BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9538_g1_i1 len=553 path=[697:0-140 837:141-199 168:200-552]

Length=553
                                                                      Score     E

ref|XP_010278088.1|  PREDICTED: inhibitor of trypsin and hageman ...  92.0    9e-21   
ref|XP_010679203.1|  PREDICTED: glu S.griseus protease inhibitor-...  82.4    4e-17   
ref|XP_010243880.1|  PREDICTED: inhibitor of trypsin and hageman ...  77.8    2e-15   
ref|XP_002521007.1|  Proteinase inhibitor, putative                   76.6    6e-15   Ricinus communis
gb|KDP21344.1|  hypothetical protein JCGZ_21815                       76.3    8e-15   
emb|CDO99178.1|  unnamed protein product                              75.5    2e-14   
ref|XP_010243990.1|  PREDICTED: glu S.griseus protease inhibitor-...  74.7    3e-14   
ref|XP_002314645.1|  hypothetical protein POPTR_0010s08640g           73.9    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_003590801.1|  Inhibitor of trypsin and hageman factor          73.9    6e-14   
ref|XP_002521006.1|  Proteinase inhibitor, putative                   73.6    6e-14   Ricinus communis
gb|EYU32853.1|  hypothetical protein MIMGU_mgv1a024582mg              73.6    7e-14   
ref|NP_001238694.1|  protease inhibitor-like                          73.2    1e-13   
ref|XP_004288453.1|  PREDICTED: inhibitor of trypsin and hageman ...  73.2    1e-13   
gb|AFP43221.1|  proteinase inhibitor                                  73.2    1e-13   
gb|AAK95644.1|AF404833_1  proteinase inhibitor                        72.8    1e-13   Ipomoea batatas [batate]
gb|AAK72904.1|AF330700_1  proteinase inhibitor SPLTI-a                72.4    2e-13   Ipomoea batatas [batate]
ref|XP_010932900.1|  PREDICTED: glu S.griseus protease inhibitor-...  72.0    2e-13   
gb|EYU32855.1|  hypothetical protein MIMGU_mgv1a021802mg              72.0    3e-13   
ref|XP_006378352.1|  hypothetical protein POPTR_0010s08600g           72.0    3e-13   
gb|EYU32854.1|  hypothetical protein MIMGU_mgv1a018761mg              72.0    3e-13   
ref|XP_004247696.2|  PREDICTED: wound-induced proteinase inhibito...  73.2    3e-13   
ref|XP_006378353.1|  hypothetical protein POPTR_0010s08630g           71.6    4e-13   
ref|XP_004134090.1|  PREDICTED: glu S.griseus protease inhibitor-...  71.2    5e-13   
ref|XP_002314644.1|  hypothetical protein POPTR_0010s08610g           70.9    6e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006411111.1|  hypothetical protein EUTSA_v10017502mg           70.9    6e-13   
ref|XP_007029841.1|  Uncharacterized protein TCM_025717               73.2    6e-13   
ref|XP_008391168.1|  PREDICTED: glu S.griseus protease inhibitor-...  70.9    7e-13   
ref|XP_006381983.1|  hypothetical protein POPTR_0006s22880g           70.5    8e-13   
gb|KFK36788.1|  hypothetical protein AALP_AA4G170800                  70.5    1e-12   
ref|XP_007221364.1|  hypothetical protein PRUPE_ppa018589mg           70.1    1e-12   
ref|XP_010100074.1|  Proteinase inhibitor                             70.1    1e-12   
ref|XP_002315724.2|  trypsin inhibitor family protein                 70.1    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_003556369.1|  PREDICTED: inhibitor of trypsin and hageman ...  70.1    1e-12   
emb|CDY14424.1|  BnaC03g21710D                                        70.1    2e-12   
ref|XP_010326741.1|  PREDICTED: proteinase inhibitor I-B-like iso...  70.9    2e-12   
gb|EYU32852.1|  hypothetical protein MIMGU_mgv1a019023mg              69.7    2e-12   
ref|XP_006387620.1|  hypothetical protein POPTR_0770s00230g           69.3    2e-12   
ref|XP_006373842.1|  hypothetical protein POPTR_0016s07990g           69.3    3e-12   
dbj|BAC10909.1|  protease inhibitor 1                                 69.3    3e-12   Zinnia violacea [garden zinnia]
ref|XP_007227504.1|  hypothetical protein PRUPE_ppa014371mg           69.3    3e-12   
ref|XP_002309424.2|  hypothetical protein POPTR_0006s22860g           68.9    4e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004247692.1|  PREDICTED: proteinase inhibitor I-B-like iso...  70.1    4e-12   
ref|XP_006420157.1|  hypothetical protein CICLE_v10007070mg           68.9    4e-12   
ref|XP_003590795.1|  Inhibitor of trypsin and hageman factor          68.9    4e-12   
dbj|BAC10910.1|  protease inhibitor 2                                 68.6    4e-12   Zinnia violacea [garden zinnia]
ref|XP_007144065.1|  hypothetical protein PHAVU_007G125500g           68.6    4e-12   
gb|AAK72906.1|  proteinase inhibitor SPLTI-2                          68.6    5e-12   Ipomoea batatas [batate]
gb|AAK72905.1|  proteinase inhibitor SPLTI-1                          68.6    5e-12   Ipomoea batatas [batate]
ref|XP_007224255.1|  hypothetical protein PRUPE_ppa018391mg           68.2    6e-12   
gb|KDP36377.1|  hypothetical protein JCGZ_08646                       68.2    6e-12   
gb|EYU32851.1|  hypothetical protein MIMGU_mgv1a022632mg              68.2    7e-12   
ref|XP_004134087.1|  PREDICTED: inhibitor of trypsin and hageman ...  67.8    8e-12   
ref|NP_001275264.1|  proteinase inhibitor I precursor                 68.9    8e-12   
ref|XP_002323424.2|  hypothetical protein POPTR_0016s07980g           68.2    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_008391172.1|  PREDICTED: glu S.griseus protease inhibitor-...  67.8    1e-11   
ref|XP_008224409.1|  PREDICTED: glu S.griseus protease inhibitor-...  67.8    1e-11   
ref|XP_008438570.1|  PREDICTED: glu S.griseus protease inhibitor-...  67.8    1e-11   
ref|XP_009779697.1|  PREDICTED: proteinase inhibitor I-B-like         69.3    1e-11   
ref|XP_007221365.1|  hypothetical protein PRUPE_ppa024500mg           67.4    1e-11   
ref|XP_002323423.1|  hypothetical protein POPTR_0016s07970g           67.4    1e-11   Populus trichocarpa [western balsam poplar]
gb|KDO68501.1|  hypothetical protein CISIN_1g039274mg                 68.2    1e-11   
gb|KDP21343.1|  hypothetical protein JCGZ_21814                       68.2    1e-11   
ref|XP_010094276.1|  Glu S.griseus protease inhibitor                 67.0    1e-11   
ref|XP_011030541.1|  PREDICTED: glu S.griseus protease inhibitor      67.0    2e-11   
sp|P24076.1|BGIA_MOMCH  RecName: Full=Glu S.griseus protease inhi...  67.0    2e-11   Momordica charantia [balsam pear]
gb|AFT92003.1|  potato inhibitor I family protein                     67.0    2e-11   
ref|XP_009782003.1|  PREDICTED: glu S.griseus protease inhibitor-...  66.6    2e-11   
ref|XP_011004115.1|  PREDICTED: inhibitor of trypsin and hageman ...  68.2    2e-11   
gb|EYU40892.1|  hypothetical protein MIMGU_mgv1a017848mg              66.6    2e-11   
ref|XP_006443889.1|  hypothetical protein CICLE_v10023822mg           67.4    2e-11   
ref|XP_002314193.1|  hypothetical protein POPTR_0009s03360g           66.6    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_004247694.1|  PREDICTED: proteinase inhibitor I-B-like         67.8    3e-11   
gb|KCW77294.1|  hypothetical protein EUGRSUZ_D01653                   66.6    3e-11   
ref|XP_007226170.1|  hypothetical protein PRUPE_ppa015379mg           66.2    3e-11   
gb|KGN56903.1|  hypothetical protein Csa_3G142950                     66.2    3e-11   
ref|XP_010100072.1|  Proteinase inhibitor                             66.2    3e-11   
ref|XP_006295369.1|  hypothetical protein CARUB_v10024461mg           66.2    3e-11   
ref|XP_007050380.1|  Inhibitor of trypsin and hageman factor          66.2    4e-11   
ref|XP_009396722.1|  PREDICTED: inhibitor of trypsin and hageman ...  66.2    4e-11   
gb|KDP42134.1|  hypothetical protein JCGZ_03191                       66.2    4e-11   
ref|XP_008439364.1|  PREDICTED: inhibitor of trypsin and hageman ...  65.9    4e-11   
ref|XP_006281379.1|  hypothetical protein CARUB_v10027439mg           66.6    4e-11   
ref|XP_008438569.1|  PREDICTED: inhibitor of trypsin and hageman ...  65.9    4e-11   
ref|XP_004134089.1|  PREDICTED: inhibitor of trypsin and hageman ...  65.9    5e-11   
ref|XP_010687945.1|  PREDICTED: glu S.griseus protease inhibitor-...  65.5    5e-11   
ref|XP_007009891.1|  Serine protease inhibitor                        65.5    5e-11   
ref|XP_006354532.1|  PREDICTED: wound-induced proteinase inhibito...  66.6    6e-11   
ref|XP_004247691.2|  PREDICTED: proteinase inhibitor I-B              67.0    6e-11   
gb|AFT92004.1|  potato inhibitor I family protein                     65.5    6e-11   
ref|XP_009605666.1|  PREDICTED: proteinase inhibitor I-B-like iso...  66.6    6e-11   
ref|XP_006442409.1|  hypothetical protein CICLE_v10022906mg           66.6    7e-11   
ref|XP_006495465.1|  PREDICTED: inhibitor of trypsin and hageman ...  66.6    7e-11   
ref|XP_006387619.1|  hypothetical protein POPTR_0770s00220g           65.5    7e-11   
ref|XP_009374774.1|  PREDICTED: glu S.griseus protease inhibitor-...  65.1    8e-11   
gb|AID52862.1|  serine protease inhibitor                             65.1    8e-11   
gb|KDP36376.1|  hypothetical protein JCGZ_08645                       65.1    9e-11   
gb|KDP42135.1|  hypothetical protein JCGZ_03192                       65.1    9e-11   
ref|XP_002881621.1|  hypothetical protein ARALYDRAFT_482903           65.1    9e-11   
gb|KDP35356.1|  hypothetical protein JCGZ_10340                       65.1    1e-10   
gb|KDP36380.1|  hypothetical protein JCGZ_08649                       65.1    1e-10   
gb|ABG49145.1|  proteinase inhibitor isoform                          65.9    1e-10   Solanum phureja [chaucha]
emb|CBI26384.3|  unnamed protein product                              65.9    1e-10   
ref|XP_003542413.1|  PREDICTED: inhibitor of trypsin and hageman ...  64.7    1e-10   
ref|XP_009776471.1|  PREDICTED: proteinase inhibitor I-B-like         66.2    1e-10   
gb|EYU17889.1|  hypothetical protein MIMGU_mgv1a022666mg              64.7    1e-10   
gb|ADB85100.1|  proteinase inhibitor                                  64.7    1e-10   
ref|XP_007009882.1|  Serine protease inhibitor                        64.7    1e-10   
ref|XP_009133305.1|  PREDICTED: protease inhibitor HPI-like           64.7    1e-10   
emb|CBI26387.3|  unnamed protein product                              64.7    1e-10   
ref|XP_004288451.1|  PREDICTED: inhibitor of trypsin and hageman ...  64.7    1e-10   
ref|NP_030435.1|  PR-6 proteinase inhibitor family protein            64.7    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AFX66991.1|  proteinase inhibitor I                                65.5    1e-10   
emb|CCW27997.1|  serine protease inhibitor                            64.3    2e-10   
ref|XP_009605665.1|  PREDICTED: proteinase inhibitor I-B-like iso...  65.5    2e-10   
emb|CAN75275.1|  hypothetical protein VITISV_043736                   64.3    2e-10   Vitis vinifera
ref|XP_009605664.1|  PREDICTED: proteinase inhibitor I-B-like iso...  65.5    2e-10   
ref|XP_003535093.2|  PREDICTED: glu S.griseus protease inhibitor-...  64.3    2e-10   
ref|XP_004288449.1|  PREDICTED: glu S.griseus protease inhibitor-...  64.3    2e-10   
ref|XP_010038018.1|  PREDICTED: proteinase inhibitor-like             64.3    2e-10   
ref|XP_006281417.1|  hypothetical protein CARUB_v10027484mg           63.9    2e-10   
ref|XP_006606926.1|  PREDICTED: glu S.griseus protease inhibitor-...  63.9    2e-10   
gb|ACU19481.1|  unknown                                               63.9    2e-10   Glycine max [soybeans]
ref|XP_007009886.1|  Serine protease inhibitor                        63.9    2e-10   
ref|XP_006421631.1|  hypothetical protein CICLE_v10006306mg           64.3    2e-10   
ref|XP_007009890.1|  Serine protease inhibitor                        63.5    3e-10   
gb|KDP42132.1|  hypothetical protein JCGZ_03189                       63.5    3e-10   
ref|XP_007009887.1|  Serine protease inhibitor, putative              63.5    3e-10   
ref|XP_011004117.1|  PREDICTED: uncharacterized protein LOC105110701  68.2    3e-10   
gb|AAP46156.1|  protease inhibitor protein 1                          63.5    3e-10   Hevea brasiliensis [jebe]
ref|XP_007138379.1|  hypothetical protein PHAVU_009G203600g           63.5    3e-10   
ref|XP_006281404.1|  hypothetical protein CARUB_v10027471mg           63.5    3e-10   
ref|XP_008224407.1|  PREDICTED: inhibitor of trypsin and hageman ...  63.5    3e-10   
ref|XP_007009884.1|  Serine protease inhibitor                        63.2    4e-10   
ref|XP_004288450.1|  PREDICTED: inhibitor of trypsin and hageman ...  63.2    4e-10   
gb|EPS59152.1|  hypothetical protein M569_15657                       63.2    4e-10   
ref|WP_017621294.1|  hypothetical protein                             63.9    4e-10   
ref|XP_006489606.1|  PREDICTED: uncharacterized protein LOC102620214  65.1    4e-10   
sp|P19873.1|ITH5_CUCMA  RecName: Full=Inhibitor of trypsin and ha...  62.8    5e-10   Cucurbita maxima [Boston marrow]
gb|KDP35352.1|  hypothetical protein JCGZ_10336                       62.8    5e-10   
gb|ABZ88804.1|  protease inhibitor protein                            62.8    5e-10   Hevea brasiliensis [jebe]
pdb|1TIN|A  Chain A, Three-Dimensional Structure In Solution Of C...  62.8    5e-10   
ref|XP_007009885.1|  Serine protease inhibitor                        62.8    5e-10   
sp|P82381.1|ICI_LINUS  RecName: Full=Proteinase inhibitor; AltNam...  62.8    5e-10   Linum usitatissimum
pdb|1DWM|A  Chain A, Solution Structure Of Linum Usitatissinum Tr...  62.8    5e-10   
pdb|1MIT|A  Chain A, Recombinant Cucurbita Maxima Trypsin Inhibit...  62.8    5e-10   
ref|XP_002284454.1|  PREDICTED: inhibitor of trypsin and hageman ...  62.8    5e-10   Vitis vinifera
sp|Q6XNP7.2|HPI_HEVBR  RecName: Full=Protease inhibitor HPI; AltN...  62.8    5e-10   Hevea brasiliensis [jebe]
ref|XP_002521005.1|  Inhibitor of trypsin and hageman factor, put...  62.8    5e-10   Ricinus communis
gb|AID52861.1|  serine protease inhibitor                             62.8    6e-10   
ref|XP_009603954.1|  PREDICTED: glu S.griseus protease inhibitor-...  62.8    6e-10   
gb|EYU46483.1|  hypothetical protein MIMGU_mgv1a023325mg              62.8    6e-10   
gb|KDO49926.1|  hypothetical protein CISIN_1g035225mg                 62.8    6e-10   
ref|XP_007199579.1|  hypothetical protein PRUPE_ppb023174mg           63.9    6e-10   
gb|KGN50840.1|  hypothetical protein Csa_5G286040                     62.8    6e-10   
ref|XP_007227104.1|  hypothetical protein PRUPE_ppa025505mg           62.8    6e-10   
gb|ADD51184.1|  protease inhibitor 1                                  62.4    8e-10   Vitis cinerea var. helleri x Vitis riparia
gb|KDP35355.1|  hypothetical protein JCGZ_10339                       62.0    9e-10   
ref|XP_003617314.1|  protease inhibitor                               62.0    1e-09   
ref|XP_007029839.1|  Uncharacterized protein TCM_025715               63.5    1e-09   
emb|CDY39726.1|  BnaA04g11270D                                        62.0    1e-09   
pdb|1VBW|A  Chain A, Crystal Structure Of Bitter Gourd Trypsin In...  61.6    1e-09   
ref|XP_006442402.1|  hypothetical protein CICLE_v10022909mg           62.8    1e-09   
gb|KDP35354.1|  hypothetical protein JCGZ_10338                       61.6    1e-09   
ref|XP_008777397.1|  PREDICTED: glu S.griseus protease inhibitor-...  61.6    1e-09   
gb|KDO41812.1|  hypothetical protein CISIN_1g044806mg                 61.6    1e-09   
ref|XP_002517007.1|  Glu S.griseus protease inhibitor, putative       61.6    2e-09   Ricinus communis
ref|XP_004134091.1|  PREDICTED: inhibitor of trypsin and hageman ...  61.2    2e-09   
gb|AAN85825.1|  protease inhibitor                                    61.2    2e-09   Vitis vinifera
ref|XP_010442010.1|  PREDICTED: inhibitor of trypsin and hageman ...  61.2    2e-09   
ref|XP_002317460.1|  hypothetical protein POPTR_0011s11140g           61.2    2e-09   Populus trichocarpa [western balsam poplar]
gb|KDP36378.1|  hypothetical protein JCGZ_08647                       61.2    2e-09   
dbj|BAB32588.1|  inhibitor against trypsin                            61.2    2e-09   Momordica charantia [balsam pear]
ref|XP_004247658.1|  PREDICTED: wound-induced proteinase inhibitor 1  62.0    2e-09   
ref|XP_006489607.1|  PREDICTED: inhibitor of trypsin and hageman ...  60.8    2e-09   
ref|XP_008235797.1|  PREDICTED: proteinase inhibitor-like             62.0    3e-09   
gb|KDO37763.1|  hypothetical protein CISIN_1g040548mg                 60.8    3e-09   
ref|XP_006354530.1|  PREDICTED: proteinase inhibitor I-B-like         61.6    3e-09   
ref|XP_006420158.1|  hypothetical protein CICLE_v10007123mg           60.8    4e-09   
ref|XP_010100075.1|  Proteinase inhibitor                             61.6    4e-09   
emb|CAZ96086.1|  putative proteinase inhibitor                        60.1    6e-09   
ref|XP_002863647.1|  hypothetical protein ARALYDRAFT_331046           59.7    6e-09   
ref|NP_199171.3|  unusual seine protease inhibitor                    60.5    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003590799.1|  Protease inhibitor                               59.7    7e-09   
gb|KEH42587.1|  inhibitor of trypsin and hageman factor-like protein  59.7    7e-09   
emb|CAZ96165.1|  putative proteinase inhibitor I13, potato inhibi...  59.7    7e-09   
gb|ABK28590.1|  unknown                                               60.1    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007201476.1|  hypothetical protein PRUPE_ppa014449mg           59.7    7e-09   
ref|XP_002983045.1|  hypothetical protein SELMODRAFT_117696           59.7    7e-09   
ref|XP_006377750.1|  hypothetical protein POPTR_0011s11170g           59.3    7e-09   
ref|XP_006383697.1|  hypothetical protein POPTR_0005s24230g           59.7    8e-09   
emb|CDX92245.1|  BnaA05g21620D                                        59.3    8e-09   
emb|CAA87073.1|  pathogenesis-related protein PR-6 type               59.7    8e-09   Sambucus nigra
ref|XP_010244180.1|  PREDICTED: inhibitor of trypsin and hageman ...  60.1    8e-09   
gb|ABP01766.1|  proteinase inhibitor 1                                59.7    8e-09   Salvia miltiorrhiza [Chinese salvia]
gb|EYU45080.1|  hypothetical protein MIMGU_mgv1a024273mg              60.1    8e-09   
sp|P80211.1|ATSI_AMACA  RecName: Full=Trypsin/subtilisin inhibito...  59.3    9e-09   Amaranthus caudatus [Inca-wheat]
gb|KGN50838.1|  hypothetical protein Csa_5G285030                     59.3    9e-09   
gb|KDP34823.1|  hypothetical protein JCGZ_11185                       59.3    9e-09   
ref|NP_190270.1|  PR-6 proteinase inhibitor family protein            59.7    9e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAB61327.1|  trypsin inhibitor                                    59.3    1e-08   Amaranthus hypochondriacus [prince's feather]
ref|XP_010528560.1|  PREDICTED: inhibitor of trypsin and hageman ...  59.3    1e-08   
emb|CAZ96083.1|  putative Subtilisin inhibitor 1 (Subtilisin inhi...  59.3    1e-08   
gb|AIT42234.1|  proteinase inhibitor 1                                60.1    1e-08   
dbj|BAB11621.1|  unnamed protein product                              58.9    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006421578.1|  hypothetical protein CICLE_v10006212mg           60.1    1e-08   
ref|XP_006299344.1|  hypothetical protein CARUB_v10015502mg           59.3    1e-08   
ref|XP_006281360.1|  hypothetical protein CARUB_v10027416mg           59.7    1e-08   
gb|KDO45261.1|  hypothetical protein CISIN_1g033055mg                 60.1    1e-08   
ref|XP_002451431.1|  hypothetical protein SORBIDRAFT_04g001970        58.9    1e-08   Sorghum bicolor [broomcorn]
emb|CDY04060.1|  BnaC02g37750D                                        58.9    1e-08   
gb|KDP42136.1|  hypothetical protein JCGZ_03193                       60.5    1e-08   
gb|EYU37170.1|  hypothetical protein MIMGU_mgv1a026023mg              58.9    1e-08   
ref|XP_002300791.1|  hypothetical protein POPTR_0002s04350g           58.5    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006490176.1|  PREDICTED: inhibitor of trypsin and hageman ...  59.7    2e-08   
ref|XP_006363673.1|  PREDICTED: trypsin inhibitor 1-like              58.9    2e-08   
ref|XP_009763818.1|  PREDICTED: trypsin/subtilisin inhibitor-like     58.9    2e-08   
gb|AAB29664.1|  ATI=trypsin inhibitor                                 58.2    2e-08   
emb|CAZ96136.1|  putative proteinase inhibitor I13, potato inhibi...  58.2    2e-08   
ref|XP_006421577.1|  hypothetical protein CICLE_v10006203mg           59.3    2e-08   
ref|XP_006354531.1|  PREDICTED: proteinase inhibitor I-B-like         59.3    2e-08   
ref|XP_006421576.1|  hypothetical protein CICLE_v10006211mg           59.3    2e-08   
ref|XP_003556368.1|  PREDICTED: glu S.griseus protease inhibitor      58.2    2e-08   
gb|AAN76363.1|  type I proteinase inhibitor-like protein              59.3    2e-08   Citrus x paradisi [grapefruit]
ref|XP_002965559.1|  hypothetical protein SELMODRAFT_84301            58.2    2e-08   
ref|XP_008391173.1|  PREDICTED: glu S.griseus protease inhibitor-...  58.2    3e-08   
ref|XP_006403221.1|  hypothetical protein EUTSA_v10003305mg           57.8    3e-08   
ref|XP_002865414.1|  hypothetical protein ARALYDRAFT_917289           57.8    4e-08   
gb|EYU45082.1|  hypothetical protein MIMGU_mgv1a026171mg              58.2    4e-08   
ref|WP_017626123.1|  hypothetical protein                             58.2    4e-08   
ref|XP_007199475.1|  hypothetical protein PRUPE_ppa027168mg           58.9    4e-08   
ref|XP_006403222.1|  hypothetical protein EUTSA_v10003342mg           57.8    5e-08   
gb|KGN56896.1|  hypothetical protein Csa_3G142410                     57.0    5e-08   
ref|XP_004247660.1|  PREDICTED: wound-induced proteinase inhibitor 1  57.8    6e-08   
pdb|3RDY|A  Chain A, Crystal Structure Of Buckwheat Trypsin Inhib...  57.4    6e-08   
ref|XP_006420961.1|  hypothetical protein CICLE_v10006680mg           57.0    6e-08   
gb|AAB35320.1|  BWI-1=protease inhibitor/trypsin inhibitor            57.0    6e-08   
gb|AAB46906.1|  BTI-2=trypsin inhibitor isoform                       57.0    6e-08   
ref|XP_010509102.1|  PREDICTED: protease inhibitor HPI                56.6    9e-08   
emb|CBI25417.3|  unnamed protein product                              56.6    9e-08   
gb|ABB96723.1|  proteinase inhibitor BTIw1                            56.6    9e-08   Fagopyrum esculentum
ref|XP_004247695.1|  PREDICTED: proteinase inhibitor 1-like           57.4    1e-07   
emb|CDO99179.1|  unnamed protein product                              56.2    1e-07   
gb|KFK29320.1|  hypothetical protein AALP_AA7G118100                  56.2    1e-07   
gb|KCW57407.1|  hypothetical protein EUGRSUZ_H00190                   55.8    1e-07   
emb|CAZ96049.1|  putative proteinase inhibitor I13, potato inhibi...  55.8    1e-07   
ref|XP_004247654.1|  PREDICTED: wound-induced proteinase inhibitor 1  56.6    2e-07   
ref|XP_008224480.1|  PREDICTED: FHA domain-containing protein At4...  59.7    2e-07   
ref|XP_009396358.1|  PREDICTED: glu S.griseus protease inhibitor-...  55.5    2e-07   
emb|CAZ96216.1|  putative Protease inhibitor HPI                      55.5    2e-07   
dbj|BAA05472.1|  tumor-related protein                                55.5    2e-07   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_009630660.1|  PREDICTED: trypsin/subtilisin inhibitor-like     56.2    2e-07   
ref|XP_008235571.1|  PREDICTED: uncharacterized protein LOC103334391  56.6    2e-07   
ref|XP_006404448.1|  hypothetical protein EUTSA_v10011055mg           55.8    2e-07   
ref|XP_008447238.1|  PREDICTED: glu S.griseus protease inhibitor-...  55.1    3e-07   
gb|KCW54181.1|  hypothetical protein EUGRSUZ_I00166                   55.1    3e-07   
ref|XP_002451430.1|  hypothetical protein SORBIDRAFT_04g001965        55.1    3e-07   Sorghum bicolor [broomcorn]
ref|XP_004134084.1|  PREDICTED: protease inhibitor HPI-like           55.1    3e-07   
gb|KCW54182.1|  hypothetical protein EUGRSUZ_I00167                   55.1    3e-07   
ref|XP_004247655.1|  PREDICTED: wound-induced proteinase inhibito...  55.8    3e-07   
ref|XP_011081244.1|  PREDICTED: proteinase inhibitor-like             55.1    3e-07   
ref|XP_004952054.1|  PREDICTED: subtilisin inhibitor 1-like           54.7    4e-07   
gb|ADP05503.1|  serine proteinase inhibitor 1b                        54.7    4e-07   
ref|XP_006281405.1|  hypothetical protein CARUB_v10027472mg           55.1    4e-07   
ref|XP_006663898.1|  PREDICTED: subtilisin inhibitor 1-like           55.1    4e-07   
gb|KFK36789.1|  hypothetical protein AALP_AA4G170900                  54.7    4e-07   
gb|EYU45083.1|  hypothetical protein MIMGU_mgv1a021054mg              55.1    4e-07   
ref|XP_004247656.1|  PREDICTED: wound-induced proteinase inhibitor 1  55.1    5e-07   
gb|ADP05502.1|  serine proteinase inhibitor 1a                        54.3    6e-07   
gb|AAA34198.1|  proteinase inhibitor I                                55.1    6e-07   Solanum peruvianum [Peruvian tomato]
sp|P16231.1|ICI1_SOLPE  RecName: Full=Wound-induced proteinase in...  55.1    7e-07   Solanum peruvianum [Peruvian tomato]
ref|XP_006295810.1|  hypothetical protein CARUB_v10024936mg           53.9    8e-07   
ref|NP_199170.2|  PR-6 proteinase inhibitor family protein            54.7    8e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010650045.1|  PREDICTED: uncharacterized protein LOC104879281  57.8    9e-07   
ref|XP_004249682.1|  PREDICTED: trypsin inhibitor 1-like              54.3    9e-07   
ref|XP_004490203.1|  PREDICTED: glu S.griseus protease inhibitor-...  53.5    1e-06   
gb|EYU46484.1|  hypothetical protein MIMGU_mgv1a017534mg              53.5    1e-06   
gb|ABR17601.1|  unknown                                               53.5    1e-06   Picea sitchensis
ref|XP_006363669.1|  PREDICTED: trypsin inhibitor 1-like              53.5    1e-06   
ref|NP_001274985.1|  proteinase inhibitor 1 PPI3B2 precursor          53.5    2e-06   
ref|NP_001234615.1|  ethylene-responsive proteinase inhibitor 1 p...  53.9    2e-06   
gb|AAZ08249.1|  proteinase inhibitor 1 PPI3A4                         53.5    2e-06   
ref|XP_009610134.1|  PREDICTED: proteinase inhibitor I-B              53.5    2e-06   
ref|XP_004249689.1|  PREDICTED: trypsin inhibitor 1-like              53.1    2e-06   
sp|Q03199.1|IPIB_TOBAC  RecName: Full=Proteinase inhibitor I-B; S...  53.1    2e-06   
ref|XP_010094275.1|  Glu S.griseus protease inhibitor                 52.8    2e-06   
ref|XP_008378667.1|  PREDICTED: proteinase inhibitor                  52.8    2e-06   
ref|XP_006381202.1|  hypothetical protein POPTR_0006s08880g           53.1    2e-06   
dbj|BAD09914.1|  hypothetical protein                                 52.4    3e-06   
gb|AAZ08246.1|  proteinase inhibitor 1 PPI2C1A                        52.8    3e-06   
ref|XP_006358889.1|  PREDICTED: ethylene-responsive proteinase in...  53.1    3e-06   
ref|XP_006381211.1|  hypothetical protein POPTR_0006s08950g           52.8    3e-06   
sp|P86971.1|ITI_FAGTA  RecName: Full=Trypsin inhibitor; Short=FtTI    52.4    4e-06   
gb|AGI36543.1|  trypsin inhibitor                                     52.4    4e-06   
emb|CDX93297.1|  BnaC04g45990D                                        52.0    4e-06   
gb|AIT42233.1|  proteinase inhibitor 1                                52.8    4e-06   
ref|XP_006420156.1|  hypothetical protein CICLE_v10007022mg           51.6    4e-06   
ref|XP_008224405.1|  PREDICTED: glu S.griseus protease inhibitor-...  52.0    4e-06   
emb|CAN75276.1|  hypothetical protein VITISV_043737                   52.0    4e-06   
ref|XP_009101778.1|  PREDICTED: glu S.griseus protease inhibitor-...  52.0    4e-06   
ref|XP_006363672.1|  PREDICTED: trypsin inhibitor 1-like              52.4    4e-06   
gb|AIT42231.1|  proteinase inhibitor 1                                52.4    4e-06   
ref|NP_001066344.1|  Os12g0193100                                     52.0    5e-06   
ref|XP_006403223.1|  hypothetical protein EUTSA_v10003303mg           52.0    5e-06   
ref|XP_006363695.1|  PREDICTED: trypsin inhibitor 1-like              52.0    5e-06   
ref|XP_009782399.1|  PREDICTED: proteinase inhibitor I-A              52.4    5e-06   
gb|KFK29321.1|  hypothetical protein AALP_AA7G118200                  51.6    5e-06   
ref|XP_009590374.1|  PREDICTED: trypsin inhibitor 1                   52.0    6e-06   
ref|XP_003614151.1|  Trypsin inhibitor                                51.6    6e-06   
ref|XP_006367782.1|  PREDICTED: serine protease inhibitor isoform X1  52.0    6e-06   
ref|XP_004288448.1|  PREDICTED: glu S.griseus protease inhibitor-...  52.0    6e-06   
gb|EYU19958.1|  hypothetical protein MIMGU_mgv1a026359mg              51.2    7e-06   
ref|XP_002532999.1|  subtilisin inhibitor 1, putative                 52.0    7e-06   
gb|AAS46024.1|  serine protease inhibitor                             51.2    8e-06   
gb|KGN44697.1|  hypothetical protein Csa_7G372910                     51.2    8e-06   
gb|AAB46905.1|  BTI-1=7.634 kda trypsin inhibitor isoform             51.2    8e-06   
ref|XP_004977162.1|  PREDICTED: subtilisin inhibitor 1-like           52.0    8e-06   
pdb|1HYM|A  Chain A, Hydrolyzed Trypsin Inhibitor (Cmti-V, Minimi...  50.4    9e-06   
ref|XP_004134085.1|  PREDICTED: protease inhibitor HPI-like           50.8    9e-06   
ref|XP_003564129.1|  PREDICTED: chymotrypsin inhibitor-like           50.8    1e-05   
gb|EAY82524.1|  hypothetical protein OsI_37748                        51.2    1e-05   
ref|XP_010312892.1|  PREDICTED: inhibitor of trypsin and hageman ...  51.2    1e-05   
ref|NP_001177000.1|  Os12g0548450                                     50.8    1e-05   
gb|KCW80912.1|  hypothetical protein EUGRSUZ_C02276                   50.8    1e-05   
gb|KCW66397.1|  hypothetical protein EUGRSUZ_F00211                   50.8    1e-05   
ref|XP_002442971.1|  hypothetical protein SORBIDRAFT_08g005570        50.8    1e-05   
ref|XP_006656935.1|  PREDICTED: uncharacterized protein LOC102704899  52.4    1e-05   
ref|XP_010907808.1|  PREDICTED: subtilisin inhibitor CLSI-I-like      50.8    1e-05   
ref|XP_010229493.1|  PREDICTED: subtilisin inhibitor CLSI-I-like      51.2    2e-05   
dbj|BAB11620.1|  unnamed protein product                              50.8    2e-05   
ref|XP_003578806.1|  PREDICTED: subtilisin inhibitor-like             50.4    2e-05   
dbj|BAD44165.1|  unknown protein                                      50.4    2e-05   
ref|NP_001274835.1|  proteinase inhibitor 1 PPI3A2 precursor          50.8    2e-05   
dbj|BAD09916.1|  hypothetical protein                                 50.1    2e-05   
ref|XP_006367785.1|  PREDICTED: wound-induced proteinase inhibito...  50.8    2e-05   
ref|XP_010442009.1|  PREDICTED: proteinase inhibitor-like             50.1    2e-05   
gb|KCW59399.1|  hypothetical protein EUGRSUZ_H02107                   50.1    2e-05   
gb|ABP52092.1|  proteinase inhibitor                                  49.7    2e-05   
ref|XP_008674421.1|  PREDICTED: subtilisin inhibitor-like             50.1    2e-05   
ref|XP_009774947.1|  PREDICTED: trypsin inhibitor 1                   50.4    2e-05   
gb|KFK31710.1|  hypothetical protein AALP_AA6G149000                  50.1    2e-05   
emb|CDY22343.1|  BnaA06g36650D                                        49.7    2e-05   
ref|WP_017556242.1|  hypothetical protein                             50.4    3e-05   
ref|WP_017542056.1|  hypothetical protein                             50.4    3e-05   
gb|AAC49603.1|  wound-inducible proteinase inhibitor I                50.1    3e-05   
ref|XP_006346444.1|  PREDICTED: glu S.griseus protease inhibitor-...  49.3    3e-05   
gb|AIT42237.1|  proteinase inhibitor 1                                50.1    4e-05   
ref|XP_006367784.1|  PREDICTED: proteinase inhibitor 1 PPI2C1A        50.1    4e-05   
ref|XP_004247659.1|  PREDICTED: wound-induced proteinase inhibito...  50.1    4e-05   
ref|XP_006346527.1|  PREDICTED: glu S.griseus protease inhibitor-...  49.3    4e-05   
ref|XP_002440438.1|  hypothetical protein SORBIDRAFT_09g001020        49.3    4e-05   
emb|CAB71340.2|  putative proteinase inhibitor                        49.3    5e-05   
ref|XP_002269887.1|  PREDICTED: subtilisin inhibitor CLSI-I           49.7    5e-05   
ref|XP_007224909.1|  hypothetical protein PRUPE_ppa021973mg           48.9    5e-05   
ref|XP_009774949.1|  PREDICTED: trypsin inhibitor 1-like              49.3    5e-05   
ref|XP_007224127.1|  hypothetical protein PRUPE_ppa015912mg           48.9    5e-05   
prf||1602257A  chymotrypsin inhibitor 1A                              48.9    5e-05
gb|AIT42232.1|  proteinase inhibitor 1                                49.3    6e-05   
prf||1314299A  proteinase inhibitor I                                 49.3    7e-05
ref|XP_009129310.1|  PREDICTED: glu S.griseus protease inhibitor-...  48.5    7e-05   
ref|XP_009129309.1|  PREDICTED: glu S.griseus protease inhibitor-...  48.1    8e-05   
ref|NP_001275201.1|  type I serine protease inhibitor precursor       48.9    8e-05   
ref|XP_010026924.1|  PREDICTED: inhibitor of trypsin and hageman ...  48.1    8e-05   
ref|XP_004960537.1|  PREDICTED: subtilisin-chymotrypsin inhibitor...  48.5    8e-05   
sp|P01052.1|ICIA_SOLTU  RecName: Full=Chymotrypsin inhibitor I, A...  48.1    9e-05   
ref|XP_006381208.1|  hypothetical protein POPTR_0006s08920g           48.9    9e-05   
sp|P16062.1|ICIA_HORVU  RecName: Full=Subtilisin-chymotrypsin inh...  48.5    9e-05   
gb|AAM22830.1|AF427791_21  CI2C                                       48.1    9e-05   
gb|ABP01767.1|  ptoteinase inhibitor 2                                48.1    1e-04   
ref|NP_001275446.1|  proteinase inhibitor I precursor                 48.9    1e-04   
emb|CDY27196.1|  BnaA09g36060D                                        48.1    1e-04   
sp|P08454.2|ICID_SOLTU  RecName: Full=Wound-induced proteinase in...  48.5    1e-04   
ref|XP_008391169.1|  PREDICTED: glu S.griseus protease inhibitor-...  48.1    1e-04   
ref|XP_007148999.1|  hypothetical protein PHAVU_005G032000g           48.5    1e-04   
emb|CDP04703.1|  unnamed protein product                              48.1    1e-04   
ref|XP_006358886.1|  PREDICTED: ethylene-responsive proteinase in...  48.9    1e-04   
ref|NP_001189707.1|  PR-6 proteinase inhibitor family protein         48.1    1e-04   
ref|NP_030438.1|  PR-6 proteinase inhibitor family protein            47.8    1e-04   
dbj|BAA02823.1|  genetic tumor-related proteinase inhibitor I pre...  48.1    1e-04   
gb|EMT11499.1|  Subtilisin-chymotrypsin inhibitor-2A                  47.8    2e-04   
ref|XP_004247657.1|  PREDICTED: wound-induced proteinase inhibito...  48.1    2e-04   
gb|KCW66396.1|  hypothetical protein EUGRSUZ_F00210                   47.8    2e-04   
ref|XP_010481850.1|  PREDICTED: LOW QUALITY PROTEIN: proteinase i...  47.8    2e-04   
ref|XP_010315497.1|  PREDICTED: glu S.griseus protease inhibitor-...  47.4    2e-04   
gb|EMT22407.1|  Subtilisin inhibitor 1                                48.1    2e-04   
ref|XP_009140106.1|  PREDICTED: protease inhibitor HPI-like           47.0    2e-04   
ref|XP_009599918.1|  PREDICTED: trypsin inhibitor 1-like              47.8    2e-04   
ref|XP_010236700.1|  PREDICTED: glu S.griseus protease inhibitor-...  47.4    2e-04   
gb|EMS48066.1|  Subtilisin-chymotrypsin inhibitor-2A                  47.0    3e-04   
gb|EYU43021.1|  hypothetical protein MIMGU_mgv1a017342mg              47.0    3e-04   
gb|EPS63527.1|  hypothetical protein M569_11259                       46.6    3e-04   
gb|EAZ00724.1|  hypothetical protein OsI_22749                        47.0    4e-04   
gb|KCW62507.1|  hypothetical protein EUGRSUZ_H05147                   47.0    4e-04   
sp|Q00783.1|ICI1_SOLTU  RecName: Full=Proteinase inhibitor 1; Alt...  47.0    4e-04   
gb|KGN49621.1|  hypothetical protein Csa_5G027950                     46.6    4e-04   
emb|CDM81426.1|  unnamed protein product                              46.6    4e-04   
ref|XP_006367783.1|  PREDICTED: proteinase inhibitor 1-like           46.6    4e-04   
ref|XP_009047357.1|  hypothetical protein LOTGIDRAFT_230585           46.2    5e-04   
ref|XP_006404447.1|  hypothetical protein EUTSA_v10011127mg           46.6    5e-04   
gb|KCW85032.1|  hypothetical protein EUGRSUZ_B01872                   46.6    6e-04   
ref|XP_002879773.1|  predicted protein                                45.8    7e-04   
ref|NP_001066973.1|  Os12g0548700                                     45.8    7e-04   
gb|AAB46861.1|  AmI=trypsin-chymotrypsin inhibitor/serine proteas...  45.4    7e-04   
ref|XP_004962602.1|  PREDICTED: subtilisin-chymotrypsin inhibitor...  45.8    7e-04   
gb|KCW71069.1|  hypothetical protein EUGRSUZ_F04168                   46.2    8e-04   
gb|KCW88972.1|  hypothetical protein EUGRSUZ_A01291                   47.0    8e-04   
ref|WP_017593962.1|  hypothetical protein                             46.6    8e-04   
gb|KCW62488.1|  hypothetical protein EUGRSUZ_H05126                   45.8    8e-04   
gb|KCW62496.1|  hypothetical protein EUGRSUZ_H05137                   45.4    0.001   
gb|AAA69780.1|  proteinase inhibitor I                                46.2    0.001   
gb|EMT22929.1|  Subtilisin-chymotrypsin inhibitor-2A                  45.8    0.001   



>ref|XP_010278088.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Nelumbo 
nucifera]
Length=70

 Score = 92.0 bits (227),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C  GK SWPELVG + +VAKA IE+ENP VTAI+V  G P+ILNFDC RVW+ VD 
Sbjct  1    MSSECS-GKSSWPELVGAEGEVAKATIEQENPAVTAIIVLEGTPVILNFDCTRVWVWVDT  59

Query  226  NNVVKRTPSIG  258
            N  V + P IG
Sbjct  60   NGTVTKVPKIG  70



>ref|XP_010679203.1| PREDICTED: glu S.griseus protease inhibitor-like [Beta vulgaris 
subsp. vulgaris]
Length=69

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS CQ GK++WPELVGE+ Q A  IIEKENPNV AIV+  G P+ L+F C RV + VDC
Sbjct  1    MSS-CQ-GKNTWPELVGEKGQKAAEIIEKENPNVKAIVILDGTPVTLDFRCDRVRVFVDC  58

Query  226  NNVVKRTPSIG  258
             ++V R P IG
Sbjct  59   KDIVVRAPIIG  69



>ref|XP_010243880.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Nelumbo 
nucifera]
Length=70

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSSIC  GK SW ELVG + +VAKA IE+ENP V+AIVV  G  +  +F C RVW+ VD 
Sbjct  1    MSSICS-GKSSWAELVGAEGEVAKATIEQENPAVSAIVVLQGTNVHEDFRCSRVWVWVDA  59

Query  226  NNVVKRTPSIG  258
            N  V   P+IG
Sbjct  60   NGTVISVPTIG  70



>ref|XP_002521007.1| Proteinase inhibitor, putative [Ricinus communis]
 gb|EEF41424.1| Proteinase inhibitor, putative [Ricinus communis]
Length=70

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS++C  GKDSWPELVG +   A A +EKEN +V AIV+  G P+  +F C RVW+ VD 
Sbjct  1    MSNVCL-GKDSWPELVGAKGDDAAATVEKENKHVHAIVLKEGTPVTRDFRCNRVWVWVDE  59

Query  226  NNVVKRTPSIG  258
            N VV R P  G
Sbjct  60   NGVVTRAPKTG  70



>gb|KDP21344.1| hypothetical protein JCGZ_21815 [Jatropha curcas]
Length=70

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C EGK SWPEL+G   + A A IEKEN NV AI+V  G  +IL+F C RVW+ V+ 
Sbjct  1    MASEC-EGKSSWPELLGANGKAAAATIEKENGNVDAILVKEGSSVILDFRCDRVWVWVNE  59

Query  226  NNVVKRTPSIG  258
            N VV R P IG
Sbjct  60   NGVVTRVPIIG  70



>emb|CDO99178.1| unnamed protein product [Coffea canephora]
Length=83

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPEL+G     AKA+IEKENP VTA++V  G  +IL+F C RVW+ V+ NN+V   
Sbjct  20   GKSSWPELLGVDGDYAKAVIEKENPLVTAMIVPEGSSVILDFRCDRVWVWVNKNNIVTEV  79

Query  247  PSIG  258
            P IG
Sbjct  80   PHIG  83



>ref|XP_010243990.1| PREDICTED: glu S.griseus protease inhibitor-like [Nelumbo nucifera]
Length=70

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C  GK+SWPELVG + +VAKA IE+ENP VTA+V+  G  +  +F C RV + VDC
Sbjct  1    MSSECY-GKNSWPELVGCEGKVAKATIEQENPAVTAVVLLEGSIVTADFLCTRVRVWVDC  59

Query  226  NNVVKRTPSIG  258
            N  V + P+IG
Sbjct  60   NGTVTKVPTIG  70



>ref|XP_002314645.1| hypothetical protein POPTR_0010s08640g [Populus trichocarpa]
 gb|EEF00816.1| hypothetical protein POPTR_0010s08640g [Populus trichocarpa]
Length=71

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S   EGK SWPEL+G + +VA A IE+ENP V A +V  G  +I NF C RVW+ VD 
Sbjct  1    MASTYCEGKSSWPELLGVEGKVAAATIERENPLVRAKMVPEGSAVIHNFRCDRVWVWVDK  60

Query  226  NNVVKRTPSIG  258
            NN+V   P IG
Sbjct  61   NNIVYTVPVIG  71



>ref|XP_003590801.1| Inhibitor of trypsin and hageman factor [Medicago truncatula]
 gb|AES61052.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=72

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            +GK SWPELVG + +VA+A IE+ENP V AI+V  G  +IL+F C RVW+ VD + +V +
Sbjct  8    KGKSSWPELVGVEGKVAEATIERENPLVNAIIVPEGSAVILDFRCDRVWVWVDKDGIVFK  67

Query  244  TPSIG  258
             P+IG
Sbjct  68   VPTIG  72



>ref|XP_002521006.1| Proteinase inhibitor, putative [Ricinus communis]
 gb|EEF41423.1| Proteinase inhibitor, putative [Ricinus communis]
Length=69

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK+SWPELVG     A A IEKEN  V AIV+  G P+  +F C RVW+ VD N VV RT
Sbjct  6    GKNSWPELVGANGDEAAAAIEKENKYVDAIVLKEGTPVTKDFRCSRVWVWVDENGVVTRT  65

Query  247  PSIG  258
            P+IG
Sbjct  66   PTIG  69



>gb|EYU32853.1| hypothetical protein MIMGU_mgv1a024582mg [Erythranthe guttata]
Length=70

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  C+ GKDSWPEL+G    VA A IE ENP V AI+V PG  +I NF C RVW+ VD 
Sbjct  1    MSDECK-GKDSWPELIGVPGNVAVATIETENPLVNAIIVPPGNFVITNFRCDRVWVFVDD  59

Query  226  NNVVKRTPSIG  258
            N  VK  P IG
Sbjct  60   NGNVKDVPLIG  70



>ref|NP_001238694.1| protease inhibitor-like [Glycine max]
 gb|ACA23204.1| putative protease inhibitor [Glycine max]
 gb|KHN01082.1| Inhibitor of trypsin and hageman factor [Glycine soja]
Length=70

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  C+ GK SWPELVG Q  VA+A IE+ENP V AI+V  G  +I +F C RVW+ +D 
Sbjct  1    MSDDCK-GKSSWPELVGVQGTVAEATIERENPLVDAIIVPEGNMVITDFRCDRVWVWIDK  59

Query  226  NNVVKRTPSIG  258
            + +VK  P IG
Sbjct  60   DGIVKEVPHIG  70



>ref|XP_004288453.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Fragaria 
vesca subsp. vesca]
Length=72

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPG-CPIILNFDCGRVWLSVD  222
            MSS C EGK SWPELVGE  +VAK  IE+ENPNVTA +V  G   +I ++DC RVW+ VD
Sbjct  1    MSSEC-EGKGSWPELVGEHGEVAKGKIERENPNVTARIVVDGEMYVITDYDCFRVWVWVD  59

Query  223  CNN-VVKRTPSIG  258
             ++  V +TP IG
Sbjct  60   KDDGTVVKTPIIG  72



>gb|AFP43221.1| proteinase inhibitor [Gossypium arboreum]
 gb|AFP43222.1| proteinase inhibitor [Gossypium arboreum]
 gb|KHG01984.1| Inhibitor of trypsin and hageman factor [Gossypium arboreum]
Length=69

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK+SWPELVG+  + AK  IE+EN NV AIV+  G P+  +F C RVW+ VD N  V R 
Sbjct  6    GKNSWPELVGKDGEGAKTTIERENSNVDAIVLLDGTPVTRDFRCDRVWVWVDSNGHVVRP  65

Query  247  PSIG  258
            P+IG
Sbjct  66   PTIG  69



>gb|AAK95644.1|AF404833_1 proteinase inhibitor [Ipomoea batatas]
Length=70

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            +GK SWPELVG  A +AK+ IEKEN ++  + ++ GCP    +   RV L VDC+NVV R
Sbjct  6    DGKSSWPELVGVDAFLAKSTIEKENSDLYVVFLFQGCPETREYIFDRVRLIVDCSNVVIR  65

Query  244  TPSIG  258
            TPSIG
Sbjct  66   TPSIG  70



>gb|AAK72904.1|AF330700_1 proteinase inhibitor SPLTI-a [Ipomoea batatas]
Length=70

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            +GK SWPELVG  A +AK+ IEKEN ++  + ++ GCP    +   RV L VDC+NVV R
Sbjct  6    DGKTSWPELVGVDAFLAKSTIEKENSDLYVVFLFQGCPETREYIFDRVRLIVDCSNVVIR  65

Query  244  TPSIG  258
            TPSIG
Sbjct  66   TPSIG  70



>ref|XP_010932900.1| PREDICTED: glu S.griseus protease inhibitor-like [Elaeis guineensis]
Length=68

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG   + A+ IIEKENP V AI+V  G  ++LNF C RVW+ VD + +V + 
Sbjct  5    GKSSWPELVGVNGKEAEKIIEKENPAVDAIIVMVGESVVLNFSCERVWVWVDKDGIVAQV  64

Query  247  PSIG  258
            P IG
Sbjct  65   PKIG  68



>gb|EYU32855.1| hypothetical protein MIMGU_mgv1a021802mg [Erythranthe guttata]
Length=70

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  C+ GK+SWPELVG    VA A IE+ENP V A++V PG  +I +F C RVW+ VD 
Sbjct  1    MSDECK-GKESWPELVGVPGNVAVATIERENPLVNAVIVPPGNSVITDFRCDRVWVFVDD  59

Query  226  NNVVKRTPSIG  258
            N  VK  P IG
Sbjct  60   NGNVKDVPFIG  70



>ref|XP_006378352.1| hypothetical protein POPTR_0010s08600g [Populus trichocarpa]
 gb|ERP56149.1| hypothetical protein POPTR_0010s08600g [Populus trichocarpa]
Length=72

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            + CQ GK SWPEL+G + +VA A IE+ENP V AI+V  G  +IL+F C RVW+ VD   
Sbjct  5    TTCQ-GKSSWPELLGAEGKVAAATIERENPLVEAIIVPEGSMVILDFRCDRVWVWVDKRG  63

Query  232  VVKRTPSIG  258
            +V + P IG
Sbjct  64   IVFQVPGIG  72



>gb|EYU32854.1| hypothetical protein MIMGU_mgv1a018761mg [Erythranthe guttata]
Length=70

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  C+ GK+SWPELVG    VA A IE+ENP V AI++ P    IL+F C RVW+ VD 
Sbjct  1    MSDECK-GKESWPELVGVPGNVAVATIERENPLVNAIILQPRTFPILDFRCDRVWVYVDG  59

Query  226  NNVVKRTPSIG  258
            N  V+R P IG
Sbjct  60   NGNVRRVPMIG  70



>ref|XP_004247696.2| PREDICTED: wound-induced proteinase inhibitor 1-like [Solanum 
lycopersicum]
Length=128

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG+ A+ AK IIEKENP     V++PG P   N+ CGRV+L VD   +VK T
Sbjct  65   GKQSWPELVGKPAEYAKKIIEKENPIAHVSVLFPGMPRPGNYVCGRVFLVVDWEAIVKIT  124

Query  247  PSIG  258
            P +G
Sbjct  125  PRMG  128



>ref|XP_006378353.1| hypothetical protein POPTR_0010s08630g [Populus trichocarpa]
 gb|ERP56150.1| hypothetical protein POPTR_0010s08630g [Populus trichocarpa]
Length=70

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+SICQ GK SWPEL+G   + A   IE+ENP V AI+V  G  +I+NF C RVW+ VD 
Sbjct  1    MASICQ-GKSSWPELLGVDGKCAVTTIERENPLVEAIIVPEGSSVIMNFQCDRVWVWVDK  59

Query  226  NNVVKRTPSIG  258
            + +V   P IG
Sbjct  60   DGIVYIVPVIG  70



>ref|XP_004134090.1| PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]
 ref|XP_004165329.1| PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]
 gb|KGN56904.1| hypothetical protein Csa_3G142960 [Cucumis sativus]
Length=71

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS+ C+ GK SWPELVG+  + A+ IIEKENP+V A++V  G  +  +F C RVW+ VD 
Sbjct  1    MSTTCK-GKSSWPELVGKAGKEAEKIIEKENPSVDAVIVDEGSVVTQDFRCDRVWVWVDS  59

Query  226  -NNVVKRTPSIG  258
              ++V RTP IG
Sbjct  60   KTSIVTRTPFIG  71



>ref|XP_002314644.1| hypothetical protein POPTR_0010s08610g [Populus trichocarpa]
 ref|XP_006387618.1| hypothetical protein POPTR_0770s00210g [Populus trichocarpa]
 gb|EEF00815.1| hypothetical protein POPTR_0010s08610g [Populus trichocarpa]
 gb|ERP46532.1| hypothetical protein POPTR_0770s00210g [Populus trichocarpa]
Length=70

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+SICQ GK SWPEL+G   + A A IE+ENP V AI+V  G  II NF C RVW+ VD 
Sbjct  1    MASICQ-GKSSWPELLGVDGKCAVATIERENPLVEAIIVPEGSSIIENFRCDRVWVWVDK  59

Query  226  NNVVKRTPSIG  258
            + +V   P IG
Sbjct  60   DGIVYIVPVIG  70



>ref|XP_006411111.1| hypothetical protein EUTSA_v10017502mg [Eutrema salsugineum]
 gb|ESQ52564.1| hypothetical protein EUTSA_v10017502mg [Eutrema salsugineum]
Length=70

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C  GK++WPELVG   + A ++IEKEN +V A+V+  G P+  +F C RV + VD 
Sbjct  1    MSSECH-GKNAWPELVGTNGEYAASVIEKENTSVDAVVILDGIPVTADFRCDRVRVRVDR  59

Query  226  NNVVKRTPSIG  258
            N +V + P+IG
Sbjct  60   NGIVVKVPTIG  70



>ref|XP_007029841.1| Uncharacterized protein TCM_025717 [Theobroma cacao]
 gb|EOY10343.1| Uncharacterized protein TCM_025717 [Theobroma cacao]
Length=160

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK+SWPELVGE+ +VA A IEKENPNV A++++ G    + FD GRV + VD + +V + 
Sbjct  97   GKESWPELVGEKGEVAAAKIEKENPNVKAVLLFEGDIADMRFDFGRVRVVVDADGIVTQV  156

Query  247  PSIG  258
            P IG
Sbjct  157  PRIG  160



>ref|XP_008391168.1| PREDICTED: glu S.griseus protease inhibitor-like [Malus domestica]
Length=70

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C EGK+SWPELVG + + A+AIIE EN  V A++V  G  + +++ C RVW+ VD 
Sbjct  1    MSSEC-EGKNSWPELVGAKGKDAEAIIESENRLVNAVIVKKGSFVTMDYRCDRVWVWVDK  59

Query  226  NNVVKRTPSIG  258
            N +V + P IG
Sbjct  60   NGIVTQIPXIG  70



>ref|XP_006381983.1| hypothetical protein POPTR_0006s22880g [Populus trichocarpa]
 gb|ERP59780.1| hypothetical protein POPTR_0006s22880g [Populus trichocarpa]
Length=70

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S CQ GK SWPEL+G QA+VA A IE ENP V   VV  G P+   F C RV + +D 
Sbjct  1    MASECQ-GKSSWPELLGAQARVAVATIETENPYVDTQVVLEGTPVTGEFSCTRVRVWIDR  59

Query  226  NNVVKRTPSIG  258
            N +V R P IG
Sbjct  60   NRIVTRVPVIG  70



>gb|KFK36788.1| hypothetical protein AALP_AA4G170800 [Arabis alpina]
Length=70

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C  GK+SWPELVG     A ++IE+EN  V AIV+  G P+I +F C RVW+ V+ 
Sbjct  1    MSSECP-GKNSWPELVGTNGDYAASVIERENSKVNAIVILDGTPVITDFRCDRVWVRVNR  59

Query  226  NNVVKRTPSIG  258
            N  V + P  G
Sbjct  60   NRTVVKVPKAG  70



>ref|XP_007221364.1| hypothetical protein PRUPE_ppa018589mg [Prunus persica]
 gb|EMJ22563.1| hypothetical protein PRUPE_ppa018589mg [Prunus persica]
Length=70

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS CQ GK  WPEL+G Q  VA+A IE++N +V A +V  G P+  +F C RV + VD 
Sbjct  1    MSSECQ-GKSRWPELLGAQGTVAEATIERQNSSVDAQIVLEGTPVTRDFRCDRVRVWVDT  59

Query  226  NNVVKRTPSIG  258
            + +V R PSIG
Sbjct  60   DGIVIRVPSIG  70



>ref|XP_010100074.1| Proteinase inhibitor [Morus notabilis]
 gb|EXB81310.1| Proteinase inhibitor [Morus notabilis]
Length=71

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S    GK SWPELVG   ++A A IEKENPNV AIV   G P+I ++ C RVW+ V+ 
Sbjct  1    MASDQCPGKKSWPELVGVCGEIAAAKIEKENPNVDAIVKLQGTPVIQDYRCNRVWIWVNT  60

Query  226  NNVVKRTPSIG  258
            + VV   P +G
Sbjct  61   HGVVSTVPHVG  71



>ref|XP_002315724.2| trypsin inhibitor family protein [Populus trichocarpa]
 ref|XP_006387617.1| hypothetical protein POPTR_0770s00200g [Populus trichocarpa]
 gb|ERP46531.1| hypothetical protein POPTR_0770s00200g [Populus trichocarpa]
 gb|EEF01895.2| trypsin inhibitor family protein [Populus trichocarpa]
Length=72

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            + CQ GK SWPEL+G + +VA A IE+ENP V AI+V  G  + L+F C RVW+ VD   
Sbjct  5    TTCQ-GKSSWPELLGAEGKVAAATIERENPLVEAIIVLDGSEVSLDFRCDRVWVWVDERG  63

Query  232  VVKRTPSIG  258
            +V   P IG
Sbjct  64   IVIEVPRIG  72



>ref|XP_003556369.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Glycine 
max]
 gb|KHN13147.1| Proteinase inhibitor [Glycine soja]
Length=70

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  C+ GK SWPELVG Q  VA+A IE+ENP V AI+V  G  +I ++ C RVW+ ++ 
Sbjct  1    MSDDCK-GKSSWPELVGVQGTVAEATIERENPLVNAIIVPEGNRVITDYRCDRVWVWINK  59

Query  226  NNVVKRTPSIG  258
            + +VK  P IG
Sbjct  60   DGIVKEVPHIG  70



>emb|CDY14424.1| BnaC03g21710D [Brassica napus]
Length=70

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C  GK+SWPELVG     A ++IE+EN  V AIV+  G P+  +F C RV + VD 
Sbjct  1    MSSDCP-GKNSWPELVGTNGDYAASVIERENTRVDAIVILDGTPVTTDFRCNRVRVRVDG  59

Query  226  NNVVKRTPSIG  258
            N +V R P+ G
Sbjct  60   NRIVVRVPTAG  70



>ref|XP_010326741.1| PREDICTED: proteinase inhibitor I-B-like isoform X2 [Solanum 
lycopersicum]
Length=116

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            GK SWPELVG+ A  AK +I+KENPNV+ I V+YPG     N+ CGRV L VD   +VK 
Sbjct  52   GKLSWPELVGKSATYAKEVIQKENPNVSDIRVLYPGMMGPFNYVCGRVLLYVDWKAIVKI  111

Query  244  TPSIG  258
            TP +G
Sbjct  112  TPRMG  116



>gb|EYU32852.1| hypothetical protein MIMGU_mgv1a019023mg [Erythranthe guttata]
Length=70

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS+ C+ GK SWPELVG     A A IE+EN  V AI+V PG  +I +F C RVW+ V+ 
Sbjct  1    MSTECR-GKRSWPELVGVPGNAAAATIERENRLVNAIIVPPGNSVITDFRCDRVWVFVNG  59

Query  226  NNVVKRTPSIG  258
            N  V R PSIG
Sbjct  60   NGNVTRVPSIG  70



>ref|XP_006387620.1| hypothetical protein POPTR_0770s00230g [Populus trichocarpa]
 gb|ERP46534.1| hypothetical protein POPTR_0770s00230g [Populus trichocarpa]
Length=70

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+SICQ GK SWPEL+G   + A   IE+ENP V AI+V  G  II NF C RVW+ VD 
Sbjct  1    MASICQ-GKSSWPELLGVDGKCAVTTIERENPLVEAIIVPEGSSIIENFRCDRVWVWVDK  59

Query  226  NNVVKRTPSIG  258
            + +V   P IG
Sbjct  60   DGIVYIVPVIG  70



>ref|XP_006373842.1| hypothetical protein POPTR_0016s07990g [Populus trichocarpa]
 gb|ERP51639.1| hypothetical protein POPTR_0016s07990g [Populus trichocarpa]
Length=70

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S CQ GK SWPEL+G QA+VA   IE +NP V   VV  G P+  +F C RV + +D 
Sbjct  1    MASDCQ-GKSSWPELLGAQARVAVVTIETQNPYVDTQVVLEGTPVTKDFSCSRVRVWIDQ  59

Query  226  NNVVKRTPSIG  258
            N +V R P IG
Sbjct  60   NRIVTRVPVIG  70



>dbj|BAC10909.1| protease inhibitor 1 [Zinnia elegans]
Length=67

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIIL-NFDCGRVWLSVDCNNVVK  240
            +GK SWPELVG +   A+A  E+ENP V AIVV  G  ++  +F C RVW+ V+ N VV 
Sbjct  2    KGKRSWPELVGARGTTAEARFERENPRVNAIVVVEGRDMVTADFRCDRVWVWVNSNGVVL  61

Query  241  RTPSIG  258
            RTPSIG
Sbjct  62   RTPSIG  67



>ref|XP_007227504.1| hypothetical protein PRUPE_ppa014371mg [Prunus persica]
 gb|EMJ28703.1| hypothetical protein PRUPE_ppa014371mg [Prunus persica]
Length=72

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPG-CPIILNFDCGRVWLSVD  222
            M S C EGK SWPELVG + +VAKA IE+ENP VTA +V  G   +I N+DC RVW+ VD
Sbjct  1    MGSEC-EGKGSWPELVGVEGEVAKATIERENPIVTAKIVVEGETYVITNYDCYRVWVWVD  59

Query  223  CNN-VVKRTPSIG  258
             ++ +V R P IG
Sbjct  60   KDDRLVTRPPIIG  72



>ref|XP_002309424.2| hypothetical protein POPTR_0006s22860g [Populus trichocarpa]
 gb|EEE92947.2| hypothetical protein POPTR_0006s22860g [Populus trichocarpa]
Length=70

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS CQ GK SWPEL+G QA VA A IE ENP V   VV  G  +   F C RV + +D 
Sbjct  1    MSSECQ-GKSSWPELLGAQASVAVATIETENPYVDTQVVLEGTIVTGEFSCTRVRVWIDS  59

Query  226  NNVVKRTPSIG  258
            N +V R P IG
Sbjct  60   NRIVTRVPMIG  70



>ref|XP_004247692.1| PREDICTED: proteinase inhibitor I-B-like isoform X1 [Solanum 
lycopersicum]
Length=117

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            GK SWPELVG+ A  AK +I+KENP V  + +++PG P+  N+ CGRV+L V+   VV+ 
Sbjct  53   GKLSWPELVGKSAGYAKVVIQKENPIVHDVRLLFPGMPMPHNYVCGRVFLVVNFQRVVQV  112

Query  244  TPSIG  258
            TPS+G
Sbjct  113  TPSMG  117



>ref|XP_006420157.1| hypothetical protein CICLE_v10007070mg [Citrus clementina]
 gb|ESR33397.1| hypothetical protein CICLE_v10007070mg [Citrus clementina]
Length=70

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C+ GK+SWPEL+G +  VA A IEK+NP V+A +V  G  + L F C RV + V+ 
Sbjct  1    MSSECK-GKNSWPELLGAKGDVAAAKIEKQNPYVSAQIVLEGTFVTLEFSCSRVRVWVNT  59

Query  226  NNVVKRTPSIG  258
            + +V R P+IG
Sbjct  60   SGIVTRAPAIG  70



>ref|XP_003590795.1| Inhibitor of trypsin and hageman factor [Medicago truncatula]
 gb|AES61046.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
 gb|AFK42591.1| unknown [Medicago truncatula]
 gb|KEH42752.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=70

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  CQ GK SWPELVG + +VA+A I++ENP V AI+V  G  +  +F C RVW+ ++ 
Sbjct  1    MSDECQ-GKSSWPELVGVEGKVAEATIQRENPLVDAIIVPEGSSVPFDFRCDRVWVWINK  59

Query  226  NNVVKRTPSIG  258
            + +V + P+IG
Sbjct  60   DEIVYQVPTIG  70



>dbj|BAC10910.1| protease inhibitor 2 [Zinnia elegans]
Length=67

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            +GK SWPELVGE+ + A+  IEKENP V AIV+  G  +  +F C RVW+ V+   +V R
Sbjct  3    KGKSSWPELVGEKGEAARLTIEKENPLVNAIVLLDGTGVTKDFRCDRVWVWVNSKGIVIR  62

Query  244  TPSI  255
            TP I
Sbjct  63   TPII  66



>ref|XP_007144065.1| hypothetical protein PHAVU_007G125500g [Phaseolus vulgaris]
 gb|ESW16059.1| hypothetical protein PHAVU_007G125500g [Phaseolus vulgaris]
Length=70

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  C+ GK SWPELVG + +VA+A IE+ENP V A +V  G  +  +F C RVW+ ++ 
Sbjct  1    MSEDCK-GKSSWPELVGVEGKVAEATIERENPLVNAQIVAEGSSVPFDFRCDRVWVWINK  59

Query  226  NNVVKRTPSIG  258
            + +VK+ P IG
Sbjct  60   DGIVKQVPHIG  70



>gb|AAK72906.1| proteinase inhibitor SPLTI-2 [Ipomoea batatas]
Length=70

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            +G  SWPELVG  A +AK+ IEKEN ++  + ++ GCP    +   RV L VDC+NVV R
Sbjct  6    DGTSSWPELVGVDAFLAKSTIEKENSDLYVVFLFQGCPETREYVFNRVRLIVDCSNVVIR  65

Query  244  TPSIG  258
            TP IG
Sbjct  66   TPVIG  70



>gb|AAK72905.1| proteinase inhibitor SPLTI-1 [Ipomoea batatas]
Length=71

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M  I      SWPELVG  A +AK+ IEKEN ++  + ++ GCP    +   RV L VDC
Sbjct  1    MQRITDGKTSSWPELVGVDAFLAKSTIEKENSDLFVVFLFQGCPESREYIFDRVRLIVDC  60

Query  226  NNVVKRTPSIG  258
            +NVV RTPSIG
Sbjct  61   SNVVIRTPSIG  71



>ref|XP_007224255.1| hypothetical protein PRUPE_ppa018391mg [Prunus persica]
 gb|EMJ25454.1| hypothetical protein PRUPE_ppa018391mg [Prunus persica]
Length=70

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS+ CQ GKD+WPEL+G Q  VA+A IE+EN  V A +V  G  +  +F C RV + V+ 
Sbjct  1    MSTECQ-GKDTWPELLGSQGTVAEATIERENSLVDAQIVLEGSIVTADFRCDRVRVWVNT  59

Query  226  NNVVKRTPSIG  258
            + +V R PSIG
Sbjct  60   DGIVTRVPSIG  70



>gb|KDP36377.1| hypothetical protein JCGZ_08646 [Jatropha curcas]
Length=71

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+ IC  GK SWPEL+G   + A A+IEKEN NV AIV+  G P+  +F C RVW+ V+ 
Sbjct  1    MADICPPGKSSWPELLGANGKPAAALIEKENSNVNAIVLKEGTPVTKDFRCDRVWVWVNE  60

Query  226  NNVVKRTPSI  255
              VV + P I
Sbjct  61   CGVVVQVPII  70



>gb|EYU32851.1| hypothetical protein MIMGU_mgv1a022632mg [Erythranthe guttata]
Length=71

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS+    GK SWPELVG    VA A IE+ENP V AI++ PG    L+F C RVW+ V+ 
Sbjct  1    MSNSECRGKRSWPELVGVPGNVAVATIERENPLVNAIILPPGTLPTLDFRCDRVWVYVNS  60

Query  226  NNVVKRTPSIG  258
            N  V R P IG
Sbjct  61   NGNVTRVPVIG  71



>ref|XP_004134087.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
sativus]
 ref|XP_004165333.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
sativus]
 gb|KGN56897.1| hypothetical protein Csa_3G142910 [Cucumis sativus]
Length=71

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTP  249
            K  WPELV  +  +A AIIEKENP+V A+ +  G P ILNFD  RVW+ ++   VV + P
Sbjct  9    KTEWPELVFVKYSIAAAIIEKENPDVEAVKILSGTPRILNFDINRVWVDINVEEVVVKKP  68

Query  250  SIG  258
             +G
Sbjct  69   KVG  71



>ref|NP_001275264.1| proteinase inhibitor I precursor [Solanum tuberosum]
 gb|AAZ94182.1| proteinase inhibitor I precursor [Solanum tuberosum]
 gb|ABB86264.1| proteinase inhibitor I precursor-like [Solanum tuberosum]
Length=117

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            GK SWPELVG+ A  AK +IEKEN  V  + +++PG P  LN+ CGRV+L V+   VV+ 
Sbjct  53   GKQSWPELVGKSAGYAKQVIEKENSIVHEVKLLFPGMPKPLNYVCGRVFLVVNFKLVVQV  112

Query  244  TPSIG  258
            TPS+G
Sbjct  113  TPSMG  117



>ref|XP_002323424.2| hypothetical protein POPTR_0016s07980g, partial [Populus trichocarpa]
 gb|EEF05185.2| hypothetical protein POPTR_0016s07980g, partial [Populus trichocarpa]
Length=83

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S CQ GK SWPEL+G QA+VA   IE +NP V   VV  G P+  +F C RV + +D 
Sbjct  14   MASDCQ-GKSSWPELLGAQARVAVVTIETQNPYVDTQVVLEGTPVTKDFSCSRVRVWIDQ  72

Query  226  NNVVKRTPSIG  258
            N +V R P  G
Sbjct  73   NRIVTRVPVSG  83



>ref|XP_008391172.1| PREDICTED: glu S.griseus protease inhibitor-like [Malus domestica]
Length=70

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C EGK SWPEL+G Q  VA+A IE+ENP V A++V  G  +  +F C RV + VD 
Sbjct  1    MSSEC-EGKASWPELLGTQGTVAEATIERENPLVDAVIVLQGTIVTDDFRCDRVRVWVDT  59

Query  226  NNVVKRTPSIG  258
            + +V   P+IG
Sbjct  60   DGIVVDVPAIG  70



>ref|XP_008224409.1| PREDICTED: glu S.griseus protease inhibitor-like [Prunus mume]
Length=70

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C+ GK+ WPEL+G Q  VA+A IE+ENP+V A +V  G  +  +F C RV + VD 
Sbjct  1    MSSECR-GKNRWPELLGAQGTVAEAKIERENPSVDAQIVPEGSVVTADFRCDRVRVWVDT  59

Query  226  NNVVKRTPSIG  258
              +V R PSIG
Sbjct  60   EGIVTRVPSIG  70



>ref|XP_008438570.1| PREDICTED: glu S.griseus protease inhibitor-like [Cucumis melo]
Length=71

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS+ C+ GK SWPELVG+  + A+  IE+ENP V AI+V  G  +I +F C RVW+ VD 
Sbjct  1    MSTTCK-GKSSWPELVGKAGKEAEKTIERENPLVDAIIVDEGSVVIQDFRCDRVWVWVDP  59

Query  226  NN-VVKRTPSIG  258
               +V RTP IG
Sbjct  60   KTAIVTRTPFIG  71



>ref|XP_009779697.1| PREDICTED: proteinase inhibitor I-B-like [Nicotiana sylvestris]
Length=141

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  25   EVDTTPRMSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGR  204
            +V T   +S+ C  GK SWPELVG+ A  AK IIEKENP      ++PG    LN+ CGR
Sbjct  65   QVKTLDDISTFC-PGKQSWPELVGKPAATAKKIIEKENPIAKVQFLFPGMVKPLNYVCGR  123

Query  205  VWLSVDCNNVVKRTPSIG  258
            V++ V+   +V+ TP++G
Sbjct  124  VFVVVNWKLIVQITPTMG  141



>ref|XP_007221365.1| hypothetical protein PRUPE_ppa024500mg [Prunus persica]
 gb|EMJ22564.1| hypothetical protein PRUPE_ppa024500mg [Prunus persica]
Length=70

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS CQ GKD+WPEL+G Q  VA+A IE+EN  V A +V  G  +  +F C RV + V+ 
Sbjct  1    MSSECQ-GKDTWPELLGSQGTVAEATIERENSLVDAQIVLEGTIVTADFRCDRVRVWVNT  59

Query  226  NNVVKRTPSIG  258
            + +V R P IG
Sbjct  60   DGIVTRVPRIG  70



>ref|XP_002323423.1| hypothetical protein POPTR_0016s07970g [Populus trichocarpa]
 gb|EEF05184.1| hypothetical protein POPTR_0016s07970g [Populus trichocarpa]
Length=70

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S CQ GK SWPEL+G QA+VA   +E +NPNV A VV  G  +   F C RV + +D 
Sbjct  1    MASECQ-GKSSWPELLGAQARVAIVTVETQNPNVDAQVVLEGTFVTGEFSCTRVRVWIDR  59

Query  226  NNVVKRTPSIG  258
            N +V R P IG
Sbjct  60   NRIVTRVPIIG  70



>gb|KDO68501.1| hypothetical protein CISIN_1g039274mg, partial [Citrus sinensis]
Length=96

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSICQ-EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            M   C+   K SWPELVG + +VA  II +EN  V AI+V  G  + +++ C RVW+ VD
Sbjct  25   MEDYCRTSSKSSWPELVGVKGEVAAEIIMRENGKVVAIIVKEGFEVTMDYRCDRVWVWVD  84

Query  223  CNNVVKRTPSIG  258
             + +VK TP IG
Sbjct  85   HHGIVKYTPRIG  96



>gb|KDP21343.1| hypothetical protein JCGZ_21814 [Jatropha curcas]
Length=114

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPEL+G   + A A IEKEN NV AIVV  G  +I +F C RVW+ V+   VV + 
Sbjct  51   GKSSWPELLGTNGEAAAATIEKENTNVDAIVVKEGTGVIEDFRCNRVWVWVNEYGVVTQV  110

Query  247  PSIG  258
            P++G
Sbjct  111  PTVG  114



>ref|XP_010094276.1| Glu S.griseus protease inhibitor [Morus notabilis]
 ref|XP_010094277.1| Glu S.griseus protease inhibitor [Morus notabilis]
 gb|EXB55550.1| Glu S.griseus protease inhibitor [Morus notabilis]
 gb|EXB55551.1| Glu S.griseus protease inhibitor [Morus notabilis]
Length=70

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS+ C  GK+SWPELVG Q +VA+ IIEKENP V AI+V  G  +  ++ C RV + V+ 
Sbjct  1    MSTECS-GKNSWPELVGVQGEVAEKIIEKENPAVDAIIVTEGSVVTADYRCDRVRVWVNN  59

Query  226  NNVVKRTPSIG  258
            + +V + P+IG
Sbjct  60   HGIVYKVPTIG  70



>ref|XP_011030541.1| PREDICTED: glu S.griseus protease inhibitor [Populus euphratica]
Length=72

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            + CQ GK SWPEL+G + +VA A IE+ENP V A +V  G  + L+F C RVW+ VD   
Sbjct  5    TTCQ-GKSSWPELLGAEGKVAAATIERENPLVDAKIVLEGSVVPLDFRCDRVWVWVDKRG  63

Query  232  VVKRTPSIG  258
            +V + P IG
Sbjct  64   IVVQVPRIG  72



>sp|P24076.1|BGIA_MOMCH RecName: Full=Glu S.griseus protease inhibitor; AltName: Full=BGIA 
[Momordica charantia]
 gb|AAB19651.1| BGIA=acidic amino acid-specific endopeptidase inhibitor [Momordica 
charantia L.=bitter gourd, Peptide, 68 aa]
Length=68

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            S CQ GK SWP+LVG     AKA+IE+ENP V A++V  G P+  +F C RV + V    
Sbjct  1    SQCQ-GKRSWPQLVGSTGAAAKAVIERENPRVRAVIVRVGSPVTADFRCDRVRVWVTERG  59

Query  232  VVKRTPSIG  258
            +V R P+IG
Sbjct  60   IVARPPAIG  68



>gb|AFT92003.1| potato inhibitor I family protein [Populus tomentosa]
 gb|AFT92015.1| potato inhibitor I family protein [Populus tomentosa]
Length=72

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            + CQ GK SWPEL+G + +VA A IE+ENP V A +V  G  + L+F C RVW+ VD   
Sbjct  5    TTCQ-GKSSWPELLGAEGKVAAATIERENPLVDAKIVLEGSVVPLDFRCDRVWVWVDKRG  63

Query  232  VVKRTPSIG  258
            +V + P IG
Sbjct  64   IVIQVPRIG  72



>ref|XP_009782003.1| PREDICTED: glu S.griseus protease inhibitor-like [Nicotiana sylvestris]
Length=68

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GKD+WPELVGE  Q AK  IE+ENP VTA V   G P   +F C RV + VD +N V + 
Sbjct  5    GKDAWPELVGENGQTAKETIERENPLVTANVALVGSPGTTDFRCDRVRVFVDRDNSVVQV  64

Query  247  PSIG  258
            P IG
Sbjct  65   PVIG  68



>ref|XP_011004115.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Populus 
euphratica]
Length=135

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            ++S CQ GK SWPEL+G QA+VA   IE +NP V   VV  G P+  +F C RV + +D 
Sbjct  66   IASDCQ-GKSSWPELLGAQARVAVVTIETQNPYVDTQVVLEGTPVTKDFSCSRVRVWIDQ  124

Query  226  NNVVKRTPSIG  258
            N +V R P IG
Sbjct  125  NRIVTRVPVIG  135


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPG  171
            M+S CQ GK SWPEL+G QA+VA   +E +NPNV A VV  G
Sbjct  1    MASECQ-GKSSWPELLGAQARVAIVTVETQNPNVDAQVVLEG  41



>gb|EYU40892.1| hypothetical protein MIMGU_mgv1a017848mg [Erythranthe guttata]
Length=69

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK+ WPEL+G     A A+IE++NPNV A+V     P   +F C RVW+ VD N VV R 
Sbjct  6    GKNFWPELLGANGYAAAAVIERQNPNVNAVVSTNPTPTTRDFRCDRVWIWVDANGVVLRA  65

Query  247  PSIG  258
            P  G
Sbjct  66   PRAG  69



>ref|XP_006443889.1| hypothetical protein CICLE_v10023822mg, partial [Citrus clementina]
 gb|ESR57129.1| hypothetical protein CICLE_v10023822mg, partial [Citrus clementina]
Length=104

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSICQ-EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            M   C+   K SWPELVG + +VA  II +EN  V AI+V  G  + +++ C RVW+ VD
Sbjct  33   MEDYCRTSSKSSWPELVGVKGEVAAEIIMRENGKVVAIIVKEGFEVTMDYRCDRVWVWVD  92

Query  223  CNNVVKRTPSIG  258
             + +VK TP IG
Sbjct  93   HHGIVKYTPRIG  104



>ref|XP_002314193.1| hypothetical protein POPTR_0009s03360g [Populus trichocarpa]
 gb|EEE88148.1| hypothetical protein POPTR_0009s03360g [Populus trichocarpa]
Length=70

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+SICQ GK SWPEL+G   + A   IE+EN  V AI+V  G  II +F C RVW+ VD 
Sbjct  1    MASICQ-GKSSWPELLGVDGKCAVETIERENSLVEAIIVPEGSSIIEDFRCDRVWVWVDK  59

Query  226  NNVVKRTPSIG  258
            + +V   P+IG
Sbjct  60   DGIVYLVPAIG  70



>ref|XP_004247694.1| PREDICTED: proteinase inhibitor I-B-like [Solanum lycopersicum]
Length=116

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            GK SWPELVG+ A+ AK +I+KENP VT   +++PG P    + CGRV+L V+   +V+ 
Sbjct  52   GKQSWPELVGKSARYAKQVIQKENPIVTQFTLLFPGMPKPAAYICGRVYLVVNWKLIVQV  111

Query  244  TPSIG  258
            TPS+G
Sbjct  112  TPSMG  116



>gb|KCW77294.1| hypothetical protein EUGRSUZ_D01653 [Eucalyptus grandis]
Length=82

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  40   PRMSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSV  219
            P  S+ C +GK SWPELVG+ A  A A I++ENP V A ++ PG   I ++ C RV++  
Sbjct  10   PCYSTCCHQGKTSWPELVGQNADKATATIQRENPLVAAAIILPGQRPIGDYCCNRVFVWA  69

Query  220  DCNNVVKRTPSIG  258
            D N  V R P IG
Sbjct  70   DNNGNVSRVPVIG  82



>ref|XP_007226170.1| hypothetical protein PRUPE_ppa015379mg [Prunus persica]
 gb|EMJ27369.1| hypothetical protein PRUPE_ppa015379mg [Prunus persica]
Length=68

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 7/73 (10%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPII--LNFDCGRVWLSV  219
            M+S C   KDSWPELVG + +VAKA IE+ENP VTA++++ G PI   L FD  RVW  V
Sbjct  1    MASGC---KDSWPELVGAEGKVAKATIERENPLVTALILHLGAPITQDLRFDRVRVW--V  55

Query  220  DCNNVVKRTPSIG  258
            + N +V   P I 
Sbjct  56   NTNGIVTWIPVIA  68



>gb|KGN56903.1| hypothetical protein Csa_3G142950 [Cucumis sativus]
Length=71

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD-CNNVVK  240
            +GK SWPELV    ++A  IIEKEN +V AI+V  G  ++ NF+CGRV++ +   +N+V 
Sbjct  6    KGKSSWPELVNAPGEIAVKIIEKENSSVKAIIVEEGSSVVTNFECGRVFVFIHKKSNMVT  65

Query  241  RTPSIG  258
            +TP IG
Sbjct  66   KTPHIG  71



>ref|XP_010100072.1| Proteinase inhibitor [Morus notabilis]
 gb|EXB81308.1| Proteinase inhibitor [Morus notabilis]
Length=71

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S   +GK SWPELVG   ++A A IE+ENP V AI+   G  +  +  C RVW+ VD 
Sbjct  1    MASERCQGKKSWPELVGVSGEIATATIERENPTVHAIIKRQGTGVTDDLKCNRVWVWVDA  60

Query  226  NNVVKRTPSIG  258
            + VV   P IG
Sbjct  61   HGVVTTVPMIG  71



>ref|XP_006295369.1| hypothetical protein CARUB_v10024461mg [Capsella rubella]
 gb|EOA28267.1| hypothetical protein CARUB_v10024461mg [Capsella rubella]
Length=71

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  C  GK+SWPELV      A ++IE+EN +V A+V+  G P+  +  C RV + VD 
Sbjct  1    MSFGCTAGKNSWPELVRTNGDYAASVIERENTSVDAVVILDGSPVTADIRCDRVRVFVDR  60

Query  226  NNVVKRTPSIG  258
            N +V RTP  G
Sbjct  61   NRIVVRTPVTG  71



>ref|XP_007050380.1| Inhibitor of trypsin and hageman factor [Theobroma cacao]
 gb|EOX94537.1| Inhibitor of trypsin and hageman factor [Theobroma cacao]
Length=69

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG   + A AII KENP V A++V  G  + ++F C RV + VD   +VKR 
Sbjct  6    GKSSWPELVGVNGEAAAAIIVKENPKVGAVIVKEGMMVTMDFRCDRVRVWVDKYGIVKRK  65

Query  247  PSIG  258
            P IG
Sbjct  66   PQIG  69



>ref|XP_009396722.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Musa 
acuminata subsp. malaccensis]
Length=70

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M +IC  GK SWPEL+G + + A  IIE ENP V A +V  G  +I +F C RVW+ V+ 
Sbjct  1    MQNICA-GKYSWPELLGVEGEKAATIIESENPTVKARIVEDGKVVIQDFRCDRVWVWVNK  59

Query  226  NNVVKRTPSIG  258
            + VV R P IG
Sbjct  60   HGVVARVPHIG  70



>gb|KDP42134.1| hypothetical protein JCGZ_03191 [Jatropha curcas]
Length=71

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+++C  GK SWPEL+G   Q A A+IEKEN NV AIV+    P+  +F C RV + V+ 
Sbjct  1    MANLCPPGKSSWPELLGANGQAAAALIEKENGNVNAIVLNERSPVTPDFRCDRVRVFVND  60

Query  226  NNVVKRTPSIG  258
              VV R P +G
Sbjct  61   CGVVVRVPIVG  71



>ref|XP_008439364.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
melo]
Length=69

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTP  249
            K SWP+LVG    VAKAIIE+ENPNV A+V+  G P+  +F C RV + V+ N +V   P
Sbjct  7    KRSWPQLVGVGGSVAKAIIERENPNVRAVVLEVGTPVTKDFRCNRVRVWVNKNGLVASPP  66

Query  250  SIG  258
            +IG
Sbjct  67   TIG  69



>ref|XP_006281379.1| hypothetical protein CARUB_v10027439mg, partial [Capsella rubella]
 gb|EOA14277.1| hypothetical protein CARUB_v10027439mg, partial [Capsella rubella]
Length=97

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +1

Query  4    KERKERIEVDTTPRMSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPI  180
            K  +  I   T  +M+SIC++ GK SWPEL+G + + AK +IE+ENP + A+++  G  +
Sbjct  12   KSLQLEINTFTQEKMTSICEDPGKSSWPELMGTRGEYAKEVIERENPKMRAVIILEGTAV  71

Query  181  ILNFDCGRVWLSVDCNNVVKRTPSIG  258
               F C RV++ V+   VV   P+IG
Sbjct  72   REIFICSRVYVWVNDYGVVVLVPTIG  97



>ref|XP_008438569.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
melo]
Length=71

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD--CNNVV  237
            +GK SWPELV   A++A  IIEK+N +V AIVV  G  ++ NF+CGRV++ V    NNV 
Sbjct  6    KGKSSWPELVNAPAEIAVKIIEKQNSSVKAIVVEEGSSVVTNFECGRVFVFVHKKTNNVT  65

Query  238  KRTPSIG  258
            K TP IG
Sbjct  66   K-TPRIG  71



>ref|XP_004134089.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
sativus]
 ref|XP_004165330.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
sativus]
Length=69

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            +GK SWP+LVG    VAKAIIE+ENPNV A+V+  G P+  +F C RV + V  N +V  
Sbjct  5    KGKRSWPQLVGVGGSVAKAIIERENPNVRAVVLEVGTPVTKDFRCNRVRVWVKKNGLVAS  64

Query  244  TPSIG  258
             P +G
Sbjct  65   PPMVG  69



>ref|XP_010687945.1| PREDICTED: glu S.griseus protease inhibitor-like [Beta vulgaris 
subsp. vulgaris]
Length=71

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS    GK+ WPELVGE    A  I+E+ENPNV A VV  G  +  +F C RV + V+ 
Sbjct  1    MSSDQCPGKNEWPELVGENGPEAANIVERENPNVEAHVVLQGSIVTADFRCDRVRVWVNT  60

Query  226  NNVVKRTPSIG  258
            N VV R+P IG
Sbjct  61   NGVVYRSPRIG  71



>ref|XP_007009891.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18701.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S   +GK SWPELVG++ + A A IEKENP+V A++V  G  + L F C RV + V+ 
Sbjct  1    MASDECKGKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGTFVTLEFLCTRVRVWVNT  60

Query  226  NNVVKRTPSIG  258
            + +V R P IG
Sbjct  61   DGIVTRVPIIG  71



>ref|XP_006354532.1| PREDICTED: wound-induced proteinase inhibitor 1-like [Solanum 
tuberosum]
Length=115

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            GK SWPELVG+ A+ AK IIEKENP    I V++PG     N+ CGRV+L VD   +VK 
Sbjct  51   GKQSWPELVGKPAEYAKKIIEKENPIAHDISVLFPGMLRPSNYVCGRVFLVVDWEAIVKI  110

Query  244  TPSIG  258
            TP +G
Sbjct  111  TPRMG  115



>ref|XP_004247691.2| PREDICTED: proteinase inhibitor I-B [Solanum lycopersicum]
Length=131

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            GK SWPELVG+ A  AK +I+KENP V  + +++PG    LN+ CGRV+L V+   +V+ 
Sbjct  67   GKLSWPELVGKSAGYAKEVIQKENPIVHDVRLLFPGMIRPLNYVCGRVFLVVNFKRIVRV  126

Query  244  TPSIG  258
            TPS+G
Sbjct  127  TPSMG  131



>gb|AFT92004.1| potato inhibitor I family protein [Populus alba x Populus glandulosa]
 gb|AFT92016.1| potato inhibitor I family protein [Populus alba x Populus glandulosa]
Length=72

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            + CQ GK SWPEL+G + +VA A IE+ENP V A +V  G  + L+F C RVW+ VD   
Sbjct  5    TTCQ-GKSSWPELLGAEGKVAAATIERENPLVDAKIVPEGSVVPLDFRCDRVWVWVDKRG  63

Query  232  VVKRTPSIG  258
            +V + P IG
Sbjct  64   IVIQVPRIG  72



>ref|XP_009605666.1| PREDICTED: proteinase inhibitor I-B-like isoform X3 [Nicotiana 
tomentosiformis]
Length=128

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG+ A+ AK IIEKENP      ++PG    LN+ CGRV++ V+   +V+ T
Sbjct  65   GKQSWPELVGKPAETAKKIIEKENPIAKVQFLFPGMVKPLNYVCGRVFVVVNWKLIVQIT  124

Query  247  PSIG  258
            P++G
Sbjct  125  PTMG  128



>ref|XP_006442409.1| hypothetical protein CICLE_v10022906mg [Citrus clementina]
 gb|ESR55649.1| hypothetical protein CICLE_v10022906mg [Citrus clementina]
Length=119

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG   ++A A I+KENPNV AI++  G P+  +F C RV + VD    V + 
Sbjct  56   GKSSWPELVGVNGEIAAATIQKENPNVHAIIILEGTPVTQDFRCDRVRVVVDKYEKVVQV  115

Query  247  PSIG  258
            P IG
Sbjct  116  PRIG  119



>ref|XP_006495465.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Citrus 
sinensis]
Length=119

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG   ++A A I+KENPNV AI++  G P+  +F C RV + VD    V + 
Sbjct  56   GKSSWPELVGVNGEIAAATIQKENPNVHAIIILEGTPVTQDFRCDRVRVVVDKYEKVVQV  115

Query  247  PSIG  258
            P IG
Sbjct  116  PRIG  119



>ref|XP_006387619.1| hypothetical protein POPTR_0770s00220g [Populus trichocarpa]
 gb|ERP46533.1| hypothetical protein POPTR_0770s00220g [Populus trichocarpa]
Length=72

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            + CQ GK SWPEL+G + +VA A IE+ENP V A +V  G  + L+F C RVW+ VD   
Sbjct  5    TTCQ-GKSSWPELLGAEGKVAAATIERENPLVDAKIVPEGSIVPLDFRCDRVWVWVDKRG  63

Query  232  VVKRTPSIG  258
            +V + P IG
Sbjct  64   IVIQVPRIG  72



>ref|XP_009374774.1| PREDICTED: glu S.griseus protease inhibitor-like [Pyrus x bretschneideri]
Length=70

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C EGKDSWPELVG + + AKAIIE EN  V  ++V  G  + +++ C RV + VD 
Sbjct  1    MSSEC-EGKDSWPELVGAKGKDAKAIIESENRLVHVVIVKEGLFVTMDYRCDRVRVWVDK  59

Query  226  NNVVKRTPSIG  258
            +++V + P  G
Sbjct  60   HDIVTKIPQSG  70



>gb|AID52862.1| serine protease inhibitor [Hevea brasiliensis]
Length=70

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C   KD+WPEL+G    +A  IIE EN NV AIVV  G P+ + ++  RV + VD 
Sbjct  1    MASQCPV-KDAWPELIGTNGDIAAGIIETENANVKAIVVKEGSPMTMEYNLCRVLVFVDD  59

Query  226  NNVVKRTPSIG  258
            N VV + P+IG
Sbjct  60   NRVVTQAPAIG  70



>gb|KDP36376.1| hypothetical protein JCGZ_08645 [Jatropha curcas]
Length=70

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C  GK SWPEL+G   + A A+IEKEN +V AIV+  G P+  +F C RVW+ V+ 
Sbjct  1    MASECP-GKSSWPELLGANGKAAAALIEKENKHVNAIVLKEGTPVTRDFRCDRVWVWVNE  59

Query  226  NNVVKRTPSI  255
              VV R P I
Sbjct  60   CGVVVRVPII  69



>gb|KDP42135.1| hypothetical protein JCGZ_03192 [Jatropha curcas]
Length=70

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+ +C  GK SWPEL+G   + A A+IEK+N NV AIV+  G P+ L+F C RVW+ V+ 
Sbjct  1    MAFVC-PGKSSWPELLGANVKAAAALIEKQNSNVNAIVLKEGSPVPLDFRCDRVWVVVNE  59

Query  226  NNVVKRTPSIG  258
              VV + P+IG
Sbjct  60   CGVVVQVPTIG  70



>ref|XP_002881621.1| hypothetical protein ARALYDRAFT_482903 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57880.1| hypothetical protein ARALYDRAFT_482903 [Arabidopsis lyrata subsp. 
lyrata]
Length=70

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C   K+SWPEL G     A  +IE+ENP V A+V+  G P+  +F C RV + VD 
Sbjct  1    MSSECPR-KNSWPELRGTNGDYAATVIERENPTVDAVVILDGSPVTADFRCDRVRVFVDR  59

Query  226  NNVVKRTPSIG  258
            + +V +TP+ G
Sbjct  60   HRIVVKTPTSG  70



>gb|KDP35356.1| hypothetical protein JCGZ_10340 [Jatropha curcas]
Length=71

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+ IC  GK SWPEL+    + A A+IEKEN NV AIV+  G P+  +  C RVW+ V+ 
Sbjct  1    MADICPPGKSSWPELLRANGKAAAALIEKENSNVNAIVLKEGTPVTSDLRCDRVWVFVNE  60

Query  226  NNVVKRTPSI  255
              VV + P I
Sbjct  61   CGVVVQVPFI  70



>gb|KDP36380.1| hypothetical protein JCGZ_08649 [Jatropha curcas]
Length=71

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+ IC  GK SWPEL+G   + A A+IEKEN NV AIV+  G P+  +F C RV + V+ 
Sbjct  1    MADICPPGKSSWPELLGANGKAAAALIEKENSNVNAIVLKEGTPVTADFRCDRVRVWVNE  60

Query  226  NNVVKRTPSI  255
              VV + P I
Sbjct  61   CGVVVQVPII  70



>gb|ABG49145.1| proteinase inhibitor isoform [Solanum phureja]
Length=116

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            GK SWPELVG+ A+ AK IIEKENP    I V++PG     N+ CGRV+L VD   +VK 
Sbjct  52   GKQSWPELVGKPAEYAKKIIEKENPIAHDIRVLFPGMLRPSNYVCGRVFLVVDWEAIVKI  111

Query  244  TPSIG  258
            TP +G
Sbjct  112  TPIMG  116



>emb|CBI26384.3| unnamed protein product [Vitis vinifera]
Length=119

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 2/82 (2%)
 Frame = +1

Query  16   ERIEVDTTPRMSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNF  192
            +R    T  RM+S C EGK SWPELVG Q +VA   I++ENP++T + ++  G  +  +F
Sbjct  39   DRYLCQTRKRMASEC-EGKSSWPELVGVQGEVAAETIKRENPHITTVDILLEGTIVTQDF  97

Query  193  DCGRVWLSVDCNNVVKRTPSIG  258
             C RV + VD N +V   P+IG
Sbjct  98   YCTRVRVWVDENGIVISVPTIG  119



>ref|XP_003542413.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Glycine 
max]
Length=71

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S+  +GK SWPE+VG    VA   IE+EN NV A +V  G  + ++F C RVW+ VD 
Sbjct  1    MASLLCQGKSSWPEVVGTNGVVAVEKIERENDNVRARLVGEGSMVTMDFWCNRVWVWVDK  60

Query  226  NNVVKRTPSIG  258
              VV R P IG
Sbjct  61   IGVVTRVPKIG  71



>ref|XP_009776471.1| PREDICTED: proteinase inhibitor I-B-like [Nicotiana sylvestris]
Length=128

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG+ A  AK IIEKENP      ++PG    LN+ CGRV++ V+   +V+ T
Sbjct  65   GKQSWPELVGKPAATAKKIIEKENPIAKVQFLFPGMVKPLNYVCGRVFVVVNWKLIVQIT  124

Query  247  PSIG  258
            P++G
Sbjct  125  PTMG  128



>gb|EYU17889.1| hypothetical protein MIMGU_mgv1a022666mg [Erythranthe guttata]
Length=69

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK+ WPEL+G     A A+IE++NPNV A+V     P   +F C RVW+ V+ N VV R 
Sbjct  6    GKNFWPELLGANGDAAAAVIERQNPNVNAVVSTNPTPTTRDFRCDRVWVWVNANGVVLRA  65

Query  247  PSIG  258
            P  G
Sbjct  66   PRAG  69



>gb|ADB85100.1| proteinase inhibitor [Jatropha curcas]
Length=70

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C  GK SWPEL+G   + A A+IEKEN +V AIV+  G P+  +F C RVW+ V+ 
Sbjct  1    MASECP-GKSSWPELLGANGKAAAALIEKENRHVNAIVLKEGTPVTRDFRCDRVWVWVNE  59

Query  226  NNVVKRTPSI  255
              VV R P I
Sbjct  60   CGVVVRVPII  69



>ref|XP_007009882.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18692.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S   +GK SWPELVG++ + A A IEKENP+V A++V  G  +  +F C RV + V+ 
Sbjct  1    MASDECKGKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGSFVTADFLCTRVRVWVNT  60

Query  226  NNVVKRTPSIG  258
              +V R P+IG
Sbjct  61   YGIVTRVPTIG  71



>ref|XP_009133305.1| PREDICTED: protease inhibitor HPI-like [Brassica rapa]
Length=70

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  C+ GK+SWPELVG     A  +IE+EN  V AIV+  G P+  +F C RV + VD 
Sbjct  1    MSYECR-GKNSWPELVGTNGDYAALVIERENTRVDAIVILDGTPVTADFRCDRVRVRVDK  59

Query  226  NNVVKRTPSIG  258
            N +V + P  G
Sbjct  60   NRIVVKVPIAG  70



>emb|CBI26387.3| unnamed protein product [Vitis vinifera]
Length=70

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            + C +GK SWPELVG   + A AIIE+EN NV A VV  G  +  +F C RV + VD   
Sbjct  2    TTCPDGKSSWPELVGVHGEAAAAIIERENLNVKAGVVKEGTLVTTDFRCDRVRVWVDSYG  61

Query  232  VVKRTPSIG  258
            +V   P IG
Sbjct  62   IVSMAPKIG  70



>ref|XP_004288451.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Fragaria 
vesca subsp. vesca]
Length=70

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  C EGKDSWPEL+G Q  VAKA IE EN +V A++V  G  +  +F   RV + V+ 
Sbjct  1    MSDQC-EGKDSWPELLGAQGTVAKATIESENASVKAVIVLEGTSVTDDFRLDRVRVWVNT  59

Query  226  NNVVKRTPSIG  258
              +V   P IG
Sbjct  60   EGIVTSVPKIG  70



>ref|NP_030435.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
 gb|AAC79626.2| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAM61318.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAO41943.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAO50715.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AEC09597.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
Length=70

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS+ C   K+SWPEL G     A  +IE+ENP V A V+  G P+  +F C RV + VD 
Sbjct  1    MSTECPR-KNSWPELTGTNGDYAAVVIERENPTVNAAVILDGSPVTADFRCDRVRVFVDG  59

Query  226  NNVVKRTPSIG  258
            N +V +TP  G
Sbjct  60   NRIVVKTPKSG  70



>gb|AFX66991.1| proteinase inhibitor I [Solanum tuberosum]
Length=117

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            GK SWPELVG+ A  AK +IEKEN  V  + +++PG    LN+ CGRV+L V+   VV+ 
Sbjct  53   GKQSWPELVGKSAGYAKQVIEKENSIVHEVRLLFPGMVKPLNYVCGRVFLVVNFKLVVQV  112

Query  244  TPSIG  258
            TPS+G
Sbjct  113  TPSMG  117



>emb|CCW27997.1| serine protease inhibitor [Hevea brasiliensis]
Length=70

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C   KD+WPEL+G    +A  IIE EN NV AIV+  G P+ + ++  RV + VD 
Sbjct  1    MASQCPV-KDAWPELIGTNGDIAAGIIETENANVKAIVLKKGSPMTMEYNLCRVLVFVDD  59

Query  226  NNVVKRTPSIG  258
            N VV + P+IG
Sbjct  60   NRVVTQAPAIG  70



>ref|XP_009605665.1| PREDICTED: proteinase inhibitor I-B-like isoform X2 [Nicotiana 
tomentosiformis]
Length=128

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG+ A+ AK IIEKENP      ++PG     N+ CGRV++ V+ N +V+ T
Sbjct  65   GKQSWPELVGKPAETAKKIIEKENPIAKVQFLFPGMVRPANYVCGRVFVVVNWNLIVQIT  124

Query  247  PSIG  258
            P +G
Sbjct  125  PRMG  128



>emb|CAN75275.1| hypothetical protein VITISV_043736 [Vitis vinifera]
Length=70

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            + C +GK SWPELVG   + A AIIE+EN NV A VV  G  +  +F C RV + VD   
Sbjct  2    ATCPDGKSSWPELVGVHGEAAAAIIERENLNVKAGVVKEGTLVTTDFRCDRVRVWVDSYG  61

Query  232  VVKRTPSIG  258
            +V   P IG
Sbjct  62   IVSMVPKIG  70



>ref|XP_009605664.1| PREDICTED: proteinase inhibitor I-B-like isoform X1 [Nicotiana 
tomentosiformis]
Length=128

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG+ A+ AK IIEKENP      ++PG     N+ CGRV++ V+ N +V+ T
Sbjct  65   GKQSWPELVGKPAETAKKIIEKENPIAKVQFLFPGMVRPANYVCGRVFVVVNWNLIVQIT  124

Query  247  PSIG  258
            P +G
Sbjct  125  PRMG  128



>ref|XP_003535093.2| PREDICTED: glu S.griseus protease inhibitor-like [Glycine max]
 gb|KHM98960.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=69

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG Q  VA+A IE+ENP+V AI+V  G  +  +    RVW+ V+ + +V R 
Sbjct  6    GKFSWPELVGVQGTVAEATIERENPSVNAIIVPLGSVVTTDLRSDRVWVWVNKDGIVNRV  65

Query  247  PSIG  258
            P IG
Sbjct  66   PKIG  69



>ref|XP_004288449.1| PREDICTED: glu S.griseus protease inhibitor-like [Fragaria vesca 
subsp. vesca]
Length=72

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQ-EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            MS  CQ EGK SWPEL+G Q   AKA IE EN +VTA++V  G  +  +  C RV + VD
Sbjct  1    MSDQCQSEGKSSWPELLGAQGTDAKATIESENSSVTAVIVQEGSIVTQDIRCDRVRVWVD  60

Query  223  CNNVVKRTPSI  255
               +V R P I
Sbjct  61   SYGIVTRVPII  71



>ref|XP_010038018.1| PREDICTED: proteinase inhibitor-like [Eucalyptus grandis]
Length=73

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK +WPELVG   +VA  IIE+EN +  A V+  G P+  +F C RVW+ +D N  V + 
Sbjct  10   GKSAWPELVGRSGKVAAEIIERENRDARARVLPEGTPVTRDFRCDRVWVWIDRNGKVTQV  69

Query  247  PSIG  258
            P IG
Sbjct  70   PHIG  73



>ref|XP_006281417.1| hypothetical protein CARUB_v10027484mg [Capsella rubella]
 gb|EOA14315.1| hypothetical protein CARUB_v10027484mg [Capsella rubella]
Length=72

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            M+SIC++ GK SWPEL+G + + AK +IE+ENP + A+++  G  +   F C RV++ V+
Sbjct  1    MTSICEDPGKSSWPELIGTRGEYAKEVIERENPKMGAVIILDGTAVPEIFICSRVYVWVN  60

Query  223  CNNVVKRTPSIG  258
               VV + P+IG
Sbjct  61   DLGVVVQVPTIG  72



>ref|XP_006606926.1| PREDICTED: glu S.griseus protease inhibitor-like [Glycine max]
 gb|KHN13145.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=69

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            +GK SWPELVG +  VA+A IE+EN  V AIVV  G  +  +F C RVW+ V+ N  V +
Sbjct  5    KGKRSWPELVGVKGTVAEATIERENSLVNAIVVPQGSGVTADFRCDRVWVWVNENGFVFQ  64

Query  244  TPSIG  258
             P+IG
Sbjct  65   VPTIG  69



>gb|ACU19481.1| unknown [Glycine max]
 gb|KHN01083.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=70

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C+ GK SWPELVG +  VA A IE+ENP V A  V  G  +  +F C RVW+ V  
Sbjct  1    MSSECK-GKSSWPELVGVEGTVAVATIERENPLVDANTVLKGTIVTPDFRCDRVWVWVTK  59

Query  226  NNVVKRTPSIG  258
            + +V + P+IG
Sbjct  60   DGIVYQVPTIG  70



>ref|XP_007009886.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18696.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S   EGK SWPELVG++ + A A IEKENP V A++V  G  +  +F C RV + V+ 
Sbjct  1    MASDECEGKSSWPELVGKKGEDAAATIEKENPRVNAVIVLEGSFVTGDFLCTRVRVWVNT  60

Query  226  NNVVKRTPSIG  258
              +V R P IG
Sbjct  61   YGIVTRVPIIG  71



>ref|XP_006421631.1| hypothetical protein CICLE_v10006306mg [Citrus clementina]
 gb|ESR34871.1| hypothetical protein CICLE_v10006306mg [Citrus clementina]
Length=97

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M++ C  GK SWPELVGE   VA A I+ +NP V  I++  G P+  +F C RVW+ VD 
Sbjct  28   MATFCS-GKTSWPELVGEIGAVAAATIKLQNPIVNPIILMLGTPVTRDFRCDRVWVWVDA  86

Query  226  NNVVKRTPSIG  258
               V + P +G
Sbjct  87   IGRVSKPPVVG  97



>ref|XP_007009890.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18700.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S   +GK SWPEL+G + + A A IE+ENPNV A++V  G  +  +F C RV + V+ 
Sbjct  1    MASDECQGKSSWPELLGAKGEEAAATIERENPNVNAVIVLEGSFVTPDFLCTRVRVWVNT  60

Query  226  NNVVKRTPSIG  258
            + +V R P IG
Sbjct  61   DGIVTRVPVIG  71



>gb|KDP42132.1| hypothetical protein JCGZ_03189 [Jatropha curcas]
Length=71

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+ IC  GK SWPEL+G   + A A+IEKEN NV AIV+    P+  +F CGRV + V+ 
Sbjct  1    MADICPPGKRSWPELLGANGKAAAALIEKENSNVNAIVLNEMSPVTPDFRCGRVRVVVND  60

Query  226  NNVVKRTPSIG  258
              VV R P +G
Sbjct  61   CGVVVRVPIVG  71



>ref|XP_007009887.1| Serine protease inhibitor, putative [Theobroma cacao]
 gb|EOY18697.1| Serine protease inhibitor, putative [Theobroma cacao]
Length=71

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S   +GK SWPELVG++ + A A IEKENP+V A++V  G  +  +F C RV + V+ 
Sbjct  1    MASDECKGKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGSFVTADFLCTRVRVWVNT  60

Query  226  NNVVKRTPSIG  258
              +V R P IG
Sbjct  61   YGIVTRVPMIG  71



>ref|XP_011004117.1| PREDICTED: uncharacterized protein LOC105110701 [Populus euphratica]
Length=503

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            ++S CQ GK SWPEL+G QA+VA   IE +NP V   VV  G P+  +F C RV + +D 
Sbjct  434  IASDCQ-GKSSWPELLGAQARVAVVTIETQNPYVDTQVVLEGTPVTKDFSCTRVRVWIDQ  492

Query  226  NNVVKRTPSIG  258
            N +V R P IG
Sbjct  493  NRIVTRVPVIG  503



>gb|AAP46156.1| protease inhibitor protein 1 [Hevea brasiliensis]
Length=70

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C   KD+WPELVG    +A  II+ EN NV AIVV  G PI  + +  RV + VD 
Sbjct  1    MASQCPV-KDAWPELVGTNGDIAAGIIQTENANVKAIVVKEGLPITQDLNFNRVRVFVDE  59

Query  226  NNVVKRTPSIG  258
            N VV + P+IG
Sbjct  60   NRVVTQVPAIG  70



>ref|XP_007138379.1| hypothetical protein PHAVU_009G203600g [Phaseolus vulgaris]
 gb|ESW10373.1| hypothetical protein PHAVU_009G203600g [Phaseolus vulgaris]
Length=70

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C+ GK SWPELVG   + A  II KENP V A+ V  G  +  +F C RV + V+ 
Sbjct  1    MSSYCK-GKRSWPELVGINGETATQIIVKENPRVEALTVPEGSFVSTDFRCDRVRVFVNY  59

Query  226  NNVVKRTPSIG  258
             N V R P+IG
Sbjct  60   KNTVTRVPNIG  70



>ref|XP_006281404.1| hypothetical protein CARUB_v10027471mg [Capsella rubella]
 gb|EOA14302.1| hypothetical protein CARUB_v10027471mg [Capsella rubella]
Length=76

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 5/76 (7%)
 Frame = +1

Query  46   MSSICQ----EG-KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVW  210
            MS IC+    EG K SWPELVG + + AK II++EN  VTA ++     ++  F C RV+
Sbjct  1    MSDICEDTAGEGMKSSWPELVGRRGEEAKEIIDRENTKVTAKIISENAIVLAVFVCDRVY  60

Query  211  LSVDCNNVVKRTPSIG  258
            + V+ N +V +TPS+G
Sbjct  61   VRVNDNGIVTQTPSVG  76



>ref|XP_008224407.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Prunus 
mume]
Length=72

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 7/74 (9%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPG--CPII--LNFDCGRVWL  213
            M+S C+ GKDSWPELVG + +VAKA IE+ENP VTA++++ G   P+   L FD  R+W 
Sbjct  1    MASGCK-GKDSWPELVGAEGKVAKATIERENPLVTALILHQGPMTPMTQDLRFDRVRIW-  58

Query  214  SVDCNNVVKRTPSI  255
             V+ N +V   P I
Sbjct  59   -VNTNGIVTWIPVI  71



>ref|XP_007009884.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18694.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S   +GK SWPEL+G + + A A IE+ENPNV A++V  G  +  +F C RV + V+ 
Sbjct  1    MASDECQGKSSWPELLGAKGEEAAATIERENPNVNAVIVSEGSFVTPDFLCTRVRVWVNT  60

Query  226  NNVVKRTPSIG  258
            + +V R P IG
Sbjct  61   DGIVTRVPVIG  71



>ref|XP_004288450.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Fragaria 
vesca subsp. vesca]
Length=70

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK+SWPEL+G +  VAK IIE EN +VTA++V  G P+  +F   RV + V+ + +V   
Sbjct  7    GKESWPELLGAEGTVAKEIIESENASVTAVIVLEGTPVTRDFRLDRVRVWVNTDGIVISI  66

Query  247  PSIG  258
            P IG
Sbjct  67   PKIG  70



>gb|EPS59152.1| hypothetical protein M569_15657, partial [Genlisea aurea]
Length=61

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG   + A A++E+ENP V  IV+  G P+  +F C RVW+ VD   +V R 
Sbjct  1    GKLSWPELVGFNGREAAAVVERENPFVHPIVILDGTPVTRDFRCDRVWVWVDRRGIVIRP  60

Query  247  P  249
            P
Sbjct  61   P  61



>ref|WP_017621294.1| hypothetical protein [Nocardiopsis gilva]
Length=111

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  43   RMSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWL  213
            + +S C+ GK  WPEL G  A++AK IIE+ENP VTA ++  G P+ L+F C RVWL
Sbjct  38   KSASFCK-GKQEWPELAGAPAKMAKEIIERENPYVTAKILPEGSPVTLDFRCDRVWL  93



>ref|XP_006489606.1| PREDICTED: uncharacterized protein LOC102620214 [Citrus sinensis]
Length=196

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +1

Query  19   RIEVDTTPRMSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDC  198
            R+ V+T   ++ +   GK+SWPEL+G +  VA A IEK+N  V+A +V  G  + L F C
Sbjct  117  RVWVNTRGTVTRVPTIGKNSWPELLGAKGDVAAAKIEKQNRYVSAQIVLEGTFVTLEFSC  176

Query  199  GRVWLSVDCNNVVKRTPSIG  258
             RV + V+ + +V R P+IG
Sbjct  177  SRVRVWVNTSGIVTRAPAIG  196


 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            +GK SW ELVG + +VA   IE+ENP V+A ++  G  + L+  CGRV++ VD N++V  
Sbjct  6    KGKSSWSELVGVEGKVAAETIERENPIVSAHILLEGSNVFLDKYCGRVYVGVDTNSIVVE  65

Query  244  TPSIG  258
             P+IG
Sbjct  66   VPTIG  70


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  22   IEVDTTPRMSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCG  201
            + VDT   +  +   GK SWPEL+G Q   A A +E+ENP V A +V  G  +  +F C 
Sbjct  55   VGVDTNSIVVEVPTIGKSSWPELLGAQGVEAAATVERENPLVNAQIVLEGSFVTADFLCT  114

Query  202  RVWLSVDCNNVVKRTPSIG  258
            RV + V+    V R P+IG
Sbjct  115  RVRVWVNTRGTVTRVPTIG  133



>sp|P19873.1|ITH5_CUCMA RecName: Full=Inhibitor of trypsin and hageman factor; AltName: 
Full=CMTI-V [Cucurbita maxima]
 prf||1701295A trypsin inhibitor
Length=68

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWP LVG    VAKAIIE++NPNV A+++  G P+  +F C RV + V+   +V   
Sbjct  5    GKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVVSP  64

Query  247  PSIG  258
            P IG
Sbjct  65   PRIG  68



>gb|KDP35352.1| hypothetical protein JCGZ_10336 [Jatropha curcas]
Length=70

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C  GK+SWPEL+G   + A A+IEKEN  V AIV+  G P+  +F C RVW+ V+ 
Sbjct  1    MASECP-GKNSWPELLGANGKAAAALIEKENKYVHAIVLKEGTPVPRDFRCDRVWVWVNE  59

Query  226  NNVVKRTPSI  255
              VV R P I
Sbjct  60   CGVVVRVPII  69



>gb|ABZ88804.1| protease inhibitor protein [Hevea brasiliensis]
Length=70

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C   KD+WPEL+G    +A  IIE EN NV AIV+  G P+ + ++  RV + VD 
Sbjct  1    MASQCPV-KDAWPELIGTNGDIAAGIIETENANVKAIVLKKGSPMTMEYNLCRVLVFVDD  59

Query  226  NNVVKRTPSIG  258
            N VV + P IG
Sbjct  60   NRVVTQAPVIG  70



>pdb|1TIN|A Chain A, Three-Dimensional Structure In Solution Of Cucurbita 
Maxima Trypsin Inhibitor-V Determined By Nmr Spectroscopy
Length=69

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWP LVG    VAKAIIE++NPNV A+++  G P+  +F C RV + V+   +V   
Sbjct  6    GKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVVSP  65

Query  247  PSIG  258
            P IG
Sbjct  66   PRIG  69



>ref|XP_007009885.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18695.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S   +GK SWPELVG++ + A A IEKENP+V A++V  G  +  +F C RV + V+ 
Sbjct  1    MASDECKGKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGSFVTADFLCTRVRVWVNT  60

Query  226  NNVVKRTPSIG  258
              +V R P IG
Sbjct  61   YGIVTRVPIIG  71



>sp|P82381.1|ICI_LINUS RecName: Full=Proteinase inhibitor; AltName: Full=LUTI [Linum 
usitatissimum]
Length=69

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK++WPELVG+   +A A +E+EN NV AIV+  G  +  +F C RVW+ V+ + VV   
Sbjct  6    GKNAWPELVGKSGNMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHGVVTSV  65

Query  247  PSI  255
            P I
Sbjct  66   PHI  68



>pdb|1DWM|A Chain A, Solution Structure Of Linum Usitatissinum Trypsin Inhibitor 
(Luti)
Length=70

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK++WPELVG+   +A A +E+EN NV AIV+  G  +  +F C RVW+ V+ + VV   
Sbjct  7    GKNAWPELVGKSGNMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHGVVTSV  66

Query  247  PSI  255
            P I
Sbjct  67   PHI  69



>pdb|1MIT|A Chain A, Recombinant Cucurbita Maxima Trypsin Inhibitor V (Rcmti-V) 
(Nmr, Minimized Average Structure)
Length=69

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWP LVG    VAKAIIE++NPNV A+++  G P+  +F C RV + V+   +V   
Sbjct  6    GKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVVSP  65

Query  247  PSIG  258
            P IG
Sbjct  66   PRIG  69



>ref|XP_002284454.1| PREDICTED: inhibitor of trypsin and hageman factor [Vitis vinifera]
 emb|CBI26386.3| unnamed protein product [Vitis vinifera]
Length=71

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVD  222
            M+S C EGK SWPELVG Q +VA   I++ENP++T + +V  G  +  +F C RV + VD
Sbjct  1    MASEC-EGKSSWPELVGVQGEVAAETIKRENPHITTVDIVLEGTSVTKDFYCTRVRVWVD  59

Query  223  CNNVVKRTPSIG  258
             N +V   P+IG
Sbjct  60   ENGIVISVPTIG  71



>sp|Q6XNP7.2|HPI_HEVBR RecName: Full=Protease inhibitor HPI; AltName: Full=HbPI1; AltName: 
Full=Protease inhibitor 1 [Hevea brasiliensis]
Length=70

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C   K+SWPELVG    +A  II+ EN NV AIVV  G PI  + +  RV + VD 
Sbjct  1    MASQCPV-KNSWPELVGTNGDIAAGIIQTENANVKAIVVKEGLPITQDLNFNRVRVFVDE  59

Query  226  NNVVKRTPSIG  258
            N VV + P+IG
Sbjct  60   NRVVTQVPAIG  70



>ref|XP_002521005.1| Inhibitor of trypsin and hageman factor, putative [Ricinus communis]
 gb|EEF41422.1| Inhibitor of trypsin and hageman factor, putative [Ricinus communis]
Length=72

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            M+ IC + GK SWPELVG + +VA  II +ENP V A +V  G  + ++F C RV + VD
Sbjct  1    MADICTDPGKRSWPELVGIKGEVAVEIIVQENPKVGATIVKEGMMVTMDFRCDRVRVWVD  60

Query  223  CNNVVKRTPSIG  258
               +VK  P IG
Sbjct  61   KYGIVKDVPHIG  72



>gb|AID52861.1| serine protease inhibitor [Hevea brasiliensis]
Length=70

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTP  249
            ++SWPELVG    +A  II+ EN NV AIVV  G P+ + ++  RV + VD N VV + P
Sbjct  8    ENSWPELVGTNGDIAAGIIQTENANVKAIVVKEGSPMTMEYNLCRVLVFVDDNRVVTQVP  67

Query  250  SIG  258
            +IG
Sbjct  68   AIG  70



>ref|XP_009603954.1| PREDICTED: glu S.griseus protease inhibitor-like [Nicotiana tomentosiformis]
Length=68

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  58   CQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVV  237
            CQ GK SWPELVGE  Q AK  IE+ENP VTA V   G     +F C RV + VD +N V
Sbjct  3    CQ-GKSSWPELVGENGQTAKETIERENPLVTANVAPVGSSGTTDFRCDRVRVFVDRDNNV  61

Query  238  KRTPSIG  258
             + P IG
Sbjct  62   AQVPVIG  68



>gb|EYU46483.1| hypothetical protein MIMGU_mgv1a023325mg [Erythranthe guttata]
Length=70

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +1

Query  58   CQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVV  237
            C  GK  WPELV      A  +IE++N NV AIVV  G  +  +  C RVW+ V+ +NVV
Sbjct  4    CPPGKSMWPELVRANGDAAATVIERQNRNVNAIVVREGTSVTEDLRCDRVWVWVNASNVV  63

Query  238  KRTPSIG  258
             R P IG
Sbjct  64   VRVPRIG  70



>gb|KDO49926.1| hypothetical protein CISIN_1g035225mg [Citrus sinensis]
Length=70

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M++ C  GK SWPELVGE   VA A I+ +NP V  I++  G P+   F C RVW+ VD 
Sbjct  1    MATFCS-GKTSWPELVGEIGAVAAATIKLQNPIVNPIILMLGTPVTREFRCDRVWVWVDA  59

Query  226  NNVVKRTPSIG  258
               V + P +G
Sbjct  60   IGRVSKPPVVG  70



>ref|XP_007199579.1| hypothetical protein PRUPE_ppb023174mg [Prunus persica]
 gb|EMJ00778.1| hypothetical protein PRUPE_ppb023174mg [Prunus persica]
Length=124

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +1

Query  43   RMSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            RM+S    GK SWPE+VGE  +VA A IE+E P+V AIV+  G  I     C RV + VD
Sbjct  53   RMASAYCPGKSSWPEIVGEDGEVAAAKIEQEKPDVHAIVIPEGTIITQELRCNRVRVWVD  112

Query  223  CNNVVKRTPSIG  258
             N VV   P +G
Sbjct  113  ENGVVTTVPRVG  124



>gb|KGN50840.1| hypothetical protein Csa_5G286040 [Cucumis sativus]
Length=72

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNV-TAIVVYPGCPIILNFDCGRVWLSVD  222
            M+ IC  GK+ WPELVG +A  AK II+K+NPNV   +V+  G     +  C RVW+ V+
Sbjct  1    MADICPPGKNQWPELVGVKATTAKYIIKKDNPNVENVVVLLAGSGTTEDIRCDRVWVFVN  60

Query  223  CNNVVKRTPSIG  258
             +++V   P +G
Sbjct  61   IHDLVVEVPKVG  72



>ref|XP_007227104.1| hypothetical protein PRUPE_ppa025505mg [Prunus persica]
 gb|EMJ28303.1| hypothetical protein PRUPE_ppa025505mg [Prunus persica]
Length=70

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C EGKDSWPELVG++ + A A IE EN  V A++V  G  +  +F C RV + V+ 
Sbjct  1    MSSEC-EGKDSWPELVGDEGKDAAATIESENHLVNAVIVKEGTFVTADFRCDRVRVWVNK  59

Query  226  NNVVKRTPSIG  258
              +V + P IG
Sbjct  60   RGIVTKVPIIG  70



>gb|ADD51184.1| protease inhibitor 1 [Vitis cinerea var. helleri x Vitis riparia]
Length=71

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVD  222
            M+S C EGK SWPELVG Q +VA   I++ENP++T + +V  G  +  +F C RV + VD
Sbjct  1    MASEC-EGKSSWPELVGVQGEVAAETIKRENPHITTVDIVLEGTIVTQDFYCTRVRVWVD  59

Query  223  CNNVVKRTPSIG  258
             N +V   P+IG
Sbjct  60   ENGIVISVPTIG  71



>gb|KDP35355.1| hypothetical protein JCGZ_10339 [Jatropha curcas]
 gb|KDP42131.1| hypothetical protein JCGZ_03188 [Jatropha curcas]
Length=71

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+++C  GK SWPEL+GE  + A A+IEKEN ++ AIV+  G P+  +    RV + VD 
Sbjct  1    MANMCSPGKTSWPELLGENGKAAAALIEKENKDLHAIVLKEGTPVTKDLRWDRVRVWVDE  60

Query  226  NNVVKRTPSIG  258
              VV   P+IG
Sbjct  61   CGVVILVPTIG  71



>ref|XP_003617314.1| protease inhibitor [Medicago truncatula]
 gb|AET00273.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
 gb|KEH28391.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=70

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  C+ GK+SWPELVG + +VA+A I+ ENP V AI+V  G  +  +F C RV + VD 
Sbjct  1    MSDECK-GKNSWPELVGVEGKVAEATIQSENPLVNAIIVPEGSFVTADFRCDRVRVWVDK  59

Query  226  NNVVKRTPSIG  258
            + +V + P IG
Sbjct  60   DGIVYQVPIIG  70



>ref|XP_007029839.1| Uncharacterized protein TCM_025715 [Theobroma cacao]
 gb|EOY10341.1| Uncharacterized protein TCM_025715 [Theobroma cacao]
Length=160

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVGE+  VA A IEKENPNV A+V+  G P    FD  RV + V+   +V + 
Sbjct  97   GKQSWPELVGEKGDVAAAKIEKENPNVKAVVLLEGTPTDRMFDITRVRVFVNEEGMVTQV  156

Query  247  PSIG  258
            P  G
Sbjct  157  PRTG  160



>emb|CDY39726.1| BnaA04g11270D [Brassica napus]
Length=72

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDC--GRVWLSV  219
            MSS C  GK SWPELVG     A ++IE++N  V A+V+  G P+  +F C   RV + V
Sbjct  1    MSSEC-PGKTSWPELVGTNGDYAASVIERQNSRVNAVVILDGSPVTADFRCDRNRVRVWV  59

Query  220  DCNNVVKRTPSIG  258
            D N +V R P+ G
Sbjct  60   DTNRIVVRVPTTG  72



>pdb|1VBW|A Chain A, Crystal Structure Of Bitter Gourd Trypsin Inhibitor
 prf||2111250B trypsin inhibitor BGIT
Length=68

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            S CQ GK SWP+LVG     AKA+IE+ENP V A+++  G     +F C RV + V    
Sbjct  1    SRCQ-GKSSWPQLVGSTGAAAKAVIERENPRVRAVIIKVGSGATKDFRCDRVRVWVTERG  59

Query  232  VVKRTPSIG  258
            +V R P+IG
Sbjct  60   IVARPPTIG  68



>ref|XP_006442402.1| hypothetical protein CICLE_v10022909mg [Citrus clementina]
 gb|ESR55642.1| hypothetical protein CICLE_v10022909mg [Citrus clementina]
Length=119

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG   ++A A I+ ENPNV AI++  G P+  +F C RV + VD    V + 
Sbjct  56   GKSSWPELVGVNGEIAAATIQIENPNVHAIIILKGTPVTPDFRCDRVRVVVDKYEKVVQV  115

Query  247  PSIG  258
            P IG
Sbjct  116  PRIG  119



>gb|KDP35354.1| hypothetical protein JCGZ_10338 [Jatropha curcas]
Length=71

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRV  207
            M+ IC  GK SWPEL+G   + A A+IEKEN NV AIV+    P+  +F CGRV
Sbjct  1    MADICPPGKRSWPELLGANGKAAAALIEKENSNVNAIVLNEMSPVTPDFRCGRV  54



>ref|XP_008777397.1| PREDICTED: glu S.griseus protease inhibitor-like [Phoenix dactylifera]
Length=70

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            GK SWPELVG + + A  IIE+ENP V AI+V  G  +I NF CGRVW+ V+
Sbjct  5    GKSSWPELVGVEGKEAAKIIERENPAVNAIIVTVGESVIQNFLCGRVWVWVN  56



>gb|KDO41812.1| hypothetical protein CISIN_1g044806mg [Citrus sinensis]
Length=70

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            +GK SWPELVG + +VA   IE+ENP V+A ++  G  + L+  C RV++ VD N +V  
Sbjct  6    KGKSSWPELVGVEGKVAAETIERENPIVSAHILLEGSIVFLDRYCRRVYVWVDTNGIVVD  65

Query  244  TPSIG  258
             P+IG
Sbjct  66   VPTIG  70



>ref|XP_002517007.1| Glu S.griseus protease inhibitor, putative [Ricinus communis]
 gb|EEF45170.1| Glu S.griseus protease inhibitor, putative [Ricinus communis]
Length=70

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            SI   GK SWPELVG   + A AII +ENP V A  V  G P+  +F   RV + +D N+
Sbjct  2    SIEFAGKSSWPELVGNNGEAATAIIMRENPRVKANTVKEGSPVSGDFRSDRVRVFIDDNH  61

Query  232  VVKRTPSIG  258
            +V   P IG
Sbjct  62   IVTLVPKIG  70



>ref|XP_004134091.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
sativus]
 gb|KGN56905.1| hypothetical protein Csa_3G142970 [Cucumis sativus]
Length=71

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS  C+ GK SWPELVG    +A+ IIEKEN  V AI+V  G  +  +F C RVW+ VD 
Sbjct  1    MSIDCK-GKSSWPELVGVSGNIAEKIIEKENCYVNAIIVEQGKFVTQDFRCDRVWVWVDK  59

Query  226  N-NVVKRTPSIG  258
            + ++V +TP IG
Sbjct  60   HTHIVIKTPIIG  71



>gb|AAN85825.1| protease inhibitor [Vitis vinifera]
 emb|CAN62712.1| hypothetical protein VITISV_025108 [Vitis vinifera]
Length=71

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVD  222
            M+S C EGK SWPELVG Q +VA   I++ENP++T + ++  G  +  +F C RV + VD
Sbjct  1    MASEC-EGKSSWPELVGVQGEVAAETIKRENPHITTVDILLEGTIVTQDFYCTRVRVWVD  59

Query  223  CNNVVKRTPSIG  258
             N +V   P+IG
Sbjct  60   ENGIVISVPTIG  71



>ref|XP_010442010.1| PREDICTED: inhibitor of trypsin and hageman factor [Camelina 
sativa]
Length=72

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            M+SIC++ GK SWPEL+G + + AK +IE+ENP + A+++  G  +   F C RV++ V+
Sbjct  1    MTSICEDPGKSSWPELMGTKGEYAKEVIERENPKMKAVIILDGTAVPEIFICSRVYVWVN  60

Query  223  CNNVVKRTPSIG  258
               VV + P IG
Sbjct  61   DCGVVVQIPIIG  72



>ref|XP_002317460.1| hypothetical protein POPTR_0011s11140g [Populus trichocarpa]
 gb|EEE98072.1| hypothetical protein POPTR_0011s11140g [Populus trichocarpa]
Length=72

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            M+ +C + GK SWPELVG   +VA  II +ENP V A +V  G  + ++F C RV + VD
Sbjct  1    MTDVCPDAGKSSWPELVGINGEVAAKIIVRENPKVRAGIVKEGMMVTMDFRCDRVRVWVD  60

Query  223  CNNVVKRTPSIG  258
               +VK  P IG
Sbjct  61   KYGIVKDIPQIG  72



>gb|KDP36378.1| hypothetical protein JCGZ_08647 [Jatropha curcas]
Length=71

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+++C  GK SWPEL+GE  + A A+IEKEN ++ AIV+  G P+ + F   RV + VD 
Sbjct  1    MANMCSPGKTSWPELLGENGKAAAALIEKENKDLHAIVLKEGTPVTMEFRWDRVRVWVDE  60

Query  226  NNVVKRTPSIG  258
              VV   P  G
Sbjct  61   CGVVILVPING  71



>dbj|BAB32588.1| inhibitor against trypsin [Momordica charantia]
Length=66

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            +GK SWP+LVG     AKA+IE+ENP V A+++  G     +F C RV + V    +V R
Sbjct  2    QGKSSWPQLVGSTGAAAKAVIERENPRVRAVIIKVGSGATKDFRCDRVRVWVTERGIVAR  61

Query  244  TPSIG  258
             P+IG
Sbjct  62   PPTIG  66



>ref|XP_004247658.1| PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]
Length=111

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = +1

Query  10   RKERIEVDTTPRM----SSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGC  174
            RKE   ++ T  +    S +  +GK SWPEL+G  AQ AK II+KENP VT + +V  G 
Sbjct  24   RKEIDRLEVTELLKEFESDLMCKGKLSWPELIGVPAQYAKGIIQKENPFVTDVQIVLNGS  83

Query  175  PIILNFDCGRVWLSVDCNNVVKRTPSIG  258
            P+  +F C RV + V+  NV    P +G
Sbjct  84   PVTADFRCFRVRIVVNILNVAVSIPVVG  111



>ref|XP_006489607.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Citrus 
sinensis]
 gb|KDO41754.1| hypothetical protein CISIN_1g038500mg [Citrus sinensis]
Length=71

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C  GK SWPELVG   + A  II  ENP V A  V     +  +F C RV + V+ 
Sbjct  1    MSSSCPAGKGSWPELVGMNGEAAAHIIMAENPKVGATTVDENAIVTTDFRCDRVRVFVND  60

Query  226  NNVVKRTPSIG  258
            + +V R P IG
Sbjct  61   HGIVTRVPRIG  71



>ref|XP_008235797.1| PREDICTED: proteinase inhibitor-like [Prunus mume]
Length=125

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPE+VG+  + A A IE+EN NV AIV+  G    L+  C RVW+ V+ N  V + 
Sbjct  62   GKKSWPEVVGQSGEDAAAKIERENHNVRAIVIPEGSATTLDRRCDRVWVWVNRNGTVTKA  121

Query  247  PSIG  258
            P +G
Sbjct  122  PKVG  125



>gb|KDO37763.1| hypothetical protein CISIN_1g040548mg [Citrus sinensis]
Length=71

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C  GK SWPELVG   + A  II  ENP V A  V     +  +F C RV + V+ 
Sbjct  1    MSSSCPAGKGSWPELVGMNGEAAAHIIMAENPKVGATTVDENAIVTADFRCDRVRVFVND  60

Query  226  NNVVKRTPSIG  258
            + +V R P IG
Sbjct  61   HGIVTRVPRIG  71



>ref|XP_006354530.1| PREDICTED: proteinase inhibitor I-B-like [Solanum tuberosum]
Length=117

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            GK SWPELVG+ A+ A+ +I+KEN  V  +  ++PG     ++ CGRV+L VD   +V+ 
Sbjct  53   GKLSWPELVGKSAEYAREVIQKENSLVHDVRFLFPGMFKPFDYVCGRVFLVVDFKLIVQI  112

Query  244  TPSIG  258
            TPS+G
Sbjct  113  TPSMG  117



>ref|XP_006420158.1| hypothetical protein CICLE_v10007123mg [Citrus clementina]
 gb|ESR33398.1| hypothetical protein CICLE_v10007123mg [Citrus clementina]
Length=94

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C+ GK SWPEL+G Q   A A +E+ENP V A +V  G  +  +F C RV + V+ 
Sbjct  25   MASECR-GKSSWPELLGAQGVEAAATVERENPLVNAQIVLEGSFVTADFLCTRVRVWVNT  83

Query  226  NNVVKRTPSIG  258
               V R P+IG
Sbjct  84   RGTVTRVPTIG  94



>ref|XP_010100075.1| Proteinase inhibitor [Morus notabilis]
 gb|EXB81311.1| Proteinase inhibitor [Morus notabilis]
Length=130

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S CQ GK SWPEL+G+  + A   IEKEN NV A V+  G  +  +F C RVW+ V+ 
Sbjct  1    MASECQ-GKSSWPELLGKNGEEAAKQIEKENKNVDAKVILEGTAVTKDFRCDRVWVWVNN  59

Query  226  NNVVKRTPSIG  258
               V   P +G
Sbjct  60   YGTVTEVPRVG  70


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +1

Query  28   VDTTPRMSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRV  207
            V+    ++ + + GK+SWPELVG   + A+  IEKEN NV AIVV  G P+  +F C RV
Sbjct  57   VNNYGTVTEVPRVGKNSWPELVGVNGKEAEKQIEKENDNVDAIVVLEGTPVPEDFRCTRV  116

Query  208  WLSVDCNNVVKRTP  249
            W+ V+ + +V + P
Sbjct  117  WVWVNDSGIVTQLP  130



>emb|CAZ96086.1| putative proteinase inhibitor [Saccharum hybrid cultivar R570]
Length=70

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            S+   GK SWPELVG  A +A   I  + P+V   V+ PG PII +++  RV + +D NN
Sbjct  2    SVPIPGKSSWPELVGVNATLAATAIAHDRPDVAVEVLPPGAPIIPDYNPLRVRVFIDNNN  61

Query  232  VVKRTPSIG  258
            +V + P IG
Sbjct  62   LVSKVPVIG  70



>ref|XP_002863647.1| hypothetical protein ARALYDRAFT_331046 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39906.1| hypothetical protein ARALYDRAFT_331046 [Arabidopsis lyrata subsp. 
lyrata]
Length=72

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            M+SIC++ GK SWPEL+G + + AK +IE+ENP + A+++  G  +   F C RV++ V+
Sbjct  1    MASICEDPGKSSWPELLGAKGEDAKEVIERENPKMKAVIILDGTAVPEIFICSRVYVWVN  60

Query  223  CNNVVKRTPSIG  258
               +V + P IG
Sbjct  61   DCGIVVQIPIIG  72



>ref|NP_199171.3| unusual seine protease inhibitor [Arabidopsis thaliana]
 gb|AED94984.1| Serine protease inhibitor, potato inhibitor I-type family protein 
[Arabidopsis thaliana]
Length=99

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +1

Query  43   RMSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSV  219
            +M+SIC++ GK SWPEL+G + + AK +IE+ENP + A+++  G  +   F C RV++ V
Sbjct  27   KMASICEDPGKSSWPELLGAKGEDAKEVIERENPKMKAVIILDGTVVPEIFICSRVYVWV  86

Query  220  DCNNVVKRTPSIG  258
            +   +V + P IG
Sbjct  87   NDCGIVVQIPIIG  99



>ref|XP_003590799.1| Protease inhibitor [Medicago truncatula]
 gb|AES61050.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=71

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 4/67 (6%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPII--LNFDCGRVWLSVDCNNVV  237
            +GK SWPELVG + +VA+A I++EN +V AI+V  G  +   L FD  RVW  VD   +V
Sbjct  7    KGKSSWPELVGVEGKVAEATIQRENASVKAIIVLEGSSVTDDLRFDRVRVW--VDKEGIV  64

Query  238  KRTPSIG  258
             + P+IG
Sbjct  65   TQVPTIG  71



>gb|KEH42587.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=70

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK+ WPE+VG     A   IE+EN  V AIVV  G  + ++F C RVW+ VD +  V R 
Sbjct  7    GKNKWPEVVGMDGDEAAEKIERENEKVNAIVVPEGSVVTMDFKCTRVWVWVDKHGRVTRM  66

Query  247  PSIG  258
            P IG
Sbjct  67   PKIG  70



>emb|CAZ96165.1| putative proteinase inhibitor I13, potato inhibitor I [Saccharum 
hybrid cultivar R570]
Length=70

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            S+   GK SWPELVG  A  A + I  E P+V+  V+ PG P+I +F+  RV + +D N+
Sbjct  2    SVPIPGKSSWPELVGVLATPAASTIAHERPDVSVEVLPPGSPVIPDFNPTRVRVFIDNNS  61

Query  232  VVKRTPSIG  258
            +V + P IG
Sbjct  62   IVNQVPVIG  70



>gb|ABK28590.1| unknown [Arabidopsis thaliana]
Length=86

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTP  249
            K  WPELVG+  Q+AK  IE+ENPNV AIV+  G   I NF C RV++ +  N  V   P
Sbjct  23   KYRWPELVGKNGQLAKMTIERENPNVLAIVLRYGEKRIENFCCNRVFVYLGSNGQVADAP  82

Query  250  SIG  258
             IG
Sbjct  83   MIG  85



>ref|XP_007201476.1| hypothetical protein PRUPE_ppa014449mg [Prunus persica]
 gb|EMJ02675.1| hypothetical protein PRUPE_ppa014449mg [Prunus persica]
Length=69

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK +WPE+VG   Q A A IE+EN NV AIV+  G P   +  C RV + ++ N VV R 
Sbjct  6    GKQAWPEVVGHSGQDAAAKIERENHNVRAIVILEGSPATKDLRCDRVRVWINRNGVVVRP  65

Query  247  PSIG  258
            P +G
Sbjct  66   PHVG  69



>ref|XP_002983045.1| hypothetical protein SELMODRAFT_117696, partial [Selaginella 
moellendorffii]
 gb|EFJ15854.1| hypothetical protein SELMODRAFT_117696, partial [Selaginella 
moellendorffii]
Length=64

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNV-TAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            K +WPELVG+ A  A+  I  +NP +   IV Y  C +  +FD  RV +  DC+N V RT
Sbjct  1    KTAWPELVGKDAIYAREQILADNPKLEIHIVFYESCSVTADFDTNRVRIYTDCSNRVVRT  60

Query  247  PSIG  258
            PSIG
Sbjct  61   PSIG  64



>ref|XP_006377750.1| hypothetical protein POPTR_0011s11170g, partial [Populus trichocarpa]
 ref|XP_006387186.1| hypothetical protein POPTR_1585s00210g, partial [Populus trichocarpa]
 gb|ERP46100.1| hypothetical protein POPTR_1585s00210g, partial [Populus trichocarpa]
 gb|ERP55547.1| hypothetical protein POPTR_0011s11170g, partial [Populus trichocarpa]
Length=65

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG   +VA  II +ENP V A +V  G  + ++F C RV + VD   +VK  
Sbjct  2    GKSSWPELVGINGEVAAKIIVRENPKVRAGIVKEGMMVTMDFRCDRVRVWVDKYGIVKDI  61

Query  247  PSIG  258
            P IG
Sbjct  62   PQIG  65



>ref|XP_006383697.1| hypothetical protein POPTR_0005s24230g [Populus trichocarpa]
 gb|ERP61494.1| hypothetical protein POPTR_0005s24230g [Populus trichocarpa]
Length=72

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            M+ +C + GK SWPELVG   +VA  IIE ENP V   +V  G  +     C RV + VD
Sbjct  1    MTDVCSDTGKSSWPELVGINGEVAAKIIESENPKVRVSIVEEGMMVTQEIRCDRVRVWVD  60

Query  223  CNNVVKRTPSI  255
             N +VK  PSI
Sbjct  61   KNGIVKDIPSI  71



>emb|CDX92245.1| BnaA05g21620D [Brassica napus]
Length=70

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M  +    +  +PELVG+  ++AK  IEKENPNVTAI++  G  + +NF C +V++ +D 
Sbjct  1    MKKVFLFFQKVFPELVGKDGEIAKMTIEKENPNVTAIIMSIGI-VKINFCCNKVYIFIDS  59

Query  226  NNVVKRTPSIG  258
            N+ V   P IG
Sbjct  60   NHNVVSVPIIG  70



>emb|CAA87073.1| pathogenesis-related protein PR-6 type [Sambucus nigra]
Length=79

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  43   RMSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSV  219
            R  S C++ GK++WPEL G + + A A +E ENP+VTA++V  G  +  +  C RV + V
Sbjct  7    RRVSHCRDVGKNTWPELCGARGEEAAATVETENPSVTAVIVPEGSIVTTDERCDRVRVWV  66

Query  220  DCNNVVKRTPSIG  258
            D N +V R P IG
Sbjct  67   DENGIVTRVPVIG  79



>ref|XP_010244180.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Nelumbo 
nucifera]
Length=93

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = +1

Query  55   ICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD--CN  228
            IC  GK SWPEL+G +A+ AK+IIE ENPNVT ++  P    I +  C  VW+ V+   N
Sbjct  20   ICCPGKQSWPELIGMEAEEAKSIIESENPNVTVVISTPDVYRIPDLCCNIVWIYVEDLSN  79

Query  229  NVVKRTPSIG  258
             +V   P +G
Sbjct  80   GIVTNVPKVG  89



>gb|ABP01766.1| proteinase inhibitor 1 [Salvia miltiorrhiza]
Length=73

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG    VA A IEKENP+V A+V+ P         C RV + VD N +V   
Sbjct  10   GKSSWPELVGVAGDVAVATIEKENPSVNAVVITPETVWTPAIFCDRVLVFVDANGIVNSV  69

Query  247  PSIG  258
            P++G
Sbjct  70   PTVG  73



>gb|EYU45080.1| hypothetical protein MIMGU_mgv1a024273mg [Erythranthe guttata]
Length=91

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  61   QEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVK  240
            Q+    W  LVG  A+ AKAII K+NP VT ++V+     I NF C RVWL VD NN V+
Sbjct  26   QKYDTVWSNLVGMVAEEAKAIITKDNPLVTVVLVHIDEATIDNFCCNRVWLFVDENNRVR  85

Query  241  RTPSIG  258
            + P +G
Sbjct  86   KVPMVG  91



>sp|P80211.1|ATSI_AMACA RecName: Full=Trypsin/subtilisin inhibitor; AltName: Full=ATSI 
[Amaranthus caudatus]
Length=69

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK  WPELVGE    A AIIE+ENPNV +IV +       +F C RVW+ VD   VV RT
Sbjct  6    GKQEWPELVGEYGYKAAAIIERENPNVRSIVKHERSGFTKDFRCDRVWVVVDSTGVVVRT  65

Query  247  PSI  255
            P +
Sbjct  66   PRV  68



>gb|KGN50838.1| hypothetical protein Csa_5G285030 [Cucumis sativus]
Length=72

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNV-TAIVVYPGCPIILNFDCGRVWLSVD  222
            M+ IC+  K+ WPELVG +A +A+ II+K+NPNV   IV+  G     +F   RVWL  +
Sbjct  1    MADICRPEKNQWPELVGIKATIAEYIIKKDNPNVENVIVLLAGTGTTKDFRSDRVWLFTN  60

Query  223  CNNVVKRTPSIG  258
             +  V   P++G
Sbjct  61   IDGRVVEMPTVG  72



>gb|KDP34823.1| hypothetical protein JCGZ_11185 [Jatropha curcas]
Length=69

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +1

Query  64   EGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            EGK SWPELVG   + A  II  ENP V A  V  G  +  +F C RV + +D N+VV  
Sbjct  5    EGKSSWPELVGTNGEAATVIIMTENPKVKANTVKEGSRVSGDFRCDRVRVFIDDNHVVTM  64

Query  244  TPSIG  258
             P IG
Sbjct  65   VPKIG  69



>ref|NP_190270.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
 emb|CAB51179.1| putative protein [Arabidopsis thaliana]
 gb|ABE65997.1| serine protease inhibitor potato inhibitor I-type family protein 
[Arabidopsis thaliana]
 gb|AEE78212.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
Length=85

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTP  249
            K  WPELVG+  Q+AK  IE+ENPNV AIV+  G   I NF C RV++ +  N  V   P
Sbjct  23   KYRWPELVGKNGQLAKMTIERENPNVLAIVLRYGEKRIENFCCNRVFVYLGSNGQVADAP  82

Query  250  SIG  258
             IG
Sbjct  83   MIG  85



>emb|CAB61327.1| trypsin inhibitor [Amaranthus hypochondriacus]
Length=76

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK  WPELVGE    A AIIE+ENPNV +IV +       +F C RVW+ VD   VV RT
Sbjct  13   GKQEWPELVGEYGYKAAAIIERENPNVRSIVKHERSGFTKDFRCDRVWVVVDSTGVVVRT  72

Query  247  PSI  255
            P +
Sbjct  73   PRV  75



>ref|XP_010528560.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Tarenaya 
hassleriana]
Length=71

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M   C  GK SWPELVG++ + AKAIIEKENPNVTA ++     I+    C RV + V+ 
Sbjct  1    MGEECPGGKSSWPELVGKRGEEAKAIIEKENPNVTAEILSEDEMILTVIICTRVVVRVND  60

Query  226  NNVVKRTPSIG  258
            + +V   P +G
Sbjct  61   SGIVVGIPIVG  71



>emb|CAZ96083.1| putative Subtilisin inhibitor 1 (Subtilisin inhibitor I) (ASI-I) 
[Contains: Subtilisin inhibitor 2 (Subtilisin inhibitor 
II) (ASI-II)] (fragment) [Saccharum hybrid cultivar R570]
Length=70

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            S+   GK SWPELVG  A  A   I  E P+V+  V+ PG P+I +F+  RV + +D N+
Sbjct  2    SVPIPGKSSWPELVGVLATPAATTIAHERPDVSVEVLPPGSPVIPDFNPTRVRVFIDNNS  61

Query  232  VVKRTPSIG  258
            +V + P IG
Sbjct  62   IVNQVPVIG  70



>gb|AIT42234.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=117

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            GK SWPELVG  A  AKAIIEKEN  V  + ++ PG     N+ CGRV+L VD   +V+ 
Sbjct  53   GKLSWPELVGMPAGYAKAIIEKENSIVHDVRLLLPGMVKPANYVCGRVFLVVDLKLIVQI  112

Query  244  TPSIG  258
             PS+G
Sbjct  113  PPSMG  117



>dbj|BAB11621.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF01212.1| hypothetical protein [Arabidopsis thaliana]
Length=72

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            M+SIC++ GK SWPEL+G + + AK +IE+ENP + A+++  G  +   F C RV++ V+
Sbjct  1    MASICEDPGKSSWPELLGAKGEDAKEVIERENPKMKAVIILDGTVVPEIFICSRVYVWVN  60

Query  223  CNNVVKRTPSIG  258
               +V + P IG
Sbjct  61   DCGIVVQIPIIG  72



>ref|XP_006421578.1| hypothetical protein CICLE_v10006212mg [Citrus clementina]
 gb|ESR34818.1| hypothetical protein CICLE_v10006212mg [Citrus clementina]
Length=128

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS+     K SWPELVG+  +VA AIIEKENP V AIV+  G P+  ++   RV + V+ 
Sbjct  58   MSAFDCPRKSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTRDYRIDRVRVWVNK  117

Query  226  NNVVKRTPSIG  258
               V R P IG
Sbjct  118  KGKVIRVPRIG  128



>ref|XP_006299344.1| hypothetical protein CARUB_v10015502mg [Capsella rubella]
 gb|EOA32242.1| hypothetical protein CARUB_v10015502mg [Capsella rubella]
Length=85

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +1

Query  58   CQEGKDS-WPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNV  234
            C  GK   WPELVG+  +VAK  IE+ENPNV AI+++ G   I +F C +V++ +D +  
Sbjct  18   CANGKKCRWPELVGKSGEVAKMTIERENPNVLAILLHAGDGRISDFCCNKVFVVLDIHGH  77

Query  235  VKRTPSIG  258
            V   P IG
Sbjct  78   VSTIPKIG  85



>ref|XP_006281360.1| hypothetical protein CARUB_v10027416mg, partial [Capsella rubella]
 gb|EOA14258.1| hypothetical protein CARUB_v10027416mg, partial [Capsella rubella]
Length=107

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = +1

Query  49   SSICQ----EG-KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWL  213
            S +CQ    EG K SWPELVG +   AK II++EN  VTA ++     ++    C RV++
Sbjct  33   SGVCQDTAGEGMKSSWPELVGRRGDEAKEIIDRENTKVTARIISEKAVVLTVVVCDRVYV  92

Query  214  SVDCNNVVKRTPSIG  258
             V+ + +V RTPS+G
Sbjct  93   RVNDHGIVTRTPSVG  107



>gb|KDO45261.1| hypothetical protein CISIN_1g033055mg [Citrus sinensis]
Length=128

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS+     K SWPELVG+  +VA AIIEKENP V AIV+  G P+  ++   RV + V+ 
Sbjct  58   MSAFDCPRKSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTRDYRIDRVRVWVNK  117

Query  226  NNVVKRTPSIG  258
               V R P IG
Sbjct  118  KGKVIRVPRIG  128



>ref|XP_002451431.1| hypothetical protein SORBIDRAFT_04g001970 [Sorghum bicolor]
 gb|EES04407.1| hypothetical protein SORBIDRAFT_04g001970 [Sorghum bicolor]
 emb|CAZ96051.1| putative proteinase inhibitor I13, potato inhibitor I [Sorghum 
bicolor]
Length=70

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            S+   GK SWPELVG  A +A   I  + P+V   V+ PG P+I +++  RV + +D NN
Sbjct  2    SVPIPGKSSWPELVGVNATLAATAIAHDRPDVAVEVLPPGAPVIPDYNPLRVRVFIDNNN  61

Query  232  VVKRTPSIG  258
            +V + P IG
Sbjct  62   LVSQVPVIG  70



>emb|CDY04060.1| BnaC02g37750D [Brassica napus]
Length=74

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTA--IVVYPGCPIILNFDCGRVWLSV  219
            MS IC  GK SWPELVG +   A ++IE+ENP VTA  IVV    P   N  C RVW+ V
Sbjct  1    MSFICS-GKTSWPELVGTKGDYAASVIERENPGVTAAVIVVRSPVPFEYNIRCNRVWVWV  59

Query  220  D  222
            D
Sbjct  60   D  60



>gb|KDP42136.1| hypothetical protein JCGZ_03193 [Jatropha curcas]
Length=181

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTP  249
            K+SWPEL+G   + A A+IEKEN  V AIV+  G P+  +F C RVW+ V+   VV R P
Sbjct  119  KNSWPELLGANGKAAAALIEKENKYVHAIVLKEGTPVPRDFRCDRVWVWVNECGVVVRVP  178

Query  250  SI  255
             I
Sbjct  179  II  180



>gb|EYU37170.1| hypothetical protein MIMGU_mgv1a026023mg [Erythranthe guttata]
Length=87

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  79   WPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTPSIG  258
            WP LVG  A+ AKAII K+NP VT   V PG  I  +F C RV L +D NN V+  P +G
Sbjct  28   WPNLVGVAAEKAKAIITKDNPLVTVFTVPPGRGIFFDFCCNRVQLFIDENNRVRAVPMVG  87



>ref|XP_002300791.1| hypothetical protein POPTR_0002s04350g [Populus trichocarpa]
 gb|EEE80064.1| hypothetical protein POPTR_0002s04350g [Populus trichocarpa]
Length=66

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLS  216
            M+S C  GK SWPELV    + A A IE+EN NV AIV+  G P+  +F C RVW++
Sbjct  1    MASRCP-GKSSWPELVRAYGEAAAATIERENRNVDAIVLREGTPVTKDFRCNRVWVN  56



>ref|XP_006490176.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Citrus 
sinensis]
Length=128

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MS+     K SWPELVG+  +VA AIIEKENP V AIV+  G P+  ++   RV + V+ 
Sbjct  58   MSAFDCPRKSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNK  117

Query  226  NNVVKRTPSIG  258
               V R P IG
Sbjct  118  KGKVIRVPRIG  128



>ref|XP_006363673.1| PREDICTED: trypsin inhibitor 1-like [Solanum tuberosum]
Length=95

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = +1

Query  52   SICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYP-GCPIILNFDCGRVWLSVDC  225
            S CQ   K SWPEL+G  A++A+ II+KENP +T ++  P G  +  +F C RV L V+ 
Sbjct  25   SSCQGVTKSSWPELLGVPAKLAREIIQKENPKLTKVLNVPNGSIVTADFRCDRVRLYVNI  84

Query  226  NNVVKRTPSIG  258
             +   RTPSIG
Sbjct  85   LDFTVRTPSIG  95



>ref|XP_009763818.1| PREDICTED: trypsin/subtilisin inhibitor-like [Nicotiana sylvestris]
Length=90

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  79   WPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTPSIG  258
            WPELVG     AKA IE+ NPNV  IV+   C  + +F C RVWL  D + +V+  P IG
Sbjct  31   WPELVGLDILPAKATIERTNPNVAVIVLDAHCAHLTDFCCNRVWLCPDASGIVREIPMIG  90



>gb|AAB29664.1| ATI=trypsin inhibitor [Amaranthus hypochondriacus=amaranth, line 
53, seeds, Peptide, 69 aa]
Length=69

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK  WPELVGE    A AIIE+ENPNV  IV +       +F C RVW+ VD   VV RT
Sbjct  6    GKQEWPELVGEYGYKAAAIIERENPNVRDIVKHERSGFTKDFRCDRVWVVVDYTGVVVRT  65

Query  247  PSI  255
            P +
Sbjct  66   PRV  68



>emb|CAZ96136.1| putative proteinase inhibitor I13, potato inhibitor I [Saccharum 
hybrid cultivar R570]
Length=70

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            S+   GK SWPELVG  A  A   I  E P+V+  V+ PG P+I +F+  RV + +D N+
Sbjct  2    SVPIPGKSSWPELVGVLATPAATTIAHERPDVSVEVLPPGSPVITDFNPTRVRVFIDNNS  61

Query  232  VVKRTPSIG  258
            +  + P IG
Sbjct  62   IANQVPVIG  70



>ref|XP_006421577.1| hypothetical protein CICLE_v10006203mg [Citrus clementina]
 gb|ESR34817.1| hypothetical protein CICLE_v10006203mg [Citrus clementina]
Length=131

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTP  249
            K SWPELVG+  +VA AIIEKENP V AIV+  G P+  ++   RV + V+    V R P
Sbjct  69   KSSWPELVGKNGKVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKGKVIRVP  128

Query  250  SIG  258
             IG
Sbjct  129  RIG  131



>ref|XP_006354531.1| PREDICTED: proteinase inhibitor I-B-like [Solanum tuberosum]
Length=116

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKR  243
            GK SWPELVG  A  A+ II+KEN  V  + +++PG     N+ CGRV+L VD   +V+ 
Sbjct  52   GKLSWPELVGMPAGYAEQIIQKENSIVHDVRLLFPGMVKPANYVCGRVFLVVDFKLIVQI  111

Query  244  TPSIG  258
            TPS+G
Sbjct  112  TPSMG  116



>ref|XP_006421576.1| hypothetical protein CICLE_v10006211mg [Citrus clementina]
 gb|ESR34816.1| hypothetical protein CICLE_v10006211mg [Citrus clementina]
Length=128

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTP  249
            K SWPELVG+  +VA AIIEKENP V AIV+  G P+  ++   RV + V+    V R P
Sbjct  66   KSSWPELVGKNGKVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKGKVIRVP  125

Query  250  SIG  258
             IG
Sbjct  126  RIG  128



>ref|XP_003556368.1| PREDICTED: glu S.griseus protease inhibitor [Glycine max]
 gb|ACU16268.1| unknown [Glycine max]
 gb|KHN13146.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=70

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C+ GK SWPELVG +  VA A IE+ENP V A  V  G  +  +F C RV + V  
Sbjct  1    MASECK-GKSSWPELVGVEGTVAVATIERENPLVDANTVLKGSIVTADFRCDRVRVWVTK  59

Query  226  NNVVKRTPSIG  258
            + +V + P IG
Sbjct  60   HGIVYQAPRIG  70



>gb|AAN76363.1| type I proteinase inhibitor-like protein [Citrus x paradisi]
Length=128

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTP  249
            K SWPELVG+  +VA AIIEKENP V AIV+  G P+  ++   RV + V+    V R P
Sbjct  66   KSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKGKVIRVP  125

Query  250  SIG  258
             IG
Sbjct  126  RIG  128



>ref|XP_002965559.1| hypothetical protein SELMODRAFT_84301, partial [Selaginella moellendorffii]
 gb|EFJ32979.1| hypothetical protein SELMODRAFT_84301, partial [Selaginella moellendorffii]
Length=64

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNV-TAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            K +WPELVG+ A  A+  I  +NP +   IV Y  C +  +FD  RV +  DC+N V RT
Sbjct  1    KTAWPELVGKDAIYAREQILADNPKLEIHIVFYEACLVTADFDKNRVRIYTDCSNRVVRT  60

Query  247  PSIG  258
            PSIG
Sbjct  61   PSIG  64



>ref|XP_008391173.1| PREDICTED: glu S.griseus protease inhibitor-like [Malus domestica]
Length=70

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C EGKDSWPELVG +   A A IE  N  V A++V     +  NF C +V + V+ 
Sbjct  1    MSSEC-EGKDSWPELVGAKGAEAAATIESNNHLVNAVIVKZRMFVTANFRCDKVRVWVNK  59

Query  226  NNVVKRTPSIG  258
            + +V R P IG
Sbjct  60   HGIVTRVPVIG  70



>ref|XP_006403221.1| hypothetical protein EUTSA_v10003305mg [Eutrema salsugineum]
 gb|ESQ44674.1| hypothetical protein EUTSA_v10003305mg [Eutrema salsugineum]
Length=72

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            M+SIC++ GK SWPEL+G + + AK +IE+ENP + A ++  G  I   F C RV + V+
Sbjct  1    MASICEDPGKSSWPELMGTKGEYAKEVIERENPKMKADIILDGTAIPEIFICSRVIVWVN  60

Query  223  CNNVVKRTPSIG  258
               +V + P+IG
Sbjct  61   DCGIVVQIPNIG  72



>ref|XP_002865414.1| hypothetical protein ARALYDRAFT_917289 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41673.1| hypothetical protein ARALYDRAFT_917289 [Arabidopsis lyrata subsp. 
lyrata]
Length=76

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +1

Query  46   MSSICQEG-----KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVW  210
            MS +C +      K SWPELVG + + AK II++EN  VTA ++     ++    C RV+
Sbjct  1    MSEVCPDSAGEGMKTSWPELVGRRGEEAKEIIDRENTKVTAEIISENAVVLTVVVCDRVY  60

Query  211  LSVDCNNVVKRTPSIG  258
            + V+ N +V RTP +G
Sbjct  61   VRVNDNGIVTRTPVVG  76



>gb|EYU45082.1| hypothetical protein MIMGU_mgv1a026171mg [Erythranthe guttata]
Length=90

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTP  249
            K  WP LVG  A+ AKAII K+NP V  ++V+    ++ NF C RVWL VD  N V + P
Sbjct  28   KTEWPNLVGMAAEQAKAIIVKDNPIVAVVLVHKDEGVVDNFCCNRVWLFVDDKNHVSQVP  87

Query  250  SIG  258
             +G
Sbjct  88   MVG  90



>ref|WP_017626123.1| hypothetical protein [Nocardiopsis chromatogenes]
Length=110

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 5/77 (6%)
 Frame = +1

Query  40   PRMSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSV  219
            P  ++ CQ GK SWPEL G  A  A+ +IE+ENP V A++V  G  + ++F C RV +  
Sbjct  35   PTGTAQCQ-GKQSWPELAGADAHTAERVIERENPRVDAVLVPKGSYVTMDFRCDRVRVFH  93

Query  220  DCNN----VVKRTPSIG  258
            + ++    +V R P +G
Sbjct  94   EGDDPAPLIVARAPQVG  110



>ref|XP_007199475.1| hypothetical protein PRUPE_ppa027168mg [Prunus persica]
 gb|EMJ00674.1| hypothetical protein PRUPE_ppa027168mg [Prunus persica]
Length=141

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPI---ILNFDCGRVWLSVDCNNVV  237
            GK SWPELVGE  + A   IE+ENPNV AI++  G P     LN D  RVW  +D N VV
Sbjct  76   GKRSWPELVGEIGEAAAMKIERENPNVGAIILVEGTPSPTKDLNCDKVRVW--IDQNGVV  133

Query  238  KRTPSI  255
             R PS+
Sbjct  134  TRVPSV  139



>ref|XP_006403222.1| hypothetical protein EUTSA_v10003342mg, partial [Eutrema salsugineum]
 gb|ESQ44675.1| hypothetical protein EUTSA_v10003342mg, partial [Eutrema salsugineum]
Length=92

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = +1

Query  43   RMSSICQE-GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILN-FDCGRVWLS  216
            +M+SIC++ GK SWPEL+G + + AK +IE+ENP + A ++  G       F C RV++ 
Sbjct  19   KMASICEDPGKSSWPELMGTKGKYAKEVIERENPKMKADIILDGTADPHEIFICSRVYVM  78

Query  217  VDCNNVVKRTPSIG  258
            V+   +V + P+IG
Sbjct  79   VNDCGIVVQIPTIG  92



>gb|KGN56896.1| hypothetical protein Csa_3G142410 [Cucumis sativus]
Length=71

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRTP  249
            K  WPELVG     A  IIE ENPNV A  +  G P+ILN+D  RVW+  +  + V   P
Sbjct  9    KSIWPELVGVDFSAAARIIETENPNVKATKILIGSPVILNYDPTRVWVICNTEDKVVDIP  68

Query  250  SIG  258
             +G
Sbjct  69   RVG  71



>ref|XP_004247660.1| PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]
 sp|P05118.1|ICI1_SOLLC RecName: Full=Wound-induced proteinase inhibitor 1; AltName: 
Full=Wound-induced proteinase inhibitor I; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34199.1| wound-induced proteinase inhibitor I prepropeptide [Solanum lycopersicum]
 gb|AAA34200.1| proteinase inhibitor I [Solanum lycopersicum]
Length=111

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  49   SSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDC  225
            S++  EGK  WPEL+G   ++AK IIEKENP++T I ++  G PI L++ C RV L  + 
Sbjct  41   SNLMCEGKQMWPELIGVPTKLAKEIIEKENPSITNIPILLSGSPITLDYLCDRVRLFDNI  100

Query  226  NNVVKRTPSI  255
               V + P +
Sbjct  101  LGFVVQMPVV  110



>pdb|3RDY|A Chain A, Crystal Structure Of Buckwheat Trypsin Inhibitor Rbti 
At 1.84 Angstrom Resolution
 pdb|3RDZ|C Chain C, Crystal Structure Of Rbti-Trypsin Complex At 2.26 Angstrom 
Resolution
 pdb|3RDZ|D Chain D, Crystal Structure Of Rbti-Trypsin Complex At 2.26 Angstrom 
Resolution
Length=79

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK  WPELVGE+   A  IIE EN +V AIV+  G  +  +  C RVW+ VD   VV  T
Sbjct  16   GKQEWPELVGERGSKAAKIIENENEDVRAIVLPEGSAVPRDLRCDRVWVFVDERGVVVDT  75

Query  247  PSI  255
            P +
Sbjct  76   PVV  78



>ref|XP_006420961.1| hypothetical protein CICLE_v10006680mg [Citrus clementina]
 gb|ESR34201.1| hypothetical protein CICLE_v10006680mg [Citrus clementina]
 gb|KDO41811.1| hypothetical protein CISIN_1g035202mg [Citrus sinensis]
Length=70

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+S C+ GK SWPEL+G Q   A A +E +NP V A +V  G  +  +F C RV + V+ 
Sbjct  1    MASECR-GKSSWPELLGAQGVEAAATVESDNPLVNAQIVLEGSFVTGDFLCTRVRVWVNT  59

Query  226  NNVVKRTPSIG  258
               V R P+IG
Sbjct  60   RGTVTRVPTIG  70



>gb|AAB35320.1| BWI-1=protease inhibitor/trypsin inhibitor [Fagopyrum esculentum=buckwheat 
plants, cv. Shatilovskaya-5, seeds, Peptide, 69 
aa]
 gb|AAP84344.2| proteinase inhibitor [Fagopyrum esculentum]
Length=69

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK  WPELVGE+   A  IIE EN +V AIV+  G  +  +  C RVW+ VD   VV  T
Sbjct  6    GKQEWPELVGERGSKAAKIIENENEDVRAIVLPEGSAVPRDLRCDRVWVFVDERGVVVDT  65

Query  247  PSI  255
            P +
Sbjct  66   PVV  68



>gb|AAB46906.1| BTI-2=trypsin inhibitor isoform [Fagopyrum esculentum=buckwheat, 
Monch, seeds, Peptide, 69 aa]
Length=69

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK  WPELVGE+   A  IIE EN +V AIV+  G  +  +  C RVW+ VD   VV  T
Sbjct  6    GKQEWPELVGERGSKAAKIIENENEDVRAIVLPEGSAVPRDLRCDRVWVFVDERGVVVDT  65

Query  247  PSI  255
            P +
Sbjct  66   PVV  68



>ref|XP_010509102.1| PREDICTED: protease inhibitor HPI [Camelina sativa]
Length=74

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK+SWPEL+G     A ++I+ EN ++  IV+  G P+  +  C RV + VD + +V +T
Sbjct  11   GKNSWPELLGTNGDYAASVIKGENSSLKVIVILVGSPVTADLRCDRVRVRVDKSRIVVKT  70

Query  247  PSIG  258
            P+ G
Sbjct  71   PTAG  74



>emb|CBI25417.3| unnamed protein product [Vitis vinifera]
Length=73

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWL--SVDCNNVVK  240
            GK +WPEL+GE+A+VAK  IE+ENP+V A  +  G    +++ C RVW+  +     VV 
Sbjct  8    GKQAWPELLGEKAEVAKETIERENPSVRARFIKQGHYRTMDYRCDRVWVWTTEGQTGVVV  67

Query  241  RTPSIG  258
              P +G
Sbjct  68   EVPKVG  73



>gb|ABB96723.1| proteinase inhibitor BTIw1 [Fagopyrum esculentum]
Length=72

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK  WPELVGE+   A  IIE EN +V AIV+  G  +  +  C RVW+ VD   VV  T
Sbjct  9    GKQEWPELVGERGSKAAKIIENENEDVRAIVLPEGSGVPRDLRCDRVWVFVDERGVVVDT  68

Query  247  PSI  255
            P +
Sbjct  69   PVV  71



>ref|XP_004247695.1| PREDICTED: proteinase inhibitor 1-like [Solanum lycopersicum]
Length=114

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 38/67 (57%), Gaps = 1/67 (1%)
 Frame = +1

Query  58   CQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVV  237
            CQ GK  WPEL+G  AQ AK IIEKENP     +V  G PI  +  C RV ++V+  +  
Sbjct  49   CQ-GKLMWPELIGVPAQYAKGIIEKENPLTHVQIVLNGSPITTDLSCNRVRIAVNILDYA  107

Query  238  KRTPSIG  258
               P +G
Sbjct  108  VSMPVVG  114



>emb|CDO99179.1| unnamed protein product [Coffea canephora]
Length=71

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNV-TAIVVYPGCPIILNFDCGRVWLSVDCN  228
            S C  GK+SWPELVGE    A A IE+EN  V  AIVV     +  +F C RVW+ V+  
Sbjct  2    SECPAGKNSWPELVGEDGDKAAAKIEQENQRVKKAIVVDESAIVTTDFRCARVWVFVNKE  61

Query  229  NVVKRTPSIG  258
              V   P IG
Sbjct  62   GKVSVVPKIG  71



>gb|KFK29320.1| hypothetical protein AALP_AA7G118100 [Arabis alpina]
Length=72

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +1

Query  46   MSSIC-QEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVD  222
            MSS C   GK+SWPELV      A ++IE EN  V A+V+  G  +  +  C RV + VD
Sbjct  1    MSSECPGTGKNSWPELVETNGDYAASVIESENSKVDAVVILVGSMVTADIRCDRVRVWVD  60

Query  223  CNNVVKRTPSIG  258
             N +V + P+IG
Sbjct  61   KNRIVVKIPTIG  72



>gb|KCW57407.1| hypothetical protein EUGRSUZ_H00190 [Eucalyptus grandis]
Length=70

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            M+  C+ GK  WPELVG +  VA A ++ ENPNV  ++V  G  +  +F C RVW+ V+ 
Sbjct  1    MADGCK-GKSKWPELVGVEEHVAAATVDAENPNVKTVIVPGGSLVPDDFVCTRVWIWVNK  59

Query  226  NNVVKRTPSIG  258
               V + P IG
Sbjct  60   AGYVFQVPIIG  70



>emb|CAZ96049.1| putative proteinase inhibitor I13, potato inhibitor I [Sorghum 
bicolor]
Length=70

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            S+   GK SWPELVG QA +A   I  + P+V+  V+ PG P+I +F+  RV + ++   
Sbjct  2    SVPITGKSSWPELVGVQATLAATAIAHDRPDVSVEVLPPGSPVIPDFNPTRVRVFINNGG  61

Query  232  VVKRTPSIG  258
             V + P IG
Sbjct  62   FVNQVPVIG  70



>ref|XP_004247654.1| PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]
Length=111

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  49   SSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVV-YPGCPIILNFDCGRVWLSVDC  225
            S++  +GK  WPEL+G  AQ AK IIEKENP +T + +   G P   +F C RV ++V+ 
Sbjct  41   SNLMCKGKRMWPELIGVPAQYAKGIIEKENPFITDVRIGLIGSPGTADFKCFRVRIAVNI  100

Query  226  NNVVKRTPSIG  258
             +V    P IG
Sbjct  101  LDVAVSMPVIG  111



>ref|XP_008224480.1| PREDICTED: FHA domain-containing protein At4g14490-like [Prunus 
mume]
Length=359

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +1

Query  46   MSSICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDC  225
            MSS C EGKDSWPELVG++ + A A IE EN  +TA++V  G  +  +F C RV + V+ 
Sbjct  1    MSSEC-EGKDSWPELVGDKGKDAAATIESENHLLTAVIVKEGTFVTADFRCDRVRVWVNK  59

Query  226  NNVV-KRTPS  252
              +V K TP+
Sbjct  60   RGIVTKVTPN  69



>ref|XP_009396358.1| PREDICTED: glu S.griseus protease inhibitor-like [Musa acuminata 
subsp. malaccensis]
Length=69

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   GKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            GK SWPELVG + + A   IE ENP V A++V  G  +  +F C RV + VD   +V   
Sbjct  6    GKSSWPELVGVKGETAVTTIESENPTVKAVIVEVGTIVTGDFLCDRVRVWVDKAGIVAEI  65

Query  247  PSIG  258
            P IG
Sbjct  66   PRIG  69



>emb|CAZ96216.1| putative Protease inhibitor HPI [Saccharum hybrid cultivar R570]
Length=70

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  52   SICQEGKDSWPELVGEQAQVAKAIIEKENPNVTAIVVYPGCPIILNFDCGRVWLSVDCNN  231
            S+   G+ +WPELVG QA +A   I  + P+V+  V+  G P+I  F+  RV + +D N 
Sbjct  2    SVPNPGRSTWPELVGVQATLAATAIAHDRPDVSVEVLPQGSPVIPGFNPERVRVFIDDNL  61

Query  232  VVKRTPSIG  258
            VV++ P IG
Sbjct  62   VVRQIPVIG  70



>dbj|BAA05472.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=64

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +1

Query  70   KDSWPELVGEQAQVAKAIIEKENPNVTAI-VVYPGCPIILNFDCGRVWLSVDCNNVVKRT  246
            K++WPEL+G  A+ A+ II+KENP +T +  V  G P+  +F C RV L V+  +VV + 
Sbjct  1    KETWPELIGVPAKFAREIIQKENPKLTNVPSVLNGSPVTKDFRCNRVRLFVNVLDVVVQI  60

Query  247  PSIG  258
            P +G
Sbjct  61   PRVG  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 571442019030