve------apppptrplvprGSFRSEKGDPSTQ-------------A  231
            M++HQRI  +H           P   T PL+ RGS +SE GDP  Q              
Sbjct  1    MADHQRIHPVHEHEAMVVVPLTPQKATAPLITRGSSKSEHGDPERQYPPPPVHRTIPYAP  60

Query  232  WQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVN  411
             +P K + SCC KC+ WT+S++++  +II   A ++Y +F PK+PKYSVD +RI+     
Sbjct  61   LKPPKRRSSCCKKCLCWTISLLLLQIVIIGILAAVVYFVFDPKVPKYSVDAMRITQFNFG  120

Query  412  PLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVL  591
              D SL A FNV ITA+NPNKKIGIYYE GS LSVWY   KLC+GSLP+ YQGH+NTT+L
Sbjct  121  -NDNSLSATFNVNITARNPNKKIGIYYESGSHLSVWYTGRKLCEGSLPKFYQGHRNTTLL  179

Query  592  EVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
             +AL+GQ+     L+ +LQ  QQTG +PL+++  +PVR+K+G+LKLMK   L  C + V+
Sbjct  180  SLALAGQTADAAGLVQSLQAQQQTGSIPLNIRAKVPVRLKLGKLKLMKWKFLVRCRVDVD  239

Query  772  SLSTNSLISIKASTCKFKLK  831
            SL+ N+ ISI+ S+CKF+ +
Sbjct  240  SLAANNAISIRDSSCKFRFR  259



>ref|XP_010108943.1| hypothetical protein L484_027138 [Morus notabilis]
 gb|EXC20583.1| hypothetical protein L484_027138 [Morus notabilis]
Length=252

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 158/232 (68%), Gaps = 21/232 (9%)
 Frame = +1

Query  190  GSFRSEKGD------------------PSTQAWQPQKSKRSCCCKCMWWTVSVIVVLFII  315
            G+  SEKGD                  P TQ+  P K +RSC CKC+ WT  VI++L I+
Sbjct  21   GASNSEKGDQASASASAPPYPPFQRTIPLTQS-NPPKKRRSCLCKCLCWTFLVILILIIV  79

Query  316  IAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYE  495
            IAA  GILYL+F+PK+PKYS+D+L+++   ++  D SL A F+V ITA+NPNKKIGIYYE
Sbjct  80   IAATVGILYLVFRPKLPKYSIDDLQVTQFNLSSND-SLSATFDVTITARNPNKKIGIYYE  138

Query  496  RGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQ-EAQQTGRV  672
             GSR+ V+Y  T+LCQG+LP+ YQGH+NTT L V ++GQ+     L++ LQ E QQTG V
Sbjct  139  GGSRIRVYYNGTRLCQGALPKFYQGHRNTTRLVVPVTGQTANATGLINDLQAERQQTGYV  198

Query  673  PLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
            PL L++  PVRIK+GRLKL K+     C L V+SL  N+ I I+ S+CKF+L
Sbjct  199  PLALRVKQPVRIKLGRLKLFKIKFYVKCSLNVDSLEANNDIKIRNSSCKFRL  250



>ref|XP_009339806.1| PREDICTED: protein YLS9 [Pyrus x bretschneideri]
Length=262

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 160/229 (70%), Gaps = 17/229 (7%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAWQ----------------PQKSKRSCCCKCMWWTVSVIVVLFIIIA  321
            G+ +S++ DP+ Q  +                P   KRSCC +C+ WTV ++V+  ++IA
Sbjct  30   GASKSDRSDPADQQGKYPPLQRRTFPVMHSPPPIHKKRSCCRRCLCWTVCLLVLQVVVIA  89

Query  322  ACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERG  501
               GI+YL+F+PK+PKYSVD L+I+   V+    SLYA F+V ITA+NPNKKIGIYYE G
Sbjct  90   IAGGIIYLVFRPKLPKYSVDQLQITQFNVSTDQTSLYATFDVNITARNPNKKIGIYYEGG  149

Query  502  SRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSAL-QEAQQTGRVPL  678
            SRLSVWY  TKLC+G+LP+ YQGH+NTT L V ++GQ+Q  + LL+AL Q+ QQTG VPL
Sbjct  150  SRLSVWYTRTKLCEGALPKFYQGHRNTTQLLVQMTGQNQDASGLLTALQQQQQQTGNVPL  209

Query  679  DLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFK  825
             L++  PV+IK+G  KL K+  +  C L+V+ LS N+ I+I++S+CKF+
Sbjct  210  TLRVRQPVKIKLGSFKLPKIFFVVRCRLVVDRLSENNDITIQSSSCKFR  258



>ref|NP_175856.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 gb|AAD25632.1|AC005287_34 Hypothetical protein [Arabidopsis thaliana]
 gb|AAT68329.1| hypothetical protein At1g54540 [Arabidopsis thaliana]
 gb|AAT69205.1| hypothetical protein At1g54540 [Arabidopsis thaliana]
 gb|AEE33116.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=239

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = +1

Query  253  RSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLY  432
            R+ CCK   W +S++V+  I +A    ++Y +F PK+P Y V++LR+++L +N LDLSL 
Sbjct  47   RNMCCKIFCWVLSLLVIALIALAIAVAVVYFVFHPKLPSYEVNSLRVTNLGIN-LDLSLS  105

Query  433  AKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQ  612
            A+F V+ITA+NPN+KIGIYYE+G  + VWY  TKLC+G +P  YQGH+N T L VAL+G+
Sbjct  106  AEFKVEITARNPNEKIGIYYEKGGHIGVWYDKTKLCEGPIPRFYQGHRNVTKLNVALTGR  165

Query  613  SQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSL  792
            +QYGNT+L+ALQ+ QQTGRVPLDLK++ PV IK+G LK+ K+ ILG C L+V+SLSTN+ 
Sbjct  166  AQYGNTVLAALQQQQQTGRVPLDLKVNAPVAIKLGNLKMKKIRILGSCKLVVDSLSTNNN  225

Query  793  ISIKASTCKFKLK  831
            I+IKAS C FK K
Sbjct  226  INIKASDCSFKAK  238



>ref|NP_198513.1| NDR1/HIN1-like 25 [Arabidopsis thaliana]
 gb|AED94133.1| NDR1/HIN1-like 25 [Arabidopsis thaliana]
Length=248

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 178/248 (72%), Gaps = 9/248 (4%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPS-TQAWQP------QKSKRSCCCK  270
            MS+HQ+I    + EAPP PT PLVPRGS RSE GDP+ TQ   P      +K  RSC C+
Sbjct  1    MSDHQKIHPVSDPEAPPHPTAPLVPRGSSRSEHGDPTKTQQAAPLDPPREKKGSRSCWCR  60

Query  271  CMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVK  450
            C+ +T+ V+ +L +I+ A  GILYL+F+PK P Y++D L+++  ++N  DLSL   FNV 
Sbjct  61   CVCYTLLVLFLLIVIVGAIVGILYLVFRPKFPDYNIDRLQLTRFQLN-QDLSLSTAFNVT  119

Query  451  ITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNT  630
            ITA+NPN+KIGIYYE GS++SV Y  T++  GSLP+ YQGH+NTT++ V ++G +Q   +
Sbjct  120  ITAKNPNEKIGIYYEDGSKISVLYMQTRISNGSLPKFYQGHENTTIILVEMTGFTQNATS  179

Query  631  LLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKA  807
            L++ LQE Q+ TG +PL +++  PVRIK+G+LKLMKV  L  C + V+SL+ NS+I +++
Sbjct  180  LMTTLQEQQRLTGSIPLRIRVTQPVRIKLGKLKLMKVRFLVRCGVSVDSLAANSVIRVRS  239

Query  808  STCKFKLK  831
            S CK++ +
Sbjct  240  SNCKYRFR  247



>ref|XP_008802758.1| PREDICTED: protein YLS9-like [Phoenix dactylifera]
Length=251

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 132/252 (52%), Positives = 168/252 (67%), Gaps = 14/252 (6%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprG-SFRSEKGD-----------PSTQAWQPQKSKR  255
            M+EHQRI        PP           S + + GD           P   A +P K KR
Sbjct  1    MAEHQRIHPEDVEAPPPSAPPAPGNFSQSAKRDAGDQRAPLPQGTTIPVAHA-KPTKKKR  59

Query  256  SCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYA  435
            SCCC+C+ WT+  I+VL I++AA AGILYLIF PKIPKYSVD L IS   V+  ++++ A
Sbjct  60   SCCCRCLCWTILTIIVLIILVAATAGILYLIFDPKIPKYSVDRLSISAFDVDN-NMTVRA  118

Query  436  KFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS  615
             F+V +TA+NPNKKIGIYYE GS LSVWY  + LC GS PE YQGH+NTTVL V L+G++
Sbjct  119  GFDVTVTARNPNKKIGIYYEDGSYLSVWYTDSSLCNGSFPEFYQGHRNTTVLNVTLTGET  178

Query  616  QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLI  795
            Q G+ +L+ LQ+ QQTG +PL  K D+PVR+K G LKL K+     C L+VNSLS ++ I
Sbjct  179  QLGSEILTELQQQQQTGTIPLLFKGDVPVRVKFGSLKLWKMTFRVRCNLVVNSLSASNKI  238

Query  796  SIKASTCKFKLK  831
            SIK+S+CKFKLK
Sbjct  239  SIKSSSCKFKLK  250



>ref|XP_008376206.1| PREDICTED: protein YLS9-like [Malus domestica]
Length=252

 Score =   213 bits (543),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 158/220 (72%), Gaps = 9/220 (4%)
 Frame = +1

Query  190  GSFRSEKGDPS-------TQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLI  348
            G+ +S+  DP          +  P   KRSCCC+C+ W V ++V+  ++IA   GI+YL+
Sbjct  30   GASKSDGSDPPLRRTFPVMHSPPPIHKKRSCCCRCLCWIVCLLVLQVVVIAITGGIIYLV  89

Query  349  FQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKT  528
            F+PK+PKYSVD L+I+   V+  D SLY+ F+V ITA+NPNKKIGIYYE GSRLSV+Y  
Sbjct  90   FRPKLPKYSVDQLQITQFNVS-TDQSLYSTFDVSITARNPNKKIGIYYEGGSRLSVFYTR  148

Query  529  TKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSAL-QEAQQTGRVPLDLKIDMPVR  705
            TKLC+G+LP+ YQGH+NTT L V L+GQ+Q  + LL+ L Q+ QQTG VPL L++  PV+
Sbjct  149  TKLCEGALPKFYQGHRNTTQLLVTLTGQTQDASGLLATLQQQQQQTGNVPLTLRVRQPVK  208

Query  706  IKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFK  825
            IK+G LKL K+  L  C L+V+SLS N+ I I++S+CKF+
Sbjct  209  IKLGSLKLPKIFFLVRCRLLVDSLSENNDIRIQSSSCKFR  248



>ref|XP_010315726.1| PREDICTED: protein YLS9-like [Solanum lycopersicum]
Length=256

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 151/228 (66%), Gaps = 16/228 (7%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAWQP--------------QKSKRSCCCKCMWWTVSVIVVLFIIIAAC  327
            GS RSE GDP  Q   P               K KR CC +C+ WT  +  +L ++I   
Sbjct  30   GSSRSENGDPERQQSPPLLKRSLTPYSPLKSPKKKRGCCVRCLCWTCCLFFLLIVLIGIA  89

Query  328  AGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSR  507
            A ++YL+FQPK+PKYS+D++R +   +N  D SL A FNV ITA+NPNK+IGIYYE GS 
Sbjct  90   AAVIYLVFQPKLPKYSIDSMRSTQFNLN-TDTSLSATFNVNITARNPNKRIGIYYENGSH  148

Query  508  LSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLK  687
            LSVWYK T LCQG LP+ YQGH+NTT L V L+GQ++    LL  LQE QQ G++PL+++
Sbjct  149  LSVWYKGTNLCQGKLPKFYQGHRNTTQLNVHLTGQTENATNLLQLLQEDQQAGKIPLNIR  208

Query  688  IDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            + +PVRIK+G+LKLMK   L  C L V++LS + +I I+ + CK + +
Sbjct  209  VKVPVRIKLGKLKLMKWKFLLKCSLNVDNLSQD-IIRIRDNKCKVRFR  255



>ref|XP_011030182.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=264

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 163/231 (71%), Gaps = 18/231 (8%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAW----------------QPQKSKRSCCCKCMWWTVSVIVVLFIIIA  321
            GS +S+KGDP+                    +P K +RSCCC+ + WT+S++++L ++I 
Sbjct  34   GSSKSDKGDPAAHIHDHHYPPFQRTIPVTHTKPPKKRRSCCCRFLCWTLSLLLLLILVIG  93

Query  322  ACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERG  501
            A AGILYL+FQPK+PK+S+D L+I+   +   + SL A FNV ITA+NPNKK+G+YYE G
Sbjct  94   AVAGILYLVFQPKLPKFSIDALQITRFNLT-NNSSLSATFNVTITARNPNKKVGVYYEGG  152

Query  502  SRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGN-TLLSALQEAQQTGRVPL  678
            S +SVWY  T LCQGSLP+ YQGH+NTTVL V LSGQ+  GN  L S  Q+ QQTG +PL
Sbjct  153  SHISVWYTGTNLCQGSLPKFYQGHRNTTVLSVLLSGQTDDGNTLLTSLQQQQQQTGIIPL  212

Query  679  DLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            +L+++ PVR+K+G+LKLMKV     C L ++SL+ NS I+I+ S+CKFK +
Sbjct  213  NLRVEQPVRVKLGKLKLMKVKFRVRCRLDIDSLAPNSAINIRNSSCKFKFR  263



>ref|XP_002318799.2| NDR1/HIN1-LIKE 25 family protein [Populus trichocarpa]
 gb|EEE97019.2| NDR1/HIN1-LIKE 25 family protein [Populus trichocarpa]
Length=267

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 161/231 (70%), Gaps = 18/231 (8%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAW----------------QPQKSKRSCCCKCMWWTVSVIVVLFIIIA  321
            GS +S++GDP+                    +P K +RSCCC+ + WT+S++++L ++I 
Sbjct  37   GSSKSDQGDPAAHIHGHHYPPFQRTIPVTHTKPPKKRRSCCCRFLCWTLSLLLLLILVIG  96

Query  322  ACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERG  501
            A AGILYL+FQPK+PK+S+D L+I+   +   + SL A FNV ITA+NPNKK+G+YYE G
Sbjct  97   AVAGILYLVFQPKLPKFSIDTLQITRFNLT-NNSSLSATFNVTITARNPNKKVGVYYEGG  155

Query  502  SRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGN-TLLSALQEAQQTGRVPL  678
            S +SVWY  T LCQGSLP+ YQGH+NTTVL V LSGQ+  GN  L S  Q+  Q G +PL
Sbjct  156  SHISVWYTGTNLCQGSLPKFYQGHRNTTVLNVLLSGQTDDGNTLLTSLQQQQLQAGIIPL  215

Query  679  DLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            +L++D PVRIK+G+LKLMKV     C L ++SL+ N+ I+I+ S+CKF+ +
Sbjct  216  NLRVDQPVRIKLGKLKLMKVKFRVRCRLDIDSLAANNAINIRNSSCKFRFR  266



>gb|KDP46951.1| hypothetical protein JCGZ_07968 [Jatropha curcas]
Length=256

 Score =   211 bits (538),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 161/226 (71%), Gaps = 16/226 (7%)
 Frame = +1

Query  199  RSEKGDPSTQA--------------WQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGI  336
            +S+KGDP+ +                +P K +RSC C+C+ WT+S+I+++ +I+   AGI
Sbjct  31   KSDKGDPAVEENRYPPFQRTLPVIHSKPPKKRRSCFCRCLCWTLSLILLIIVIVGIIAGI  90

Query  337  LYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSV  516
            LYL+F+PK+PKYS+D L+I++  ++  D SL A F+V+ITA+NPNKKIGIYYE GS + V
Sbjct  91   LYLVFRPKLPKYSIDGLQITEFNLS-TDSSLSAAFDVRITAENPNKKIGIYYEGGSHIGV  149

Query  517  WYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKID  693
             Y  TKLC+GSLP+ YQGH+N TVL V L GQ+Q    L ++LQ+ QQ  G +PL+L++ 
Sbjct  150  LYLGTKLCEGSLPKFYQGHRNITVLNVPLQGQTQDAYGLFTSLQQQQQENGVIPLNLRVK  209

Query  694  MPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
             PVR+K+G+LKLMKV  L  C L V+SLST + I I+ S+CKF+L+
Sbjct  210  QPVRVKLGKLKLMKVKFLVKCKLDVDSLSTANDIRIRNSSCKFRLR  255



>ref|XP_010935586.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=249

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 149/199 (75%), Gaps = 1/199 (1%)
 Frame = +1

Query  235  QPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNP  414
            +P K KR  CC+C+ WTV  I++L I+IAA AGILYLIF PKIPKYSVD LR+S   V+ 
Sbjct  51   KPTKKKRCSCCRCLCWTVLTIIILIILIAAIAGILYLIFDPKIPKYSVDRLRVSSFDVDN  110

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
             ++++ A FN+ +TA+NPNKKIGIYYE GS LSVWY    LC GS P  YQGH+NTTVL 
Sbjct  111  -NMTVTAGFNMTVTARNPNKKIGIYYEDGSYLSVWYTDNSLCNGSFPAFYQGHRNTTVLN  169

Query  595  VALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNS  774
            V L+G++Q G  +L+ LQ+ QQTG +PL  K D+PVR+K G LKL K+     C L+VNS
Sbjct  170  VILTGETQLGGEILTELQQQQQTGTIPLLFKGDVPVRVKFGSLKLWKMTFRVKCNLVVNS  229

Query  775  LSTNSLISIKASTCKFKLK  831
            LST++ ISIK+S+CKFKLK
Sbjct  230  LSTSNQISIKSSSCKFKLK  248



>ref|XP_002321933.1| hypothetical protein POPTR_0015s12720g [Populus trichocarpa]
 gb|EEF06060.1| hypothetical protein POPTR_0015s12720g [Populus trichocarpa]
Length=273

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 158/234 (68%), Gaps = 21/234 (9%)
 Frame = +1

Query  190  GSFRSEKGDPSTQ-------------------AWQPQKSKRSCCCKCMWWTVSVIVVLFI  312
            GS +S+KGD +                       +P K + SCCC+ + WT+ ++ +L +
Sbjct  40   GSSKSDKGDAAAHLLPRDNQHYPPFQRTIPVIHTKPPKERSSCCCRFLCWTLFLLFLLIL  99

Query  313  IIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYY  492
            +I   AGILYL+FQPK+PKYS+D L+I+   +   + SL A F+V ITA+NPNKK+G+YY
Sbjct  100  LIGVVAGILYLVFQPKLPKYSIDRLQITQFNLTN-NSSLTATFDVTITARNPNKKVGVYY  158

Query  493  ERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSAL-QEAQQTGR  669
            E GS +SVWY  T LCQGSLP  YQGH+NTTVL V LSGQ+   NTL+++L Q+ QQTG 
Sbjct  159  EGGSHISVWYTGTNLCQGSLPRFYQGHRNTTVLNVVLSGQTNDANTLITSLQQQQQQTGI  218

Query  670  VPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            +PL+L++  PVRIK G+LK+MKV     C L V++L+ N+ I+I+ S+CKF+ +
Sbjct  219  IPLNLRVIQPVRIKFGKLKIMKVKFRVRCRLDVDNLAANNAINIRNSSCKFRFR  272



>ref|XP_010551645.1| PREDICTED: protein YLS9-like [Tarenaya hassleriana]
Length=252

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/252 (49%), Positives = 182/252 (72%), Gaps = 13/252 (5%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQA-------WQP----QKSKRS  258
            MS+HQ+I    + EAPP PT PLVPRG+ RS++GDP  ++       +QP    +K KRS
Sbjct  1    MSDHQKIHPVSDQEAPPQPTAPLVPRGASRSDRGDPGKESPPRRTVPYQPLPPPKKRKRS  60

Query  259  CCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAK  438
            CCC+C+ +T+ V+++L +++ A  GILYL+F+PKIP YS+D L ++   +N  + SL A 
Sbjct  61   CCCRCVCYTLCVLLLLVVLLGATVGILYLVFKPKIPDYSIDRLELTRFSLN-QNSSLSAT  119

Query  439  FNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQ  618
            FNV ITA+NPN+KIGIYYE GS++SVWY  TKL +GSLP+ YQGH+NTTVL V ++GQ++
Sbjct  120  FNVTITAKNPNEKIGIYYEDGSKISVWYTRTKLSEGSLPKFYQGHENTTVLYVEMTGQTE  179

Query  619  YGNTLLS-ALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLI  795
                L++   Q+  QTG +PL ++++ PVRIK+G+LKLM+V     C + V++L+ N++I
Sbjct  180  DAAGLMATLQQQQLQTGNIPLRVRVNQPVRIKLGKLKLMEVKFRVRCGVSVDNLAPNNVI  239

Query  796  SIKASTCKFKLK  831
             I+ S+CK +L+
Sbjct  240  RIQRSSCKIRLR  251



>gb|KHN18621.1| Putative syntaxin-24 [Glycine soja]
Length=243

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 156/216 (72%), Gaps = 6/216 (3%)
 Frame = +1

Query  199  RSEKGDPS----TQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIP  366
            +S+KG P         +P K +RSCCC+ M WT+S++++L I IA   GILYL+F+PK+P
Sbjct  28   KSDKGIPQRTFPVMHSKPPKRRRSCCCRFMCWTLSILLILIIAIAITIGILYLVFRPKLP  87

Query  367  KYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQG  546
            KYSVD LRIS   V+  + +LYA FNV ITA+NPNKKIGIYYE GS +S WY  TKLC+G
Sbjct  88   KYSVDQLRISQFNVSDNN-TLYATFNVAITARNPNKKIGIYYEGGSHISAWYMDTKLCEG  146

Query  547  SLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEA-QQTGRVPLDLKIDMPVRIKVGRL  723
            SLP+ YQGH+NTTVL++ L+GQ+   + L++ +QE  QQT  VPL+LK++ PVR+K G+L
Sbjct  147  SLPKFYQGHRNTTVLDLPLTGQAPDASGLVNRIQEQLQQTNNVPLNLKVNQPVRVKFGKL  206

Query  724  KLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            KL KV     C L V++   ++ I I +S+CKFKL+
Sbjct  207  KLFKVKFRVRCRLEVDNFGASNDIRISSSSCKFKLR  242



>ref|XP_003553153.1| PREDICTED: protein YLS9 [Glycine max]
Length=244

 Score =   208 bits (529),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 156/216 (72%), Gaps = 6/216 (3%)
 Frame = +1

Query  199  RSEKGDPS----TQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIP  366
            +S+KG P         +P K +RSCCC+ M WT+S++++L I IA   GILYL+F+PK+P
Sbjct  29   KSDKGIPQRTFPVMHSKPPKRRRSCCCRFMCWTLSILLILIIAIAITIGILYLVFRPKLP  88

Query  367  KYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQG  546
            KYSVD LRIS   V+  + +LYA FNV ITA+NPNKKIGIYYE GS +S WY  TKLC+G
Sbjct  89   KYSVDQLRISQFNVSDNN-TLYATFNVAITARNPNKKIGIYYEGGSHISAWYMDTKLCEG  147

Query  547  SLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEA-QQTGRVPLDLKIDMPVRIKVGRL  723
            SLP+ YQGH+NTTVL++ L+GQ+   + L++ +QE  QQT  VPL+LK++ PVR+K G+L
Sbjct  148  SLPKFYQGHRNTTVLDLPLTGQAPDASGLVNRIQEQLQQTNNVPLNLKVNQPVRVKFGKL  207

Query  724  KLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            KL KV     C L V++   ++ I I +S+CKFKL+
Sbjct  208  KLFKVKFRVRCRLEVDNFGASNDIRISSSSCKFKLR  243



>ref|XP_002888443.1| hypothetical protein ARALYDRAFT_894159 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64702.1| hypothetical protein ARALYDRAFT_894159 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 173/252 (69%), Gaps = 13/252 (5%)
 Frame = +1

Query  112  MSEHQRI-RIHpeveapppptrplvprGSFRSEKGDPS----TQAWQ------PQKSKRS  258
            MS+HQ+I  +H        PT PL PRGS RSE GDPS     Q  Q      P K +RS
Sbjct  1    MSQHQKIYPVHDPEAPTARPTAPLFPRGSSRSEHGDPSKVPLNQRPQRFVPLAPPKKRRS  60

Query  259  CCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAK  438
            CCC+C+ +T   +++L + + A  GILYL+F+PK+P YS+D L+++   +N  D SL   
Sbjct  61   CCCRCVCYTFCFLLLLVVAVGATIGILYLVFKPKLPDYSIDRLQLTRFALN-QDSSLTTA  119

Query  439  FNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQ  618
            FNV ITA+NPN+KIGIYYE GS+++VWY   +L  GSLP+ YQGH+NTTV+ V ++GQ+Q
Sbjct  120  FNVTITAKNPNEKIGIYYEDGSKITVWYLENQLSNGSLPKFYQGHENTTVIYVEMTGQTQ  179

Query  619  YGNTLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLI  795
                L + L+E QQ TG +PL ++++ PVR+K G+LKL +V  L  C + V+SL+TN++I
Sbjct  180  NALGLRTTLEEQQQRTGNIPLRIRVNQPVRVKFGKLKLFEVRFLVRCGVFVDSLATNNVI  239

Query  796  SIKASTCKFKLK  831
             I++S+CKF+L+
Sbjct  240  KIQSSSCKFRLR  251



>ref|XP_009613605.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
Length=260

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 153/230 (67%), Gaps = 17/230 (7%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAWQPQKSKRS--------------CCCK-CMWWTVSVIVVLFIIIAA  324
            GSFRSEKGDP  Q  +P   +R+              C CK C+  T  ++ +L III A
Sbjct  31   GSFRSEKGDPERQQLEPPLRRRTIPYYPPLKPPKKRICSCKRCLCCTCCLLFLLIIIIGA  90

Query  325  CAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL-YAKFNVKITAQNPNKKIGIYYERG  501
             A   Y +FQPKIP YSVD++RI+    N  D+SL +A FNV ITA+NPNKKIGIYYE G
Sbjct  91   LAAAFYFVFQPKIPNYSVDSMRITQFNFNN-DMSLLFATFNVNITARNPNKKIGIYYESG  149

Query  502  SRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLD  681
            S LSVWY   KLC+GSLP+ YQGH+NTTVL + LSGQ++  + LL +LQ  QQ G +PL+
Sbjct  150  SHLSVWYTGVKLCEGSLPKFYQGHRNTTVLSLNLSGQTENASELLQSLQVDQQKGSIPLN  209

Query  682  LKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            L+  +PV++K+G+LKLMK   L  C L V+SLS N+ I I+ S CKF  +
Sbjct  210  LRAKVPVKLKIGKLKLMKWKFLVKCRLDVDSLSANNAIRIRNSDCKFGFR  259



>ref|NP_564862.1| late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 gb|AAM63331.1| unknown [Arabidopsis thaliana]
 gb|AEE34412.1| late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=252

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 174/252 (69%), Gaps = 13/252 (5%)
 Frame = +1

Query  112  MSEHQRIR-IHpeveapppptrplvprGSFRSEKGDPS----TQAWQ------PQKSKRS  258
            MS+HQ+I  +     A   PT PLVPRGS RSE GDPS     Q  Q      P K +RS
Sbjct  1    MSQHQKIYPVQDPEAATARPTAPLVPRGSSRSEHGDPSKVPLNQRPQRFVPLAPPKKRRS  60

Query  259  CCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAK  438
            CCC+C  +T   +++L + + A  GILYL+F+PK+P YS+D L+++   +N  D SL   
Sbjct  61   CCCRCFCYTFCFLLLLVVAVGASIGILYLVFKPKLPDYSIDRLQLTRFALN-QDSSLTTA  119

Query  439  FNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQ  618
            FNV ITA+NPN+KIGIYYE GS+++VWY   +L  GSLP+ YQGH+NTTV+ V ++GQ+Q
Sbjct  120  FNVTITAKNPNEKIGIYYEDGSKITVWYMEHQLSNGSLPKFYQGHENTTVIYVEMTGQTQ  179

Query  619  YGNTLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLI  795
              + L + L+E QQ TG +PL ++++ PVR+K G+LKL +V  L  C + V+SL+TN++I
Sbjct  180  NASGLRTTLEEQQQRTGNIPLRIRVNQPVRVKFGKLKLFEVRFLVRCGVFVDSLATNNVI  239

Query  796  SIKASTCKFKLK  831
             I++S+CKF+L+
Sbjct  240  KIQSSSCKFRLR  251



>dbj|BAB11640.1| unnamed protein product [Arabidopsis thaliana]
Length=256

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 178/256 (70%), Gaps = 17/256 (7%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPS-TQAWQP------QKSKRSCCCK  270
            MS+HQ+I    + EAPP PT PLVPRGS RSE GDP+ TQ   P      +K  RSC C+
Sbjct  1    MSDHQKIHPVSDPEAPPHPTAPLVPRGSSRSEHGDPTKTQQAAPLDPPREKKGSRSCWCR  60

Query  271  CMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVK  450
            C+ +T+ V+ +L +I+ A  GILYL+F+PK P Y++D L+++  ++N  DLSL   FNV 
Sbjct  61   CVCYTLLVLFLLIVIVGAIVGILYLVFRPKFPDYNIDRLQLTRFQLN-QDLSLSTAFNVT  119

Query  451  ITAQNPNKKIGIYYERGSRLSVWYKTTKLCQ--------GSLPELYQGHQNTTVLEVALS  606
            ITA+NPN+KIGIYYE GS++SV Y  T++          GSLP+ YQGH+NTT++ V ++
Sbjct  120  ITAKNPNEKIGIYYEDGSKISVLYMQTRISNGTDFVISTGSLPKFYQGHENTTIILVEMT  179

Query  607  GQSQYGNTLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLST  783
            G +Q   +L++ LQE Q+ TG +PL +++  PVRIK+G+LKLMKV  L  C + V+SL+ 
Sbjct  180  GFTQNATSLMTTLQEQQRLTGSIPLRIRVTQPVRIKLGKLKLMKVRFLVRCGVSVDSLAA  239

Query  784  NSLISIKASTCKFKLK  831
            NS+I +++S CK++ +
Sbjct  240  NSVIRVRSSNCKYRFR  255



>ref|XP_011048775.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=273

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 158/234 (68%), Gaps = 21/234 (9%)
 Frame = +1

Query  190  GSFRSEKGDPSTQ-------------------AWQPQKSKRSCCCKCMWWTVSVIVVLFI  312
            GS +S+KGD ++                      +P K + SCCC+ + W +S++ +L +
Sbjct  40   GSSKSDKGDAASHLLSRDNQHYPPFQRTIPVIHTKPPKERSSCCCRFLCWILSLLFLLIL  99

Query  313  IIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYY  492
            +I   AGILYL+FQPK+PKYS+D L+I+   +   + SL A F++ ITA+NPNKK+G+YY
Sbjct  100  LIGVVAGILYLVFQPKLPKYSIDRLQITQFNLTN-NSSLTATFDITITARNPNKKVGVYY  158

Query  493  ERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSAL-QEAQQTGR  669
            E GS +SVWY  T LCQGSLP  YQGH+NTTVL V LSGQ+   NTL+++L Q+ QQTG 
Sbjct  159  EGGSHISVWYTGTNLCQGSLPRFYQGHKNTTVLNVVLSGQTNDANTLITSLQQQQQQTGI  218

Query  670  VPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            +PL+L++  PVRIK G+LK+MK+     C L V+ L+ N+ I+I+ S+CKF+ +
Sbjct  219  IPLNLRVIQPVRIKFGKLKIMKLKFRVRCRLDVDDLAANNAINIRNSSCKFRFR  272



>gb|KHN24686.1| Putative syntaxin-24 [Glycine soja]
Length=246

 Score =   206 bits (523),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 165/245 (67%), Gaps = 9/245 (4%)
 Frame = +1

Query  115  SEHQRIRIHpeveapppptrplvprGSFRSEKGDPS----TQAWQPQKSKRSCCCKCMWW  282
            +EHQRI  HP  +        +    +   +KG P         +P K +RSCCC+ M W
Sbjct  4    AEHQRI--HPVHDVEAQHRPLVPQNIAKSDDKGIPHRTFPVMHSKPPKRRRSCCCRFMCW  61

Query  283  TVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQ  462
            T+S++++L I IA   GILYL+F+PK+PKYSVD LRIS   V+  + +LYA FNV ITA+
Sbjct  62   TLSILLILIIAIAITIGILYLVFRPKLPKYSVDQLRISQFNVSDNN-TLYATFNVAITAR  120

Query  463  NPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSA  642
            NPNKKIGIYYE GS +S WY  T+LC+GSLP+ YQGH+NTTVL++ L+GQ+   N L++ 
Sbjct  121  NPNKKIGIYYEGGSHISAWYMETQLCEGSLPKFYQGHRNTTVLDLPLTGQAHDANGLVNR  180

Query  643  LQEA-QQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIV-NSLSTNSLISIKASTC  816
            +QE  QQT  VPL+LK++ PVR+K+G+LKL KV     C L V N L  ++ I I  S+C
Sbjct  181  IQEQLQQTNNVPLNLKVNQPVRVKLGKLKLFKVKFRVRCKLEVDNILGASNDIRISRSSC  240

Query  817  KFKLK  831
            KFKL+
Sbjct  241  KFKLR  245



>ref|XP_006405958.1| hypothetical protein EUTSA_v10028131mg [Eutrema salsugineum]
 gb|ESQ47411.1| hypothetical protein EUTSA_v10028131mg [Eutrema salsugineum]
Length=253

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 156/225 (69%), Gaps = 12/225 (5%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAW-QP---------QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGIL  339
            GS RSE GDP+  +  QP         ++ +RSC C+C+ +T+ V+ +L +I+ A  GIL
Sbjct  29   GSSRSEHGDPTKVSLTQPPPLDLPPRNKRGRRSCWCRCLCYTLLVLFLLVVIVGAAVGIL  88

Query  340  YLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVW  519
            YL+F+PK+P Y++D L+++   +N  D SL   FNV ITA+NPN KIGIYYE GSR+SV 
Sbjct  89   YLVFRPKLPDYNIDRLQLTRFTLN-QDSSLSTAFNVTITAKNPNSKIGIYYEEGSRISVL  147

Query  520  YKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDM  696
            Y  T+L  GSLP+ YQGH+NTT + V ++G +Q    L++ LQE QQ TG +PL +++  
Sbjct  148  YMQTRLSNGSLPKFYQGHENTTTIFVEMTGYTQNATGLMTTLQEQQQLTGSIPLRIRVTQ  207

Query  697  PVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            PVRIK+G+LKLM+V  L  C + V++L+ N++I +++S CKF+ +
Sbjct  208  PVRIKLGKLKLMEVKFLVRCGVSVDNLAANNVIRVRSSNCKFRFR  252



>ref|NP_001239877.1| uncharacterized protein LOC100778798 [Glycine max]
 gb|ACU20165.1| unknown [Glycine max]
 gb|KHN41016.1| Putative syntaxin-24 [Glycine soja]
Length=255

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 146/208 (70%), Gaps = 6/208 (3%)
 Frame = +1

Query  217  PSTQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRIS  396
            P  Q   P K +RSCCC+   W +S++++L + I    GILYL+F+PK+PKYSVD LR++
Sbjct  50   PLKQTKPPPKKRRSCCCRFFCWLISILLILIVAIGITVGILYLVFRPKLPKYSVDELRVT  109

Query  397  --DLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQG  570
              DL  N    SL   FN+ ITA+NPNKKIGI Y  GS +S WY  TKLC+GSLP+ YQG
Sbjct  110  HFDLADN---NSLSVTFNLTITARNPNKKIGIDYRGGSHISAWYMDTKLCEGSLPKFYQG  166

Query  571  HQNTTVLEVALSGQSQYGNTLLSALQ-EAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGIL  747
            H+NTTVL + L+G++Q    L S LQ + Q++G VPL+LK+  PVRIK+G+LKL K+   
Sbjct  167  HRNTTVLSIPLTGKTQDATGLQSTLQNQLQESGNVPLNLKVKQPVRIKLGKLKLFKIKFR  226

Query  748  GDCMLIVNSLSTNSLISIKASTCKFKLK  831
              C ++V+SLS NS I I++S+CKF+ +
Sbjct  227  VRCKIVVDSLSANSSIRIQSSSCKFRFR  254



>ref|XP_003538353.1| PREDICTED: protein YLS9-like [Glycine max]
Length=246

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 165/245 (67%), Gaps = 9/245 (4%)
 Frame = +1

Query  115  SEHQRIRIHpeveapppptrplvprGSFRSEKGDPS----TQAWQPQKSKRSCCCKCMWW  282
            +EHQRI  HP  +        +    +   +KG P         +P K +RSCCC+ M W
Sbjct  4    AEHQRI--HPVHDVEAQHRPLVPQNIAKSDDKGIPHRTFPVMHSKPPKRRRSCCCRFMCW  61

Query  283  TVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQ  462
            T+S++++L I IA   GILYL+F+PK+PKYSVD LRIS   V+  + +LYA FNV ITA+
Sbjct  62   TLSILLILIIAIAITIGILYLVFRPKLPKYSVDQLRISQFNVSDNN-TLYATFNVAITAR  120

Query  463  NPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSA  642
            NPNKKIGIYYE GS +S WY  T+LC+GSLP+ YQGH+NTTVL++ L+GQ+   N L++ 
Sbjct  121  NPNKKIGIYYEGGSHISAWYMETQLCEGSLPKFYQGHRNTTVLDLPLTGQAHDANGLVNR  180

Query  643  LQEA-QQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIV-NSLSTNSLISIKASTC  816
            +QE  QQT  VPL+LK++ PVR+K+G+LKL KV     C L V N L  ++ I I  S+C
Sbjct  181  IQEQLQQTNNVPLNLKVNQPVRVKLGKLKLFKVKFRVRCKLEVDNILGASNDIRISRSSC  240

Query  817  KFKLK  831
            KF+L+
Sbjct  241  KFRLR  245



>gb|ACU21028.1| unknown [Glycine max]
Length=255

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 146/208 (70%), Gaps = 6/208 (3%)
 Frame = +1

Query  217  PSTQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRIS  396
            P  +   P K +RSCCC+   W +S++++L + I    GILYL+F+PK+PKYSVD LR++
Sbjct  50   PLKRTKPPPKKRRSCCCRFFCWLISILLILIVAIGITVGILYLVFRPKLPKYSVDELRVT  109

Query  397  --DLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQG  570
              DL  N    SL   FN+ ITA+NPNKKIGI Y  GS +S WY  TKLC+GSLP+ YQG
Sbjct  110  HFDLADN---NSLSVTFNLTITARNPNKKIGIDYRGGSHISAWYMDTKLCEGSLPKFYQG  166

Query  571  HQNTTVLEVALSGQSQYGNTLLSALQ-EAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGIL  747
            H+NTTVL + L+G++Q    L S LQ + Q++G VPL+LK+  PVRIK+G+LKL K+   
Sbjct  167  HRNTTVLSIPLTGKTQDATGLQSTLQNQLQESGNVPLNLKVKQPVRIKLGKLKLFKIKFR  226

Query  748  GDCMLIVNSLSTNSLISIKASTCKFKLK  831
              C ++V+SLS NS I I++S+CKF+ +
Sbjct  227  VRCKIVVDSLSANSSIRIQSSSCKFRFR  254



>ref|XP_004306186.1| PREDICTED: protein NDR1-like [Fragaria vesca subsp. vesca]
Length=261

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 172/261 (66%), Gaps = 22/261 (8%)
 Frame = +1

Query  112  MSEHQRIRI--HpeveapppptrplvprGSFRSEKGDPST------QAWQPQKS------  249
            M++HQRI      E   P  P  PLVPRG  +S+KGDP+       Q + P +       
Sbjct  1    MADHQRIHPVQDVEAVLPHAPDAPLVPRGDSKSDKGDPTGREIEAGQYYSPFQGRRIPVM  60

Query  250  ------KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVN  411
                  KRSC  KC+ WT+ ++++  I++A   GI+YL+F+PK+PKY+V  L+I+   +N
Sbjct  61   HSTPPKKRSCFRKCLCWTICLLLLQVIVVAITGGIIYLVFRPKLPKYTVSKLQITQFTLN  120

Query  412  PLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVL  591
              D SL A F+V ITA+NPNKKIGIYYE GSR++VWY  TKLC+G LP+ YQGH+NTT L
Sbjct  121  D-DQSLNATFDVSITARNPNKKIGIYYEGGSRINVWYTNTKLCEGGLPKFYQGHRNTTEL  179

Query  592  EVALSGQSQYGN-TLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIV  768
             V LSGQ+Q  +  L +  Q+ QQTG VP+ L++  PVRIK+G  KL K   +  C L+V
Sbjct  180  VVPLSGQTQDASGLLTTLQQQQQQTGNVPITLRVRQPVRIKLGSFKLPKFKFVVRCRLLV  239

Query  769  NSLSTNSLISIKASTCKFKLK  831
            +SLS N+ ISI++S+CKF+L+
Sbjct  240  DSLSENNDISIQSSSCKFRLR  260



>ref|XP_004500420.1| PREDICTED: uncharacterized protein LOC101493957 [Cicer arietinum]
Length=256

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 169/255 (66%), Gaps = 16/255 (6%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQPQ--------------KS  249
            M++HQRI    +VEA   PT PLV R   +S++G P   A+ P               K 
Sbjct  2    MADHQRIYPANDVEAQTKPTVPLVTRNMAKSDRGSPWQHAYSPPVPKRHFPVRHSMPPKK  61

Query  250  KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL  429
            +RSCCC+ + W   ++++L I I+   G+LYL F+PK+PKYSVD LRI+   ++  + SL
Sbjct  62   RRSCCCRFLCWIFCILLILIIAISITIGVLYLAFRPKLPKYSVDRLRITQFNLSDNN-SL  120

Query  430  YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSG  609
            +  FNV ITA+NPNKKIGI Y  GS +S WYK T+LC+GSLP+ YQGH+NTTVL + L+G
Sbjct  121  FVTFNVTITARNPNKKIGINYVDGSHISAWYKDTELCEGSLPKFYQGHRNTTVLNLPLTG  180

Query  610  QSQYGNTLLSALQEA-QQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTN  786
            Q+Q    L++ LQ+  Q+ G +PL++K++  VR+K+G+LK+ +V     C L+V+SL  +
Sbjct  181  QTQDATGLVNTLQQQLQEAGNIPLNIKVNQNVRVKLGKLKIFRVKFRVRCRLVVDSLGAD  240

Query  787  SLISIKASTCKFKLK  831
            + IS+  S+CKF+L+
Sbjct  241  NDISVSDSSCKFRLR  255



>emb|CDY53530.1| BnaCnng25340D [Brassica napus]
Length=255

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/254 (46%), Positives = 169/254 (67%), Gaps = 14/254 (6%)
 Frame = +1

Query  112  MSEHQRIR---IHpeveapppptrplvprGSFRSEKGDPSTQA-WQP---------QKSK  252
            MSEHQ+I           P  PT PLV RGS RSE GD + ++  QP         +K +
Sbjct  1    MSEHQKIHPVSDPEAPPPPTHPTVPLVSRGSSRSEHGDTTKESVTQPPQLDSPQRKKKGR  60

Query  253  RSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLY  432
            RSC C+C+ +T+ V+ +L +++ A  GILYL+F+PK+P Y++D L+++   +N  D SL 
Sbjct  61   RSCWCRCVCYTLLVLFLLIVVVGAAVGILYLVFRPKLPDYNIDRLQLTRSILNNQDSSLS  120

Query  433  AKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQ  612
              FNV ITA+NPN+KIGIYYE GS++SV Y  T+L  GSLP+ YQGH+NTT++ V ++G 
Sbjct  121  TAFNVTITAKNPNEKIGIYYEDGSKISVLYMQTRLSNGSLPKFYQGHENTTIIFVEMTGY  180

Query  613  SQYGNTLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNS  789
            +Q   +L++ L E QQ TG +PL +++  PVRIK+G+LKL +V     C + V+SL+ NS
Sbjct  181  TQNATSLMATLLEQQQLTGSIPLRIRVTQPVRIKLGKLKLPEVKFFVRCGVFVDSLAANS  240

Query  790  LISIKASTCKFKLK  831
            +I ++ S CKF+ K
Sbjct  241  VIRVRNSNCKFRFK  254



>ref|XP_007141987.1| hypothetical protein PHAVU_008G242900g [Phaseolus vulgaris]
 gb|ESW13981.1| hypothetical protein PHAVU_008G242900g [Phaseolus vulgaris]
Length=258

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 147/200 (74%), Gaps = 2/200 (1%)
 Frame = +1

Query  235  QPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNP  414
            +P K +RSCCC+   W +S++++L + IA   GILYL+F+PK+PKYSVD LR++    + 
Sbjct  59   RPPKKRRSCCCRFFCWLISILLILIVAIAITVGILYLVFRPKVPKYSVDELRVTQFDTSD  118

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
             + SL A FN+ ITA+NPNKKIGIYYE GS +S WY+ TKLC+GSLP+ YQGH+NTTVL 
Sbjct  119  NN-SLSATFNLTITARNPNKKIGIYYEGGSHISSWYEDTKLCEGSLPKFYQGHRNTTVLS  177

Query  595  VALSGQSQYGN-TLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
            + L+GQ+Q       S  Q+ Q+TG VPL+LK++ PVRIK+G+LKL  +     C ++V+
Sbjct  178  IPLTGQTQDATGLQSSLQQQLQETGNVPLNLKVNQPVRIKLGKLKLFTIKFRIRCNIVVD  237

Query  772  SLSTNSLISIKASTCKFKLK  831
            +L+ NS I I++S+CKF+ +
Sbjct  238  NLTANSSIRIQSSSCKFRFR  257



>ref|XP_009139699.1| PREDICTED: protein YLS9 [Brassica rapa]
Length=255

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 155/225 (69%), Gaps = 11/225 (5%)
 Frame = +1

Query  190  GSFRSEKGDPSTQA-WQP---------QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGIL  339
            GS RSE GD + ++  QP         +K +RSC C+C+ +T+ V+ +L +++ A  GIL
Sbjct  30   GSSRSEHGDTTKESVTQPPQLDSPQRKKKGRRSCWCRCVCYTLLVLFLLIVVVGAAVGIL  89

Query  340  YLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVW  519
            YL+F+PK+P Y++D L+++   +N  D SL   FNV ITA+NPN+KIGIYYE GS++SV 
Sbjct  90   YLVFRPKLPDYNIDRLQLTRSILNNQDSSLSTAFNVTITAKNPNEKIGIYYEDGSKISVL  149

Query  520  YKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDM  696
            Y  T+L  GSLP+ YQGH+NTT++ V ++G +Q   +L++ L E QQ TG +PL +++  
Sbjct  150  YMQTRLSNGSLPKFYQGHENTTIIFVEMTGYTQNATSLMATLLEQQQLTGSIPLRIRVTQ  209

Query  697  PVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            PVRIK+G+LKL +V     C + V+SLS NS+I ++ S CKF+ +
Sbjct  210  PVRIKLGKLKLPEVKFFVRCGVFVDSLSANSVIRVRNSNCKFRFR  254



>ref|XP_003544951.1| PREDICTED: protein YLS9 [Glycine max]
 gb|KHN39516.1| Putative syntaxin-24 [Glycine soja]
Length=260

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 145/206 (70%), Gaps = 2/206 (1%)
 Frame = +1

Query  217  PSTQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRIS  396
            P      P K +RSCCC+   W +S++++L + I    GILYL+F+PK+PKYSVD L+++
Sbjct  55   PVKHTKPPTKKRRSCCCRFFCWLISILLILIVAIGITIGILYLVFRPKLPKYSVDELKVT  114

Query  397  DLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQ  576
            +  +   + SL   FN+ ITA+NPNKKIGI Y  GS +S WY  TKLC+GSLP+ YQGH+
Sbjct  115  NFDLADNN-SLSVTFNLTITARNPNKKIGIDYRGGSHISAWYMDTKLCEGSLPKFYQGHR  173

Query  577  NTTVLEVALSGQSQYGNTLLSALQ-EAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGD  753
            NTT+L + L+G++Q    L + LQ + Q+TG VPL+L++  PVRIK+G+LKL K+     
Sbjct  174  NTTILSIPLTGKTQDATGLQNTLQNQLQETGNVPLNLRVKQPVRIKLGKLKLFKIKFRVR  233

Query  754  CMLIVNSLSTNSLISIKASTCKFKLK  831
            C ++V+SLS NS I I++S+CKF+ +
Sbjct  234  CRIVVDSLSANSSIRIQSSSCKFRFR  259



>ref|XP_002530555.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31823.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   201 bits (510),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 160/225 (71%), Gaps = 13/225 (6%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAWQP-----------QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGI  336
             S +S++GDP+ Q + P              KRSCCCKC+ WT+S++++L ++I    GI
Sbjct  28   NSSKSDQGDPAAQQYPPFQRTFPVKHSKPPKKRSCCCKCLCWTLSLLLILIVVIGIIIGI  87

Query  337  LYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSV  516
            LYL+F+PK+P +S+D L+I+   ++  D SL A F+V ITA NPN+KIGIYYE GS + V
Sbjct  88   LYLVFRPKLPDFSIDRLQITQFNLS-SDSSLSAAFDVTITATNPNEKIGIYYEGGSHIGV  146

Query  517  WYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKID  693
            WY  TKLC+GSLP+ YQGH+NTTVL V L+G +Q    LL++LQ+ QQ TG +PL+L++ 
Sbjct  147  WYSGTKLCEGSLPKFYQGHENTTVLNVPLTGHTQDAAGLLTSLQQQQQATGIIPLNLRVK  206

Query  694  MPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
             PVRIK+G+LKL ++  L  C L V+SLSTN+ ISI+ S+CKF L
Sbjct  207  QPVRIKLGKLKLFEIKFLVKCKLDVDSLSTNNDISIRNSSCKFSL  251



>ref|XP_007020018.1| NDR1/HIN1-like 25, putative [Theobroma cacao]
 gb|EOY17243.1| NDR1/HIN1-like 25, putative [Theobroma cacao]
Length=254

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 164/226 (73%), Gaps = 13/226 (6%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAWQPQK-----------SKRSCCCKCMWWTVSVIVVLFIIIAACAGI  336
            G+ +S+KG P  + + P K            KRSC CKC+ WT+S++++L +I+    GI
Sbjct  29   GTLKSDKGKP-VEEYPPFKRTLPSMHSKPPKKRSCFCKCLCWTLSLLLLLIVILGIIVGI  87

Query  337  LYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSV  516
            ++L+FQPK+PKYS+D L+I+   ++ +D SL A F+V ITA+NPNK+IGIYYE GSR+SV
Sbjct  88   IFLVFQPKLPKYSIDTLQITQFDLSSVDSSLSATFDVTITARNPNKRIGIYYEGGSRISV  147

Query  517  WYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGN-TLLSALQEAQQTGRVPLDLKID  693
            WY  TKLC+GS+P+ YQGH+NTTVL + LSGQ Q G   L +  ++ QQTG +PL L+++
Sbjct  148  WYTETKLCEGSMPKFYQGHRNTTVLLLPLSGQIQNGTGLLTTLQEQQQQTGNIPLRLRVN  207

Query  694  MPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
             PVR+K+G+LKLMKV     C L+V++LS N+ I I++S+CKF+L+
Sbjct  208  QPVRVKLGKLKLMKVKFSVRCGLVVDALSANNAIRIQSSSCKFRLR  253



>gb|AAF23842.1|AC007234_14 F1E22.7 [Arabidopsis thaliana]
Length=260

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/260 (47%), Positives = 174/260 (67%), Gaps = 21/260 (8%)
 Frame = +1

Query  112  MSEHQRIR-IHpeveapppptrplvprGSFRSEKGDPS----TQAWQ------PQKSKRS  258
            MS+HQ+I  +     A   PT PLVPRGS RSE GDPS     Q  Q      P K +RS
Sbjct  1    MSQHQKIYPVQDPEAATARPTAPLVPRGSSRSEHGDPSKVPLNQRPQRFVPLAPPKKRRS  60

Query  259  CCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAK  438
            CCC+C  +T   +++L + + A  GILYL+F+PK+P YS+D L+++   +N  D SL   
Sbjct  61   CCCRCFCYTFCFLLLLVVAVGASIGILYLVFKPKLPDYSIDRLQLTRFALN-QDSSLTTA  119

Query  439  FNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQ--------GSLPELYQGHQNTTVLE  594
            FNV ITA+NPN+KIGIYYE GS+++VWY   +L          GSLP+ YQGH+NTTV+ 
Sbjct  120  FNVTITAKNPNEKIGIYYEDGSKITVWYMEHQLSNGTSLLVYSGSLPKFYQGHENTTVIY  179

Query  595  VALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
            V ++GQ+Q  + L + L+E QQ TG +PL ++++ PVR+K G+LKL +V  L  C + V+
Sbjct  180  VEMTGQTQNASGLRTTLEEQQQRTGNIPLRIRVNQPVRVKFGKLKLFEVRFLVRCGVFVD  239

Query  772  SLSTNSLISIKASTCKFKLK  831
            SL+TN++I I++S+CKF+L+
Sbjct  240  SLATNNVIKIQSSSCKFRLR  259



>emb|CDY38564.1| BnaA05g12930D [Brassica napus]
Length=634

 Score =   207 bits (528),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 154/218 (71%), Gaps = 12/218 (6%)
 Frame = +1

Query  190  GSFRSEKGDPSTQAWQ--------PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYL  345
            GS RSE GDP+ ++          P+K + SCCC+C+ +T+ VI +L +I+ A  GILYL
Sbjct  29   GSSRSEHGDPTKESVTQPPLLDTPPRKKRGSCCCRCVCYTLLVIFLLIVIVGAAVGILYL  88

Query  346  IFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYK  525
            +F+PK+P Y++D L+++   +N  D SL   FNV ITA+NPN+KIGIYYE GSR+SV Y 
Sbjct  89   VFRPKLPDYNIDRLQLTRFTLNQ-DSSLSTAFNVTITAKNPNEKIGIYYEDGSRISVLYM  147

Query  526  TTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDMPV  702
             T+L  GSLP+ YQGH+NTT++ V ++G +Q   +L++ LQE QQ TG +PL +++  PV
Sbjct  148  QTRLSNGSLPKFYQGHENTTIIFVEMTGYTQNATSLMATLQEQQQLTGSIPLRIRVIQPV  207

Query  703  RIKVGRLKLMKVGILGDCM--LIVNSLSTNSLISIKAS  810
            RIK+G+LKLM+V  +      + V+SL+ N++IS++++
Sbjct  208  RIKLGKLKLMEVKFMFMVRYGVSVDSLAANNVISVRSN  245



>ref|XP_004982769.1| PREDICTED: uncharacterized protein LOC101757821 [Setaria italica]
Length=274

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 170/274 (62%), Gaps = 35/274 (13%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQP-----------------  240
            M++HQRI    ++E+   PT PLVP GSFRS+KGDP+ +A  P                 
Sbjct  1    MADHQRIH-PVDLESGNRPTAPLVPGGSFRSDKGDPAPRANNPHHYQQQQQRGHGHGPLP  59

Query  241  ----------------QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKY  372
                            ++  R CCC+ +      +VVL ++ AA AG LYLIF+PK P+Y
Sbjct  60   PPPRRVAPLAPLPPPQKRRGRGCCCRFLCCAAVTLVVLAVLAAAAAGALYLIFRPKAPRY  119

Query  373  SVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSL  552
            SVD L +S  +V+P  L+  A F+V +TA NPN +IGIYYERGS LSVWY++ +L +G+L
Sbjct  120  SVDRLAVSAFQVDPSTLTARAAFDVSVTAANPNSRIGIYYERGSSLSVWYESYRLARGAL  179

Query  553  PELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLM  732
            P  YQGH+NTTVL +A++G+ Q G+ ++S L++AQQ G VPL  + D+PVR+++G  KL 
Sbjct  180  PAFYQGHRNTTVLALAMAGEVQLGSAVVSGLRDAQQAGSVPLVFRADVPVRVELGSFKLW  239

Query  733  KVGILGDCMLIVNSL-STNSLISIKASTCKFKLK  831
            KV     C L+V+ L   +S I IKAS CKF LK
Sbjct  240  KVTSRVRCDLVVDRLMDLSSPIKIKASNCKFSLK  273



>emb|CDX74604.1| BnaA04g07850D [Brassica napus]
Length=255

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 154/224 (69%), Gaps = 11/224 (5%)
 Frame = +1

Query  193  SFRSEKGDPSTQA-WQP---------QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILY  342
            S RSE G+ + ++  QP         +K +RSC C+C+ +T+ V+ +L +++ A  GILY
Sbjct  31   SSRSEHGETTKESVTQPPQLDSPQRKKKGRRSCWCRCVCYTLLVLFLLIVVVGAAVGILY  90

Query  343  LIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWY  522
            L+F+PK+P Y++D L+++   +N  D SL   FNV ITA+NPN+KIGIYYE GS++SV Y
Sbjct  91   LVFRPKLPDYNIDRLQLTRSILNNQDSSLSTAFNVTITAKNPNEKIGIYYEDGSKISVLY  150

Query  523  KTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ-TGRVPLDLKIDMP  699
              T+L  GSLP+ YQGH+NTT++ V ++G +Q   +L++ L E QQ TG +PL +++  P
Sbjct  151  MQTRLSNGSLPKFYQGHENTTIIFVEMTGYTQNATSLMATLLEQQQLTGSIPLRIRVTQP  210

Query  700  VRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            VRIK+G+LKL +V     C + V+SL+ NS+I ++ S CKF+ +
Sbjct  211  VRIKLGKLKLPEVKFFVRCGVFVDSLAANSVIRVRNSNCKFRFR  254



>ref|XP_010511116.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=254

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 167/254 (66%), Gaps = 15/254 (6%)
 Frame = +1

Query  112  MSEHQRIRI-HpeveapppptrplvprGSFRSEKGDPS----TQAWQ-----PQKSKRSC  261
            MS+HQ+I   H        PT PLVPRGS RSE+GDPS     Q  Q     P   KR  
Sbjct  1    MSQHQKIYPDHDPEAPTARPTAPLVPRGSSRSEQGDPSKDPLNQGPQRFVPLPPPKKRGS  60

Query  262  CCKCMW---WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLY  432
               C     +T   +++L +++ A  GILYL+F+PK+P YS+D L+++   +N  D SL 
Sbjct  61   RSCCCRCFCYTFCFLLLLVVVVGATIGILYLVFKPKLPDYSIDRLQLTRFALN-QDSSLT  119

Query  433  AKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQ  612
              FNV ITA+NPN+KIGIYYE GS+++VWY   +L  GSLP+ YQGH+NTTV+ V ++GQ
Sbjct  120  TAFNVTITAKNPNEKIGIYYEDGSKITVWYLEHQLSNGSLPKFYQGHENTTVIYVEMTGQ  179

Query  613  SQYGNTLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNS  789
            +Q    L + L+E QQ TG +PL ++++ PVR+K G+LK  +V  L  C + V+SL+TN+
Sbjct  180  TQNALGLRTTLEEQQQRTGNIPLRIRVNQPVRVKFGKLKFFEVRFLVRCGVFVDSLATNN  239

Query  790  LISIKASTCKFKLK  831
            +I I++S+CKF+L+
Sbjct  240  VIKIQSSSCKFRLR  253



>ref|XP_010415112.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=254

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 167/254 (66%), Gaps = 15/254 (6%)
 Frame = +1

Query  112  MSEHQRIRI-HpeveapppptrplvprGSFRSEKGD----PSTQAWQ-----PQKSKRSC  261
            MS+HQ+I   H        PT PLVPRGS RSE+GD    P  Q  Q     P   KR  
Sbjct  1    MSQHQKIYPDHDPEAPTARPTAPLVPRGSSRSEQGDRSKDPLNQGPQRFVPLPPPKKRGS  60

Query  262  CCKCMW---WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLY  432
               C     +T   +++L +++ A  GILYL+F+PK+P YS+D L+++   +N  D SL 
Sbjct  61   RSCCCRCFCYTFCFLLLLVVVVGATIGILYLVFKPKLPDYSIDRLQLTRFALN-QDSSLT  119

Query  433  AKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQ  612
              FNV ITA+NPN+KIGIYYE GS+++VWY   +L  GSLP+ YQGH+NTTV+ V ++GQ
Sbjct  120  TAFNVTITAKNPNEKIGIYYEDGSKITVWYLEHQLSNGSLPKFYQGHENTTVIYVEMTGQ  179

Query  613  SQYGNTLLSALQEAQQ-TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNS  789
            +Q    L + L+E QQ TG +PL ++++ PVR+K G+LKL +V  L  C + V+SL+TN+
Sbjct  180  TQNALGLRTTLEEQQQRTGNIPLRIRVNQPVRVKFGKLKLFEVRFLVRCGVFVDSLATNN  239

Query  790  LISIKASTCKFKLK  831
            +I I++S+CKF+L+
Sbjct  240  VIKIQSSSCKFRLR  253



>ref|XP_004232659.1| PREDICTED: protein YLS9 [Solanum lycopersicum]
Length=260

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 121/165 (73%), Gaps = 2/165 (1%)
 Frame = +1

Query  340  YLIFQPKIPKYSVDNLRISDLRVNPLDLSL-YAKFNVKITAQNPNKKIGIYYERGSRLSV  516
            Y +FQPKIPKYSVD++RI+    N  D+SL +A FNV ITA+NPNKKIGIYYE GS+LSV
Sbjct  96   YFVFQPKIPKYSVDSMRITQFNFN-NDMSLLFATFNVNITARNPNKKIGIYYENGSQLSV  154

Query  517  WYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDM  696
            WY   +LC+GSLP  YQGHQNTTVL + LSGQ+Q    LL ALQ  QQ G +PL+L+  +
Sbjct  155  WYTGVQLCEGSLPRFYQGHQNTTVLSLDLSGQTQNVTGLLQALQVDQQRGSIPLNLRAKV  214

Query  697  PVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            PV++K+G LKLMK   L  C L V+SLS N+ I I+ S C+F  +
Sbjct  215  PVKLKIGNLKLMKWNFLVKCSLDVDSLSANNTIRIRNSDCQFGFR  259



>ref|XP_010940382.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=250

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 122/171 (71%), Gaps = 2/171 (1%)
 Frame = +1

Query  319  AACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYER  498
             A AGILYLIF PKIPKYSVD L I  L  N  +  + A FNV +TA+NPNKKIGIYYE 
Sbjct  81   GATAGILYLIFDPKIPKYSVDRLGI--LAFNVDNNMVRASFNVTVTARNPNKKIGIYYEE  138

Query  499  GSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPL  678
            GS LSVWY  + LC+GS PE YQGHQN TVL + ++G++Q    LL+ L   QQTG +PL
Sbjct  139  GSYLSVWYTDSSLCKGSFPEFYQGHQNMTVLNIIMTGEAQLTGELLTELLRQQQTGMIPL  198

Query  679  DLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
              K D+PVR+K G LKL KV     C L+VNSLS ++ ISIK+S+CKFKLK
Sbjct  199  LFKGDVPVRVKFGSLKLWKVTFRVRCNLVVNSLSASNQISIKSSSCKFKLK  249



>ref|XP_009799970.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
Length=260

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 168/260 (65%), Gaps = 21/260 (8%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvp---rGSFRSEKGDPSTQAWQP--------------  240
            M++HQRI   PE E  PP  +P VP   RGSFRSEKGDP  Q  +P              
Sbjct  1    MADHQRIHPVPEPEQEPPVQKPTVPLVPRGSFRSEKGDPERQQLEPPPLRKRTIPYYPPL  60

Query  241  -QKSKRSCCCK-CMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNP  414
                KR C CK C+  T  ++  L III A A   Y +FQPKIP YSVD++RI+    N 
Sbjct  61   KPPKKRICSCKRCLCCTCCLLFFLIIIIGALAAAFYFVFQPKIPNYSVDSMRITQFNFNN  120

Query  415  LDLSL-YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVL  591
             D+SL +A FNV ITA+NPNKKIGIYYE GS LSVWY   KLC+GSLP+ YQGH+NTTVL
Sbjct  121  -DMSLLFATFNVNITARNPNKKIGIYYESGSHLSVWYTGVKLCEGSLPKFYQGHRNTTVL  179

Query  592  EVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
             + LSGQ++  + LL +LQ  QQ G +PL+L+  +PV++K+G+LKLMK   L  C L V+
Sbjct  180  SLNLSGQTENASELLQSLQLDQQKGSIPLNLRAKVPVKLKIGKLKLMKWKFLVKCKLDVD  239

Query  772  SLSTNSLISIKASTCKFKLK  831
            SLS N+ I I+ S CKF  +
Sbjct  240  SLSANNAIRIRNSDCKFGFR  259



>dbj|BAJ85346.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 162/266 (61%), Gaps = 27/266 (10%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvpr---GSFRSEKGDPSTQAW----------------  234
            M++HQR RIHP       P           SFRS+KGDP+  A                 
Sbjct  1    MADHQRQRIHPVDLEAGQPRPSAPLVPPGSSFRSDKGDPAAAAGGRPPHHQPLPPPPRRV  60

Query  235  ------QPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRIS  396
                   P K +R CCC+ +   V   ++L ++ AA  G LYL+FQPK P+YSVD L +S
Sbjct  61   AAPLPLPPPKRRRGCCCRFICCAVVTALLLAVLAAAALGALYLVFQPKAPRYSVDRLSVS  120

Query  397  DLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQ  576
              +V+P  L+  A+F+V +TA NPN +IGI+YERGS LSVWY T +L QG+LP  YQ  +
Sbjct  121  QFQVDPA-LTASARFDVTVTAANPNGRIGIFYERGSSLSVWYDTHRLAQGALPAFYQPRR  179

Query  577  NTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDC  756
            NTTVL V ++GQ+Q G+ +++AL++ QQTG VPL  + D+PVR+++G LKL  V     C
Sbjct  180  NTTVLGVVMAGQAQLGSAVVAALRDEQQTGAVPLVFRADVPVRVELGSLKLWTVTSRVRC  239

Query  757  MLIVNS-LSTNSLISIKASTCKFKLK  831
             L+V+S L+ ++ I IKAS CKF LK
Sbjct  240  DLVVDSLLNASTHIKIKASNCKFSLK  265



>ref|XP_010667864.1| PREDICTED: protein YLS9-like [Beta vulgaris subsp. vulgaris]
Length=259

 Score =   190 bits (483),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 139/198 (70%), Gaps = 2/198 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            ++SKRSCCC+ +   ++ ++VL I I A  GIL+LIF+PKIP YS+  LRI+    N  D
Sbjct  60   KRSKRSCCCRTLCCILTTLLVLIIAIGATIGILFLIFRPKIPDYSIQTLRITQFSPNSND  119

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
             S+ A F V IT +NPN +IGIYY  GS LS +Y+ T LCQGSLP  YQGH+NTT +EVA
Sbjct  120  -SISATFVVNITTRNPNNRIGIYYLGGSSLSAYYRNTLLCQGSLPAFYQGHRNTTAIEVA  178

Query  601  LSGQSQYGNTLLSALQEAQ-QTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            L+G   + +   + LQ+ Q +TG VPL L+  +PVR+K+G+LKLMK+     C L ++SL
Sbjct  179  LTGTVNHASEFSATLQQQQAETGNVPLVLRARVPVRVKLGKLKLMKMRFRVTCELSIDSL  238

Query  778  STNSLISIKASTCKFKLK  831
            ++N+ I + +S+CKF+L+
Sbjct  239  TSNTEIRVASSSCKFRLR  256



>ref|XP_009418272.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=240

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 149/205 (73%), Gaps = 2/205 (1%)
 Frame = +1

Query  217  PSTQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRIS  396
            P+  +  P K +RS CC C+ W++  IV+L ++IA  AG+LYL+F+PKIPKYSVD L +S
Sbjct  37   PAAHSRPPGK-RRSRCCTCLCWSLLAIVILIVVIAVAAGVLYLVFRPKIPKYSVDRLAVS  95

Query  397  DLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQ  576
               V+  + ++   FNV +TA+NPN++IGIYY+ GS LS WY   +LC GS P  YQGH+
Sbjct  96   SFTVDD-NATVAVTFNVTVTARNPNRRIGIYYQGGSDLSAWYTDERLCTGSFPAFYQGHR  154

Query  577  NTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDC  756
            NTTVL V L+G+++ G+ LL+ LQ+ QQTG +PL ++  +PVR+K+G+LKL KV     C
Sbjct  155  NTTVLHVLLTGEAKIGSELLTELQQQQQTGTIPLAVRGVVPVRVKLGKLKLWKVRFKVRC  214

Query  757  MLIVNSLSTNSLISIKASTCKFKLK  831
             L+VNSLS +  +SI++S+CKFKLK
Sbjct  215  SLVVNSLSASGDVSIRSSSCKFKLK  239



>ref|XP_003616105.1| hypothetical protein MTR_5g076170 [Medicago truncatula]
 gb|AES99063.1| late embryogenesis abundant hydroxyproline-rich glycoprotein, 
putative [Medicago truncatula]
Length=263

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 138/200 (69%), Gaps = 2/200 (1%)
 Frame = +1

Query  235  QPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNP  414
            +P K +RSCCCK   W  S++++L I +    GIL+L+F+PKIPKYSVD LR++   ++ 
Sbjct  64   KPPKKRRSCCCKFFCWIFSILIILIIALGITIGILFLVFRPKIPKYSVDELRVTQFDLS-  122

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
             + SL   FN+ ITA+NPNKKIGI Y  GSR+S WY  TKLC+GSLP+ YQGH+N TVL 
Sbjct  123  NNNSLAVTFNLTITARNPNKKIGIDYRGGSRISAWYIDTKLCEGSLPKFYQGHKNVTVLS  182

Query  595  VALSGQSQYGN-TLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
            + L+GQ+Q       S  Q+ Q  G VPL L +  PVRIK+G+LKL K+     C ++V+
Sbjct  183  IPLTGQTQNATGLSSSLQQQFQSEGSVPLKLNVKQPVRIKLGKLKLPKINFRVRCTIVVD  242

Query  772  SLSTNSLISIKASTCKFKLK  831
            SLS N+ I I++S+CKF+ +
Sbjct  243  SLSANNSIRIRSSSCKFRFR  262



>gb|AFK46819.1| unknown [Medicago truncatula]
 gb|KEH34564.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Medicago truncatula]
Length=252

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 165/251 (66%), Gaps = 12/251 (5%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPS----------TQAWQPQKSKRSC  261
            M++HQRI    ++E+   PT PL+PR + +S++  PS           +   P K KRSC
Sbjct  2    MTDHQRIHPASDLESQTKPTVPLIPRNTSKSDRRSPSYPPLPKRHFPVRHTHPPKKKRSC  61

Query  262  CCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKF  441
            CC+    T +++++L I I    G LYL F+PK+PKYSVD LRI+   ++  D SL+  F
Sbjct  62   CCRFFCCTFTILLILIIAIGITVGALYLAFRPKLPKYSVDRLRITQFNLSD-DNSLFVTF  120

Query  442  NVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQY  621
            NV +TA+NPNKKIGIYY  GS +S WYK T LC+GSLP+ YQGH+NTTVL + L+GQ+Q 
Sbjct  121  NVTVTARNPNKKIGIYYVSGSHISAWYKETGLCEGSLPKFYQGHRNTTVLNLPLTGQTQD  180

Query  622  GNTLLSALQEA-QQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLIS  798
               L + LQ+  Q+ G +PLD+K++  VR+K+G+LK+ +V     C L V+SL  ++ IS
Sbjct  181  ATGLFNTLQQQLQEAGNIPLDIKVNQNVRVKLGKLKIFRVKFRVRCSLQVDSLGADNDIS  240

Query  799  IKASTCKFKLK  831
            I  S CKF+L+
Sbjct  241  ISDSRCKFRLR  251



>ref|XP_004490745.1| PREDICTED: protein NDR1-like [Cicer arietinum]
Length=253

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 138/209 (66%), Gaps = 5/209 (2%)
 Frame = +1

Query  217  PSTQ---AWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNL  387
            PSTQ     +P K ++SCCC+   W  S++++L I I    GIL+L F+PKIPKYSVD L
Sbjct  45   PSTQQNIPSKPAKKRKSCCCRLFCWIFSILIILIIAIGITIGILFLAFRPKIPKYSVDEL  104

Query  388  RISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQ  567
             I+   ++  + SL   FN+ ITA+NPNKKIGI Y  GS +S WY  TKLC+G+LP+ YQ
Sbjct  105  TITQFDLSNNN-SLSVTFNLTITARNPNKKIGIDYRGGSHISAWYTDTKLCEGALPKFYQ  163

Query  568  GHQNTTVLEVALSGQSQYGNTLLSAL-QEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGI  744
            GH+N TVL + L+GQ+Q    L   L Q+ Q  G VPL LK+  PVRIK G+LK+ K+  
Sbjct  164  GHKNITVLSIPLTGQTQNATGLRDTLVQKVQSDGSVPLHLKVKQPVRIKFGKLKIFKINF  223

Query  745  LGDCMLIVNSLSTNSLISIKASTCKFKLK  831
               C ++V++ S N+ I IK S+CKF+ K
Sbjct  224  RVRCRIVVDNFSDNNSIRIKDSSCKFRFK  252



>gb|ABC86702.1| harpin-induced protein-like [Coffea arabica]
Length=163

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = +1

Query  343  LIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWY  522
            L+F+PK+PKYSVD+L I+ L +N  D SL+A FNV +TA+NPNKKIGIYYE GS L V++
Sbjct  1    LVFRPKLPKYSVDSLTITHLNLNN-DNSLFATFNVNVTARNPNKKIGIYYEGGSDLRVYF  59

Query  523  KTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPV  702
              T+LC+GSLP+ YQGH+NTTV+ V L+GQ+Q  N LL +LQ  +QTG +PL L+  +PV
Sbjct  60   TGTQLCEGSLPKFYQGHRNTTVMNVTLTGQTQDANGLLQSLQAQEQTGNIPLFLRGKVPV  119

Query  703  RIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            R+K+G LK MK   L  C L V+SL+ ++ I I+ S CKF+L+
Sbjct  120  RLKLGGLKSMKWKFLVRCWLNVDSLTPDNTIRIRDSRCKFRLR  162



>ref|XP_008449868.1| PREDICTED: protein YLS9-like [Cucumis melo]
Length=258

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 169/258 (66%), Gaps = 19/258 (7%)
 Frame = +1

Query  112  MSEHQRIR----IHpeveapppptrplvprGSFRSEKGDPSTQAW-------------QP  240
            M+EHQ+I     +      P  PT PLVPRG+ +S+  D +T                +P
Sbjct  1    MAEHQKIHPVHDVEAPSPTPAAPTDPLVPRGTQKSDAADTTTAVQYPPFQRTIPVMHSKP  60

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
             K +RSCCC+C+ WT+S++V+L ++I    GILYL+F+PK+P+YS+D L++S   ++  D
Sbjct  61   PKKRRSCCCRCLCWTISILVLLLVLIGIVIGILYLVFRPKLPEYSIDRLKVSQFTLSGND  120

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
              L A FN+ +T  NPNKKIGIYYE GS +S WY  TKLC+G+LP+ YQGH+N TVL V 
Sbjct  121  -RLDAVFNLTLTTVNPNKKIGIYYEGGSHISAWYAETKLCEGALPKFYQGHRNRTVLNVP  179

Query  601  LSGQSQYGNTLLSAL-QEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            L G ++    L + L Q+ Q+TG +PL+L +  PVRIK+G LKLMKV     C L+V+S+
Sbjct  180  LVGVTENATALFTTLQQQHQETGNIPLNLNVRQPVRIKLGSLKLMKVKFSATCRLLVDSV  239

Query  778  STNSLISIKASTCKFKLK  831
            S NS I IK S+CKFKL+
Sbjct  240  SANSDIVIKNSSCKFKLR  257



>gb|AFK35063.1| unknown [Lotus japonicus]
Length=250

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 166/250 (66%), Gaps = 11/250 (4%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQ---------PQKSKRSCC  264
            M++HQRI    +VE+P  PT PLVP  + +S+ GDP+T   Q         P K +RSCC
Sbjct  1    MADHQRIHPAHDVESPNTPTAPLVPENTAKSDSGDPTTPLPQRTHPVMYSNPPKKRRSCC  60

Query  265  CKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFN  444
            C+      S +++L I IA   G+LYL+F PK+PKYSVD LR++    +  + SL   FN
Sbjct  61   CRFFCCIFSTLLILIIAIAITVGVLYLVFNPKLPKYSVDKLRVTQFNYSESN-SLSVTFN  119

Query  445  VKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYG  624
            V ITA+NPNKKIGIYY  GS +S WY+ TKLC+GSLP+ YQGH+NTTVL++ L+G++Q  
Sbjct  120  VAITARNPNKKIGIYYVGGSHISAWYEDTKLCEGSLPKFYQGHKNTTVLDLPLTGETQDA  179

Query  625  N-TLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISI  801
            +    S  Q+ QQ G +PL L+++ PVRIK+G+LKL K+     C L+V+SL  N  + I
Sbjct  180  SGLQSSLQQQLQQVGNIPLHLRVNQPVRIKLGKLKLFKIKFRVRCKLVVDSLGANDDVRI  239

Query  802  KASTCKFKLK  831
              S+CKF+L+
Sbjct  240  SNSSCKFRLR  249



>gb|KCW57916.1| hypothetical protein EUGRSUZ_H00662 [Eucalyptus grandis]
Length=211

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 131/186 (70%), Gaps = 16/186 (9%)
 Frame = +1

Query  253  RSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLY  432
            RSC  +C  W + ++VVL +++ A A ILY IFQ K+ K S+  L I+ LR+N +DL+LY
Sbjct  35   RSCFYRCWCWIICLLVVLLLVVLATAAILYAIFQSKLLKCSIQKLGITKLRLN-IDLTLY  93

Query  433  AKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQ  612
            AKF V+I A NPNK+IGIYY++GS               LP  YQGH+N T L V LSG+
Sbjct  94   AKFKVQIKASNPNKRIGIYYDKGS---------------LPIFYQGHKNFTELNVGLSGK  138

Query  613  SQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSL  792
            ++ G+TL++ALQE QQ GR+PL L +D PV +KVGRLKL KV ILG C+ +V+SLSTN+L
Sbjct  139  TRSGSTLMNALQEQQQRGRIPLSLNVDAPVTVKVGRLKLRKVRILGKCLFVVDSLSTNNL  198

Query  793  ISIKAS  810
            +SIKA 
Sbjct  199  VSIKAD  204



>ref|XP_009386692.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=240

 Score =   179 bits (454),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 145/203 (71%), Gaps = 1/203 (0%)
 Frame = +1

Query  223  TQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDL  402
            T   +P K +RS C +C+ WT+  +++L ++IAA AG++Y++F+ ++PKYSVD+LR+S  
Sbjct  37   TARLRPPK-RRSRCSRCLCWTLLAVIILIVLIAAAAGVVYVVFRLRLPKYSVDHLRVSRF  95

Query  403  RVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNT  582
             VN  D+++ A F+V + A NPN+KIGIYYE GS LS+WY   +LC GS P  YQGH+NT
Sbjct  96   GVNDDDITVGAVFDVAVMATNPNRKIGIYYEEGSELSLWYADERLCTGSFPVFYQGHRNT  155

Query  583  TVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCML  762
             VL V L+G +Q G+ LL+ LQ+ Q  G +PL    D+PVR+K+ +L L KV     C +
Sbjct  156  MVLHVFLTGGTQEGSELLAELQQQQLAGVLPLTFLGDVPVRVKLDKLTLWKVTFNVRCSV  215

Query  763  IVNSLSTNSLISIKASTCKFKLK  831
            +V+SL+T+  IS+++S+C+F+LK
Sbjct  216  VVDSLTTSDDISVRSSSCRFRLK  238



>ref|XP_010234855.1| PREDICTED: protein YLS9-like [Brachypodium distachyon]
Length=265

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 115/162 (71%), Gaps = 1/162 (1%)
 Frame = +1

Query  349  FQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKT  528
            F PK P+YSVD L ++  +V+P  L+  A F   +TA NPN +IGI+YERGS LSVWY++
Sbjct  102  FNPKAPRYSVDRLSVTQFQVDPATLTATAAFEAALTASNPNARIGIFYERGSSLSVWYES  161

Query  529  TKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRI  708
             +L +G+LP  YQGH+NTT L VA++GQ+Q G  ++SA+++AQ+TG VPL  + D+PVR+
Sbjct  162  VRLARGALPAFYQGHRNTTTLGVAMAGQAQLGGAVVSAMRDAQRTGAVPLVFRADVPVRV  221

Query  709  KVGRLKLMKVGILGDCMLIVNS-LSTNSLISIKASTCKFKLK  831
            ++G LKL  V     C L+V+S L+  S I IKAS CKF  K
Sbjct  222  ELGTLKLWTVTSRVRCDLVVDSILNAGSNIKIKASNCKFGFK  263



>ref|XP_009392242.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=242

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 148/210 (70%), Gaps = 1/210 (0%)
 Frame = +1

Query  202  SEKGDPSTQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVD  381
            +EK D       P K +RSCCC+C+ WTV  +V+L +II A  GILYL F PK+PKYSVD
Sbjct  33   AEKTDHPPPPPPPPKKRRSCCCRCLCWTVLTVVILVVIIGAIVGILYLAFDPKLPKYSVD  92

Query  382  NLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPEL  561
             L IS+  V+  ++++ A FN+ +T  NPNKKIGIYY  GS LS WY  T LC G+ P  
Sbjct  93   RLAISNFTVDD-NMTVSATFNLTVTTTNPNKKIGIYYRGGSHLSAWYTNTSLCSGTFPVF  151

Query  562  YQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVG  741
            YQGH+NTTVL + LSG++Q G+ LL  LQ+ QQTG +PL  + ++PV++K+G LKL KV 
Sbjct  152  YQGHKNTTVLNLLLSGETQLGSGLLQELQQQQQTGTIPLVFRGNVPVKVKLGSLKLPKVT  211

Query  742  ILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
                C +IVNSLS+++ IS+K+S CKF+LK
Sbjct  212  FKVKCDIIVNSLSSSNTISLKSSRCKFRLK  241



>ref|XP_004161918.1| PREDICTED: uncharacterized LOC101205367 [Cucumis sativus]
Length=204

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  439  FNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQ  618
            F+VKIT  NPN+KIGIYYE+G  LSVWY   KLC+GSLP  Y GH+N T L+V L+G++ 
Sbjct  73   FDVKITTYNPNEKIGIYYEKGGVLSVWYTENKLCEGSLPAFYHGHRNKTALDVVLTGRTV  132

Query  619  YGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLIS  798
            YG+TL+SAL E QQTGR+PL L+   PV +K+G++KL KV ILG+C+L+V+SL+ N+ I+
Sbjct  133  YGSTLMSALVEQQQTGRIPLQLQAVAPVAVKMGKMKLKKVKILGNCLLVVDSLTANNAIT  192

Query  799  IKASTCKFKLK  831
            IKAS CKF+LK
Sbjct  193  IKASNCKFRLK  203



>ref|XP_004147714.1| PREDICTED: uncharacterized protein LOC101205367 [Cucumis sativus]
Length=202

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  439  FNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQ  618
            F+VKIT  NPN+KIGIYYE+G  LSVWY   KLC+GSLP  Y GH+N T L+V L+G++ 
Sbjct  71   FDVKITTYNPNEKIGIYYEKGGVLSVWYTENKLCEGSLPAFYHGHRNKTALDVVLTGRTV  130

Query  619  YGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLIS  798
            YG+TL+SAL E QQTGR+PL L+   PV +K+G++KL KV ILG+C+L+V+SL+ N+ I+
Sbjct  131  YGSTLMSALVEQQQTGRIPLQLQAVAPVAVKMGKMKLKKVKILGNCLLVVDSLTANNAIT  190

Query  799  IKASTCKFKLK  831
            IKAS CKF+LK
Sbjct  191  IKASNCKFRLK  201



>gb|ABK24926.1| unknown [Picea sitchensis]
Length=268

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 128/188 (68%), Gaps = 2/188 (1%)
 Frame = +1

Query  250  KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL  429
            +R+ CC+C+ + +  +  L  IIA   GILYL+F+P+IPKYS+D++RI++  +N  DLS 
Sbjct  76   RRNSCCRCLCYAICFLFALVAIIAITCGILYLVFEPRIPKYSIDSVRITNFSIN-ADLST  134

Query  430  YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSG  609
              +F V ++A+NPNKKIGIYY     L++ Y  T+LC G+LP  YQGH+NTT L+V L G
Sbjct  135  NCQFAVNVSARNPNKKIGIYYLDNGHLAISYSGTELCTGALPVFYQGHKNTTFLDVVLRG  194

Query  610  Q-SQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTN  786
              ++    ++S L+E QQ   VPL+LK D+PV+IK+G+LK MK+ +     L+V+ L  N
Sbjct  195  TGARLTGAVVSTLKEQQQKASVPLNLKADVPVKIKLGKLKSMKIKVRVRWDLVVDRLDAN  254

Query  787  SLISIKAS  810
            + ++ + S
Sbjct  255  AKVTTEKS  262



>ref|NP_001147622.1| NHL25 [Zea mays]
 gb|ACG28138.1| NHL25 [Zea mays]
 gb|AFW68497.1| NHL25 [Zea mays]
Length=265

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 115/162 (71%), Gaps = 2/162 (1%)
 Frame = +1

Query  352  QPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTT  531
             PK P+YSVD L +S  +V+P  L+  A+F+V + A NPN +IGI+YERGS L VWY++ 
Sbjct  103  DPKAPRYSVDRLSVSAFQVDPATLAARARFDVAVAATNPNSRIGIHYERGSSLGVWYQSY  162

Query  532  KLCQGSLPELYQGHQNTTVLEVALSGQSQYGN-TLLSALQEAQQTGRVPLDLKIDMPVRI  708
            +L +G+LP  YQGH+NTTVL +A++G++Q G+  ++S +Q+AQ+TG VPL  + D+PVR+
Sbjct  163  RLARGALPAFYQGHRNTTVLALAMAGEAQLGSAAVVSGMQDAQRTGAVPLVFRADVPVRV  222

Query  709  KVGRLKLMKVGILGDCMLIVNSL-STNSLISIKASTCKFKLK  831
            ++G  KL KV     C L+V+ L    SLI IKA  CKF LK
Sbjct  223  QLGTFKLWKVTARVRCDLVVDRLMDVTSLIKIKAGNCKFSLK  264



>gb|EAZ16506.1| hypothetical protein OsJ_31978 [Oryza sativa Japonica Group]
Length=153

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 109/146 (75%), Gaps = 2/146 (1%)
 Frame = +1

Query  400  LRVNPLD--LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGH  573
            +R++P+D  L+  A+F+V +TA NPN +IGIYYE GS LSVWY   +L +G+LP  YQGH
Sbjct  7    MRIHPVDPTLTATARFDVTVTATNPNARIGIYYEAGSSLSVWYDAHRLARGALPAFYQGH  66

Query  574  QNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGD  753
            +NTTVL V ++GQ+Q G  ++SALQ+AQ+TG VPL  + D+PVR+++G L+L KV     
Sbjct  67   RNTTVLAVVMAGQAQLGGAVMSALQDAQRTGAVPLVFRADVPVRVELGSLRLWKVTSRVR  126

Query  754  CMLIVNSLSTNSLISIKASTCKFKLK  831
            C L+V+SL  N+ ++IKAS CKF LK
Sbjct  127  CDLVVDSLGVNNPVNIKASNCKFSLK  152



>ref|XP_004164514.1| PREDICTED: protein NDR1-like [Cucumis sativus]
Length=259

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 166/259 (64%), Gaps = 20/259 (8%)
 Frame = +1

Query  112  MSEHQRIR----IHpeveapppptrplvprGSFRSEKGDPSTQAWQ--------------  237
            M+EHQ+I     +      P  PT PLVPRG+ +S+  D +    Q              
Sbjct  1    MAEHQKIHPLHDVEAPSPTPAAPTDPLVPRGTQKSDAADTTATPVQYPPFQRTIPVMHSK  60

Query  238  PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPL  417
            P K +RSCCC+C+ WT+S++V+L ++I    GILYL+F+PK+P+YS+D L++S   ++  
Sbjct  61   PPKKRRSCCCRCLCWTISILVLLLVLIGIVIGILYLVFRPKLPEYSIDRLQVSQFTLSGN  120

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
            D  L A FN+ +T  NPNKKIGIYYE GS +S WY  TKLC+G+LP+ YQGH+N TVL V
Sbjct  121  D-RLDAVFNLTLTTVNPNKKIGIYYEGGSHISAWYTETKLCEGALPKFYQGHRNRTVLNV  179

Query  598  ALSGQSQYGNTLL-SALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNS  774
             L G ++    L  +  Q+ QQTG +PL+L +  PVRIK+G LKLMKV     C L+V+S
Sbjct  180  PLVGVTENATALFTTLQQQHQQTGNIPLNLNVRQPVRIKLGSLKLMKVKFSATCRLLVDS  239

Query  775  LSTNSLISIKASTCKFKLK  831
            +S NS I IK S CKFKL+
Sbjct  240  VSANSDIVIKNSNCKFKLR  258



>ref|XP_004149663.1| PREDICTED: protein NDR1-like [Cucumis sativus]
 gb|KGN54039.1| hypothetical protein Csa_4G269210 [Cucumis sativus]
Length=259

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 165/259 (64%), Gaps = 20/259 (8%)
 Frame = +1

Query  112  MSEHQRIR----IHpeveapppptrplvprGSFRSEKGDPSTQAWQ--------------  237
            M+EHQ+I     +      P  PT PLVPRG+ +S+  D +    Q              
Sbjct  1    MAEHQKIHPLHDVEAPSPTPAAPTDPLVPRGTQKSDAADTTATPVQYPPFQRTIPVMHSK  60

Query  238  PQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPL  417
            P K +RSCCC+C  WT+S++V+L ++I    GILYL+F+PK+P+YS+D L++S   ++  
Sbjct  61   PPKKRRSCCCRCRCWTISILVLLLVLIGIVIGILYLVFRPKLPEYSIDRLQVSQFTLSGN  120

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
            D  L A FN+ +T  NPNKKIGIYYE GS +S WY  TKLC+G+LP+ YQGH+N TVL V
Sbjct  121  D-RLDAVFNLTLTTVNPNKKIGIYYEGGSHISAWYTETKLCEGALPKFYQGHRNRTVLNV  179

Query  598  ALSGQSQYGNTLL-SALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNS  774
             L G ++    L  +  Q+ QQTG +PL+L +  PVRIK+G LKLMKV     C L+V+S
Sbjct  180  PLVGVTENATALFTTLQQQHQQTGNIPLNLNVRQPVRIKLGSLKLMKVKFSATCRLLVDS  239

Query  775  LSTNSLISIKASTCKFKLK  831
            +S NS I IK S CKFKL+
Sbjct  240  VSANSDIVIKNSNCKFKLR  258



>ref|XP_010529003.1| PREDICTED: protein YLS9 [Tarenaya hassleriana]
Length=238

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  334  ILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLS  513
            ILYL+FQPKIP YSVD L +    +N  D    A FNV ITA+NPN KIGI+YE GS++S
Sbjct  72   ILYLVFQPKIPVYSVDRLELIRFTLN-QDSGSSATFNVTITAKNPNDKIGIFYEDGSKIS  130

Query  514  VWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQ-QTGRVPLDLKI  690
            VW+  TKL +GSLP+ YQG++NTTVL + ++GQ +    L++ +Q  + +TG +PL +++
Sbjct  131  VWHMQTKLSEGSLPKFYQGYKNTTVLYIKMTGQWEDTTGLMTTMQRQELETGNIPLRIRV  190

Query  691  DMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
            + PV++KVG+LKLM+V  L  C + VNSL  ++ I I++S+CKF L
Sbjct  191  NQPVKVKVGKLKLMEVRFLVRCGVAVNSLPPSNCIRIQSSSCKFSL  236



>ref|XP_009406139.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=272

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 132/184 (72%), Gaps = 2/184 (1%)
 Frame = +1

Query  283  TVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQ  462
            T   +VVL I I A  GILYL+F+PKIPKYSVD L +S+  V+  D ++ A FN+ +TA+
Sbjct  89   TALTLVVLIIAIGATVGILYLVFRPKIPKYSVDRLTLSNFTVDD-DTTISATFNLTVTAR  147

Query  463  NPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGN-TLLS  639
            NPN++IGIYY  GS LS WY  T+LC G+ P  YQGH+NTTV+ + L+G++Q G+  L  
Sbjct  148  NPNRRIGIYYGHGSHLSAWYNGTRLCTGAFPVFYQGHRNTTVVSLLLAGETQLGSGLLQE  207

Query  640  ALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCK  819
              Q+ QQTG V LD +  +PVR+K+GRLKL KV     C ++VNSLS+++ IS+++S CK
Sbjct  208  LQQQQQQTGTVLLDFRGSVPVRVKLGRLKLPKVSFKVRCNIVVNSLSSSNSISLRSSHCK  267

Query  820  FKLK  831
            FKLK
Sbjct  268  FKLK  271



>tpg|DAA49515.1| TPA: NHL25 [Zea mays]
Length=274

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 115/274 (42%), Positives = 162/274 (59%), Gaps = 35/274 (13%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQPQKSKR------------  255
            M++HQRI    ++EA   PT PLVP GSFRS+KGDP+ +A    + ++            
Sbjct  1    MADHQRIH-PVDLEAGNRPTTPLVPGGSFRSDKGDPAQRANNHHQQQQQRGYVYVPGPLP  59

Query  256  ---------------------SCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKY  372
                                  CCC+ +   V   VVL ++ AA AG LYL+  PK P+Y
Sbjct  60   PPPRRAAPPAPPLPPPKRRGRGCCCRFLCCAVITAVVLAVLAAAAAGALYLLLDPKAPRY  119

Query  373  SVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSL  552
            SVD L +S  +V+P  L+  A F+V +TA NPN +I I YE GS L VWY++ +L +G+L
Sbjct  120  SVDRLSVSTFQVDPSTLTARAGFDVAVTAANPNSRIAIQYEPGSSLGVWYQSYRLARGAL  179

Query  553  PELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLM  732
            P  YQGH+NTTVL +A++G+ Q G   ++ +++AQ+TG VPL  + D+PVR+++G  KL 
Sbjct  180  PPFYQGHRNTTVLALAMAGEVQLGGAAVAGMRDAQRTGAVPLVFRADVPVRVELGTFKLW  239

Query  733  KVGILGDCMLIVNSL-STNSLISIKASTCKFKLK  831
            KV     C L+V+ L   +S I IKAS CKF LK
Sbjct  240  KVTSRVRCDLVVDRLMDVSSPIKIKASNCKFGLK  273



>gb|EPS70084.1| hypothetical protein M569_04680, partial [Genlisea aurea]
Length=201

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = +1

Query  328  AGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSR  507
            A ++Y +F+PK+P YS+D ++I+  ++   D +L   F+V +TA NPNK+IGIYY  GS 
Sbjct  33   AAVVYFVFKPKVPDYSLDAIKITQFKLGSDD-TLSTTFDVNLTATNPNKRIGIYYRSGSD  91

Query  508  LSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQ-EAQQTGRVPLDL  684
            L V Y  T+LCQGSLPE YQGH+NTT L + LSG++  G  LL +L+ + QQTG VPLDL
Sbjct  92   LRVLYSGTQLCQGSLPEFYQGHRNTTQLSLNLSGETADGLGLLQSLRTQQQQTGSVPLDL  151

Query  685  KIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            +  +PVR+K+G LKL     L  C + V+SLS ++ I I+ S+C F+ +
Sbjct  152  RGRVPVRLKLGSLKLTTWKFLVRCRVTVDSLSADNTIRIRESSCSFRFR  200



>ref|NP_001151435.1| NHL25 [Zea mays]
 gb|ACG42868.1| NHL25 [Zea mays]
Length=274

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 109/275 (40%), Positives = 156/275 (57%), Gaps = 37/275 (13%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprG-SFRSEKGDPSTQA--WQPQKSKRS--------  258
            M++HQRI  HP            +  G SFRS+KGDP+ +A     Q+ +R         
Sbjct  1    MADHQRI--HPVDLEAGNRPTTPLVPGASFRSDKGDPAQRANNHHHQQQQRGYVYVPGPL  58

Query  259  -----------------------CCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPK  369
                                   CCC+ +   V   VVL ++ AA AG LYL+  PK P+
Sbjct  59   PPPPRRAAPPAPPLPPPKRRGRGCCCRFLCCAVITAVVLAVLAAAAAGALYLLLDPKAPR  118

Query  370  YSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGS  549
            YSVD L +S  +V+P   +  A F+V +TA NPN +IGI YE GS L VWY++ +L +G+
Sbjct  119  YSVDRLSVSAFQVDPSTFTARAGFDVAVTAANPNSRIGIQYEPGSSLGVWYQSYRLARGA  178

Query  550  LPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKL  729
            LP  YQGH+NTTVL +A++G+ Q G   ++ +++A+++G VPL  + D+PVR+++G  KL
Sbjct  179  LPPFYQGHRNTTVLALAMAGEVQLGGAAVAGMRDARRSGAVPLVFRADVPVRVELGTFKL  238

Query  730  MKVGILGDCMLIVNSL-STNSLISIKASTCKFKLK  831
             KV     C L+V+ L   +S I IKAS CKF LK
Sbjct  239  WKVTSRVRCDLVVDRLMDVSSPIKIKASNCKFGLK  273



>ref|NP_001169317.1| uncharacterized protein LOC100383182 [Zea mays]
 gb|ACN33389.1| unknown [Zea mays]
Length=274

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 114/274 (42%), Positives = 161/274 (59%), Gaps = 35/274 (13%)
 Frame = +1

Query  112  MSEHQRIRIHpeveapppptrplvprGSFRSEKGDPSTQAWQPQKSKR------------  255
            M++HQRI    ++EA   PT PLVP GSFRS+KGDP+ +A    + ++            
Sbjct  1    MADHQRIH-PVDLEAGNRPTTPLVPGGSFRSDKGDPAQRANNHHQQQQQRGYVYVPGPLP  59

Query  256  ---------------------SCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKY  372
                                  CCC+ +   V   VVL ++ AA AG LYL+  PK P+Y
Sbjct  60   PPPRRAAPPAPPLPPPKRRGRGCCCRFLCCAVITAVVLAVLAAAAAGALYLLLDPKAPRY  119

Query  373  SVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSL  552
            SVD L +S  +V+P  L+  A F+V +TA NPN +I I YE GS L VWY++ +L +G+L
Sbjct  120  SVDRLSVSTFQVDPSTLTARAGFDVAVTAANPNSRIAIQYEPGSSLGVWYQSYRLARGAL  179

Query  553  PELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLM  732
            P  YQGH+NTTVL +A++G+ Q G   ++ +++AQ+ G VPL  + D+PVR+++G  KL 
Sbjct  180  PPFYQGHRNTTVLALAMAGEVQLGGAAVAGMRDAQRAGAVPLVFRADVPVRVELGTFKLW  239

Query  733  KVGILGDCMLIVNSL-STNSLISIKASTCKFKLK  831
            KV     C L+V+ L   +S I IKAS CKF LK
Sbjct  240  KVTSRVRCDLVVDRLMDVSSPIKIKASNCKFGLK  273



>gb|ABK25808.1| unknown [Picea sitchensis]
Length=268

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 129/199 (65%), Gaps = 3/199 (2%)
 Frame = +1

Query  235  QPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNP  414
            +P K + SCC         +  ++ II+ AC GILYL+FQP+IPKYSVD +RI++  +N 
Sbjct  72   RPPKRRNSCCRCLCCTICFLFALVAIIVIAC-GILYLVFQPRIPKYSVDGIRITNFSIN-  129

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
             DLS   +F V + A+NPNKKIGIYY   S L+V Y  T+LC G+LP  YQGH+NTTVL+
Sbjct  130  ADLSTNCQFTVNVRARNPNKKIGIYYLDNSHLAVSYMGTELCTGTLPVFYQGHKNTTVLD  189

Query  595  VALSGQ-SQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
            VALS   ++  + ++S L+E QQ   VPL+LK D+PV+IK+G LK MK+ +     L+V+
Sbjct  190  VALSRTGARLTSAVVSTLKEQQQKASVPLNLKADVPVKIKLGNLKSMKIKVRVRWDLVVD  249

Query  772  SLSTNSLISIKASTCKFKL  828
             L  ++ +    S    KL
Sbjct  250  RLDASAKVITDKSKVSVKL  268



>ref|XP_002467031.1| hypothetical protein SORBIDRAFT_01g018550 [Sorghum bicolor]
 gb|EER94029.1| hypothetical protein SORBIDRAFT_01g018550 [Sorghum bicolor]
Length=278

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 108/158 (68%), Gaps = 1/158 (1%)
 Frame = +1

Query  352  QPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTT  531
             PK P+YSVD L +S  +V+P  ++  A+F+V +TA NPN +IGI YE GS L VWY++ 
Sbjct  115  DPKAPRYSVDRLSVSAFQVDPSTVTARARFDVTVTAANPNSRIGIQYEPGSSLGVWYQSY  174

Query  532  KLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIK  711
            +L +G+LP  YQGH+NTTVL +AL+G+ Q    ++S LQ+AQ+TG VPL  + D+PVR++
Sbjct  175  RLARGALPAFYQGHRNTTVLPLALAGEVQLATAVVSGLQDAQRTGAVPLVFRADVPVRVE  234

Query  712  VGRLKLMKVGILGDCMLIVNSL-STNSLISIKASTCKF  822
            VG  KL KV     C L+V+ L   +S I IK+  C F
Sbjct  235  VGSFKLWKVTSRVRCDLVVDRLMDVSSPIKIKSLGCLF  272



>gb|ABK26349.1| unknown [Picea sitchensis]
Length=270

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 121/179 (68%), Gaps = 2/179 (1%)
 Frame = +1

Query  295  IVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNK  474
            +  L  IIA   G+LYL+FQP+IPKYSVD++RI++  +N  DL+   +  V + A+NPNK
Sbjct  93   LFALVAIIAIACGVLYLVFQPRIPKYSVDSIRITNFSIN-ADLTTNCQVAVNVRARNPNK  151

Query  475  KIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQ-SQYGNTLLSALQE  651
            KIGIYY   S L++ Y  T+LC G+LP  YQGH+N+T L+VALSG  ++  + ++S L+E
Sbjct  152  KIGIYYLDNSHLAISYMGTELCTGALPVFYQGHKNSTFLDVALSGTGARVTSAVVSTLKE  211

Query  652  AQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
             +Q   VPL+L+ D+PV+IK+G+LK MK+ +     L+V+ L  N+ +  + S    K+
Sbjct  212  QKQKASVPLNLRADVPVKIKLGKLKSMKIKVRVRWDLVVDRLDANAKVISEKSKVSVKM  270



>ref|XP_002448773.1| hypothetical protein SORBIDRAFT_06g032920 [Sorghum bicolor]
 gb|EES13101.1| hypothetical protein SORBIDRAFT_06g032920 [Sorghum bicolor]
Length=247

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 130/197 (66%), Gaps = 1/197 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            ++ + S CC+C+ +T   +V+L + +   AGILYL+F+PKIP ++VD L ++   VN   
Sbjct  51   RQRRHSRCCRCVCYTFLALVLLVVALGVTAGILYLVFRPKIPTFNVDRLTVTRFDVNTTT  110

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
             ++   F+V +TA NPN++IGIYY+ G  ++  +  T LC+G+ P LYQGH+ T    ++
Sbjct  111  ATVTDAFDVDVTATNPNRRIGIYYD-GGDVTASFNGTVLCRGAFPALYQGHRTTVHPNIS  169

Query  601  LSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLS  780
            L+G+++  + + + L + +Q G VPL ++  +P+RIK G ++L K+    +C L+V+++ 
Sbjct  170  LAGETRLDSDVAAQLLQQRQAGFVPLTVRARVPIRIKFGAIRLWKMTGKANCNLVVDNIQ  229

Query  781  TNSLISIKASTCKFKLK  831
              + ++I+++TC FKLK
Sbjct  230  AGTQLNIRSNTCSFKLK  246



>gb|ABK26597.1| unknown [Picea sitchensis]
Length=270

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 121/179 (68%), Gaps = 2/179 (1%)
 Frame = +1

Query  295  IVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNK  474
            +  L  IIA   G+LYL+FQP+IPKYSVD++RI++  +N  DL+   + +V + A+NPNK
Sbjct  93   LFALVAIIAIACGVLYLVFQPRIPKYSVDSIRITNFSIN-ADLTTNCQVSVNVRARNPNK  151

Query  475  KIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQ-SQYGNTLLSALQE  651
            KIGIYY   S L++ Y  T+LC G+LP  YQGH+NTT L+VAL G  ++  + ++S L+E
Sbjct  152  KIGIYYLDNSHLAISYLGTELCTGALPVFYQGHKNTTFLDVALRGTGARVTSAVVSTLKE  211

Query  652  AQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
             +Q   VPL+L+ D+PV+IK+G+LK MK+ +     L+V+ L  N+ +  + S    K+
Sbjct  212  QKQKASVPLNLRADVPVKIKLGKLKSMKIKVRVRWDLVVDRLDANAKVISEKSKVSVKM  270



>ref|XP_004960074.1| PREDICTED: uncharacterized protein LOC101769159 [Setaria italica]
Length=250

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 121/184 (66%), Gaps = 1/184 (1%)
 Frame = +1

Query  280  WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITA  459
            WT+  +V+L + + A AGILYL+F+PKIP + VD L ++   VN   +++   F+V +TA
Sbjct  67   WTLLAVVILVVALGATAGILYLVFRPKIPNFKVDRLTVTRFDVNQTTMTVTDAFDVDVTA  126

Query  460  QNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLS  639
             NPNK+IGIYY+ G  ++  +  T++C+G  P LYQGH+ T    ++L+G+++  + ++ 
Sbjct  127  TNPNKRIGIYYD-GGEVTASFNGTQMCRGDFPALYQGHRTTVRPRISLAGETRLDSEVVG  185

Query  640  ALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCK  819
             L + QQ G VPL +   +P+RIK G +KL K+    DC L+V++L   + + I++++C 
Sbjct  186  QLLQQQQAGFVPLTVSARVPIRIKFGAIKLWKMTGKADCNLVVDNLQAGTQLRIRSNSCS  245

Query  820  FKLK  831
            FKLK
Sbjct  246  FKLK  249



>ref|XP_003580823.1| PREDICTED: protein YLS9-like [Brachypodium distachyon]
Length=251

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 129/211 (61%), Gaps = 0/211 (0%)
 Frame = +1

Query  199  RSEKGDPSTQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSV  378
            R +   P     +  K K   CC+C+ WT+  +++L I + A AGILY +F+P+IPK++V
Sbjct  40   RPDAPAPLRAPRRNSKRKHGRCCRCLCWTLLSLLILAIALGATAGILYAVFKPQIPKFNV  99

Query  379  DNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPE  558
            D L  +   VN   + +   F V++TA+NPN++IG+YY +G  +S  +  T+LC G+ P 
Sbjct  100  DRLTATKFDVNTTSMVVTDAFEVQVTAENPNRRIGVYYLQGGTVSAAFNGTELCTGAFPA  159

Query  559  LYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKV  738
            LYQGH++T    V L G+++  + + + L   QQ G VPL +   +P+RIK G LKL K+
Sbjct  160  LYQGHRSTVRPLVTLRGETRLDSEVAAQLARQQQAGFVPLTVAASVPIRIKFGVLKLWKM  219

Query  739  GILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
                 C L+V+S+   + + I++++C FKLK
Sbjct  220  TGKARCSLVVDSIRPGTPLRIRSNSCSFKLK  250



>ref|XP_008797780.1| PREDICTED: protein YLS9-like [Phoenix dactylifera]
Length=225

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 117/180 (65%), Gaps = 1/180 (1%)
 Frame = +1

Query  292  VIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPN  471
            +++VL I+IA  A I  LI +P++P YSVD+  I DL +NP DL++  KF V + A+NPN
Sbjct  46   LLLVLVIVIAITAYI-SLIIKPRVPTYSVDDFSIGDLNLNPTDLTIRTKFIVTVRAKNPN  104

Query  472  KKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQE  651
              IGI+Y+ GS +++ Y+ T LC G LP  YQGH NTTV+ V L GQS+ G  +   L+E
Sbjct  105  DMIGIWYKNGSYVAISYRNTLLCSGCLPSFYQGHHNTTVMRVVLEGQSKLGAEVHGVLEE  164

Query  652  AQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
             ++TGR+PLD+ + +PV ++V  +   +V +   C L+V+ LS +  + IK++  K  + 
Sbjct  165  NRRTGRIPLDVFVRVPVGLRVFNIDWRQVTVNVTCALVVDGLSPDKKVGIKSADYKVDVD  224



>dbj|BAJ99714.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 128/198 (65%), Gaps = 1/198 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            ++ + S CC+C+  T+ V++VL + + A AGILY +F+PKIP + V+ L  +   VN   
Sbjct  56   RRKRHSRCCRCVCCTLLVVIVLVVALGATAGILYAVFRPKIPTFRVERLTATRFDVNTTS  115

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
            ++L   F V++TA+NPN++IG+YY+ G  +S  +  T+LC+G+ P LYQGH++T    + 
Sbjct  116  MTLRDAFEVQVTAENPNRRIGVYYD-GGWVSASFNGTELCRGAFPALYQGHRSTVRPLIT  174

Query  601  LSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLS  780
            L G+++  + + + L + +Q G VPL +   +P+RIK G LKL K+     C L+V++L 
Sbjct  175  LEGETRLDSAVAAQLLQQRQAGFVPLTVIAHVPIRIKFGALKLWKMTGKARCRLVVDNLE  234

Query  781  TNSLISIKASTCKFKLKP  834
                + I++++C FKLKP
Sbjct  235  AGRRLRIRSNSCSFKLKP  252



>ref|XP_010942560.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=239

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 102/159 (64%), Gaps = 0/159 (0%)
 Frame = +1

Query  343  LIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWY  522
            L+ +PK+P YSVDNL I  LR NP  L+++ KF V + A+NPN  IGI+Y  GSR+ + Y
Sbjct  76   LVVKPKVPSYSVDNLSIGGLRFNPASLTIHTKFIVTVRAKNPNDMIGIWYRDGSRVMISY  135

Query  523  KTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPV  702
            + T LC G LP  YQGH NTTV+ V L GQS+ G  +    +E ++TGR+PLD+ + +PV
Sbjct  136  RNTSLCSGRLPSFYQGHHNTTVMHVVLEGQSKLGAGVHGVFEENRRTGRIPLDVFVRVPV  195

Query  703  RIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCK  819
             ++V      KV +   C L+V+ LS N  + I+++  K
Sbjct  196  SLRVFNTDWQKVTVNVTCALVVDGLSPNKKVGIRSADYK  234



>ref|XP_003577187.1| PREDICTED: uncharacterized protein LOC100833518 [Brachypodium 
distachyon]
Length=208

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 109/170 (64%), Gaps = 3/170 (2%)
 Frame = +1

Query  313  IIAACAGI---LYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIG  483
            IIAA AG    L+  ++PK P YSV+N+ +S    +  DL+LY K    + A+NPN  IG
Sbjct  32   IIAALAGTGAYLFYAYKPKPPSYSVNNMAVSQFEFSSSDLTLYTKLVASVRAENPNDMIG  91

Query  484  IYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQT  663
            I Y  GSR  V Y+ T LC G LP  +QGH+N TV+E+A+ G+  +G+ L  AL+E++++
Sbjct  92   IKYAEGSRTVVSYRGTPLCSGHLPTFFQGHKNVTVMEIAMEGRHGFGSGLQGALEESEKS  151

Query  664  GRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            G VPLD+ + +PV +++G   L ++ +   C L+V+SLS     +IK++T
Sbjct  152  GNVPLDIFVSVPVELQLGTFNLRQIKVNVHCALVVDSLSPKKKPTIKSAT  201



>ref|XP_006841672.1| hypothetical protein AMTR_s00003p00244400 [Amborella trichopoda]
 gb|ERN03347.1| hypothetical protein AMTR_s00003p00244400 [Amborella trichopoda]
Length=257

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 114/179 (64%), Gaps = 0/179 (0%)
 Frame = +1

Query  295  IVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNK  474
            I +  +IIA     LYL   PK+P+YSV +  +S    N  DLS++ +F V I A NPN+
Sbjct  78   IFIFLLIIAGFLMFLYLYLVPKLPQYSVQHFGVSRFEPNYEDLSIFTQFLVSIHAHNPNE  137

Query  475  KIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEA  654
             I I Y   S++SV Y    LC G LP  YQGH NTTV++V LSG S +G  L +AL + 
Sbjct  138  NIAIIYATNSKVSVKYLGETLCDGKLPAFYQGHVNTTVMDVVLSGTSPFGMGLQAALMDQ  197

Query  655  QQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            Q+TG+VPLD+ +D+PV++++   ++ K+ ++    ++V+SL+ +  ++I++S  KF +K
Sbjct  198  QRTGKVPLDINVDVPVQVELSGYRMPKLTVIVRAAIVVDSLAPHKKVNIRSSRYKFNVK  256



>ref|XP_002454018.1| hypothetical protein SORBIDRAFT_04g023155 [Sorghum bicolor]
 gb|EES06994.1| hypothetical protein SORBIDRAFT_04g023155 [Sorghum bicolor]
Length=202

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +1

Query  340  YLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVW  519
            YL   PK P+YSVD L +S  +V+P  ++  A+F+V +TA NPN +IGI YE GS L VW
Sbjct  61   YLALDPKAPRYSVDRLSVSAFQVDPSTVTARARFDVTVTAVNPNSRIGIQYEPGSSLGVW  120

Query  520  YKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMP  699
            Y++ +L +G+LP  YQGH+NTTVL +AL+G+ Q    ++S LQ+AQ+TG VPL  + D+P
Sbjct  121  YRSYRLARGALPAFYQGHRNTTVLPLALAGEVQLATAVVSGLQDAQRTGAVPLVFRADVP  180

Query  700  VRIKVGRLKLMK  735
            V ++VG  KL K
Sbjct  181  VHVEVGSFKLWK  192



>ref|XP_006836205.1| hypothetical protein AMTR_s00101p00083450 [Amborella trichopoda]
 gb|ERM99058.1| hypothetical protein AMTR_s00101p00083450 [Amborella trichopoda]
Length=283

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 114/189 (60%), Gaps = 2/189 (1%)
 Frame = +1

Query  232  WQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVN  411
            +Q  + +RS CC+ + + +  I  L +++AA AGI YL+  PK PKYS++ + I    + 
Sbjct  85   YQRSRKRRSHCCRFLCYFLGSIFALVVLLAAIAGISYLVISPKSPKYSIEKVAIKGFTLG  144

Query  412  PLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVL  591
              DL++  +F+V + A+NPNKKIGIYY   + + V+Y   +LC G LP  YQGH+N TV 
Sbjct  145  -RDLTISPEFDVTVRAENPNKKIGIYYGDKNNVDVFYSDVRLCNGKLPAFYQGHRNVTVF  203

Query  592  EVALSGQSQYGNTLLSALQEAQ-QTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIV  768
               L G     +T ++    AQ + GRVPL L ID+PVR+KVG +K   V +   C + V
Sbjct  204  PALLVGSDVRLSTAVNGTLTAQLREGRVPLRLNIDVPVRVKVGAVKSWTVTVRARCDVTV  263

Query  769  NSLSTNSLI  795
            + L+ ++ +
Sbjct  264  DKLAVDATV  272



>ref|XP_002460968.1| hypothetical protein SORBIDRAFT_02g038356 [Sorghum bicolor]
 gb|EER97489.1| hypothetical protein SORBIDRAFT_02g038356 [Sorghum bicolor]
Length=152

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +1

Query  355  PKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTK  534
            PK P+YSVD L +S  +V+P  ++  A+F+V +TA NPN +IGI YE GS L VWY++ +
Sbjct  22   PKAPRYSVDRLSVSAFQVDPSTVTAQARFDVTVTAANPNSRIGIQYEPGSSLRVWYQSYR  81

Query  535  LCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKV  714
            L +G+LP  YQGH+NTTVL  AL+G+ Q    ++S LQ+AQ+TG VPL  + D+PVR++V
Sbjct  82   LERGALPAFYQGHRNTTVLPPALAGEVQLATAVVSGLQDAQRTGAVPLVFRADVPVRVEV  141

Query  715  GRLK  726
            G  K
Sbjct  142  GSFK  145



>ref|XP_006659297.1| PREDICTED: protein YLS9-like [Oryza brachyantha]
Length=232

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 105/161 (65%), Gaps = 0/161 (0%)
 Frame = +1

Query  349  FQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKT  528
            ++PK P YSV  + ++ L V+  DLS+YA+    ++A+NPN  IGI Y  GSR  V Y+ 
Sbjct  71   YRPKAPSYSVSGMSVAQLDVSASDLSVYARLVASVSAENPNDMIGIRYGPGSRTVVSYRG  130

Query  529  TKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRI  708
            T LC G LP  YQGH+NTTV+ VA+ G+  +G+ L SAL+E++  G VPLD+ + +P+ +
Sbjct  131  TVLCSGRLPAFYQGHRNTTVMVVAMEGRHGFGSGLQSALEESENAGNVPLDVYVSVPLTL  190

Query  709  KVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            ++G + L +V +   C L+V+SLS     +IK++  KF  +
Sbjct  191  RLGDVDLREVTVNVHCALVVDSLSPKKKPAIKSAQYKFNAE  231



>ref|XP_003571637.1| PREDICTED: protein YLS9 [Brachypodium distachyon]
Length=246

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 103/155 (66%), Gaps = 0/155 (0%)
 Frame = +1

Query  346  IFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYK  525
            +++P+ P YSV  + +S   V+  DL++YA+    + A+NPN  IGI Y  GSR +V Y+
Sbjct  84   LYKPRAPSYSVSGISVSRFDVSAFDLTVYARLVATVRAENPNAMIGIGYGEGSRTAVSYR  143

Query  526  TTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVR  705
             T LC G+LP  YQG++NTTV+E+A+ G+  +G+ L SAL+E ++ G VPLD+ + +PV 
Sbjct  144  GTTLCSGTLPVFYQGYRNTTVMEIAMEGRHGFGSGLQSALEEGEKAGHVPLDVYVSVPVT  203

Query  706  IKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAS  810
            +++G   L +V +   C L+V+SLS     +IK++
Sbjct  204  LRLGTFDLRQVTVNVHCALVVDSLSPKKKPAIKSA  238



>ref|XP_002444561.1| hypothetical protein SORBIDRAFT_07g023796 [Sorghum bicolor]
 gb|EES14056.1| hypothetical protein SORBIDRAFT_07g023796 [Sorghum bicolor]
Length=152

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = +1

Query  355  PKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTK  534
            PK P+YSVD L +S  +V+P  ++  A+F+V +TA NPN +IGI YE GS L VWY++ +
Sbjct  22   PKAPRYSVDRLFVSAFQVDPSTVTARARFDVTVTAANPNSQIGIQYEPGSSLGVWYQSYR  81

Query  535  LCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKV  714
            L +G+LP  YQGH+NT VL  AL+G+ Q    ++S LQ+AQ+TG VPL  + D+PVR++V
Sbjct  82   LERGALPAFYQGHRNTKVLPPALAGEVQLATAVVSGLQDAQRTGAVPLVFRADVPVRVEV  141

Query  715  GRLK  726
            G  K
Sbjct  142  GSFK  145



>gb|KDP42899.1| hypothetical protein JCGZ_23841 [Jatropha curcas]
Length=271

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 107/187 (57%), Gaps = 8/187 (4%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +K +RS CC C+ W   ++    ++ A  AG+LYL+F+P+ PKYS++++ I    +    
Sbjct  75   RKHRRSTCCCCLCWFFGLLFTFILLAAIAAGVLYLVFRPEAPKYSIESVSIKGFNLT-SS  133

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
              L  +F+V + A NPN KIGIYY  GS ++V+Y   +LC G LP  YQG  N TV   +
Sbjct  134  APLSPEFDVAVRAHNPNNKIGIYYRTGSSVNVYYNDVRLCNGKLPVFYQGTNNVTVFVAS  193

Query  601  LSGQSQYGNTLLSALQEA----QQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIV  768
            L G    G  L SA+ +A    +  G VP  L +  PVRIKVG LK   + +  DC + V
Sbjct  194  LKGS---GIELTSAVHKALISGETKGAVPFKLNLRAPVRIKVGSLKTWTITVKVDCDVTV  250

Query  769  NSLSTNS  789
            + L++ S
Sbjct  251  DKLTSKS  257



>ref|NP_001170455.1| uncharacterized protein LOC100384448 [Zea mays]
 gb|ACN37051.1| unknown [Zea mays]
Length=251

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 110/171 (64%), Gaps = 1/171 (1%)
 Frame = +1

Query  319  AACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYER  498
             A AGILYL+F+PKIP + VD L ++   VN    ++   F+V +TA NPN++IGIYY+ 
Sbjct  81   GATAGILYLVFRPKIPTFHVDRLTVTRFDVNGTSATVTDAFDVDVTADNPNRRIGIYYD-  139

Query  499  GSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPL  678
            G  ++  +  T LC G+ P LYQGH+ T    ++L+G+++  + + + L + +  G VPL
Sbjct  140  GGDVTASFNGTVLCSGAFPALYQGHRTTVHPRISLAGETRLDSAVAAQLLQQRAAGFVPL  199

Query  679  DLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
             ++  +P+RIK G ++L  +    +C L+V+++   + +SI++++C FKLK
Sbjct  200  TVRARVPIRIKFGAVRLWTMTGKANCNLVVDNIQAGTQLSIRSNSCTFKLK  250



>tpg|DAA35350.1| TPA: hypothetical protein ZEAMMB73_623168 [Zea mays]
Length=251

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 110/171 (64%), Gaps = 1/171 (1%)
 Frame = +1

Query  319  AACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYER  498
             A AGILYL+F+PKIP + VD L ++   VN    ++   F+V +TA NPN++IGIYY+ 
Sbjct  81   GATAGILYLVFRPKIPTFHVDRLTVTRFDVNGTSATVTDAFDVDVTADNPNRRIGIYYD-  139

Query  499  GSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPL  678
            G  ++  +  T LC G+ P LYQGH+ T    ++L+G+++  + + + L + +  G VPL
Sbjct  140  GGDVTASFNGTVLCSGAFPALYQGHRTTVHPRISLAGETRLDSAVAAQLLQQRAAGFVPL  199

Query  679  DLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
             ++  +P+RIK G ++L  +    +C L+V+++   + +SI++++C FKLK
Sbjct  200  TVRARVPIRIKFGAVRLWTMTGKANCNLVVDNIQAGTQLSIRSNSCTFKLK  250



>ref|XP_010038643.1| PREDICTED: uncharacterized protein LOC104427219 [Eucalyptus grandis]
 gb|KCW47154.1| hypothetical protein EUGRSUZ_K00959 [Eucalyptus grandis]
Length=235

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 106/174 (61%), Gaps = 1/174 (1%)
 Frame = +1

Query  295  IVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNK  474
            + +L  ++A  A   Y +FQP++P Y+VD+   +   + P D SLY +F V + A NPN 
Sbjct  57   LFILIFVVATLAFYFYAVFQPRVPSYTVDSFATNAFNMQP-DFSLYTEFVVTVKADNPNS  115

Query  475  KIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEA  654
             IG  Y + S + V Y+ + LC G LP  +QGH+N T+++V L G+S++G+ L  AL E 
Sbjct  116  NIGFNYGKDSSVMVAYQDSTLCNGQLPAFHQGHKNITMIKVLLKGKSEFGSGLQEALMEN  175

Query  655  QQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTC  816
            + TGR+PL++ + +PV I +G   L +  +   C L+V++LS N    I +++C
Sbjct  176  RHTGRIPLNVIVKVPVGIVIGTFPLRRFTVRVICALVVDNLSPNKKTQIVSNSC  229



>ref|NP_001275940.1| protein NDR1-like [Solanum tuberosum]
 gb|AFI81517.1| LEA2-like protein [Solanum tuberosum]
Length=263

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 124/203 (61%), Gaps = 4/203 (2%)
 Frame = +1

Query  226  QAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLR  405
            +A + +K +RS CC+C+ +T S++++L I +   A +LYL+F+P+ PKY++ N+ I +  
Sbjct  62   EALRKRKPRRSFCCRCVCYTFSLLLILIIALGITAAVLYLVFRPEAPKYTISNVAIKNFN  121

Query  406  VNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTT  585
            +      +  +F+V + A+NPN KIGIYY +GS ++V+Y   +L  G LP  YQ   N T
Sbjct  122  LT-SSSPVSPEFDVTVRAENPNNKIGIYYRKGSSVTVFYSDVRLSNGELPAFYQPTNNVT  180

Query  586  VLEVALSGQSQ-YGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCML  762
            V +  L G +   GN + +AL+  Q  G+VP  + I  PV++KVG +K+ ++ +   C +
Sbjct  181  VFQTPLKGSNVLLGNAVKTALRNEQLKGKVPFKVNIKAPVKVKVGAVKMWEITVKVKCDI  240

Query  763  IVNSLSTNSLISIKASTCKFKLK  831
             VN+L+  S   I +  CK+ ++
Sbjct  241  TVNTLTAKS--KIISEDCKYSVR  261



>ref|XP_008366385.1| PREDICTED: protein NDR1-like [Malus domestica]
Length=274

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 113/206 (55%), Gaps = 13/206 (6%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVN-PL  417
            Q  +RS C  C  W   ++  L  + AA AGI YL+ +PK P YS+D++      +  P 
Sbjct  73   QNPRRSSCRCCFCWLFGLVAALIFLSAAAAGIFYLVVRPKSPNYSIDSIAFRGFNLTAPS  132

Query  418  DLSLYA---KFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTV  588
                YA   +  V + AQNPNKKIGIYY + S + ++Y   KLC G+LP  YQ  +N TV
Sbjct  133  PSPSYAISPEIQVTVRAQNPNKKIGIYYGKKSSVXLFYSDVKLCDGALPAFYQPLKNVTV  192

Query  589  LEVALSGQSQYGNTLLSALQ----EAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDC  756
             + AL G    G  L SA Q    +AQ+ G+VPL L I MPVRIKVG +K   + +   C
Sbjct  193  FQTALKGS---GIELTSAAQQGLVDAQKQGKVPLGLDIRMPVRIKVGPIKTWTINVKVGC  249

Query  757  MLIVNSLSTNSLISIKASTCKFKLKP  834
             L V+ L+T + I  K   C + + P
Sbjct  250  DLTVDKLTTEAKIVSK--DCDYSVDP  273



>ref|XP_002461441.1| hypothetical protein SORBIDRAFT_02g002730 [Sorghum bicolor]
 gb|EER97962.1| hypothetical protein SORBIDRAFT_02g002730 [Sorghum bicolor]
Length=188

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +1

Query  355  PKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTK  534
            PK P+YSVD L +S  +V+P  ++  A+F+V +T  NPN +IGI YE GS L VWY++ +
Sbjct  57   PKAPRYSVDRLSVSAFQVDPSTVTARARFDVTVTVANPNSRIGIQYEPGSSLGVWYQSYR  116

Query  535  LCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKV  714
            L +G+LP  YQGH+NTTVL  AL+G+ Q    ++S LQ+AQ+TG  PL  + D+PVR++V
Sbjct  117  LERGALPAFYQGHRNTTVLPPALAGEVQLATAVVSGLQDAQRTGAAPLVFRADVPVRVEV  176

Query  715  GRLK  726
            G  K
Sbjct  177  GSFK  180



>ref|XP_006661063.1| PREDICTED: uncharacterized protein LOC102715330 [Oryza brachyantha]
Length=260

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 115/185 (62%), Gaps = 8/185 (4%)
 Frame = +1

Query  259  CCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAK  438
            CCC        ++V++   IA  A   + I++PK P YSV N+ +S    N  DL+LYAK
Sbjct  77   CCC--------ILVLIIAAIAGAAAYAFFIYKPKAPSYSVSNMSVSQFDFNSNDLTLYAK  128

Query  439  FNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQ  618
                + A+NPN+ IGI Y  GS   V Y+ T LC G LP  +QG++N TV+E+++ G+  
Sbjct  129  LVATVRAENPNEMIGINYGEGSHTVVSYRGTPLCSGHLPTFFQGYKNVTVMEISMEGRHG  188

Query  619  YGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLIS  798
            +G+ L SAL+E+++ G VPLD+ + +PV +++G L + +V +   C L+V+S+S     +
Sbjct  189  FGSGLQSALEESEKEGNVPLDVFVSVPVSLRLGTLDIREVKVNVHCALVVDSISPKKKPT  248

Query  799  IKAST  813
            IK++T
Sbjct  249  IKSAT  253



>ref|NP_001054263.1| Os04g0677300 [Oryza sativa Japonica Group]
 emb|CAE05763.2| OSJNBa0064G10.14 [Oryza sativa Japonica Group]
 emb|CAJ86231.1| H0402C08.7 [Oryza sativa Indica Group]
 dbj|BAF16177.1| Os04g0677300 [Oryza sativa Japonica Group]
 gb|EAY96051.1| hypothetical protein OsI_17924 [Oryza sativa Indica Group]
 gb|EAZ32414.1| hypothetical protein OsJ_16625 [Oryza sativa Japonica Group]
Length=255

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 115/184 (63%), Gaps = 1/184 (1%)
 Frame = +1

Query  280  WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITA  459
            WT+  ++VL + + A AGILY +F+PKIP + VD L ++   VN    ++   F V++T+
Sbjct  72   WTLLAVLVLAVALGATAGILYAVFKPKIPDFHVDRLTVTRFDVNATAATVSDAFEVEVTS  131

Query  460  QNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLS  639
             NPN++IGIYY+ G  ++  +  T+LC+G  P LYQGH++T    + L+G+++  + +  
Sbjct  132  TNPNRRIGIYYD-GGEVTASFNGTELCRGGFPALYQGHRSTVRPVILLAGETRLDSAVAL  190

Query  640  ALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCK  819
             L   QQ G VPL +   +P+RIK G +KL K+     C L+V++L     I I++++C 
Sbjct  191  QLARQQQAGFVPLTVWARVPIRIKFGAIKLWKMTGKATCNLVVDNLVAGRQIRIRSNSCS  250

Query  820  FKLK  831
            FKLK
Sbjct  251  FKLK  254



>ref|XP_004956347.1| PREDICTED: uncharacterized protein LOC101756013 [Setaria italica]
Length=208

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 106/170 (62%), Gaps = 0/170 (0%)
 Frame = +1

Query  304  LFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIG  483
            + + +A  A   + +++PK P YSV N+ +S    +  DL+LY K    + A+NPN  IG
Sbjct  32   IVVALAGTAAYFFFVYKPKAPSYSVSNMSVSQFDFSSKDLTLYVKLTAAVRAENPNDMIG  91

Query  484  IYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQT  663
            I Y  GS   V Y+ T LC G LP  +QG++N TV+++++ G+  +G+ L  AL+E+++ 
Sbjct  92   IKYGEGSHTVVSYRGTPLCSGKLPAFFQGYKNVTVMDISMEGRHGFGSGLQQALEESEKL  151

Query  664  GRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            G +PLD+ + +PV +++G + L +V +   C L+++S+S     +IK++T
Sbjct  152  GDIPLDVFVSVPVELRLGTVDLRQVKVNVHCALVLDSISPKKKPTIKSAT  201



>ref|XP_002462092.1| hypothetical protein SORBIDRAFT_02g017900 [Sorghum bicolor]
 gb|EER98613.1| hypothetical protein SORBIDRAFT_02g017900 [Sorghum bicolor]
Length=208

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 104/167 (62%), Gaps = 0/167 (0%)
 Frame = +1

Query  313  IIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYY  492
            ++A  A   + +++PK P YSV N+ +S       DL+LY K    + A+NPN+ I I Y
Sbjct  35   VLAGTAAYFFFVYKPKAPSYSVSNMSVSQFDFKSSDLTLYVKLTASVRAENPNEMITIKY  94

Query  493  ERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRV  672
              GS   V Y+ T LC G LP  +QG++N TV+++++ G+  +G+ L  AL+E+++ G +
Sbjct  95   GEGSHTVVSYRGTPLCSGKLPAFFQGYKNVTVMDISMEGRHGFGSGLQQALEESEKAGDI  154

Query  673  PLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            PLD+ + +PV +++G L L +V +   C L+++S+S     +IK++T
Sbjct  155  PLDIFVSVPVELQLGSLDLRQVKVNVHCALVLDSISPKKKPNIKSAT  201



>ref|NP_001061545.1| Os08g0324200 [Oryza sativa Japonica Group]
 dbj|BAD03245.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD03668.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23459.1| Os08g0324200 [Oryza sativa Japonica Group]
 gb|EAZ42310.1| hypothetical protein OsJ_26883 [Oryza sativa Japonica Group]
Length=242

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 105/166 (63%), Gaps = 2/166 (1%)
 Frame = +1

Query  340  YLIF--QPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLS  513
            YL++  +PK P YSV ++ ++   V+  DL++YAK    + A+NPN  +GI Y  GSR +
Sbjct  76   YLLYACRPKAPSYSVSDMSVARFDVSSSDLTVYAKLVASVRAENPNDMVGIGYGAGSRAA  135

Query  514  VWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKID  693
            V Y+ T LC G LP  YQGH+NTTV+ VA+ G+  +G  L  AL+E+++ G VPLD+ + 
Sbjct  136  VSYRGTTLCSGRLPAFYQGHRNTTVVRVAMEGRHGFGPGLQGALEESEEAGNVPLDVYVS  195

Query  694  MPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
             PV +++G + L +V +   C L+V+ LS     +IK++  +  ++
Sbjct  196  APVTLRLGDVDLREVTVNVHCALVVDGLSPKKKPAIKSAEYRVNVE  241



>ref|NP_001062721.1| Os09g0267400 [Oryza sativa Japonica Group]
 dbj|BAD26256.1| HIN1-like protein [Oryza sativa Japonica Group]
 dbj|BAF24635.1| Os09g0267400 [Oryza sativa Japonica Group]
Length=210

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 99/155 (64%), Gaps = 0/155 (0%)
 Frame = +1

Query  349  FQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKT  528
            ++PK P YSV N+ +S    N  DL+LY K    + A+NPN+ IGI Y  GSR  V Y+ 
Sbjct  49   YKPKAPSYSVSNMSVSQFDFNSNDLTLYTKLVATVRAENPNEMIGIIYGDGSRTVVSYRG  108

Query  529  TKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRI  708
            T LC G LP  YQG +N TV+E+++ G+  +G+ L SAL+E+++ G VPLD+ + +PV +
Sbjct  109  TPLCSGHLPTFYQGFKNVTVMEISMEGRHGFGSGLQSALEESEKEGNVPLDVFVSVPVSL  168

Query  709  KVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            + G   + +V +   C L+V+S+S     +IK++T
Sbjct  169  RFGSFDVREVRVNVHCALVVDSISPKKKPTIKSAT  203



>gb|EAZ06534.1| hypothetical protein OsI_28780 [Oryza sativa Indica Group]
Length=242

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 105/166 (63%), Gaps = 2/166 (1%)
 Frame = +1

Query  340  YLIF--QPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLS  513
            YL++  +PK P YSV ++ ++   V+  DL++YAK    + A+NPN  +GI Y  GSR +
Sbjct  76   YLLYACRPKAPSYSVSDMSVARFDVSSSDLTVYAKLVASVRAENPNDMVGIGYGAGSRAA  135

Query  514  VWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKID  693
            V Y+ T LC G LP  YQGH+NTTV+ VA+ G+  +G  L  AL+E+++ G VPLD+ + 
Sbjct  136  VSYRGTTLCSGRLPAFYQGHRNTTVVRVAMEGRHGFGPGLQGALEESEEAGNVPLDVYVS  195

Query  694  MPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
             PV +++G + L +V +   C L+V+ LS     +IK++  +  ++
Sbjct  196  APVTLRLGDVDLREVTVNVHCALVVDGLSPKKKPAIKSAEYRVNVE  241



>ref|XP_008231176.1| PREDICTED: uncharacterized protein LOC103330379 [Prunus mume]
Length=266

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 119/207 (57%), Gaps = 6/207 (3%)
 Frame = +1

Query  226  QAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLR  405
            Q++  +K +RS C  C  W + ++  +  + AA AGI YL+ +P+ P YSV+++      
Sbjct  61   QSYTHRKPRRSSCHCCCCWFLGLLAAIVFLSAAAAGIFYLVVRPEAPNYSVESIAFKGFN  120

Query  406  V---NPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQ  576
            +   + L  ++  + +V + AQNPNKKIGIYYER S + ++Y   KLC G LP  YQ  +
Sbjct  121  LTTTSSLPSAISPEIHVTVRAQNPNKKIGIYYERESSVKLFYSDIKLCDGVLPAFYQPSK  180

Query  577  NTTVLEVALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGD  753
            N T    AL+G   +  + +   L +AQ+ G+VPLDL +  PVRIKVG +K   + +   
Sbjct  181  NVTEFRTALTGSGIELTSAVHKGLVDAQKQGKVPLDLDLRAPVRIKVGPIKTWTITVKVA  240

Query  754  CMLIVNSLSTNSLISIKASTCKFKLKP  834
            C L VN L+ ++  SI +  C + + P
Sbjct  241  CHLTVNRLTADA--SIVSRDCDYGVDP  265



>ref|XP_004963560.1| PREDICTED: uncharacterized protein LOC101778109 [Setaria italica]
Length=300

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 107/170 (63%), Gaps = 3/170 (2%)
 Frame = +1

Query  313  IIAACAGI---LYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIG  483
            I+AA AG     + +++PK P YSV N+ +S    +  DL+LY K    + A+NPN  IG
Sbjct  124  IVAALAGTAAYFFFVYKPKAPSYSVSNMSVSQFDFSSKDLTLYVKLTAAVRAENPNDMIG  183

Query  484  IYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQT  663
            I Y  GS   V Y+ T LC G LP  +QG++N TV+++++ G+  +G+ L  AL+E+++ 
Sbjct  184  IKYGEGSHTVVSYRGTPLCSGKLPAFFQGYKNVTVMDISMEGRQGFGSGLQQALEESEKL  243

Query  664  GRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            G +PLD+ + +PV +++G + L +V +   C L+++S+S     +IK++T
Sbjct  244  GDIPLDVFVSVPVELRLGTVDLRQVKVNVHCALVLDSISPKKRPTIKSAT  293



>ref|NP_001136657.1| uncharacterized protein LOC100216786 [Zea mays]
 gb|ACF82346.1| unknown [Zea mays]
 tpg|DAA39521.1| TPA: hypothetical protein ZEAMMB73_772213 [Zea mays]
Length=208

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 107/170 (63%), Gaps = 3/170 (2%)
 Frame = +1

Query  313  IIAACAGI---LYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIG  483
            I+AA AG     + +++PK P YSV N+ +S    +  DL+LY K    + A+NPN+ I 
Sbjct  32   IVAALAGTAAYFFFVYKPKAPSYSVSNMSVSQFDFSTSDLTLYVKLTASVRAENPNEMIT  91

Query  484  IYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQT  663
            I Y  GS   V Y+ T LC G LP  +QG++N TV+++++ G+  +G+ L  AL+E+++ 
Sbjct  92   IRYGEGSHTVVSYRGTPLCSGKLPAFFQGYKNVTVMDISMEGRHGFGSGLQQALEESEKA  151

Query  664  GRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            G +PLD+ + +PV +++G + L ++ +   C L+++S+S     +IK++T
Sbjct  152  GDIPLDIFVSVPVELQLGSVDLRQIKVNVHCALVLDSISPKKKPNIKSAT  201



>ref|XP_009606975.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
Length=219

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 105/177 (59%), Gaps = 3/177 (2%)
 Frame = +1

Query  304  LFII--IAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKK  477
             FII  ++A A   Y ++QPK+P Y+V+ L + +    P D +L     V I A+NPNK 
Sbjct  42   FFIILLVSALAFYFYTVYQPKLPHYNVEALEVKEFGYQP-DFTLTMAIIVTIKAENPNKA  100

Query  478  IGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQ  657
            I + Y   S ++V Y  + LC G LP  +QGH+NTT+++V L G+SQ+G+ L  A+QE +
Sbjct  101  IELTYGEASSMNVTYTDSTLCSGKLPAFHQGHKNTTIIQVELKGKSQFGSGLYEAMQENE  160

Query  658  QTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
            + G+VPL + + +PV +  G  +L +  +L +C LIVN+L       I  S   +KL
Sbjct  161  KNGKVPLLVIVKVPVEVLFGTRRLKQFNVLANCSLIVNNLKAGKKAEIVESKFTYKL  217



>gb|AAS90599.1| unknown pollen protein [Petunia integrifolia subsp. inflata]
Length=234

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 109/181 (60%), Gaps = 1/181 (1%)
 Frame = +1

Query  292  VIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPN  471
            V+  + +++ A A   Y ++QPK+P Y   +L + +    P D SL     V I A+NPN
Sbjct  55   VLFFIIVLLGAFAFYFYTMYQPKLPTYKFQSLEVKEFGYQP-DFSLTTDIIVTIRAENPN  113

Query  472  KKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQE  651
            K I + Y + S ++V Y  + +C G+LP  +QGH+N T++++ L G+SQ+G+ L  A+Q+
Sbjct  114  KAISLIYGKESSVNVTYTDSTICSGTLPSFHQGHKNVTMMQIELKGKSQFGSGLYEAMQD  173

Query  652  AQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
             ++ G++PL +K+ +PV++ VG   L +  +L +C L+V++L     + I  +   FKL 
Sbjct  174  NEKNGKIPLLVKLKVPVQVYVGEYPLRQFNVLANCSLVVDNLKPGKKVEIIKNDVTFKLA  233

Query  832  P  834
            P
Sbjct  234  P  234



>ref|XP_007205722.1| hypothetical protein PRUPE_ppa010043mg [Prunus persica]
 gb|EMJ06921.1| hypothetical protein PRUPE_ppa010043mg [Prunus persica]
Length=266

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 120/210 (57%), Gaps = 12/210 (6%)
 Frame = +1

Query  226  QAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLR  405
            Q++  +K++RS C  C  W + ++  +  + AA AGI YL+ +P+ P YSV+++      
Sbjct  61   QSYTHRKTRRSSCHCCCCWFLGLLAAIVFLSAAAAGIFYLVVRPEAPNYSVESIAFKGFN  120

Query  406  VNPLDL---SLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQ  576
            +        ++  + +V + AQNPNKKIGIYYER S + ++Y   KLC G LP  YQ  +
Sbjct  121  LTTTSSPPSAISPEIHVTVRAQNPNKKIGIYYERESSVKLFYSDIKLCDGVLPAFYQPSK  180

Query  577  NTTVLEVALSGQSQYGNTLLSALQ----EAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGI  744
            N T    AL+G    G  L SA+Q    +AQ+ G+VPL+L +  PVRIKVG +K   + +
Sbjct  181  NVTEFRTALTGS---GIELTSAVQKGLVDAQKQGKVPLELDLRAPVRIKVGPIKTWTITV  237

Query  745  LGDCMLIVNSLSTNSLISIKASTCKFKLKP  834
               C L VN L+ ++  +I +  C + + P
Sbjct  238  KVACHLTVNKLTADA--NIVSRDCDYSVDP  265



>gb|EAZ43981.1| hypothetical protein OsJ_28602 [Oryza sativa Japonica Group]
Length=339

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 99/155 (64%), Gaps = 0/155 (0%)
 Frame = +1

Query  349  FQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKT  528
            ++PK P YSV N+ +S    N  DL+LY K    + A+NPN+ IGI Y  GSR  V Y+ 
Sbjct  49   YKPKAPSYSVSNMSVSQFDFNSNDLTLYTKLVATVRAENPNEMIGIIYGDGSRTVVSYRG  108

Query  529  TKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRI  708
            T LC G LP  YQG +N TV+E+++ G+  +G+ L SAL+E+++ G VPLD+ + +PV +
Sbjct  109  TPLCSGHLPTFYQGFKNVTVMEISMEGRHGFGSGLQSALEESEKEGNVPLDVFVSVPVSL  168

Query  709  KVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            + G   + +V +   C L+V+S+S     +IK++T
Sbjct  169  RFGSFDVREVRVNVHCALVVDSISPKKKPTIKSAT  203



>ref|XP_002313615.1| harpin-induced family protein [Populus trichocarpa]
 gb|EEE87570.1| harpin-induced family protein [Populus trichocarpa]
Length=281

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 109/190 (57%), Gaps = 2/190 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +K +RS CC C+ W +S +     ++   A ILYL+F+P+ P YS++ + IS L +    
Sbjct  85   RKPRRSHCCCCLCWFLSFLAAFLFLVGLAAAILYLVFRPESPDYSIERVSISGLNLT-SS  143

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
              +  +FNV + A NPN KIGIYYE+GS ++V+    K+  GSLP  YQ   N TV   +
Sbjct  144  GPISPEFNVTVRANNPNNKIGIYYEKGSSVNVYNDGVKMAAGSLPVFYQDKNNVTVFVTS  203

Query  601  LSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            L G + +  + + +AL      G VP +L +  PV+ KVG +K  K+ +  DC L V+ L
Sbjct  204  LKGSAIELTSGVRTALVNGVSKGTVPFNLALRAPVKFKVGSVKTWKITVKVDCDLTVDKL  263

Query  778  STNSLISIKA  807
            + ++ I  K+
Sbjct  264  TASAKIGSKS  273



>ref|XP_003617084.1| Avr9/Cf-9 rapidly elicited protein [Medicago truncatula]
 gb|AET00043.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Medicago truncatula]
Length=255

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 114/199 (57%), Gaps = 7/199 (4%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRV-NPL  417
             +  R CCC C  W + +I +L  ++   AGI YL+F+PK P Y+++N+ I  + + +P 
Sbjct  58   HRRNRHCCCLC--WFIGIIFILIALLGIAAGIFYLVFRPKAPNYTIENITIRGINITSPS  115

Query  418  DLS-LYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
              + +  +F+V + A NPN KIGI YE+ S   ++YK  +LC G LP  YQ   N TV +
Sbjct  116  STTGISPEFDVTVKADNPNDKIGISYEKDSSAEIFYKDMRLCNGILPSFYQPSNNVTVFK  175

Query  595  VALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
              L G   +  +    AL +AQ    V L +K+  PV+IKVG +K  K+ +  DC L+V+
Sbjct  176  TMLKGNGVKMSSEDQRALVKAQTKQEVQLMVKLRAPVKIKVGSVKTWKITVKVDCDLMVD  235

Query  772  SLSTNSLISIKASTCKFKL  828
             L+ N+   I + +C F++
Sbjct  236  KLTANA--KIVSRSCTFRV  252



>ref|XP_010245322.1| PREDICTED: protein YLS9-like [Nelumbo nucifera]
Length=243

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 107/167 (64%), Gaps = 1/167 (1%)
 Frame = +1

Query  301  VLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKI  480
            +L +++A     LY  FQPKIP Y  + + +++  +   D SLYA+F V + A+NPN KI
Sbjct  67   LLILMLAGFIFYLYTFFQPKIPSYKFERIDVNNFDMQK-DFSLYAEFVVTVKAENPNDKI  125

Query  481  GIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQ  660
            GI Y++ S + V Y  + LC G LP  +QG++N TVL + L G+S++G+ L +AL + ++
Sbjct  126  GIVYDKDSIVLVDYDDSTLCSGKLPAFHQGYKNITVLNIVLKGKSEFGSGLQAALMDNRK  185

Query  661  TGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISI  801
            T R+PL +++  PV + +G + L +  +  +C ++V++LS N  +SI
Sbjct  186  TNRIPLFIRVKAPVNVVLGNVPLRQFDVFLNCSMVVDNLSPNKTVSI  232



>ref|XP_010922964.1| PREDICTED: protein YLS9 [Elaeis guineensis]
Length=281

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 111/191 (58%), Gaps = 6/191 (3%)
 Frame = +1

Query  274  MWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYA---KFN  444
            + WT ++++ L   +A  AGILYL+FQPKIPKYSVD L +    ++    +L A   +F+
Sbjct  92   LAWTAALLLFLLFALAVTAGILYLVFQPKIPKYSVDGLAVKGFNLSSAATNLAAISPEFD  151

Query  445  VKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS-QY  621
              I A NPNKKIGIYY  GS ++V Y    LC G  P  YQG +N TV + AL+G   + 
Sbjct  152  ATIRADNPNKKIGIYYRSGSSITVSYDGVNLCHGVWPTFYQGKRNVTVFQTALTGAGIRL  211

Query  622  GNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISI  801
               +  AL  AQ  G VPL++ I +PVRIK G ++   + +   C + V+ L+ ++ +  
Sbjct  212  SAAMKDALVTAQSRGEVPLEINIKVPVRIKFGAVRTWTITVKVGCDVTVDKLAADARVVS  271

Query  802  KASTCKFKLKP  834
            K  +C  K+ P
Sbjct  272  K--SCSVKVDP  280



>ref|XP_009788478.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
 ref|XP_009788479.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
Length=271

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 109/184 (59%), Gaps = 1/184 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +K +RSCCC+C+ +T+ V +V  I++   AG+LY +++P+ PKY++ ++ I +       
Sbjct  74   RKPQRSCCCRCLCFTLIVFLVSVIVLGVTAGVLYAVYRPESPKYTISSIAIKNFNFTSAT  133

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
             ++   F++ + A+NPN KIGIYY +GS ++V Y    L  G LP  +Q   N TV + A
Sbjct  134  STISPGFDIAVRAENPNDKIGIYYMKGSSVTVVYSGVDLSTGVLPAFFQPANNVTVFKTA  193

Query  601  LSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            L G     G+ + S L   Q+  +VP  + I  PV+IK+G +K  ++ +  +C + V++L
Sbjct  194  LKGSKVMLGSAVKSTLMNEQRKRKVPFRVNIKAPVKIKIGAVKTWEITVKVNCGVTVDAL  253

Query  778  STNS  789
            +  S
Sbjct  254  TVKS  257



>dbj|BAK05673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=209

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 103/173 (60%), Gaps = 3/173 (2%)
 Frame = +1

Query  304  LFIIIAACAGILYLIF---QPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNK  474
            L +I+A  AG +   F    PK P YS+  + +S    +  DL+LY K    + A+NPN 
Sbjct  30   LLVIMALVAGAVIHFFYTMHPKAPSYSISKMAVSKFDFSSSDLTLYTKLVATVRAENPND  89

Query  475  KIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEA  654
            KIGI Y  GS   V Y+ T LC G LP  +QGH N T+LE+++ G+  +G+ L  AL+E+
Sbjct  90   KIGIKYAEGSHTVVSYRGTPLCSGKLPTFFQGHNNVTMLEISMEGRHGFGSGLQDALEES  149

Query  655  QQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            ++ G VPLD+ + +PV++++    L ++ +     L+V+S+S     +IK++T
Sbjct  150  EKAGNVPLDVYVTVPVQLQLDTYDLSQIKVNVHAALVVDSISPKKPPTIKSAT  202



>emb|CDP14749.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 118/199 (59%), Gaps = 1/199 (1%)
 Frame = +1

Query  232  WQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVN  411
            + P+KS  S C +C+     ++ +L  +++  A   Y +++PK+P Y V +L +    + 
Sbjct  40   YYPKKSGGSSCLRCICCCYCILFLLIFVVSVLAFYFYTVYEPKVPSYKVQSLDVKSFDLL  99

Query  412  PLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVL  591
            P D SL   F V + A N NK IG  Y +GS + V Y  ++LC GSLP  +QG  NTT++
Sbjct  100  P-DFSLNTVFLVTVEADNMNKAIGFTYGQGSSVLVEYTDSRLCSGSLPNFHQGPHNTTLI  158

Query  592  EVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
            ++ L G+S++G  L  ALQ++++ GR+PL ++I +PV + VG +   +  +  +C L+V+
Sbjct  159  QIELKGRSEFGTGLQQALQDSKEKGRIPLLVRIQVPVSVVVGEISSRQFHVFVNCTLVVD  218

Query  772  SLSTNSLISIKASTCKFKL  828
            +L+    I+I +S   F L
Sbjct  219  NLAPGKKIAILSSKYNFDL  237



>ref|XP_004243338.1| PREDICTED: protein YLS9-like [Solanum lycopersicum]
Length=215

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 102/180 (57%), Gaps = 1/180 (1%)
 Frame = +1

Query  292  VIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPN  471
            V+ +L II+A+ A   Y+ ++PK+P Y   +L + D R  P D S+ A   + +   NPN
Sbjct  36   VLFLLIIILASIAFYFYMYYKPKMPTYDFQSLDVKDFRYQP-DFSVNADLIITMKTDNPN  94

Query  472  KKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQE  651
              IG  Y  GS ++V Y  + +C G LP  YQG +NTT+ ++ L G+S +G+ L  A QE
Sbjct  95   TAIGFIYGEGSSVNVTYSDSNICTGKLPSFYQGQKNTTIFQIELKGKSTFGSGLYEAFQE  154

Query  652  AQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
             ++ G++PL + I +PV+I +G +KL +  +  +  L V+ L       ++ S   F +K
Sbjct  155  NEKNGKIPLKVMIKVPVQIILGDIKLKQFNVFANVTLTVHDLKPGKKPEVEHSQPTFDVK  214



>ref|XP_006371581.1| hypothetical protein POPTR_0019s13360g [Populus trichocarpa]
 gb|ERP49378.1| hypothetical protein POPTR_0019s13360g [Populus trichocarpa]
Length=225

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 111/178 (62%), Gaps = 1/178 (1%)
 Frame = +1

Query  298  VVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKK  477
            +V+ I++A+   +LY+   PK+P+Y++++  ++   + P D SLY +F V + A NPNK+
Sbjct  46   IVVIIVLASLLSVLYVTLDPKMPQYNIESFEVNAFNMAP-DFSLYTEFVVVVKANNPNKE  104

Query  478  IGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQ  657
            I   Y + S + V Y  + LC G LP  +Q  +NTT++ V L+G+S++G+ L  AL + +
Sbjct  105  IAFTYGKDSSVVVAYSDSTLCSGKLPAFHQPFENTTMIRVVLTGKSEFGSGLQEALMDNR  164

Query  658  QTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            +TGR+PL + +  P+ + V  L L +V +  +C L+V++L+ N  + I +ST  +  +
Sbjct  165  ETGRIPLLVIVKAPISVMVKSLALRQVMVNVNCSLVVDNLAPNKRVRILSSTYTYAFE  222



>ref|XP_003519484.1| PREDICTED: uncharacterized protein LOC100789647 [Glycine max]
Length=273

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 103/175 (59%), Gaps = 3/175 (2%)
 Frame = +1

Query  280  WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD--LSLYAKFNVKI  453
            W + ++ +L + +A  AG+LYL+F+P+ PKYS++N+ +  + +       ++   FNV +
Sbjct  87   WLIGILFILVVFLAIAAGVLYLVFRPEEPKYSIENIAVRGINLTSPSSTAAMSPVFNVTV  146

Query  454  TAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS-QYGNT  630
             A NPN KIGI Y + S   V+YK  +LC G+LP  YQ   N TV   AL G   +  + 
Sbjct  147  KADNPNDKIGIRYLKDSSAEVFYKDARLCNGALPAFYQPSNNVTVFGTALRGDGIELRSE  206

Query  631  LLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLI  795
            +  AL EAQ   RVPL ++I  PV+IKVG +K  K+ +  +C + VN L+  + I
Sbjct  207  VRRALLEAQTKRRVPLTVRIRAPVKIKVGSVKTWKITVKVNCHMTVNELTARAKI  261



>ref|XP_011043555.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=280

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 109/190 (57%), Gaps = 2/190 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +K +RS CC C+ W +S +     ++   A ILYL+F+P+ P YS++ + IS L +    
Sbjct  84   RKPRRSHCCCCLCWFLSFLAAFLFLVGLAAAILYLVFRPESPDYSIERVSISGLNLT-SS  142

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
              +  +FNV + A N N KIGIYYE+GS ++V+    K+  GSLP  YQ   N TV   +
Sbjct  143  GPISPEFNVTVRANNRNNKIGIYYEKGSSVNVYNDGVKMAAGSLPVFYQEKNNVTVFVTS  202

Query  601  LSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            L G + +  + + +AL +    G VP +L +  PV+ KVG +K  K+ +  DC L V+ L
Sbjct  203  LKGSAIELTSGVRTALVDGVSKGTVPFNLVLRAPVKFKVGSVKTWKITVKVDCDLTVDKL  262

Query  778  STNSLISIKA  807
            + ++ I  K+
Sbjct  263  TASAKIGSKS  272



>ref|XP_002517954.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44472.1| conserved hypothetical protein [Ricinus communis]
Length=236

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 104/174 (60%), Gaps = 1/174 (1%)
 Frame = +1

Query  310  IIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIY  489
            I +AA    LY   QP+IP Y+VD   +    V P D SLY +F V + + NPN  IG  
Sbjct  63   IFLAAALFALYSALQPEIPHYNVDRFDVHAFNVQP-DFSLYTEFVVTVKSDNPNMHIGFD  121

Query  490  YERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGR  669
            Y + S + V Y+ + LC GS+P  +Q H N +++ + L G+S++G+ L  AL + + TGR
Sbjct  122  YGKESSVVVTYRDSPLCSGSIPTFHQPHHNISLIPIVLKGKSEFGSGLQEALMQNRNTGR  181

Query  670  VPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            +PL +++  PV I V  L L +V +L +C L+V++LS N    I +S+ ++ ++
Sbjct  182  IPLLVEVKAPVSIVVQELPLRQVTVLINCSLVVDNLSPNKKAKILSSSYQYGVE  235



>ref|XP_003545485.1| PREDICTED: uncharacterized protein LOC100800674 isoform 1 [Glycine 
max]
Length=273

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 107/175 (61%), Gaps = 3/175 (2%)
 Frame = +1

Query  280  WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRV-NPLDL-SLYAKFNVKI  453
            W + ++ +L +++A  AG+LYL+F+P+ PKYS++N+ +  + + +P  + ++  +FNV +
Sbjct  87   WLIGILFILVVLLAIAAGVLYLVFRPEAPKYSIENITVRGINLTSPSSVAAISPEFNVTV  146

Query  454  TAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS-QYGNT  630
             A NPN KIGI Y + S   V+YK  +LC G+LP  YQ   N TV   AL G   +  + 
Sbjct  147  KADNPNDKIGIRYLKDSSAEVFYKDARLCNGALPAFYQPSNNVTVFGTALRGDGIELRSE  206

Query  631  LLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLI  795
               AL EAQ   RVPL ++I  PV+IKVG ++  K+ +  +C + VN L+  + I
Sbjct  207  DRRALLEAQTKRRVPLTVRIRAPVKIKVGSIRTWKITVKVNCDVTVNELTAQAKI  261



>gb|EAZ08367.1| hypothetical protein OsI_30624 [Oryza sativa Indica Group]
Length=339

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 97/155 (63%), Gaps = 0/155 (0%)
 Frame = +1

Query  349  FQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKT  528
            ++PK P YSV N+ +S    N  DL+LY K    + A+NPN  IGI Y  GS   V Y+ 
Sbjct  49   YKPKAPSYSVSNMSVSQFDFNSNDLTLYTKLVASVRAENPNDMIGIKYGEGSHTVVSYRG  108

Query  529  TKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRI  708
            T LC G LP  +QG +N TV+++++ G+  +G+ L SAL+E+++ G VPLD+ + +PV +
Sbjct  109  TPLCSGKLPAFFQGFKNVTVMDISMEGRHGFGSGLQSALEESEKLGNVPLDVFVSVPVSL  168

Query  709  KVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            + G   + +V +   C L+V+S+S     +IK++T
Sbjct  169  RFGSFDVREVRVNVHCALVVDSISPKKKPTIKSAT  203



>ref|XP_007141573.1| hypothetical protein PHAVU_008G207300g [Phaseolus vulgaris]
 gb|ESW13567.1| hypothetical protein PHAVU_008G207300g [Phaseolus vulgaris]
Length=273

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 111/199 (56%), Gaps = 5/199 (3%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNP--  414
            +K  RS  C C  W + ++ +  +++   AGI YL+F+P+ PKYS++N+ +  + V    
Sbjct  74   RKHSRSRFCCCCCWLIGLLFIFVVLLGIAAGIFYLVFRPEAPKYSIENIAVRGINVTSPS  133

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
             D ++  +FNV + A NPN KIGIYY + S   V+Y   +LC G+LP  +Q   N TV  
Sbjct  134  FDAAISPEFNVTVKADNPNDKIGIYYLKDSSAEVFYNDARLCNGALPAFHQPSNNVTVFG  193

Query  595  VALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
            + L G   +  +    +L  +Q   +VPL + I  PVRIKVG +K  K+ +  DC + VN
Sbjct  194  MVLKGNGIELSSEDQRSLVGSQTKRKVPLTVSIRAPVRIKVGSVKTWKITVKVDCDVTVN  253

Query  772  SLSTNSLISIKASTCKFKL  828
             L+  + I  K   C +K+
Sbjct  254  ELTAQAKIVSK--RCDYKV  270



>ref|XP_010243135.1| PREDICTED: protein YLS9-like [Nelumbo nucifera]
Length=271

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 103/169 (61%), Gaps = 3/169 (2%)
 Frame = +1

Query  331  GILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRL  510
            G+ YL+ +PKIP YSV+++ I    +   D ++   FNV + A+NPNKKIGIYYE GS +
Sbjct  102  GVFYLVVRPKIPSYSVEDVSIKGFNLTLTDPTISPVFNVTVRAENPNKKIGIYYETGSYV  161

Query  511  SVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS-QYGNTLLSALQEAQQTGRVPLDLK  687
            +V Y   KLC G+LP  +Q  +N TV    L G   +  + + + L + Q+ G++PL L 
Sbjct  162  AVSYTDVKLCNGALPAFFQPSKNVTVFATELKGSDLRLSSQVHATLTQEQKLGKIPLGLY  221

Query  688  IDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLKP  834
            + +PVR+KVG +K   + +   C + VN LS ++  ++ + +C  +LKP
Sbjct  222  LKVPVRVKVGSVKTWTITVKVHCDITVNKLSVDA--AVLSKSCDARLKP  268



>ref|XP_009350715.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
Length=272

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 112/201 (56%), Gaps = 5/201 (2%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNL--RISDLRVNP  414
            Q  +RS C  C  W   ++  L ++ AA AGI YL+ +PK P YS+D++  R  +L    
Sbjct  73   QNPRRSSCRCCFCWFFGLVAALILLSAAAAGIFYLVVRPKSPNYSIDSIAFRGFNLTAPS  132

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
               ++  +  V + AQNPNKKIGIYY + S + ++Y   KLC G+LP  YQ   N TV  
Sbjct  133  PSYAISPEIQVTVRAQNPNKKIGIYYGKKSSVKLFYSDGKLCDGALPAFYQPSSNVTVFR  192

Query  595  VALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
             AL G   +  +T    L +AQ+ G+VPL L I MPVRIKVG +K   + +   C L V+
Sbjct  193  TALKGSGIELTSTAQQGLVDAQKQGKVPLGLDIRMPVRIKVGPIKTWTINVKVGCDLTVD  252

Query  772  SLSTNSLISIKASTCKFKLKP  834
             L+T + I  K   C + + P
Sbjct  253  KLTTEAKIVSK--DCDYSVDP  271



>ref|XP_004491178.1| PREDICTED: uncharacterized protein LOC101511932 isoform X1 [Cicer 
arietinum]
 ref|XP_004491179.1| PREDICTED: uncharacterized protein LOC101511932 isoform X2 [Cicer 
arietinum]
Length=274

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 113/204 (55%), Gaps = 7/204 (3%)
 Frame = +1

Query  226  QAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVD--NLRISD  399
            + +  +K+ R+ CC C  W + +I VL +++   AG+LYL+F+P+ PKYS+   N+R  +
Sbjct  72   EEYTRRKNHRNRCCCC--WFIGLIFVLLVLLGITAGVLYLVFRPEAPKYSIQQINIRGIN  129

Query  400  LRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQN  579
            L       +    F+V + A NPN KIGI YE+ S   ++Y    LC G +P  YQ   N
Sbjct  130  LTSPSSTAASSPVFDVTVKADNPNNKIGISYEKESSAEIFYNNVILCNGVMPTFYQPSNN  189

Query  580  TTVLEVALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDC  756
             TV +  L G   +  N    AL +AQ   +VPL +K+  PV+IKVG +K  K+ +  DC
Sbjct  190  VTVFKTVLEGSGIKLNNENRRALLKAQTKRKVPLIVKLRAPVKIKVGSVKTWKITVKIDC  249

Query  757  MLIVNSLSTNSLISIKASTCKFKL  828
             L V+ L+  + I  +   C F++
Sbjct  250  DLTVDQLTAKAKIGYRH--CNFRV  271



>ref|XP_006357497.1| PREDICTED: uncharacterized protein LOC102600286 [Solanum tuberosum]
Length=215

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 102/180 (57%), Gaps = 1/180 (1%)
 Frame = +1

Query  292  VIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPN  471
            V+ +L II+A+ A   Y+ ++PKIP Y   +L + D    P D S+     + + A NPN
Sbjct  36   VLFLLIIILASIAFYFYMYYKPKIPTYDFQSLDVKDFGYQP-DFSVNVDLILTMKANNPN  94

Query  472  KKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQE  651
              IG  Y  GS ++V Y  + +C G LP  +QG +NTT+ ++ L+G+S +G+ L  A QE
Sbjct  95   TAIGFIYGEGSSVNVTYSDSNICTGKLPSFHQGQKNTTIFQIELTGKSTFGSGLYEAFQE  154

Query  652  AQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
             ++ G++PL + I +PV+I +G +KL +  +  +  L V+ L       ++ S   F +K
Sbjct  155  NEKNGKIPLKVMIKVPVQIILGDIKLKQFNVFANVTLTVHDLKPGKKPEVEHSKPTFDVK  214



>gb|EMT15576.1| hypothetical protein F775_11436 [Aegilops tauschii]
Length=209

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = +1

Query  337  LYLIF--QPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRL  510
            +YL++  +PK P YSV  + +S    +  DL+LY K    + A+NPN KIGI Y  GSR 
Sbjct  42   VYLVYTLKPKAPSYSVSKMAVSKFDFSSSDLTLYTKLVATVRAENPNDKIGIKYADGSRT  101

Query  511  SVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKI  690
             V Y+ T LC G LP  +QGH N T+LE+++ G+  +G+ L  AL+E+++ G VPLD+ +
Sbjct  102  VVSYRGTPLCSGKLPTFFQGHNNVTMLEISMEGRHGFGSGLQEALEESEKAGNVPLDVYV  161

Query  691  DMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
             +PV++ +    L ++ +     L+V+S+S     +IK++T
Sbjct  162  TVPVQLLLDTYDLPQLKVNVHAALVVDSISPKKPPTIKSAT  202



>ref|XP_010521605.1| PREDICTED: uncharacterized protein LOC104800491 [Tarenaya hassleriana]
Length=263

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 112/192 (58%), Gaps = 3/192 (2%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +K  R+ C  C    ++ I+ L ++    A +LYL+++P+ P+YSV+ + IS   V    
Sbjct  67   KKPNRNRCRCCFCSFLAGIITLAVLAGISAAVLYLVYRPESPRYSVEGVSISGFNVTSTS  126

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
              +  +F+V + ++N N KIGIYYE+GS + V+Y    LC G+LP  YQ   N TV + A
Sbjct  127  -PISPRFDVTVRSRNGNGKIGIYYEKGSSVDVYYNDLDLCNGALPVFYQPTNNVTVFKTA  185

Query  601  LSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            L+G   Q  +++   L++ Q    VP  LKI +PVRIKVG +K   V +  +C L V+ L
Sbjct  186  LTGAKIQLTSSMRKELRDRQSKKTVPFKLKIKVPVRIKVGSVKSWTVSVKVNCELTVDKL  245

Query  778  STNS-LISIKAS  810
            +T S ++S K S
Sbjct  246  TTASRIVSTKCS  257



>ref|XP_009768528.1| PREDICTED: uncharacterized protein LOC104219533 [Nicotiana sylvestris]
Length=221

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 101/174 (58%), Gaps = 1/174 (1%)
 Frame = +1

Query  310  IIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIY  489
            ++++A     Y ++QP++P+Y+   L I +    P D +L     V I A+NPNKKI + 
Sbjct  46   LVVSALTYYFYRVYQPQMPRYNFQALEIKEFGYQPHDFTLTMDIIVTIKAENPNKKIELS  105

Query  490  YERGSRLSVWY-KTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTG  666
            Y   S +++ Y  +T LC G LP   QG++NTT+++V L G+SQ+G+    A+QE ++ G
Sbjct  106  YGEASSMNMTYTDSTILCSGKLPAFRQGYKNTTIIQVELKGKSQFGSGQYEAMQENEKNG  165

Query  667  RVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
            ++PL +   +PV +  G+  L K  +L +C LIVN+L       I  S   +KL
Sbjct  166  KIPLSVTAKVPVEVLFGKTPLKKFNVLANCSLIVNNLKPGKKAEIVESKFTYKL  219



>gb|EMS64527.1| hypothetical protein TRIUR3_33050 [Triticum urartu]
Length=290

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 97/159 (61%), Gaps = 0/159 (0%)
 Frame = +1

Query  337  LYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSV  516
            L+   +PK P YSV  + +S    +  DL+LY K    + A+NPN KIGI Y  GS   V
Sbjct  44   LFYTMKPKPPSYSVSKMAVSKFDFSSSDLTLYTKLVATVRAENPNDKIGIKYADGSHTVV  103

Query  517  WYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDM  696
             Y+ T LC G LP  +QGH N T+LE+++ G+  +G+ L  AL+E+++ G VPLD+ + +
Sbjct  104  SYRGTPLCSGKLPTFFQGHNNVTMLEISMEGRHGFGSGLQEALEESEKAGNVPLDVYVTV  163

Query  697  PVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKAST  813
            PV++++    L ++ +     L+V+S+S     +IK++T
Sbjct  164  PVQLQLDTYDLHQIKVNVHAALVVDSISPKKPPTIKSAT  202



>ref|XP_010093832.1| hypothetical protein L484_022546 [Morus notabilis]
 gb|EXB54683.1| hypothetical protein L484_022546 [Morus notabilis]
Length=268

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 115/203 (57%), Gaps = 3/203 (1%)
 Frame = +1

Query  226  QAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLR  405
            Q +  +KS+RS C  C+   +  IVVL I+    A +LYL+F+P+ P YS+D++ I  + 
Sbjct  65   QNYSRRKSRRSKCGLCLCSLLGSIVVLAILAGISAAVLYLVFRPESPNYSIDDIAIKGIN  124

Query  406  VNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTT  585
                   +    +V + A+NPN  IGI+Y + S ++V+Y   +LC G++P  +Q   N T
Sbjct  125  TTASSAEISPAIDVVLRAKNPNDNIGIFYGKDSSVTVYYSDVELCNGAMPAFHQPSNNVT  184

Query  586  VLEVALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCML  762
            V + AL+G   +   ++  AL+++++ G+VPL L +  PV+ KVG +K   + +   C +
Sbjct  185  VFKTALTGPGIELTASMKKALRDSEKKGKVPLKLNMKAPVKFKVGSVKTWTLAVKFRCDV  244

Query  763  IVNSLSTNSLISIKASTCKFKLK  831
             V+ L+  + I  K   C++  K
Sbjct  245  TVDKLTAEAKIVSK--DCEYGWK  265



>ref|XP_007016676.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
 ref|XP_007016677.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
 gb|EOY34295.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
 gb|EOY34296.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative isoform 1 [Theobroma cacao]
Length=260

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 108/182 (59%), Gaps = 6/182 (3%)
 Frame = +1

Query  253  RSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLY  432
            RSCCC C+   + V+++   I AA   ++Y +F+P+ P YSV+++ I  L +      L 
Sbjct  72   RSCCC-CLLTVILVLLLSAAIAAA---VVYFVFKPESPNYSVESVAIKGLNLTSAS-PLS  126

Query  433  AKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQ  612
             +F+V + A NPN KIGIYYE+GS + V+Y+   LC G+LP  YQ   N TV + AL G 
Sbjct  127  PEFDVTVRAHNPNDKIGIYYEKGSSVKVYYEDVNLCNGALPAFYQPTNNVTVFQTALKGS  186

Query  613  S-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNS  789
              +  NT L AL +AQ  G VP  LK+  PV+IKVG +K  K+     C + V++L+  S
Sbjct  187  GIELTNTALRALSDAQNKGTVPFTLKLRAPVKIKVGSIKTWKITAKVTCKITVDNLTATS  246

Query  790  LI  795
             I
Sbjct  247  KI  248



>emb|CDP19130.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 112/198 (57%), Gaps = 4/198 (2%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +K +RSCC  C+ +TV V+ ++ +  A  AG+LYL+++PK PKY+V ++ I  L      
Sbjct  93   RKPRRSCCRLCVCYTVFVLFLVIVAAAISAGVLYLVYRPKAPKYAVLDVAIRGLNSTSTS  152

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
             ++  +F+V I A+NPNKKIGIYY  GS + V +    L  G+ P  YQ  +N TV + A
Sbjct  153  -AMSPEFDVSIRAENPNKKIGIYYLSGSEIQVSHGDVGLSNGAWPVFYQPSKNVTVFQTA  211

Query  601  LSGQSQY-GNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            L G      + +  A+    + G VP  L I  PV+IKVG +K  K+ +   C + V++L
Sbjct  212  LKGSDVVLSDDVRLAMANELREGNVPFRLNIKAPVKIKVGSVKTWKITVKVKCDVAVDAL  271

Query  778  STNSLISIKASTCKFKLK  831
            +  S I  K   C + +K
Sbjct  272  NQQSKIVSK--DCDYSVK  287



>ref|XP_002319911.1| hypothetical protein POPTR_0013s13940g [Populus trichocarpa]
 gb|EEE95834.1| hypothetical protein POPTR_0013s13940g [Populus trichocarpa]
Length=239

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 110/190 (58%), Gaps = 1/190 (1%)
 Frame = +1

Query  262  CCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKF  441
            C KC+ +    ++V+ I++A+    +Y+   PK+P+Y+V +  ++   + P D SLY +F
Sbjct  45   CLKCVCFCFCFLIVMIILLASVIAFIYMTLNPKMPEYNVASFDVNAFNMAP-DFSLYTEF  103

Query  442  NVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQY  621
             V + A NPN  I   Y + S + V Y  + LC G LP  +Q   NTT+++V L G+S++
Sbjct  104  AVTVKANNPNTGISFIYGKESSVVVAYSDSTLCSGKLPAFHQPGVNTTMIQVVLKGKSEF  163

Query  622  GNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISI  801
            G+ L   L + ++TG++PL + ++ PV + +    L +V +  +C L+V++LS N  + I
Sbjct  164  GSGLQEVLMDNRETGKIPLLVMVNAPVSVVLKSFPLREVIVNVNCSLVVDNLSPNKRVRI  223

Query  802  KASTCKFKLK  831
             +S   + + 
Sbjct  224  LSSEYAYAVN  233



>ref|XP_006470441.1| PREDICTED: protein YLS9-like [Citrus sinensis]
Length=254

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 100/173 (58%), Gaps = 4/173 (2%)
 Frame = +1

Query  319  AACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYER  498
            A  AG+ YL+F+P+ P YSVD + I+ L +      +  +F+V +TA NPN KIGIYYER
Sbjct  82   AIAAGVFYLVFRPESPNYSVDGVSIAGLNLTSPSSVVSPRFDVSVTADNPNDKIGIYYER  141

Query  499  GSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS-QYGNTLLSALQEAQQTGR-V  672
            GS + V YK   LC G  P+ YQ   N TV + +L G S +  + +   L  AQ +G+ V
Sbjct  142  GSSVEVSYKDVALCDGEWPQFYQPSNNVTVFKTSLKGSSIELTSAMRKDLVAAQTSGKTV  201

Query  673  PLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            P  + + +PV+IKVG +K   + +   C L V+ L++ S I  K   C + +K
Sbjct  202  PFKVNLRVPVKIKVGSVKTWTIKVKVRCDLTVDKLTSQSKIVSK--DCDYSVK  252



>gb|KDP24159.1| hypothetical protein JCGZ_25816 [Jatropha curcas]
Length=236

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 105/184 (57%), Gaps = 7/184 (4%)
 Frame = +1

Query  259  CCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAK  438
            CCC   W      ++L I++A     L+ +F+P+IP Y V+   ++   +   D SLYA+
Sbjct  52   CCCFFFW------LILIILLAGAIVALFTVFEPEIPHYKVERFDVNTFDLQ-QDFSLYAE  104

Query  439  FNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQ  618
            F V + ++NPN+ IG  Y + S + V Y+ + LC+G +P   Q   NTT++ + L G+S 
Sbjct  105  FVVTVKSENPNQHIGFRYGKDSSVIVTYRDSTLCKGKVPAFLQPTSNTTMIRIVLKGKSA  164

Query  619  YGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLIS  798
            +G+ L  AL + + TG++PL +++  PV + V      +V +  +C L+VN+LS  +   
Sbjct  165  FGSKLQEALMQNRNTGKIPLLVEVKAPVSVVVQDFPFRQVTVFLNCSLVVNNLSPKTKAK  224

Query  799  IKAS  810
            I +S
Sbjct  225  ILSS  228



>ref|XP_006446378.1| hypothetical protein CICLE_v10016351mg [Citrus clementina]
 gb|ESR59618.1| hypothetical protein CICLE_v10016351mg [Citrus clementina]
Length=256

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 100/173 (58%), Gaps = 4/173 (2%)
 Frame = +1

Query  319  AACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYER  498
            A  AG+ YL+F+P+ P YSVD + I+ L +      +  +F+V +TA NPN KIGIYYER
Sbjct  84   AIAAGVFYLVFRPESPNYSVDGVSIAGLNLTSPSSVVSPRFDVSVTADNPNDKIGIYYER  143

Query  499  GSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS-QYGNTLLSALQEAQQTGR-V  672
            GS + V YK   LC G  P+ YQ   N TV +  L G S +  +++   L  AQ +G+ V
Sbjct  144  GSSVEVSYKDVALCDGEWPQFYQPSNNVTVFKTLLKGSSIELTSSMRKDLVAAQTSGKTV  203

Query  673  PLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            P  + + +PV+IKVG +K   + +   C L V+ L++ S I  K   C + +K
Sbjct  204  PFKVNLRVPVKIKVGSVKTWTIKVKVRCDLTVDKLTSQSKIVSK--DCDYSVK  254



>ref|XP_008786759.1| PREDICTED: uncharacterized protein LOC103704991 [Phoenix dactylifera]
 ref|XP_008786761.1| PREDICTED: uncharacterized protein LOC103704991 [Phoenix dactylifera]
 ref|XP_008786762.1| PREDICTED: uncharacterized protein LOC103704991 [Phoenix dactylifera]
 ref|XP_008786763.1| PREDICTED: uncharacterized protein LOC103704991 [Phoenix dactylifera]
Length=277

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 107/189 (57%), Gaps = 6/189 (3%)
 Frame = +1

Query  280  WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYA---KFNVK  450
            WT ++++   + +AA A ILY +FQPKIP YSVD L +    ++    +L A   +F+  
Sbjct  90   WTAALLLFFLVALAAAAVILYFVFQPKIPNYSVDGLSVKGFNLSSTAANLAALSPEFDAT  149

Query  451  ITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS-QYGN  627
            + A N NKKIGIYY  GS ++V Y    LC G  P  YQG +N TV + AL+G   +   
Sbjct  150  VRADNANKKIGIYYRSGSSIAVSYDGVNLCHGVWPTFYQGERNATVFQTALTGSGIRLAA  209

Query  628  TLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKA  807
               +AL  AQ  G+VPL++ I +PVR+K G +    + +   C + VN L+ +S I  K 
Sbjct  210  ATHAALVTAQSHGKVPLEINIQVPVRLKFGAVTTWTITVKVRCDVTVNKLTADSRIISK-  268

Query  808  STCKFKLKP  834
             +C  K+ P
Sbjct  269  -SCSVKVDP  276



>ref|XP_006648662.1| PREDICTED: uncharacterized protein LOC102720493 [Oryza brachyantha]
Length=221

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 117/205 (57%), Gaps = 6/205 (3%)
 Frame = +1

Query  217  PSTQAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRIS  396
            P  +  + ++ +RSCCC+     + ++V +  +  A     Y    PK+P Y+V+ L +S
Sbjct  21   PPDRPGKTKQKRRSCCCRVACAALVLVVAVAAVAGAP----YRALAPKLPLYAVEVLNVS  76

Query  397  DLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQ  576
               ++  +++  A+F+  +  +NPN+ IGI YE GS L+V+Y + +L +GSLP  YQGH 
Sbjct  77   AFDMD-YEMTARARFDADVRFENPNRAIGISYEAGSSLAVYYGSYRLSEGSLPAFYQGHG  135

Query  577  NTTVLEVALSGQSQYGNTLLSALQEA-QQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGD  753
            +  V+ VA+S     G  ++ A++   +  G +PL  +  +PVR+KVGR+   K+     
Sbjct  136  DAAVVRVAMSEAQLAGTGVVEAMRHVNEDDGELPLVFRGVVPVRVKVGRVTAAKMTPRIR  195

Query  754  CMLIVNSLSTNSLISIKASTCKFKL  828
            C L+++ LST   I +K  +CK KL
Sbjct  196  CDLVLDRLSTEGEIRVKKMSCKIKL  220



>gb|KDO66384.1| hypothetical protein CISIN_1g025262mg [Citrus sinensis]
Length=255

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 99/173 (57%), Gaps = 4/173 (2%)
 Frame = +1

Query  319  AACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYER  498
            A  AG+ YL+F+P+ P YSVD + I+ L +      +  +F+V +TA NPN KIGIYYER
Sbjct  83   AIAAGVFYLVFRPESPNYSVDGVSIAGLNLTSPSSVVSPRFDVSVTADNPNDKIGIYYER  142

Query  499  GSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS-QYGNTLLSALQEAQQTGR-V  672
            GS + V YK   LC G  P+ YQ   N TV +  L G S +  + +   L  AQ +G+ V
Sbjct  143  GSSVEVSYKDVALCDGEWPQFYQPSNNVTVFKTLLKGSSIELTSAMRKDLVAAQTSGKTV  202

Query  673  PLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            P  + + +PV+IKVG +K   + +   C L V+ L++ S I  K   C + +K
Sbjct  203  PFKVNLRVPVKIKVGSVKTWTIKVKVRCDLTVDKLTSQSKIVSK--DCDYSVK  253



>ref|XP_010928131.1| PREDICTED: uncharacterized protein LOC105049989 [Elaeis guineensis]
Length=191

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 102/191 (53%), Gaps = 9/191 (5%)
 Frame = +1

Query  262  CCKCMWWTVSVIVVLFIIIAACAGILY--LIFQPKIPKYSVDNLRISDLRVNPLDLSLYA  435
            CC C  +       L  ++ A A  LY  L+  P +P Y V++  ++ L +NP D S+ A
Sbjct  6    CCSCTLF-------LLFLLMAVASFLYISLVINPVMPTYKVEHFGVTALDINPKDGSVAA  58

Query  436  KFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS  615
            +  V + A+NPNKK+G+ Y+ G  ++V Y    LC G LP LYQ  Q+  V+ V+L G+ 
Sbjct  59   ELAVTVRAENPNKKVGVRYKEGGWVAVAYHGVALCSGQLPALYQEPQSVAVMRVSLKGRE  118

Query  616  QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLI  795
            +    + +ALQ  Q TG VPLD+ +  PV ++VG + L +V +     L V  LS     
Sbjct  119  KLEVGMAAALQRDQSTGSVPLDVTVRAPVALRVGEVDLREVVVKAVWDLEVEGLSPGKNA  178

Query  796  SIKASTCKFKL  828
            SIK    K  L
Sbjct  179  SIKVKDYKVNL  189



>ref|XP_009361555.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
Length=265

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 112/201 (56%), Gaps = 5/201 (2%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRIS--DLRVNP  414
            Q  +RS C  C +W   ++  L ++ AA AGI YL+ +P+ P YS++++     +L    
Sbjct  66   QNPRRSSCRCCFYWLFGLVAALILLSAAAAGIFYLVVRPESPNYSIESIAFKGFNLTTPS  125

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
               ++  +  V +  QNPNKKIGIYY + + + ++Y   KLC G+LP  YQ  +N T   
Sbjct  126  PSSTISPEIQVTVRVQNPNKKIGIYYGKKNSVKLFYSDIKLCDGALPAFYQPSKNVTEFR  185

Query  595  VALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
             AL G   +  +T+   L +AQ  G+VPL+L I MPVRIKVG +K   + +   C L V+
Sbjct  186  TALKGSGIELTSTVQQGLVDAQNQGKVPLELDIRMPVRIKVGPIKTWTITVKVGCDLTVD  245

Query  772  SLSTNSLISIKASTCKFKLKP  834
             L+T + I  K   C + + P
Sbjct  246  KLTTEAKIVSK--DCDYSVDP  264



>ref|XP_010557487.1| PREDICTED: uncharacterized protein LOC104826475 [Tarenaya hassleriana]
Length=291

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 114/193 (59%), Gaps = 5/193 (3%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRV-NPL  417
            +K  RS C  C    V+ I++L ++    A +LYL+++P++P+YSV+ + IS   V +P 
Sbjct  94   KKPNRSRCRCCFCSFVAGILILTVVAGISASVLYLVYRPEMPRYSVEGISISGFNVTSPS  153

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
             +S   +F+V   +QN N KIGIYYE+GS + V+Y    LC G LP  YQ  +N TV + 
Sbjct  154  PIS--PRFDVTFRSQNGNGKIGIYYEKGSSVDVYYNDLDLCNGKLPAFYQPAKNVTVFKT  211

Query  598  ALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNS  774
            A++G+  Q   ++   + + Q    VP  L I +PV I+VG +KL  V +  +C L V++
Sbjct  212  AVTGEKIQLMRSMRKEMIDWQGKKTVPFKLSIRVPVGIEVGSVKLGTVNVKVNCDLTVDN  271

Query  775  LSTNS-LISIKAS  810
            L+  S ++S K S
Sbjct  272  LTRKSRIVSTKCS  284



>ref|XP_002273485.1| PREDICTED: protein YLS9 [Vitis vinifera]
 emb|CBI24356.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 115/208 (55%), Gaps = 11/208 (5%)
 Frame = +1

Query  226  QAWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLR  405
            Q +  +K +RS CC C+ W + +  +L  ++A  AGI YL+ +PK   YSV+++ I+   
Sbjct  63   QKYSGRKPRRSGCCCCLCWFLGLAALLIFLLAIAAGIFYLVIRPKALSYSVEDISITGFN  122

Query  406  VNPLDLSLY--AKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQN  579
            V+    +     +F+V + A NPNKKI IYYE  S + V+Y    LC G LP  YQ  +N
Sbjct  123  VSSAAATASISPEFDVTVRADNPNKKISIYYEEDSSVKVYYSDVDLCNGVLPVFYQPPKN  182

Query  580  TTVLEVALSGQSQYGNTLLSALQEA----QQTGRVPLDLKIDMPVRIKVGRLKLMKVGIL  747
             TV + AL+G    G  L S ++E     Q+ G +PL LK+  PV+I+VG +K   + + 
Sbjct  183  VTVFQTALNGS---GVVLTSGMKETLVNQQREGNIPLKLKLKAPVKIRVGSVKTWTITVK  239

Query  748  GDCMLIVNSLSTNSLISIKASTCKFKLK  831
              C L V+ L+  S I  K   C F ++
Sbjct  240  VSCDLTVDKLTAESKIVSK--DCDFSVR  265



>ref|XP_010236796.1| PREDICTED: protein YLS9-like [Brachypodium distachyon]
Length=200

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 100/168 (60%), Gaps = 3/168 (2%)
 Frame = +1

Query  331  GILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRL  510
            G LY+   PK+P+Y+V  L ++   ++  DL+  A+F+  +  +NPN+ IGI YE GS L
Sbjct  33   GALYVALDPKLPRYTVHALNVTAFGMDD-DLTARARFDAAVRFENPNRAIGISYEAGSSL  91

Query  511  SVWYKTTKLCQGSLPELYQGHQN-TTVLEVALSGQSQYGNTLLSALQEAQQT-GRVPLDL  684
            +VWY   +L QG+L   YQGH++   V+ VA+S     G  +++A++   +  G +PL  
Sbjct  92   AVWYGGYRLSQGALSPFYQGHRSKAVVVHVAMSEARLQGTGMVAAMRHVNEAGGELPLVF  151

Query  685  KIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
            + ++PVR+KVGR    KV     C ++++ LST  +I +K  +C  K 
Sbjct  152  RGEVPVRVKVGRFTTGKVTPRVRCDVVLDRLSTEGVIGVKRLSCNLKF  199



>ref|XP_010904739.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=279

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 120/211 (57%), Gaps = 11/211 (5%)
 Frame = +1

Query  226  QAWQPQKSKRSC--CCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISD  399
            QA+  +  +R C  CC C+ WT ++++ L +  AA AGILYL+FQPKIPKYSVD L +  
Sbjct  71   QAYTRRAHRRRCGFCC-CLAWTAALLLFLLVATAAAAGILYLVFQPKIPKYSVDGLSVKG  129

Query  400  LRVNPLDLSLYA-----KFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELY  564
              ++    +        +F+  + A NPN+KIGIYY  GS +S+ Y    LC G  P  Y
Sbjct  130  FNLSAATAAANLAALSPEFDATVRADNPNEKIGIYYRSGSSISISYDGVNLCHGVWPTFY  189

Query  565  QGHQNTTVLEVALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVG  741
            QG +N TV + AL+G   +    + +AL  AQ   +VPL++ + +PVR+K G +    + 
Sbjct  190  QGKRNVTVFQTALTGSGIRLSAAMRNALVTAQSRRKVPLEINLAVPVRVKFGAVTTWTIT  249

Query  742  ILGDCMLIVNSLSTNSLISIKASTCKFKLKP  834
            +   C + V+ L+ +S I  K  +C  K+ P
Sbjct  250  VNVRCDVTVDKLTVDSRIVSK--SCSVKVDP  278



>gb|EYU26144.1| hypothetical protein MIMGU_mgv1a013252mg [Erythranthe guttata]
Length=226

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 102/170 (60%), Gaps = 1/170 (1%)
 Frame = +1

Query  322  ACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERG  501
            A +  LYL + PKIP Y V+NL +    + P D SL  +F + +TAQNPNK++G  Y   
Sbjct  57   AVSVALYLYYDPKIPTYKVENLAVKAFNIMP-DFSLNTEFLLSVTAQNPNKRVGFIYGER  115

Query  502  SRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTGRVPLD  681
            S + V Y    LC G +P  YQG +NTT++++ L+G+S +G+ L  A  + +   ++PL 
Sbjct  116  SWVVVTYSDAVLCSGKIPNFYQGFENTTLMQIGLTGKSDFGSGLQQAFTDNKNNHKIPLL  175

Query  682  LKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            +++ +P+ + +G++ L +  +  +C L+++++S N  + I +    F ++
Sbjct  176  VRLKVPIIVVLGQIHLREFKVFVNCSLVLDNVSPNKDVGIISKNTTFNVE  225



>ref|XP_004246717.1| PREDICTED: protein YLS9-like [Solanum lycopersicum]
Length=264

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 101/169 (60%), Gaps = 4/169 (2%)
 Frame = +1

Query  325  CAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGS  504
             A ++YL+F+P+ PKY++ ++ I +  +      +  +F+V I A+NPN KIGIYY +GS
Sbjct  96   TAAVVYLVFRPEAPKYTISDVAIKNFNLT-SSSPVSPEFDVTIRAENPNNKIGIYYRKGS  154

Query  505  RLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQ-YGNTLLSALQEAQQTGRVPLD  681
             ++V+Y   +L  G LPE YQ   N TV +  L G +   GN + +AL+  Q  G+VP  
Sbjct  155  SVTVFYSDVRLSNGELPEFYQPSTNITVFQTPLKGSNVLLGNAVKTALRNEQMKGKVPFK  214

Query  682  LKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
            + I +PV++KVG +K  ++ +   C + VN+L+  S I  K   CK+ +
Sbjct  215  VNIKVPVKVKVGAVKTWEITVKVKCDVTVNTLTAKSKIISK--DCKYSV  261



>ref|XP_011080512.1| PREDICTED: uncharacterized protein LOC105163758 [Sesamum indicum]
Length=270

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 109/181 (60%), Gaps = 6/181 (3%)
 Frame = +1

Query  298  VVLFIIIAAC--AGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPN  471
            +++F++IAA   AG+LYL+F+ K PKY+V +L I  + +      +   F+V I A+NPN
Sbjct  91   LLVFLVIAAAVSAGVLYLVFRFKSPKYTVTHLAIKGMNLTSA-APISPGFDVTIRAENPN  149

Query  472  KKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQY-GNTLLSALQ  648
             K+GI+Y + S ++V+Y   KL  G LP  YQ  +N TVL+ AL+G     G T+ +AL+
Sbjct  150  SKVGIHYLKDSAVNVFYNDVKLSNGVLPAFYQPRKNVTVLKTALTGSDVVLGGTVKTALR  209

Query  649  EAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKL  828
             AQ  GR+P  +K   PV+I+VG +K  ++ +   C ++V+ L  N    I +  C F +
Sbjct  210  NAQNQGRIPFLVKTKAPVKIEVGSVKTWEITVKVKCDIVVDGL--NQKAQIVSHDCDFSV  267

Query  829  K  831
            +
Sbjct  268  R  268



>ref|XP_002440103.1| hypothetical protein SORBIDRAFT_09g026065 [Sorghum bicolor]
 gb|EES18533.1| hypothetical protein SORBIDRAFT_09g026065 [Sorghum bicolor]
Length=152

 Score =   119 bits (298),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +1

Query  355  PKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTK  534
            PK P+YSVD L +S  +V+P  ++  A+F+V +TA NPN +IGI YE GS L VWY++ +
Sbjct  22   PKAPRYSVDRLSVSAFQVDPSMVTARARFDVTVTAANPNSRIGIQYEPGSSLGVWYQSYR  81

Query  535  LCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQQTG  666
            L +G+LP  YQGH+NTTVL  AL+G+ Q    ++S LQ+AQ+T 
Sbjct  82   LERGALPAFYQGHRNTTVLPPALAGEVQLATAVVSGLQDAQRTA  125



>ref|XP_008792445.1| PREDICTED: protein YLS9 [Phoenix dactylifera]
Length=279

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 93/167 (56%), Gaps = 6/167 (4%)
 Frame = +1

Query  346  IFQPKIPKYSVDNLRISDLRVNPLDLSLYA---KFNVKITAQNPNKKIGIYYERGSRLSV  516
            +F+PKIPKYSVD L +    ++     L A   +F+  I A+NPNKKIGIYY  GS + V
Sbjct  114  VFRPKIPKYSVDGLAVKGFNLSSASTDLAALSPEFDATIRAENPNKKIGIYYRSGSSVEV  173

Query  517  WYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS-QYGNTLLSALQEAQQTGRVPLDLKID  693
             Y    LC G  P  YQG +N TV + AL+G   +    +  AL  AQ  G VPL++ I 
Sbjct  174  SYDGVNLCHGVWPTFYQGKRNVTVFQTALTGSGIRLAAAIQDALVTAQSRGEVPLEMNIK  233

Query  694  MPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLKP  834
            +PVRIK G +    + +   C + V+ L+ +S I  K  +C  K+ P
Sbjct  234  VPVRIKFGAVTTWTITVKVRCDVTVDKLAADSRIVSK--SCSVKVDP  278



>ref|XP_010689677.1| PREDICTED: uncharacterized protein LOC104903352 [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 118/194 (61%), Gaps = 1/194 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            ++S+ +CC + +     ++ +L   +AA   + Y  ++PKIP Y +++  +++  + P D
Sbjct  35   RRSRGNCCIRFICCIYCLLFILIFFMAASLVLTYTFYKPKIPIYKLEDFSVTNFNMQP-D  93

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
            + + A+F V I AQNPN+KIG  Y +GS + V ++ + LC G+LP  +QGH+N T+L++ 
Sbjct  94   MIINAEFLVTIRAQNPNRKIGFIYGKGSTVIVTFEGSTLCSGNLPAFHQGHENVTMLKIP  153

Query  601  LSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLS  780
            L+G+  +G  L  AL++ ++ GR+PL +++++PV + +    + +      C + ++SL 
Sbjct  154  LAGKVTFGPDLNKALRDDKEQGRIPLMVQVNVPVTVVMDAFPMRQFDFHVSCHMTIDSLR  213

Query  781  TNSLISIKASTCKF  822
             +   SI ++T  F
Sbjct  214  PDKKPSILSTTYTF  227



>gb|EMS54995.1| hypothetical protein TRIUR3_27489 [Triticum urartu]
Length=288

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 110/197 (56%), Gaps = 27/197 (14%)
 Frame = +1

Query  244  KSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDL  423
            +++ + CC+C+  T+ V++VL + + A AGILY +F+PKIP + V+ L  +   VN   +
Sbjct  118  RARHNRCCRCVCCTLLVLIVLVVALGATAGILYAVFRPKIPTFRVERLTATRFDVNTTSM  177

Query  424  SLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVAL  603
            ++   F V++   NPN++IG+YY+ G  ++  +  T+LC+G+ P LYQGH++T    + L
Sbjct  178  TVSDAFEVQVITDNPNRRIGVYYD-GGWVAASFNGTELCRGAFPALYQGHRSTVRPLITL  236

Query  604  SGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLST  783
             G                            +P+RIK G LKL  +     C L+V+SL  
Sbjct  237  QGAR--------------------------VPIRIKFGALKLWTMTGKARCSLVVDSLEA  270

Query  784  NSLISIKASTCKFKLKP  834
             + + I++++C FKLKP
Sbjct  271  GTRLRIRSNSCTFKLKP  287



>gb|KEH35108.1| late embryogenesis abundant hydroxyproline-rich glycoprotein, 
putative [Medicago truncatula]
Length=265

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 104/185 (56%), Gaps = 3/185 (2%)
 Frame = +1

Query  280  WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITA  459
            W + ++  L +++A  AG+ YLI +P+ PKY++D + +  + +  L  ++  +F+V + A
Sbjct  69   WFIGILFTLIVLMAIAAGVFYLIVRPEAPKYAIDRVSVKGMNLTSLS-TISPEFDVSVKA  127

Query  460  QNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS-QYGNTLL  636
             N NKKIGIYYE  S + ++Y+   LC+G LP  YQ   N TV +  L G   +   +  
Sbjct  128  DNGNKKIGIYYESDSSVEMFYRGVSLCKGVLPAFYQPSNNVTVFQTVLKGNGIELVRSDQ  187

Query  637  SALQEAQQTGRVPLDLKIDMPVRIKVGRLKLM-KVGILGDCMLIVNSLSTNSLISIKAST  813
             AL  A   G VPL LK+  PV+IKVG +K   KV +  DC L V+ L+  + I  +  +
Sbjct  188  RALVNAVTKGSVPLTLKLRAPVKIKVGSVKKTWKVRVKVDCDLTVDQLTAQAKIVDRDCS  247

Query  814  CKFKL  828
              F L
Sbjct  248  YGFDL  252



>ref|XP_009341739.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
 ref|XP_009341740.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
Length=272

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 111/201 (55%), Gaps = 5/201 (2%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRIS--DLRVNP  414
            Q  +RS C  C  W   ++  L ++ AA AGI YL+ +P+ P YS++++     +L    
Sbjct  73   QNPRRSSCRCCFCWLFGLVAALILLSAAAAGIFYLVVRPESPNYSIESIAFKGFNLTTPS  132

Query  415  LDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
               ++  +  V +  QNPNKKIGIYY + + + ++Y   KLC G+ P  YQ  +N T   
Sbjct  133  PSSTISPEIQVTVRVQNPNKKIGIYYGKKNSVKLFYSDVKLCDGATPAFYQPSKNVTEFR  192

Query  595  VALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
             AL G   +  +T+   L +AQ+ G+VPL+L I MPVRIKVG +K   + +   C L V+
Sbjct  193  TALKGSGIKLTSTVQQGLVDAQRQGKVPLELDIRMPVRIKVGPIKTWTITVKVGCDLTVD  252

Query  772  SLSTNSLISIKASTCKFKLKP  834
             L+T + I  K   C + + P
Sbjct  253  KLTTEAKIVSK--DCDYSVDP  271



>ref|XP_007146082.1| hypothetical protein PHAVU_006G011100g [Phaseolus vulgaris]
 gb|ESW18076.1| hypothetical protein PHAVU_006G011100g [Phaseolus vulgaris]
Length=249

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 108/204 (53%), Gaps = 18/204 (9%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            + S+  CCC  + W +S+I+VL +++ A  G+ YL+FQP+ P Y++   R++   VN   
Sbjct  55   EPSRCGCCC-FLCWLISIIIVLAVLLGAATGVFYLVFQPEAPAYTIQ--RVAVKGVNLTS  111

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
             +   +F+V + A N N KIGIYYE GS ++++Y   +LC G  P  YQ   N T+LE  
Sbjct  112  SAFSPEFDVVVRAYNGNDKIGIYYEEGSSVAMFYNDARLCDGVFPAFYQPSNNVTLLEAL  171

Query  601  LSGQSQYGNTLLSALQEAQQTG--------RVPLDLKIDMPVRIKVGRLKLMKVGILGDC  756
            L G           L  + QTG         VPL L++ +  +IKVG +   K+ +  +C
Sbjct  172  LKGND-------VELMVSDQTGLVMAVTDRSVPLKLELQVAAKIKVGSVTTWKISVRVEC  224

Query  757  MLIVNSLSTNSLISIKASTCKFKL  828
             + V+ L+  + I  +    +F L
Sbjct  225  DVTVDELTVQARIVKRDCGYRFDL  248



>ref|XP_009628620.1| PREDICTED: protein YLS9 [Nicotiana tomentosiformis]
Length=269

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 121/198 (61%), Gaps = 4/198 (2%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +K +RSCCC+C+ +T S++++L I +   AG+LYL+F+P+ PKY++  + I +  + P  
Sbjct  73   RKPRRSCCCRCLCYTFSLLLILIIALGITAGVLYLVFRPEAPKYTISGIAIKNFNLTP-S  131

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
             S+   F+V + A+NPN KIGIYY +GS ++V Y    L  G  P  YQ   N TV +  
Sbjct  132  SSVSPAFDVTVRAENPNNKIGIYYRKGSSVTVLYSDVNLSNGEFPAFYQPTNNVTVFKTP  191

Query  601  LSGQSQ-YGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            L G +   G+ + +AL+  Q+ G+VP  + I  PV+IKVG +K  ++ +   C + V++L
Sbjct  192  LKGSNVLLGSAVRTALRNEQKQGKVPFRVNIKAPVKIKVGAVKTWEITVKVKCDITVDAL  251

Query  778  STNSLISIKASTCKFKLK  831
            +  S   I ++ CK+ ++
Sbjct  252  TEKS--KIVSNDCKYSVR  267



>gb|AFK38883.1| unknown [Medicago truncatula]
Length=265

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 104/185 (56%), Gaps = 3/185 (2%)
 Frame = +1

Query  280  WTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITA  459
            W + ++  L +++A  AG+ YLI +P+ PKY++D + +  + +  L  ++  +F+V + A
Sbjct  69   WFIGILFTLIVLMAIAAGVFYLIVRPEAPKYAIDRVSVKGMNLTSLS-TISPEFDVSVKA  127

Query  460  QNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQS-QYGNTLL  636
             N NKKIGIYYE  S + ++Y+   LC+G LP  YQ   N TV +  L G   +   +  
Sbjct  128  DNGNKKIGIYYESDSSVEMFYRGVSLCKGVLPAFYQPSNNVTVFQTVLKGNGIELVRSDQ  187

Query  637  SALQEAQQTGRVPLDLKIDMPVRIKVGRLKLM-KVGILGDCMLIVNSLSTNSLISIKAST  813
             AL  A   G VPL LK+  PV+I+VG +K   KV +  DC L V+ L+  + I  +  +
Sbjct  188  RALVNAVTKGSVPLTLKLRAPVKIRVGSVKKTWKVRVKVDCDLTVDQLTAQAKIVDRDCS  247

Query  814  CKFKL  828
              F L
Sbjct  248  YGFDL  252



>ref|XP_008359184.1| PREDICTED: protein NDR1-like [Malus domestica]
Length=272

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 110/201 (55%), Gaps = 5/201 (2%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            Q  +RS C  C  W   ++  L ++ AA AGI YL+ +P+ P YS++++      +    
Sbjct  73   QNPRRSSCRCCFCWLFGLVAALILLSAAAAGIFYLVVRPESPNYSIESIAFKGFHLTTPS  132

Query  421  LS--LYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLE  594
             S  +  +  V +  QNPNKKIGIYY + + + ++Y   KLC G+LP  YQ  +N T   
Sbjct  133  PSSTISPEIQVTVRVQNPNKKIGIYYGKKNSVKLFYSDIKLCDGALPAFYQPSKNVTEFR  192

Query  595  VALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVN  771
             AL G   +  +T+   L +AQ+ G+VPL L + MPVRIKVG +K   + +   C L V+
Sbjct  193  TALKGSGIKLTSTVQQGLVDAQRQGKVPLKLDLRMPVRIKVGAIKTWTITVKVGCDLTVD  252

Query  772  SLSTNSLISIKASTCKFKLKP  834
             L+T + I  K   C + + P
Sbjct  253  KLTTEAKIVSK--DCDYSVDP  271



>ref|XP_006447341.1| hypothetical protein CICLE_v10018129mg, partial [Citrus clementina]
 gb|ESR60581.1| hypothetical protein CICLE_v10018129mg, partial [Citrus clementina]
Length=268

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 115/200 (58%), Gaps = 1/200 (1%)
 Frame = +1

Query  229  AWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRV  408
            ++Q + S  +CC KC+ +    +  L I  +    ++Y  F+  IPKY ++  ++    V
Sbjct  69   SYQDRSSSGNCCLKCICFCYCCLFFLIIAFSIAGYVIYATFKIDIPKYRIEEFKVEAFNV  128

Query  409  NPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTV  588
             P DLSL  + NV + A+NP+  I + YE+GS +++ Y    +C G + E YQG+++   
Sbjct  129  LP-DLSLNTEINVIVRAENPSDLISLQYEKGSSVTMNYIDKTICSGKVSEFYQGYKSIKR  187

Query  589  LEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIV  768
            + + L G++++ +    +L E ++ G++PL + +  P+ +++GR+ L +V I  +  +IV
Sbjct  188  INIPLQGKTEFSSEFQESLAEDKKQGKIPLLIVVKAPIIVELGRIPLKEVVINVNISMIV  247

Query  769  NSLSTNSLISIKASTCKFKL  828
            +SL  +  I I +S+ K+ L
Sbjct  248  DSLEKDKKIGIISSSYKYGL  267



>emb|CDX77067.1| BnaC04g38620D [Brassica napus]
Length=260

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 107/187 (57%), Gaps = 4/187 (2%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRV-NPL  417
            +K  RS C  C  + ++ IV+L ++      +LY++F+P+ PKYSV+   +S + + +P 
Sbjct  64   KKPNRSRCRCCFCYFLAAIVILVVLAGISFAVLYVVFRPEAPKYSVEGFSVSGINLTSPS  123

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
             +S   +FNV + ++N N K+GIYYE+GS + V+Y    LC G+LP  YQ   N T+++ 
Sbjct  124  PIS--PRFNVTVRSRNGNGKLGIYYEKGSSVDVFYGDVALCNGALPVFYQPANNVTLVKT  181

Query  598  ALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNS  774
            AL+G   Q  +     ++       +P  LKI  PV+IKVG +K   V +  +C + V+ 
Sbjct  182  ALTGSRIQLTSGARKEMRNELSKKTMPFKLKIKAPVKIKVGSVKTWTVTVKVNCDVTVDK  241

Query  775  LSTNSLI  795
            L+  S I
Sbjct  242  LTAPSRI  248



>gb|KDO40292.1| hypothetical protein CISIN_1g045712mg, partial [Citrus sinensis]
Length=268

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 115/200 (58%), Gaps = 1/200 (1%)
 Frame = +1

Query  229  AWQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRV  408
            ++Q + S  +CC KC+ +    +  L I  +    ++Y  F+  IPKY ++  ++    V
Sbjct  69   SYQDRSSSGNCCLKCICFCYCCLFFLIIAFSIAGYVIYATFKIDIPKYRIEEFKVEAFNV  128

Query  409  NPLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTV  588
             P DLSL  + NV + A+NP+  I + YE+GS +++ Y    +C G + E YQG+++   
Sbjct  129  LP-DLSLNTEINVIVRAENPSDLISLQYEKGSSVTMNYIDKTICSGKVSEFYQGYKSIKR  187

Query  589  LEVALSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIV  768
            + + L G++++ +    +L E ++ G++PL + +  P+ +++GR+ L +V I  +  +IV
Sbjct  188  INIPLQGKTEFSSGFQESLAEDKKQGKIPLLIVVKAPIIVELGRIPLKEVVINVNISMIV  247

Query  769  NSLSTNSLISIKASTCKFKL  828
            +SL  +  I I +S+ K+ L
Sbjct  248  DSLEKDKKIGIISSSYKYGL  267



>ref|XP_008230436.1| PREDICTED: uncharacterized protein LOC103329716 [Prunus mume]
Length=249

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 109/188 (58%), Gaps = 6/188 (3%)
 Frame = +1

Query  232  WQPQKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVN  411
            ++P   +++ C +C         +  ++I A   I ++I  P +P+Y +++  +    + 
Sbjct  40   YRPNGRRKNTCLRCYCCFYCCFFITLVVIIAAVVISFIIINPHVPEYKINDFSVKAFNLT  99

Query  412  PLDLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVL  591
            P D +L A F + + A+NPNK+I I Y +GS +++ Y   KLC G++P+  Q  +NTT++
Sbjct  100  P-DFNLNAHFVITVKAENPNKQISIIYGKGSSVTLLYSGKKLCSGNVPDFTQPTKNTTMI  158

Query  592  EVALSGQ---SQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMK--VGILGDC  756
             V L G    S +G +L  +L E  ++ R+PL + + +P+   +G++ ++K  +GI  +C
Sbjct  159  NVDLKGDLKGSDFGGSLGESLMEKMKSDRIPLTVAVRVPLNAAMGKMHVLKDPMGIYVNC  218

Query  757  MLIVNSLS  780
             ++VN+LS
Sbjct  219  SMVVNNLS  226



>ref|XP_011100344.1| PREDICTED: protein YLS9-like [Sesamum indicum]
Length=234

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 109/192 (57%), Gaps = 1/192 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +KS    C +C+      +++L   +A     LY +++PK+P Y++++L++    + P D
Sbjct  38   KKSGGKNCFRCICCCCCCLLLLIFSLAILTFFLYNMYKPKVPSYNIEDLQVKSFDLQP-D  96

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
              L  +  V + A NPN  IG  Y   S + V Y  T LC G LP  YQGH+NTT++ + 
Sbjct  97   SILKTEILVNVKADNPNSHIGFTYGNDSSVDVVYSDTNLCTGKLPYFYQGHENTTLMMID  156

Query  601  LSGQSQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLS  780
            L G+S+ G+ +     + Q+ G++PL +K+ +P+RI +G + L +  +  +C L+V++L+
Sbjct  157  LVGESELGSGVQEDFAQRQKEGKIPLLVKVKVPLRIVIGNMPLRQFKVFLNCSLVVDNLT  216

Query  781  TNSLISIKASTC  816
             N  + + +S  
Sbjct  217  PNKKVGVLSSNT  228



>ref|XP_011045499.1| PREDICTED: uncharacterized protein LOC105140389 [Populus euphratica]
Length=239

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 104/178 (58%), Gaps = 1/178 (1%)
 Frame = +1

Query  298  VVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAKFNVKITAQNPNKK  477
            +V+ I++A+    +Y+   PK+P+Y+V +  ++   + P D SLY +F V + A NPN  
Sbjct  57   IVMIILLASVIAFIYMTLNPKMPEYNVASFDVNAFNMAP-DFSLYTEFAVTVKANNPNTD  115

Query  478  IGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSGQSQYGNTLLSALQEAQ  657
            I   Y + S + V Y  + LC G LP  +Q   NTT+++V L G+S++G+ L   L + +
Sbjct  116  ISFTYGKESSVVVAYSDSTLCSGKLPAFHQPGVNTTMIQVVLKGKSEFGSGLQEVLMDNR  175

Query  658  QTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTNSLISIKASTCKFKLK  831
            +TG++PL + ++ PV + +    L +V +  +C L+V++LS N  + I +S   + + 
Sbjct  176  ETGKIPLLVMVNAPVSVVLKSFPLREVIVNVNCSLVVDNLSPNKRVRILSSEYAYAVN  233



>gb|EAY85185.1| hypothetical protein OsI_06544 [Oryza sativa Indica Group]
Length=375

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 101/177 (57%), Gaps = 24/177 (14%)
 Frame = +1

Query  259  CCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSLYAK  438
            CCC C+ WT+  ++V  + + A AGILY +F+PKIP + V+ L ++   VN    ++   
Sbjct  190  CCC-CVCWTLLAVLVRAVALGATAGILYAVFKPKIPDFRVNRLTVTRFDVNATAATVSDA  248

Query  439  FNVKITAQNPNKKIGIYYERGSRLSVWYKT--TKLCQGSLPELYQGHQNTTVLEVALSGQ  612
            F V++T+ NPN++IG+YY+ G  ++  +    T+LC+G  P LYQGH++T          
Sbjct  249  FEVEVTSTNPNRRIGMYYD-GLEVTASFHNNGTELCRGGFPALYQGHRST----------  297

Query  613  SQYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLST  783
                      L + QQ   VPL + + MP+RIK G +KL K+     C L+V++L T
Sbjct  298  ----------LLQQQQARFVPLTVWVRMPIRIKFGAIKLWKMTGKATCNLVVDNLVT  344



>ref|XP_009390664.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=265

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 103/194 (53%), Gaps = 7/194 (4%)
 Frame = +1

Query  250  KRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLDLSL  429
            +R CC     W    +  L  ++A  A ILYL+F+P++P+YS+D L I+   ++   +S 
Sbjct  72   RRGCCFLVFAW----LGALLFLLAVVADILYLVFRPRVPQYSIDALSIASFNLSAASVS-  126

Query  430  YAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVALSG  609
               F+  + A+NPNKK+GIYY  GS ++V Y    LC G+    YQ   N TV   AL G
Sbjct  127  -PAFDATVRAENPNKKVGIYYRDGSDITVAYDGVTLCTGAWLAFYQSPGNVTVFVAALKG  185

Query  610  QS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSLSTN  786
             + +  +    AL  A+   +VPL++ + +PVRIK G +    + +   C + V  L+ N
Sbjct  186  STIRLSSAARQALVTAETQRQVPLEIDVKVPVRIKFGGVTSWTITVKLKCDVTVTGLTEN  245

Query  787  SLISIKASTCKFKL  828
            + I  K    K KL
Sbjct  246  AKIVSKKCGVKVKL  259



>ref|XP_004228470.1| PREDICTED: protein YLS9 [Solanum lycopersicum]
Length=271

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 112/184 (61%), Gaps = 2/184 (1%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRVNPLD  420
            +K +RSCCC+C+ +T SV++ L I I   AG+L+L+++P+ PKY++ ++ I +  V    
Sbjct  75   RKPRRSCCCRCLCFTFSVLLFLIISIGITAGVLFLVYRPEAPKYTISSIAIKNFNVT-SS  133

Query  421  LSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEVA  600
              +  +F++ + ++NPN K+GIYY +GS ++V Y    L  G LP  YQ   N TV + A
Sbjct  134  SKISPEFDISVRSENPNNKLGIYYRKGSSVTVVYSGVDLSAGVLPAFYQPVNNVTVFQTA  193

Query  601  LSGQSQ-YGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNSL  777
            L G +   GN + S L+  Q+ G+VP  + I  PV+IK+G +K  +V +   C L V+ L
Sbjct  194  LKGSNVILGNAVKSTLRNEQRKGKVPFRVNIKAPVKIKIGAVKTWEVIVKVKCDLTVDVL  253

Query  778  STNS  789
            +  S
Sbjct  254  TVKS  257



>ref|XP_006408666.1| hypothetical protein EUTSA_v10002079mg [Eutrema salsugineum]
 gb|ESQ50119.1| hypothetical protein EUTSA_v10002079mg [Eutrema salsugineum]
Length=260

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 111/193 (58%), Gaps = 5/193 (3%)
 Frame = +1

Query  241  QKSKRSCCCKCMWWTVSVIVVLFIIIAACAGILYLIFQPKIPKYSVDNLRISDLRV-NPL  417
            +K  RS C  C+   ++ I +L ++      +LYL+F+P+ PKYSV+   +S + + +P 
Sbjct  64   KKVNRSRCRCCICSILAAIFILIVLAGISLTVLYLVFRPEAPKYSVEGFSVSGINLTSPS  123

Query  418  DLSLYAKFNVKITAQNPNKKIGIYYERGSRLSVWYKTTKLCQGSLPELYQGHQNTTVLEV  597
             +S   KFNV + ++N N KIGIYYE+GS + ++Y    LC G+LP  YQ   N T+++ 
Sbjct  124  PIS--PKFNVTVRSRNGNGKIGIYYEKGSTVDIYYNDVDLCNGALPVFYQPANNVTMVKT  181

Query  598  ALSGQS-QYGNTLLSALQEAQQTGRVPLDLKIDMPVRIKVGRLKLMKVGILGDCMLIVNS  774
            AL+G   Q  + +   ++       +P  +KI  PV+IKVG +K   + +  +C + V+ 
Sbjct  182  ALTGSRIQLTSAMRKEMRNELSKKTMPFKVKIKAPVKIKVGSVKTWTITVKVNCDVTVDK  241

Query  775  LSTNS-LISIKAS  810
            L+  S ++S K S
Sbjct  242  LTAPSRIVSTKCS  254



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2009378593860