BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c95136_g1_i1 len=476 path=[454:0-475]

Length=476
                                                                      Score     E

gb|AAK95644.1|AF404833_1  proteinase inhibitor                        86.7    6e-19   Ipomoea batatas [batate]
ref|XP_007221364.1|  hypothetical protein PRUPE_ppa018589mg           85.9    1e-18   
gb|AAK72904.1|AF330700_1  proteinase inhibitor SPLTI-a                85.5    2e-18   Ipomoea batatas [batate]
ref|XP_010243990.1|  PREDICTED: glu S.griseus protease inhibitor-...  85.5    2e-18   
ref|XP_010243880.1|  PREDICTED: inhibitor of trypsin and hageman ...  85.5    2e-18   
ref|XP_006411111.1|  hypothetical protein EUTSA_v10017502mg           85.1    2e-18   
ref|XP_006495465.1|  PREDICTED: inhibitor of trypsin and hageman ...  85.9    3e-18   
ref|XP_006442409.1|  hypothetical protein CICLE_v10022906mg           85.9    3e-18   
ref|XP_008391172.1|  PREDICTED: glu S.griseus protease inhibitor-...  84.0    6e-18   
ref|XP_003617314.1|  protease inhibitor                               84.0    6e-18   
gb|AFP43221.1|  proteinase inhibitor                                  83.6    8e-18   
ref|XP_006442402.1|  hypothetical protein CICLE_v10022909mg           84.3    1e-17   
ref|XP_009133305.1|  PREDICTED: protease inhibitor HPI-like           82.8    1e-17   
ref|XP_006606926.1|  PREDICTED: glu S.griseus protease inhibitor-...  82.4    2e-17   
ref|XP_007224255.1|  hypothetical protein PRUPE_ppa018391mg           82.4    2e-17   
ref|XP_003556368.1|  PREDICTED: glu S.griseus protease inhibitor      81.6    4e-17   
gb|AAK72906.1|  proteinase inhibitor SPLTI-2                          81.6    5e-17   Ipomoea batatas [batate]
ref|XP_007221365.1|  hypothetical protein PRUPE_ppa024500mg           81.6    5e-17   
ref|XP_004288451.1|  PREDICTED: inhibitor of trypsin and hageman ...  80.9    9e-17   
pdb|1MIT|A  Chain A, Recombinant Cucurbita Maxima Trypsin Inhibit...  80.1    2e-16   
sp|P19873.1|ITH5_CUCMA  RecName: Full=Inhibitor of trypsin and ha...  80.1    2e-16   Cucurbita maxima [Boston marrow]
pdb|1TIN|A  Chain A, Three-Dimensional Structure In Solution Of C...  80.1    2e-16   
gb|AAK72905.1|  proteinase inhibitor SPLTI-1                          80.1    2e-16   Ipomoea batatas [batate]
ref|XP_004288450.1|  PREDICTED: inhibitor of trypsin and hageman ...  79.7    3e-16   
emb|CDY39726.1|  BnaA04g11270D                                        79.0    4e-16   
emb|CDY14424.1|  BnaC03g21710D                                        79.0    5e-16   
ref|XP_010278088.1|  PREDICTED: inhibitor of trypsin and hageman ...  78.6    5e-16   
ref|XP_007227104.1|  hypothetical protein PRUPE_ppa025505mg           78.6    6e-16   
ref|XP_003590801.1|  Inhibitor of trypsin and hageman factor          78.6    6e-16   
ref|XP_004134089.1|  PREDICTED: inhibitor of trypsin and hageman ...  78.6    6e-16   
ref|XP_010094276.1|  Glu S.griseus protease inhibitor                 78.6    6e-16   
gb|ACU19481.1|  unknown                                               78.2    8e-16   Glycine max [soybeans]
ref|XP_003590799.1|  Protease inhibitor                               77.8    1e-15   
ref|XP_002314193.1|  hypothetical protein POPTR_0009s03360g           77.8    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_008391168.1|  PREDICTED: glu S.griseus protease inhibitor-...  77.8    1e-15   
sp|P24076.1|BGIA_MOMCH  RecName: Full=Glu S.griseus protease inhi...  77.8    1e-15   Momordica charantia [balsam pear]
ref|XP_008439364.1|  PREDICTED: inhibitor of trypsin and hageman ...  77.4    2e-15   
emb|CBI26384.3|  unnamed protein product                              78.6    2e-15   
ref|XP_002315724.2|  trypsin inhibitor family protein                 77.4    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_003590795.1|  Inhibitor of trypsin and hageman factor          77.4    2e-15   
ref|XP_002314645.1|  hypothetical protein POPTR_0010s08640g           76.3    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_008391173.1|  PREDICTED: glu S.griseus protease inhibitor-...  76.3    4e-15   
ref|XP_010679203.1|  PREDICTED: glu S.griseus protease inhibitor-...  76.3    4e-15   
ref|NP_001238694.1|  protease inhibitor-like                          76.3    5e-15   
ref|XP_009374774.1|  PREDICTED: glu S.griseus protease inhibitor-...  75.9    6e-15   
ref|XP_009782003.1|  PREDICTED: glu S.griseus protease inhibitor-...  75.5    9e-15   
ref|XP_004288449.1|  PREDICTED: glu S.griseus protease inhibitor-...  75.5    9e-15   
emb|CDO99178.1|  unnamed protein product                              75.5    1e-14   
ref|XP_002314644.1|  hypothetical protein POPTR_0010s08610g           75.1    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007144065.1|  hypothetical protein PHAVU_007G125500g           74.7    2e-14   
ref|XP_002284454.1|  PREDICTED: inhibitor of trypsin and hageman ...  74.7    2e-14   Vitis vinifera
ref|XP_008224407.1|  PREDICTED: inhibitor of trypsin and hageman ...  74.7    2e-14   
ref|XP_002881621.1|  hypothetical protein ARALYDRAFT_482903           74.7    2e-14   
ref|XP_008224409.1|  PREDICTED: glu S.griseus protease inhibitor-...  74.7    2e-14   
ref|XP_002521007.1|  Proteinase inhibitor, putative                   74.3    2e-14   Ricinus communis
gb|ADD51184.1|  protease inhibitor 1                                  74.3    2e-14   Vitis cinerea var. helleri x Vitis riparia
ref|XP_006295369.1|  hypothetical protein CARUB_v10024461mg           74.3    3e-14   
gb|AFT92003.1|  potato inhibitor I family protein                     74.3    3e-14   
ref|XP_003556369.1|  PREDICTED: inhibitor of trypsin and hageman ...  73.9    3e-14   
ref|XP_006420158.1|  hypothetical protein CICLE_v10007123mg           74.7    3e-14   
ref|NP_030435.1|  PR-6 proteinase inhibitor family protein            73.6    4e-14   Arabidopsis thaliana [mouse-ear cress]
pdb|1VBW|A  Chain A, Crystal Structure Of Bitter Gourd Trypsin In...  73.6    4e-14   
dbj|BAB32588.1|  inhibitor against trypsin                            73.6    5e-14   Momordica charantia [balsam pear]
ref|XP_006387620.1|  hypothetical protein POPTR_0770s00230g           73.6    5e-14   
gb|AAN85825.1|  protease inhibitor                                    73.6    5e-14   Vitis vinifera
ref|XP_011030541.1|  PREDICTED: glu S.griseus protease inhibitor      73.6    5e-14   
ref|XP_009603954.1|  PREDICTED: glu S.griseus protease inhibitor-...  73.2    6e-14   
ref|XP_004134091.1|  PREDICTED: inhibitor of trypsin and hageman ...  73.2    6e-14   
gb|KFK29320.1|  hypothetical protein AALP_AA7G118100                  73.2    6e-14   
ref|XP_006378352.1|  hypothetical protein POPTR_0010s08600g           73.2    7e-14   
ref|XP_006381983.1|  hypothetical protein POPTR_0006s22880g           72.8    8e-14   
ref|XP_002521006.1|  Proteinase inhibitor, putative                   72.4    1e-13   Ricinus communis
ref|XP_006378353.1|  hypothetical protein POPTR_0010s08630g           72.4    1e-13   
gb|KDO41812.1|  hypothetical protein CISIN_1g044806mg                 72.4    1e-13   
ref|XP_006387619.1|  hypothetical protein POPTR_0770s00220g           72.0    2e-13   
gb|AFT92004.1|  potato inhibitor I family protein                     72.0    2e-13   
ref|XP_003614151.1|  Trypsin inhibitor                                72.0    2e-13   
ref|XP_007201476.1|  hypothetical protein PRUPE_ppa014449mg           72.0    2e-13   
dbj|BAC10910.1|  protease inhibitor 2                                 72.0    2e-13   Zinnia violacea [garden zinnia]
ref|XP_006421631.1|  hypothetical protein CICLE_v10006306mg           72.4    2e-13   
ref|XP_006420961.1|  hypothetical protein CICLE_v10006680mg           71.6    2e-13   
ref|XP_006373842.1|  hypothetical protein POPTR_0016s07990g           71.6    2e-13   
gb|KFK36788.1|  hypothetical protein AALP_AA4G170800                  71.6    3e-13   
ref|XP_007226170.1|  hypothetical protein PRUPE_ppa015379mg           71.2    3e-13   
ref|XP_007050380.1|  Inhibitor of trypsin and hageman factor          71.2    3e-13   
gb|KDP36380.1|  hypothetical protein JCGZ_08649                       71.2    4e-13   
ref|XP_006489606.1|  PREDICTED: uncharacterized protein LOC102620214  73.6    4e-13   
ref|XP_002309424.2|  hypothetical protein POPTR_0006s22860g           71.2    4e-13   Populus trichocarpa [western balsam poplar]
gb|KDO49926.1|  hypothetical protein CISIN_1g035225mg                 70.5    5e-13   
gb|EYU32852.1|  hypothetical protein MIMGU_mgv1a019023mg              70.5    6e-13   
gb|AAZ08249.1|  proteinase inhibitor 1 PPI3A4                         71.2    6e-13   Solanum tuberosum [potatoes]
ref|XP_009396358.1|  PREDICTED: glu S.griseus protease inhibitor-...  70.5    6e-13   
ref|XP_008224480.1|  PREDICTED: FHA domain-containing protein At4...  74.3    9e-13   
gb|KFK36789.1|  hypothetical protein AALP_AA4G170900                  70.1    9e-13   
ref|XP_011004115.1|  PREDICTED: inhibitor of trypsin and hageman ...  71.6    9e-13   
gb|EYU32855.1|  hypothetical protein MIMGU_mgv1a021802mg              69.7    1e-12   
gb|KDP21344.1|  hypothetical protein JCGZ_21815                       69.7    1e-12   
ref|XP_010509102.1|  PREDICTED: protease inhibitor HPI                69.7    1e-12   
ref|XP_002323424.2|  hypothetical protein POPTR_0016s07980g           69.7    2e-12   Populus trichocarpa [western balsam poplar]
gb|EYU32854.1|  hypothetical protein MIMGU_mgv1a018761mg              69.3    2e-12   
gb|AIT42231.1|  proteinase inhibitor 1                                70.1    2e-12   
gb|AAC49603.1|  wound-inducible proteinase inhibitor I                70.1    2e-12   Solanum tuberosum [potatoes]
ref|XP_006421576.1|  hypothetical protein CICLE_v10006211mg           70.5    2e-12   
ref|XP_006421577.1|  hypothetical protein CICLE_v10006203mg           70.9    2e-12   
gb|AAN76363.1|  type I proteinase inhibitor-like protein              70.5    2e-12   Citrus x paradisi [grapefruit]
ref|XP_006490176.1|  PREDICTED: inhibitor of trypsin and hageman ...  70.5    2e-12   
emb|CBI26387.3|  unnamed protein product                              69.3    2e-12   
gb|EYU40892.1|  hypothetical protein MIMGU_mgv1a017848mg              68.9    2e-12   
ref|XP_006421578.1|  hypothetical protein CICLE_v10006212mg           70.5    2e-12   
ref|XP_006367782.1|  PREDICTED: serine protease inhibitor isoform X1  70.1    2e-12   
gb|EPS59152.1|  hypothetical protein M569_15657                       68.9    2e-12   
gb|AIT42233.1|  proteinase inhibitor 1                                69.7    2e-12   
dbj|BAC10909.1|  protease inhibitor 1                                 68.9    2e-12   Zinnia violacea [garden zinnia]
gb|KDO45261.1|  hypothetical protein CISIN_1g033055mg                 70.1    2e-12   
gb|KDP42134.1|  hypothetical protein JCGZ_03191                       68.9    2e-12   
ref|XP_004490203.1|  PREDICTED: glu S.griseus protease inhibitor-...  68.6    3e-12   
ref|XP_011004117.1|  PREDICTED: uncharacterized protein LOC105110701  73.6    3e-12   
ref|XP_010687945.1|  PREDICTED: glu S.griseus protease inhibitor-...  68.2    4e-12   
emb|CAN75275.1|  hypothetical protein VITISV_043736                   68.2    4e-12   Vitis vinifera
ref|XP_007009882.1|  Serine protease inhibitor                        68.2    4e-12   
ref|XP_010100072.1|  Proteinase inhibitor                             67.8    7e-12   
gb|KDP36376.1|  hypothetical protein JCGZ_08645                       67.4    7e-12   
ref|XP_004247658.1|  PREDICTED: wound-induced proteinase inhibitor 1  68.6    7e-12   
gb|ADB85100.1|  proteinase inhibitor                                  67.4    8e-12   
gb|EYU32851.1|  hypothetical protein MIMGU_mgv1a022632mg              67.4    9e-12   
ref|NP_001274835.1|  proteinase inhibitor 1 PPI3A2 precursor          68.2    9e-12   
gb|EYU32853.1|  hypothetical protein MIMGU_mgv1a024582mg              67.4    9e-12   
ref|XP_002517007.1|  Glu S.griseus protease inhibitor, putative       67.0    1e-11   Ricinus communis
gb|KDP35355.1|  hypothetical protein JCGZ_10339                       67.0    1e-11   
ref|XP_006420157.1|  hypothetical protein CICLE_v10007070mg           67.0    1e-11   
sp|P08454.2|ICID_SOLTU  RecName: Full=Wound-induced proteinase in...  67.8    1e-11   Solanum tuberosum [potatoes]
gb|KDP34823.1|  hypothetical protein JCGZ_11185                       67.0    1e-11   
ref|XP_007138379.1|  hypothetical protein PHAVU_009G203600g           66.6    1e-11   
prf||1314299A  proteinase inhibitor I                                 67.8    1e-11
ref|XP_008438570.1|  PREDICTED: glu S.griseus protease inhibitor-...  66.6    2e-11   
ref|XP_007009886.1|  Serine protease inhibitor                        66.6    2e-11   
ref|XP_007009890.1|  Serine protease inhibitor                        66.6    2e-11   
ref|XP_007009887.1|  Serine protease inhibitor, putative              66.6    2e-11   
gb|AAS46024.1|  serine protease inhibitor                             66.2    2e-11   Solanum tuberosum [potatoes]
emb|CAA87073.1|  pathogenesis-related protein PR-6 type               66.2    3e-11   Sambucus nigra
ref|XP_007009885.1|  Serine protease inhibitor                        66.2    3e-11   
ref|XP_007227504.1|  hypothetical protein PRUPE_ppa014371mg           66.2    3e-11   
ref|XP_006383697.1|  hypothetical protein POPTR_0005s24230g           66.2    3e-11   
ref|XP_010038018.1|  PREDICTED: proteinase inhibitor-like             66.2    3e-11   
gb|KDP21343.1|  hypothetical protein JCGZ_21814                       67.0    3e-11   
ref|XP_004134090.1|  PREDICTED: glu S.griseus protease inhibitor-...  65.9    3e-11   
ref|XP_007199579.1|  hypothetical protein PRUPE_ppb023174mg           67.0    3e-11   
ref|XP_002323423.1|  hypothetical protein POPTR_0016s07970g           65.9    3e-11   Populus trichocarpa [western balsam poplar]
gb|KDP42135.1|  hypothetical protein JCGZ_03192                       65.5    4e-11   
ref|XP_004288448.1|  PREDICTED: glu S.griseus protease inhibitor-...  66.2    5e-11   
gb|KDP36377.1|  hypothetical protein JCGZ_08646                       65.5    5e-11   
ref|XP_007009884.1|  Serine protease inhibitor                        65.5    5e-11   
gb|AIT42232.1|  proteinase inhibitor 1                                66.2    5e-11   
ref|XP_010100074.1|  Proteinase inhibitor                             64.7    8e-11   
gb|KDP35352.1|  hypothetical protein JCGZ_10336                       64.3    1e-10   
ref|XP_009396722.1|  PREDICTED: inhibitor of trypsin and hageman ...  64.3    1e-10   
gb|AAA33816.1|  proteinase inhibitor I                                64.7    1e-10   Solanum tuberosum [potatoes]
ref|XP_002879773.1|  predicted protein                                63.9    1e-10   
ref|XP_006367784.1|  PREDICTED: proteinase inhibitor 1 PPI2C1A        64.7    1e-10   
ref|XP_006377750.1|  hypothetical protein POPTR_0011s11170g           63.9    2e-10   
ref|XP_007224127.1|  hypothetical protein PRUPE_ppa015912mg           63.9    2e-10   
gb|AIT42237.1|  proteinase inhibitor 1                                64.7    2e-10   
ref|XP_003535093.2|  PREDICTED: glu S.griseus protease inhibitor-...  63.9    2e-10   
gb|EYU17889.1|  hypothetical protein MIMGU_mgv1a022666mg              63.5    2e-10   
ref|WP_017626123.1|  hypothetical protein                             64.7    2e-10   
emb|CAN75276.1|  hypothetical protein VITISV_043737                   63.5    2e-10   Vitis vinifera
ref|XP_004247695.1|  PREDICTED: proteinase inhibitor 1-like           64.3    2e-10   
sp|Q6XNP7.2|HPI_HEVBR  RecName: Full=Protease inhibitor HPI; AltN...  63.5    3e-10   Hevea brasiliensis [jebe]
sp|Q00783.1|ICI1_SOLTU  RecName: Full=Proteinase inhibitor 1; Alt...  64.3    3e-10   Solanum tuberosum [potatoes]
ref|XP_002317460.1|  hypothetical protein POPTR_0011s11140g           63.5    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_007009891.1|  Serine protease inhibitor                        63.2    3e-10   
ref|NP_001275446.1|  proteinase inhibitor I precursor                 64.3    3e-10   
ref|XP_010100075.1|  Proteinase inhibitor                             64.3    3e-10   
sp|P82381.1|ICI_LINUS  RecName: Full=Proteinase inhibitor; AltNam...  63.2    3e-10   Linum usitatissimum
pdb|1DWM|A  Chain A, Solution Structure Of Linum Usitatissinum Tr...  63.2    3e-10   
gb|KDO68501.1|  hypothetical protein CISIN_1g039274mg                 63.5    3e-10   
emb|CDY04060.1|  BnaC02g37750D                                        63.2    4e-10   
ref|XP_002521005.1|  Inhibitor of trypsin and hageman factor, put...  62.8    4e-10   Ricinus communis
gb|AAA72133.1|  proteinase inhibitor I                                63.5    4e-10   Solanum tuberosum [potatoes]
ref|XP_006443889.1|  hypothetical protein CICLE_v10023822mg           63.5    4e-10   
ref|WP_017542056.1|  hypothetical protein                             63.5    4e-10   
emb|CDX93297.1|  BnaC04g45990D                                        62.8    4e-10   
ref|WP_017556242.1|  hypothetical protein                             63.5    5e-10   
ref|XP_002983045.1|  hypothetical protein SELMODRAFT_117696           62.4    5e-10   
ref|NP_001274985.1|  proteinase inhibitor 1 PPI3B2 precursor          63.2    5e-10   
ref|XP_003542413.1|  PREDICTED: inhibitor of trypsin and hageman ...  62.4    6e-10   
gb|KDP36378.1|  hypothetical protein JCGZ_08647                       62.4    6e-10   
gb|AAA69780.1|  proteinase inhibitor I                                63.2    6e-10   Solanum tuberosum [potatoes]
gb|KDO37763.1|  hypothetical protein CISIN_1g040548mg                 62.4    6e-10   
sp|P01052.1|ICIA_SOLTU  RecName: Full=Chymotrypsin inhibitor I, A...  62.0    8e-10   Solanum tuberosum [potatoes]
gb|ABP01766.1|  proteinase inhibitor 1                                62.0    8e-10   Salvia miltiorrhiza [Chinese salvia]
gb|AAZ08246.1|  proteinase inhibitor 1 PPI2C1A                        62.8    8e-10   Solanum tuberosum [potatoes]
gb|KDP35354.1|  hypothetical protein JCGZ_10338                       62.0    8e-10   
gb|KDP42132.1|  hypothetical protein JCGZ_03189                       62.0    9e-10   
gb|AAP46156.1|  protease inhibitor protein 1                          62.0    9e-10   Hevea brasiliensis [jebe]
gb|KCW59399.1|  hypothetical protein EUGRSUZ_H02107                   62.0    9e-10   
ref|XP_002300791.1|  hypothetical protein POPTR_0002s04350g           61.6    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010932900.1|  PREDICTED: glu S.griseus protease inhibitor-...  61.6    1e-09   
dbj|BAA02823.1|  genetic tumor-related proteinase inhibitor I pre...  61.6    2e-09   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_008447238.1|  PREDICTED: glu S.griseus protease inhibitor-...  61.2    2e-09   
ref|WP_017593962.1|  hypothetical protein                             62.0    2e-09   
ref|XP_002965559.1|  hypothetical protein SELMODRAFT_84301            60.8    2e-09   
ref|XP_004247654.1|  PREDICTED: wound-induced proteinase inhibitor 1  61.6    2e-09   
sp|P16231.1|ICI1_SOLPE  RecName: Full=Wound-induced proteinase in...  61.6    2e-09   Solanum peruvianum [Peruvian tomato]
gb|KEH42587.1|  inhibitor of trypsin and hageman factor-like protein  60.8    2e-09   
gb|AAA34198.1|  proteinase inhibitor I                                61.6    2e-09   Solanum peruvianum [Peruvian tomato]
ref|XP_004247655.1|  PREDICTED: wound-induced proteinase inhibito...  61.6    2e-09   
ref|XP_006489607.1|  PREDICTED: inhibitor of trypsin and hageman ...  60.5    3e-09   
emb|CAA47907.1|  proteinase inhibitor I                               61.2    3e-09   Solanum tuberosum [potatoes]
gb|KDP35356.1|  hypothetical protein JCGZ_10340                       60.5    3e-09   
ref|XP_006295810.1|  hypothetical protein CARUB_v10024936mg           60.5    3e-09   
gb|EYU46483.1|  hypothetical protein MIMGU_mgv1a023325mg              60.1    3e-09   
gb|KFK29321.1|  hypothetical protein AALP_AA7G118200                  60.1    4e-09   
ref|XP_008391169.1|  PREDICTED: glu S.griseus protease inhibitor-...  60.1    4e-09   
ref|XP_006363695.1|  PREDICTED: trypsin inhibitor 1-like              59.7    7e-09   
ref|XP_010650045.1|  PREDICTED: uncharacterized protein LOC104879281  63.2    7e-09   
ref|XP_008224405.1|  PREDICTED: glu S.griseus protease inhibitor-...  59.3    7e-09   
ref|XP_006281379.1|  hypothetical protein CARUB_v10027439mg           59.7    8e-09   
ref|WP_017621294.1|  hypothetical protein                             59.7    1e-08   
ref|XP_009774947.1|  PREDICTED: trypsin inhibitor 1                   59.3    1e-08   
ref|XP_006363673.1|  PREDICTED: trypsin inhibitor 1-like              58.9    1e-08   
ref|XP_006363669.1|  PREDICTED: trypsin inhibitor 1-like              58.9    1e-08   
gb|AIT42235.1|  proteinase inhibitor 1                                58.9    2e-08   
ref|XP_004247656.1|  PREDICTED: wound-induced proteinase inhibitor 1  58.9    2e-08   
ref|XP_006420156.1|  hypothetical protein CICLE_v10007022mg           57.8    2e-08   
ref|XP_010094275.1|  Glu S.griseus protease inhibitor                 57.8    3e-08   
gb|KDP42136.1|  hypothetical protein JCGZ_03193                       59.3    3e-08   
ref|NP_001189707.1|  PR-6 proteinase inhibitor family protein         57.8    3e-08   
emb|CCW27997.1|  serine protease inhibitor                            57.4    4e-08   
ref|XP_006281404.1|  hypothetical protein CARUB_v10027471mg           57.4    4e-08   
gb|ABZ88804.1|  protease inhibitor protein                            57.0    4e-08   Hevea brasiliensis [jebe]
sp|P86971.1|ITI_FAGTA  RecName: Full=Trypsin inhibitor; Short=FtTI    57.4    4e-08   
ref|XP_007224909.1|  hypothetical protein PRUPE_ppa021973mg           57.0    5e-08   
gb|AGI36543.1|  trypsin inhibitor                                     57.4    5e-08   
ref|NP_001275282.1|  proteinase inhibitor 1 PPI2C1A precursor         57.4    5e-08   
gb|AID52862.1|  serine protease inhibitor                             57.0    5e-08   
ref|XP_004288453.1|  PREDICTED: inhibitor of trypsin and hageman ...  57.0    6e-08   
gb|KCW57407.1|  hypothetical protein EUGRSUZ_H00190                   56.6    6e-08   
ref|XP_006367783.1|  PREDICTED: proteinase inhibitor 1-like           57.0    7e-08   
gb|ABP01767.1|  ptoteinase inhibitor 2                                56.6    7e-08   Salvia miltiorrhiza [Chinese salvia]
gb|KGN44697.1|  hypothetical protein Csa_7G372910                     56.2    9e-08   
gb|KGN49621.1|  hypothetical protein Csa_5G027950                     56.2    9e-08   
emb|CDO99179.1|  unnamed protein product                              56.2    1e-07   
ref|XP_009047357.1|  hypothetical protein LOTGIDRAFT_230585           55.8    1e-07   
ref|NP_030438.1|  PR-6 proteinase inhibitor family protein            55.8    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004247660.1|  PREDICTED: wound-induced proteinase inhibitor 1  56.6    1e-07   
gb|ABB96723.1|  proteinase inhibitor BTIw1                            55.8    1e-07   Fagopyrum esculentum
gb|AAB35320.1|  BWI-1=protease inhibitor/trypsin inhibitor            55.8    1e-07   
ref|XP_008235797.1|  PREDICTED: proteinase inhibitor-like             56.6    1e-07   
ref|XP_006281417.1|  hypothetical protein CARUB_v10027484mg           55.8    1e-07   
pdb|3RDY|A  Chain A, Crystal Structure Of Buckwheat Trypsin Inhib...  55.8    1e-07   
sp|P80211.1|ATSI_AMACA  RecName: Full=Trypsin/subtilisin inhibito...  55.5    1e-07   Amaranthus caudatus [Inca-wheat]
pir||S27218  chymotrypsin inhibitor I chain D - potato                55.8    2e-07
ref|XP_004249682.1|  PREDICTED: trypsin inhibitor 1-like              55.8    2e-07   
emb|CAB61327.1|  trypsin inhibitor                                    55.5    2e-07   Amaranthus hypochondriacus [prince's feather]
ref|XP_002451431.1|  hypothetical protein SORBIDRAFT_04g001970        55.1    2e-07   Sorghum bicolor [broomcorn]
ref|XP_011081244.1|  PREDICTED: proteinase inhibitor-like             55.5    2e-07   
ref|XP_004249689.1|  PREDICTED: trypsin inhibitor 1-like              55.5    2e-07   
ref|XP_009129310.1|  PREDICTED: glu S.griseus protease inhibitor-...  54.7    2e-07   
dbj|BAA05472.1|  tumor-related protein                                54.7    3e-07   Nicotiana glauca x Nicotiana langsdorffii
gb|KGN56903.1|  hypothetical protein Csa_3G142950                     54.7    3e-07   
emb|CAZ96086.1|  putative proteinase inhibitor                        54.7    3e-07   
emb|CAZ96165.1|  putative proteinase inhibitor I13, potato inhibi...  54.7    3e-07   
gb|ADP05502.1|  serine proteinase inhibitor 1a                        54.3    3e-07   
gb|AAB29664.1|  ATI=trypsin inhibitor                                 54.3    4e-07   
ref|NP_001275201.1|  type I serine protease inhibitor precursor       55.1    4e-07   
ref|XP_006296188.1|  hypothetical protein CARUB_v10025358mg           54.7    4e-07   
emb|CAZ96083.1|  putative Subtilisin inhibitor 1 (Subtilisin inhi...  54.3    5e-07   
gb|AID52861.1|  serine protease inhibitor                             54.3    5e-07   
ref|XP_007148999.1|  hypothetical protein PHAVU_005G032000g           54.3    6e-07   
gb|AIT42234.1|  proteinase inhibitor 1                                54.7    7e-07   
ref|XP_009599918.1|  PREDICTED: trypsin inhibitor 1-like              53.9    7e-07   
ref|XP_009774949.1|  PREDICTED: trypsin inhibitor 1-like              53.9    9e-07   
ref|XP_010442010.1|  PREDICTED: inhibitor of trypsin and hageman ...  53.1    1e-06   
ref|XP_007029841.1|  Uncharacterized protein TCM_025717               54.3    1e-06   
ref|XP_004247659.1|  PREDICTED: wound-induced proteinase inhibito...  53.5    1e-06   
ref|XP_009028832.1|  hypothetical protein HELRODRAFT_69476            52.8    1e-06   
ref|XP_006363672.1|  PREDICTED: trypsin inhibitor 1-like              53.1    1e-06   
ref|XP_004134085.1|  PREDICTED: protease inhibitor HPI-like           52.8    2e-06   
gb|KCW62496.1|  hypothetical protein EUGRSUZ_H05137                   52.8    2e-06   
emb|CAZ96136.1|  putative proteinase inhibitor I13, potato inhibi...  52.8    2e-06   
gb|ABR17601.1|  unknown                                               52.8    2e-06   
gb|ADP05503.1|  serine proteinase inhibitor 1b                        52.4    2e-06   
ref|XP_002863647.1|  hypothetical protein ARALYDRAFT_331046           52.4    2e-06   
gb|KGN50840.1|  hypothetical protein Csa_5G286040                     52.4    2e-06   
ref|NP_199171.3|  unusual seine protease inhibitor                    52.8    2e-06   
gb|AAB46906.1|  BTI-2=trypsin inhibitor isoform                       52.0    2e-06   
gb|KCW62488.1|  hypothetical protein EUGRSUZ_H05126                   52.0    3e-06   
ref|XP_009590374.1|  PREDICTED: trypsin inhibitor 1                   52.4    3e-06   
ref|XP_006367785.1|  PREDICTED: wound-induced proteinase inhibito...  52.8    3e-06   
pir||S27217  chymotrypsin inhibitor I chain C - potato                52.0    3e-06
dbj|BAB11621.1|  unnamed protein product                              51.6    4e-06   
ref|XP_007199475.1|  hypothetical protein PRUPE_ppa027168mg           52.8    4e-06   
gb|EYU46484.1|  hypothetical protein MIMGU_mgv1a017534mg              51.6    4e-06   
ref|XP_004247696.2|  PREDICTED: wound-induced proteinase inhibito...  52.4    4e-06   
ref|XP_007029839.1|  Uncharacterized protein TCM_025715               52.8    4e-06   
ref|XP_006281360.1|  hypothetical protein CARUB_v10027416mg           52.0    5e-06   
ref|XP_003598789.1|  Subtilisin inhibitor                             51.6    5e-06   
ref|XP_010322583.1|  PREDICTED: subtilisin inhibitor-like             51.6    6e-06   
emb|CBI25417.3|  unnamed protein product                              51.2    6e-06   
ref|XP_008777397.1|  PREDICTED: glu S.griseus protease inhibitor-...  50.8    7e-06   
ref|XP_009140106.1|  PREDICTED: protease inhibitor HPI-like           50.8    7e-06   
ref|XP_009610134.1|  PREDICTED: proteinase inhibitor I-B              51.6    8e-06   
gb|KCW77294.1|  hypothetical protein EUGRSUZ_D01653                   50.8    9e-06   
gb|EWM21885.1|  subtilisin inhibitor                                  51.6    9e-06   
ref|XP_006281405.1|  hypothetical protein CARUB_v10027472mg           50.4    1e-05   
sp|Q03199.1|IPIB_TOBAC  RecName: Full=Proteinase inhibitor I-B; S...  50.8    1e-05   
ref|XP_006354745.1|  PREDICTED: subtilisin inhibitor 1-like           50.4    1e-05   
emb|CDX92245.1|  BnaA05g21620D                                        50.1    1e-05   
pdb|1HYM|A  Chain A, Hydrolyzed Trypsin Inhibitor (Cmti-V, Minimi...  49.7    1e-05   
ref|XP_006403222.1|  hypothetical protein EUTSA_v10003342mg           50.4    2e-05   
ref|XP_006403221.1|  hypothetical protein EUTSA_v10003305mg           49.7    2e-05   
ref|XP_009782399.1|  PREDICTED: proteinase inhibitor I-A              50.4    2e-05   
ref|XP_003598776.1|  Chymotrypsin inhibitor-2                         50.1    2e-05   
ref|NP_001275264.1|  proteinase inhibitor I precursor                 50.4    2e-05   
ref|NP_001066344.1|  Os12g0193100                                     49.7    2e-05   
ref|XP_004247657.1|  PREDICTED: wound-induced proteinase inhibito...  50.1    2e-05   
ref|XP_009129309.1|  PREDICTED: glu S.griseus protease inhibitor-...  49.3    2e-05   
ref|XP_004247694.1|  PREDICTED: proteinase inhibitor I-B-like         50.1    2e-05   
ref|XP_002865414.1|  hypothetical protein ARALYDRAFT_917289           49.7    2e-05   
gb|AAB46905.1|  BTI-1=7.634 kda trypsin inhibitor isoform             49.3    2e-05   
gb|EAZ00724.1|  hypothetical protein OsI_22749                        49.7    2e-05   
ref|XP_008438569.1|  PREDICTED: inhibitor of trypsin and hageman ...  49.3    2e-05   
ref|XP_005642821.1|  hypothetical protein COCSUDRAFT_60469            50.8    3e-05   
ref|XP_009337301.1|  PREDICTED: subtilisin-chymotrypsin inhibitor...  50.1    3e-05   
emb|CBK21898.2|  unnamed protein product                              49.7    3e-05   
gb|EAY82524.1|  hypothetical protein OsI_37748                        49.3    3e-05   
ref|XP_003564129.1|  PREDICTED: chymotrypsin inhibitor-like           48.9    3e-05   
gb|EWM21884.1|  subtilisin inhibitor                                  50.1    4e-05   
gb|ABK22457.1|  unknown                                               49.3    4e-05   
ref|XP_006656935.1|  PREDICTED: uncharacterized protein LOC102704899  50.4    4e-05   
gb|KCW54181.1|  hypothetical protein EUGRSUZ_I00166                   48.5    4e-05   
ref|NP_001234615.1|  ethylene-responsive proteinase inhibitor 1 p...  49.3    4e-05   
gb|KCW54182.1|  hypothetical protein EUGRSUZ_I00167                   48.5    4e-05   
ref|XP_010442009.1|  PREDICTED: proteinase inhibitor-like             48.5    4e-05   
ref|XP_009776471.1|  PREDICTED: proteinase inhibitor I-B-like         49.7    4e-05   
ref|XP_009349774.1|  PREDICTED: proteinase inhibitor I-B-like         49.7    5e-05   
ref|XP_009605664.1|  PREDICTED: proteinase inhibitor I-B-like iso...  49.7    5e-05   
ref|XP_004952054.1|  PREDICTED: subtilisin inhibitor 1-like           48.5    5e-05   
ref|XP_009605665.1|  PREDICTED: proteinase inhibitor I-B-like iso...  49.3    5e-05   
gb|ABP52092.1|  proteinase inhibitor                                  48.1    5e-05   
ref|XP_009763818.1|  PREDICTED: trypsin/subtilisin inhibitor-like     48.9    5e-05   
gb|EMT11499.1|  Subtilisin-chymotrypsin inhibitor-2A                  48.5    5e-05   
emb|CAZ96049.1|  putative proteinase inhibitor I13, potato inhibi...  48.5    5e-05   
ref|XP_010528560.1|  PREDICTED: inhibitor of trypsin and hageman ...  48.5    5e-05   
gb|ACN40009.1|  unknown                                               48.5    6e-05   
emb|CDP04703.1|  unnamed protein product                              48.5    7e-05   
ref|XP_008391174.1|  PREDICTED: inhibitor of trypsin and hageman ...  48.1    7e-05   
ref|XP_001424380.1|  hypothetical protein                             47.8    8e-05   
ref|XP_004247692.1|  PREDICTED: proteinase inhibitor I-B-like iso...  48.5    9e-05   
ref|XP_008235571.1|  PREDICTED: uncharacterized protein LOC103334391  48.9    9e-05   
gb|ELU11714.1|  hypothetical protein CAPTEDRAFT_21329                 47.4    1e-04   
emb|CAZ96216.1|  putative Protease inhibitor HPI                      47.8    1e-04   
ref|XP_006663898.1|  PREDICTED: subtilisin inhibitor 1-like           47.8    1e-04   
ref|XP_010236700.1|  PREDICTED: glu S.griseus protease inhibitor-...  47.8    1e-04   
ref|XP_006358889.1|  PREDICTED: ethylene-responsive proteinase in...  48.1    1e-04   
gb|ABK28590.1|  unknown                                               47.4    2e-04   
dbj|BAD09914.1|  hypothetical protein                                 47.0    2e-04   
gb|EPS63527.1|  hypothetical protein M569_11259                       47.0    2e-04   
sp|P16064.1|ICI1_PHAAN  RecName: Full=Subtilisin inhibitor 1; Alt...  47.4    2e-04   
ref|NP_190270.1|  PR-6 proteinase inhibitor family protein            47.0    2e-04   
ref|XP_009605666.1|  PREDICTED: proteinase inhibitor I-B-like iso...  47.8    2e-04   
ref|XP_006381211.1|  hypothetical protein POPTR_0006s08950g           47.0    2e-04   
gb|KCW80912.1|  hypothetical protein EUGRSUZ_C02276                   46.6    2e-04   
ref|XP_006404448.1|  hypothetical protein EUTSA_v10011055mg           46.6    3e-04   
ref|XP_006299344.1|  hypothetical protein CARUB_v10015502mg           46.6    3e-04   
gb|KFK31710.1|  hypothetical protein AALP_AA6G149000                  46.2    3e-04   
ref|NP_199170.2|  PR-6 proteinase inhibitor family protein            46.6    3e-04   
ref|XP_010481850.1|  PREDICTED: LOW QUALITY PROTEIN: proteinase i...  46.6    3e-04   
ref|XP_006358886.1|  PREDICTED: ethylene-responsive proteinase in...  47.0    3e-04   
ref|XP_006381208.1|  hypothetical protein POPTR_0006s08920g           46.6    3e-04   
gb|KGN50838.1|  hypothetical protein Csa_5G285030                     46.2    3e-04   
ref|XP_010229493.1|  PREDICTED: subtilisin inhibitor CLSI-I-like      47.0    4e-04   
ref|XP_006354531.1|  PREDICTED: proteinase inhibitor I-B-like         47.0    4e-04   
ref|XP_006381202.1|  hypothetical protein POPTR_0006s08880g           46.6    4e-04   
gb|KCW85032.1|  hypothetical protein EUGRSUZ_B01872                   46.2    4e-04   
ref|XP_006354530.1|  PREDICTED: proteinase inhibitor I-B-like         46.6    4e-04   
ref|XP_008454787.1|  PREDICTED: inhibitor of trypsin and hageman ...  45.8    4e-04   
ref|XP_002532999.1|  subtilisin inhibitor 1, putative                 46.2    4e-04   
ref|XP_006403223.1|  hypothetical protein EUTSA_v10003303mg           45.8    4e-04   
ref|XP_002451430.1|  hypothetical protein SORBIDRAFT_04g001965        45.4    5e-04   
dbj|BAB11620.1|  unnamed protein product                              45.8    5e-04   
dbj|BAD44165.1|  unknown protein                                      45.8    6e-04   
ref|XP_002442971.1|  hypothetical protein SORBIDRAFT_08g005570        45.4    6e-04   
gb|EMS51622.1|  Inhibitor of trypsin and hageman factor               45.8    6e-04   
gb|AFX66991.1|  proteinase inhibitor I                                46.2    7e-04   
ref|XP_009630660.1|  PREDICTED: trypsin/subtilisin inhibitor-like     45.8    7e-04   
ref|XP_004962602.1|  PREDICTED: subtilisin-chymotrypsin inhibitor...  45.4    7e-04   
gb|EYU25612.1|  hypothetical protein MIMGU_mgv1a021253mg              45.4    7e-04   
ref|NP_001177000.1|  Os12g0548450                                     45.4    7e-04   
ref|XP_004134087.1|  PREDICTED: inhibitor of trypsin and hageman ...  45.1    8e-04   
ref|XP_009779697.1|  PREDICTED: proteinase inhibitor I-B-like         46.2    8e-04   
gb|KCW71069.1|  hypothetical protein EUGRSUZ_F04168                   45.4    0.001   



>gb|AAK95644.1|AF404833_1 proteinase inhibitor [Ipomoea batatas]
Length=70

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M  I +GKSSWPELVGVD F+AK+T+E ENS +  V +F+ CP T ++  DRVR+ VDC+
Sbjct  1    MQRITDGKSSWPELVGVDAFLAKSTIEKENSDLYVVFLFQGCPETREYIFDRVRLIVDCS  60

Query  224  NLVIAPPTIG  195
            N+VI  P+IG
Sbjct  61   NVVIRTPSIG  70



>ref|XP_007221364.1| hypothetical protein PRUPE_ppa018589mg [Prunus persica]
 gb|EMJ22563.1| hypothetical protein PRUPE_ppa018589mg [Prunus persica]
Length=70

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GKS WPEL+G  G VA+AT+E +NS V A +V +  PVT DFRCDRVR+ VD +
Sbjct  1    MSSECQGKSRWPELLGAQGTVAEATIERQNSSVDAQIVLEGTPVTRDFRCDRVRVWVDTD  60

Query  224  NLVIAPPTIG  195
             +VI  P+IG
Sbjct  61   GIVIRVPSIG  70



>gb|AAK72904.1|AF330700_1 proteinase inhibitor SPLTI-a [Ipomoea batatas]
Length=70

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M  I +GK+SWPELVGVD F+AK+T+E ENS +  V +F+ CP T ++  DRVR+ VDC+
Sbjct  1    MQRITDGKTSWPELVGVDAFLAKSTIEKENSDLYVVFLFQGCPETREYIFDRVRLIVDCS  60

Query  224  NLVIAPPTIG  195
            N+VI  P+IG
Sbjct  61   NVVIRTPSIG  70



>ref|XP_010243990.1| PREDICTED: glu S.griseus protease inhibitor-like [Nelumbo nucifera]
Length=70

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK+SWPELVG +G VAKAT+E EN  VTAVV+ +   VTADF C RVR+ VDCN
Sbjct  1    MSSECYGKNSWPELVGCEGKVAKATIEQENPAVTAVVLLEGSIVTADFLCTRVRVWVDCN  60

Query  224  NLVIAPPTIG  195
              V   PTIG
Sbjct  61   GTVTKVPTIG  70



>ref|XP_010243880.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Nelumbo 
nucifera]
Length=70

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS IC+GKSSW ELVG +G VAKAT+E EN  V+A+VV +   V  DFRC RV + VD N
Sbjct  1    MSSICSGKSSWAELVGAEGEVAKATIEQENPAVSAIVVLQGTNVHEDFRCSRVWVWVDAN  60

Query  224  NLVIAPPTIG  195
              VI+ PTIG
Sbjct  61   GTVISVPTIG  70



>ref|XP_006411111.1| hypothetical protein EUTSA_v10017502mg [Eutrema salsugineum]
 gb|ESQ52564.1| hypothetical protein EUTSA_v10017502mg [Eutrema salsugineum]
Length=70

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C+GK++WPELVG +G  A + +E EN+ V AVV+    PVTADFRCDRVR+ VD N
Sbjct  1    MSSECHGKNAWPELVGTNGEYAASVIEKENTSVDAVVILDGIPVTADFRCDRVRVRVDRN  60

Query  224  NLVIAPPTIG  195
             +V+  PTIG
Sbjct  61   GIVVKVPTIG  70



>ref|XP_006495465.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Citrus 
sinensis]
Length=119

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 59/91 (65%), Gaps = 4/91 (4%)
 Frame = -1

Query  467  HTRRKQTLLSDP*PSPNTKLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVF  288
            H+  ++ L++    + N  +   F CNGKSSWPELVGV+G +A AT++ EN  V A+++ 
Sbjct  33   HSDGQELLMA----TSNCDIVTQFECNGKSSWPELVGVNGEIAAATIQKENPNVHAIIIL  88

Query  287  KKCPVTADFRCDRVRIGVDCNNLVIAPPTIG  195
            +  PVT DFRCDRVR+ VD    V+  P IG
Sbjct  89   EGTPVTQDFRCDRVRVVVDKYEKVVQVPRIG  119



>ref|XP_006442409.1| hypothetical protein CICLE_v10022906mg [Citrus clementina]
 gb|ESR55649.1| hypothetical protein CICLE_v10022906mg [Citrus clementina]
Length=119

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 4/91 (4%)
 Frame = -1

Query  467  HTRRKQTLLSDP*PSPNTKLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVF  288
            H+  +Q L +    + N  +   F CNGKSSWPELVGV+G +A AT++ EN  V A+++ 
Sbjct  33   HSDGQQLLTA----TSNCDIVTQFECNGKSSWPELVGVNGEIAAATIQKENPNVHAIIIL  88

Query  287  KKCPVTADFRCDRVRIGVDCNNLVIAPPTIG  195
            +  PVT DFRCDRVR+ VD    V+  P IG
Sbjct  89   EGTPVTQDFRCDRVRVVVDKYEKVVQVPRIG  119



>ref|XP_008391172.1| PREDICTED: glu S.griseus protease inhibitor-like [Malus domestica]
Length=70

 Score = 84.0 bits (206),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK+SWPEL+G  G VA+AT+E EN LV AV+V +   VT DFRCDRVR+ VD +
Sbjct  1    MSSECEGKASWPELLGTQGTVAEATIERENPLVDAVIVLQGTIVTDDFRCDRVRVWVDTD  60

Query  224  NLVIAPPTIG  195
             +V+  P IG
Sbjct  61   GIVVDVPAIG  70



>ref|XP_003617314.1| protease inhibitor [Medicago truncatula]
 gb|AET00273.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
 gb|KEH28391.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=70

 Score = 84.0 bits (206),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK+SWPELVGV+G VA+AT++SEN LV A++V +   VTADFRCDRVR+ VD +
Sbjct  1    MSDECKGKNSWPELVGVEGKVAEATIQSENPLVNAIIVPEGSFVTADFRCDRVRVWVDKD  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVYQVPIIG  70



>gb|AFP43221.1| proteinase inhibitor [Gossypium arboreum]
 gb|AFP43222.1| proteinase inhibitor [Gossypium arboreum]
 gb|KHG01984.1| Inhibitor of trypsin and hageman factor [Gossypium arboreum]
Length=69

 Score = 83.6 bits (205),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK+SWPELVG DG  AK T+E ENS V A+V+    PVT DFRCDRV + VD N  V+
Sbjct  4    CPGKNSWPELVGKDGEGAKTTIERENSNVDAIVLLDGTPVTRDFRCDRVWVWVDSNGHVV  63

Query  212  APPTIG  195
             PPTIG
Sbjct  64   RPPTIG  69



>ref|XP_006442402.1| hypothetical protein CICLE_v10022909mg [Citrus clementina]
 gb|ESR55642.1| hypothetical protein CICLE_v10022909mg [Citrus clementina]
Length=119

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  398  FICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNL  219
            F CNGKSSWPELVGV+G +A AT++ EN  V A+++ K  PVT DFRCDRVR+ VD    
Sbjct  52   FECNGKSSWPELVGVNGEIAAATIQIENPNVHAIIILKGTPVTPDFRCDRVRVVVDKYEK  111

Query  218  VIAPPTIG  195
            V+  P IG
Sbjct  112  VVQVPRIG  119



>ref|XP_009133305.1| PREDICTED: protease inhibitor HPI-like [Brassica rapa]
Length=70

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS+ C GK+SWPELVG +G  A   +E EN+ V A+V+    PVTADFRCDRVR+ VD N
Sbjct  1    MSYECRGKNSWPELVGTNGDYAALVIERENTRVDAIVILDGTPVTADFRCDRVRVRVDKN  60

Query  224  NLVIAPPTIG  195
             +V+  P  G
Sbjct  61   RIVVKVPIAG  70



>ref|XP_006606926.1| PREDICTED: glu S.griseus protease inhibitor-like [Glycine max]
 gb|KHN13145.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=69

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK SWPELVGV G VA+AT+E ENSLV A+VV +   VTADFRCDRV + V+ N  V 
Sbjct  4    CKGKRSWPELVGVKGTVAEATIERENSLVNAIVVPQGSGVTADFRCDRVWVWVNENGFVF  63

Query  212  APPTIG  195
              PTIG
Sbjct  64   QVPTIG  69



>ref|XP_007224255.1| hypothetical protein PRUPE_ppa018391mg [Prunus persica]
 gb|EMJ25454.1| hypothetical protein PRUPE_ppa018391mg [Prunus persica]
Length=70

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK +WPEL+G  G VA+AT+E ENSLV A +V +   VTADFRCDRVR+ V+ +
Sbjct  1    MSTECQGKDTWPELLGSQGTVAEATIERENSLVDAQIVLEGSIVTADFRCDRVRVWVNTD  60

Query  224  NLVIAPPTIG  195
             +V   P+IG
Sbjct  61   GIVTRVPSIG  70



>ref|XP_003556368.1| PREDICTED: glu S.griseus protease inhibitor [Glycine max]
 gb|ACU16268.1| unknown [Glycine max]
 gb|KHN13146.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=70

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GKSSWPELVGV+G VA AT+E EN LV A  V K   VTADFRCDRVR+ V  +
Sbjct  1    MASECKGKSSWPELVGVEGTVAVATIERENPLVDANTVLKGSIVTADFRCDRVRVWVTKH  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVYQAPRIG  70



>gb|AAK72906.1| proteinase inhibitor SPLTI-2 [Ipomoea batatas]
Length=70

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M  I +G SSWPELVGVD F+AK+T+E ENS +  V +F+ CP T ++  +RVR+ VDC+
Sbjct  1    MQRITDGTSSWPELVGVDAFLAKSTIEKENSDLYVVFLFQGCPETREYVFNRVRLIVDCS  60

Query  224  NLVIAPPTIG  195
            N+VI  P IG
Sbjct  61   NVVIRTPVIG  70



>ref|XP_007221365.1| hypothetical protein PRUPE_ppa024500mg [Prunus persica]
 gb|EMJ22564.1| hypothetical protein PRUPE_ppa024500mg [Prunus persica]
Length=70

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK +WPEL+G  G VA+AT+E ENSLV A +V +   VTADFRCDRVR+ V+ +
Sbjct  1    MSSECQGKDTWPELLGSQGTVAEATIERENSLVDAQIVLEGTIVTADFRCDRVRVWVNTD  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVTRVPRIG  70



>ref|XP_004288451.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Fragaria 
vesca subsp. vesca]
Length=70

 Score = 80.9 bits (198),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK SWPEL+G  G VAKAT+ESEN+ V AV+V +   VT DFR DRVR+ V+  
Sbjct  1    MSDQCEGKDSWPELLGAQGTVAKATIESENASVKAVIVLEGTSVTDDFRLDRVRVWVNTE  60

Query  224  NLVIAPPTIG  195
             +V + P IG
Sbjct  61   GIVTSVPKIG  70



>pdb|1MIT|A Chain A, Recombinant Cucurbita Maxima Trypsin Inhibitor V (Rcmti-V) 
(Nmr, Minimized Average Structure)
Length=69

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWP LVGV G VAKA +E +N  V AV++ +  PVT DFRC+RVRI V+   LV+
Sbjct  4    CPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVV  63

Query  212  APPTIG  195
            +PP IG
Sbjct  64   SPPRIG  69



>sp|P19873.1|ITH5_CUCMA RecName: Full=Inhibitor of trypsin and hageman factor; AltName: 
Full=CMTI-V [Cucurbita maxima]
 prf||1701295A trypsin inhibitor
Length=68

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWP LVGV G VAKA +E +N  V AV++ +  PVT DFRC+RVRI V+   LV+
Sbjct  3    CPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVV  62

Query  212  APPTIG  195
            +PP IG
Sbjct  63   SPPRIG  68



>pdb|1TIN|A Chain A, Three-Dimensional Structure In Solution Of Cucurbita 
Maxima Trypsin Inhibitor-V Determined By Nmr Spectroscopy
Length=69

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWP LVGV G VAKA +E +N  V AV++ +  PVT DFRC+RVRI V+   LV+
Sbjct  4    CPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVV  63

Query  212  APPTIG  195
            +PP IG
Sbjct  64   SPPRIG  69



>gb|AAK72905.1| proteinase inhibitor SPLTI-1 [Ipomoea batatas]
Length=71

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICNGK-SSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDC  228
            M  I +GK SSWPELVGVD F+AK+T+E ENS +  V +F+ CP + ++  DRVR+ VDC
Sbjct  1    MQRITDGKTSSWPELVGVDAFLAKSTIEKENSDLFVVFLFQGCPESREYIFDRVRLIVDC  60

Query  227  NNLVIAPPTIG  195
            +N+VI  P+IG
Sbjct  61   SNVVIRTPSIG  71



>ref|XP_004288450.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Fragaria 
vesca subsp. vesca]
Length=70

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GK SWPEL+G +G VAK  +ESEN+ VTAV+V +  PVT DFR DRVR+ V+ + +VI+ 
Sbjct  7    GKESWPELLGAEGTVAKEIIESENASVTAVIVLEGTPVTRDFRLDRVRVWVNTDGIVISI  66

Query  206  PTIG  195
            P IG
Sbjct  67   PKIG  70



>emb|CDY39726.1| BnaA04g11270D [Brassica napus]
Length=72

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCD--RVRIGVD  231
            MS  C GK+SWPELVG +G  A + +E +NS V AVV+    PVTADFRCD  RVR+ VD
Sbjct  1    MSSECPGKTSWPELVGTNGDYAASVIERQNSRVNAVVILDGSPVTADFRCDRNRVRVWVD  60

Query  230  CNNLVIAPPTIG  195
             N +V+  PT G
Sbjct  61   TNRIVVRVPTTG  72



>emb|CDY14424.1| BnaC03g21710D [Brassica napus]
Length=70

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK+SWPELVG +G  A + +E EN+ V A+V+    PVT DFRC+RVR+ VD N
Sbjct  1    MSSDCPGKNSWPELVGTNGDYAASVIERENTRVDAIVILDGTPVTTDFRCNRVRVRVDGN  60

Query  224  NLVIAPPTIG  195
             +V+  PT G
Sbjct  61   RIVVRVPTAG  70



>ref|XP_010278088.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Nelumbo 
nucifera]
Length=70

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C+GKSSWPELVG +G VAKAT+E EN  VTA++V +  PV  +F C RV + VD N
Sbjct  1    MSSECSGKSSWPELVGAEGEVAKATIEQENPAVTAIIVLEGTPVILNFDCTRVWVWVDTN  60

Query  224  NLVIAPPTIG  195
              V   P IG
Sbjct  61   GTVTKVPKIG  70



>ref|XP_007227104.1| hypothetical protein PRUPE_ppa025505mg [Prunus persica]
 gb|EMJ28303.1| hypothetical protein PRUPE_ppa025505mg [Prunus persica]
Length=70

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK SWPELVG +G  A AT+ESEN LV AV+V +   VTADFRCDRVR+ V+  
Sbjct  1    MSSECEGKDSWPELVGDEGKDAAATIESENHLVNAVIVKEGTFVTADFRCDRVRVWVNKR  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVTKVPIIG  70



>ref|XP_003590801.1| Inhibitor of trypsin and hageman factor [Medicago truncatula]
 gb|AES61052.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=72

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPELVGV+G VA+AT+E EN LV A++V +   V  DFRCDRV + VD + +V 
Sbjct  7    CKGKSSWPELVGVEGKVAEATIERENPLVNAIIVPEGSAVILDFRCDRVWVWVDKDGIVF  66

Query  212  APPTIG  195
              PTIG
Sbjct  67   KVPTIG  72



>ref|XP_004134089.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
sativus]
 ref|XP_004165330.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
sativus]
Length=69

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK SWP+LVGV G VAKA +E EN  V AVV+    PVT DFRC+RVR+ V  N LV 
Sbjct  4    CKGKRSWPQLVGVGGSVAKAIIERENPNVRAVVLEVGTPVTKDFRCNRVRVWVKKNGLVA  63

Query  212  APPTIG  195
            +PP +G
Sbjct  64   SPPMVG  69



>ref|XP_010094276.1| Glu S.griseus protease inhibitor [Morus notabilis]
 ref|XP_010094277.1| Glu S.griseus protease inhibitor [Morus notabilis]
 gb|EXB55550.1| Glu S.griseus protease inhibitor [Morus notabilis]
 gb|EXB55551.1| Glu S.griseus protease inhibitor [Morus notabilis]
Length=70

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C+GK+SWPELVGV G VA+  +E EN  V A++V +   VTAD+RCDRVR+ V+ +
Sbjct  1    MSTECSGKNSWPELVGVQGEVAEKIIEKENPAVDAIIVTEGSVVTADYRCDRVRVWVNNH  60

Query  224  NLVIAPPTIG  195
             +V   PTIG
Sbjct  61   GIVYKVPTIG  70



>gb|ACU19481.1| unknown [Glycine max]
 gb|KHN01083.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=70

 Score = 78.2 bits (191),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GKSSWPELVGV+G VA AT+E EN LV A  V K   VT DFRCDRV + V  +
Sbjct  1    MSSECKGKSSWPELVGVEGTVAVATIERENPLVDANTVLKGTIVTPDFRCDRVWVWVTKD  60

Query  224  NLVIAPPTIG  195
             +V   PTIG
Sbjct  61   GIVYQVPTIG  70



>ref|XP_003590799.1| Protease inhibitor [Medicago truncatula]
 gb|AES61050.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=71

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPELVGV+G VA+AT++ EN+ V A++V +   VT D R DRVR+ VD   +V 
Sbjct  6    CKGKSSWPELVGVEGKVAEATIQRENASVKAIIVLEGSSVTDDLRFDRVRVWVDKEGIVT  65

Query  212  APPTIG  195
              PTIG
Sbjct  66   QVPTIG  71



>ref|XP_002314193.1| hypothetical protein POPTR_0009s03360g [Populus trichocarpa]
 gb|EEE88148.1| hypothetical protein POPTR_0009s03360g [Populus trichocarpa]
Length=70

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+ IC GKSSWPEL+GVDG  A  T+E ENSLV A++V +   +  DFRCDRV + VD +
Sbjct  1    MASICQGKSSWPELLGVDGKCAVETIERENSLVEAIIVPEGSSIIEDFRCDRVWVWVDKD  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVYLVPAIG  70



>ref|XP_008391168.1| PREDICTED: glu S.griseus protease inhibitor-like [Malus domestica]
Length=70

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK+SWPELVG  G  A+A +ESEN LV AV+V K   VT D+RCDRV + VD N
Sbjct  1    MSSECEGKNSWPELVGAKGKDAEAIIESENRLVNAVIVKKGSFVTMDYRCDRVWVWVDKN  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVTQIPXIG  70



>sp|P24076.1|BGIA_MOMCH RecName: Full=Glu S.griseus protease inhibitor; AltName: Full=BGIA 
[Momordica charantia]
 gb|AAB19651.1| BGIA=acidic amino acid-specific endopeptidase inhibitor [Momordica 
charantia L.=bitter gourd, Peptide, 68 aa]
Length=68

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK SWP+LVG  G  AKA +E EN  V AV+V    PVTADFRCDRVR+ V    +V 
Sbjct  3    CQGKRSWPQLVGSTGAAAKAVIERENPRVRAVIVRVGSPVTADFRCDRVRVWVTERGIVA  62

Query  212  APPTIG  195
             PP IG
Sbjct  63   RPPAIG  68



>ref|XP_008439364.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
melo]
Length=69

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  383  KSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAPP  204
            K SWP+LVGV G VAKA +E EN  V AVV+    PVT DFRC+RVR+ V+ N LV +PP
Sbjct  7    KRSWPQLVGVGGSVAKAIIERENPNVRAVVLEVGTPVTKDFRCNRVRVWVNKNGLVASPP  66

Query  203  TIG  195
            TIG
Sbjct  67   TIG  69



>emb|CBI26384.3| unnamed protein product [Vitis vinifera]
Length=119

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -1

Query  419  NTKLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVR  243
             T+ RM+  C GKSSWPELVGV G VA  T++ EN  +T V ++ +   VT DF C RVR
Sbjct  44   QTRKRMASECEGKSSWPELVGVQGEVAAETIKRENPHITTVDILLEGTIVTQDFYCTRVR  103

Query  242  IGVDCNNLVIAPPTIG  195
            + VD N +VI+ PTIG
Sbjct  104  VWVDENGIVISVPTIG  119



>ref|XP_002315724.2| trypsin inhibitor family protein [Populus trichocarpa]
 ref|XP_006387617.1| hypothetical protein POPTR_0770s00200g [Populus trichocarpa]
 gb|ERP46531.1| hypothetical protein POPTR_0770s00200g [Populus trichocarpa]
 gb|EEF01895.2| trypsin inhibitor family protein [Populus trichocarpa]
Length=72

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPEL+G +G VA AT+E EN LV A++V     V+ DFRCDRV + VD   +VI
Sbjct  7    CQGKSSWPELLGAEGKVAAATIERENPLVEAIIVLDGSEVSLDFRCDRVWVWVDERGIVI  66

Query  212  APPTIG  195
              P IG
Sbjct  67   EVPRIG  72



>ref|XP_003590795.1| Inhibitor of trypsin and hageman factor [Medicago truncatula]
 gb|AES61046.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
 gb|AFK42591.1| unknown [Medicago truncatula]
 gb|KEH42752.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=70

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GKSSWPELVGV+G VA+AT++ EN LV A++V +   V  DFRCDRV + ++ +
Sbjct  1    MSDECQGKSSWPELVGVEGKVAEATIQRENPLVDAIIVPEGSSVPFDFRCDRVWVWINKD  60

Query  224  NLVIAPPTIG  195
             +V   PTIG
Sbjct  61   EIVYQVPTIG  70



>ref|XP_002314645.1| hypothetical protein POPTR_0010s08640g [Populus trichocarpa]
 gb|EEF00816.1| hypothetical protein POPTR_0010s08640g [Populus trichocarpa]
Length=71

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN  222
            S  C GKSSWPEL+GV+G VA AT+E EN LV A +V +   V  +FRCDRV + VD NN
Sbjct  3    STYCEGKSSWPELLGVEGKVAAATIERENPLVRAKMVPEGSAVIHNFRCDRVWVWVDKNN  62

Query  221  LVIAPPTIG  195
            +V   P IG
Sbjct  63   IVYTVPVIG  71



>ref|XP_008391173.1| PREDICTED: glu S.griseus protease inhibitor-like [Malus domestica]
Length=70

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK SWPELVG  G  A AT+ES N LV AV+V ++  VTA+FRCD+VR+ V+ +
Sbjct  1    MSSECEGKDSWPELVGAKGAEAAATIESNNHLVNAVIVKZRMFVTANFRCDKVRVWVNKH  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVTRVPVIG  70



>ref|XP_010679203.1| PREDICTED: glu S.griseus protease inhibitor-like [Beta vulgaris 
subsp. vulgaris]
Length=69

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK++WPELVG  G  A   +E EN  V A+V+    PVT DFRCDRVR+ VDC ++V+
Sbjct  4    CQGKNTWPELVGEKGQKAAEIIEKENPNVKAIVILDGTPVTLDFRCDRVRVFVDCKDIVV  63

Query  212  APPTIG  195
              P IG
Sbjct  64   RAPIIG  69



>ref|NP_001238694.1| protease inhibitor-like [Glycine max]
 gb|ACA23204.1| putative protease inhibitor [Glycine max]
 gb|KHN01082.1| Inhibitor of trypsin and hageman factor [Glycine soja]
Length=70

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GKSSWPELVGV G VA+AT+E EN LV A++V +   V  DFRCDRV + +D +
Sbjct  1    MSDDCKGKSSWPELVGVQGTVAEATIERENPLVDAIIVPEGNMVITDFRCDRVWVWIDKD  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVKEVPHIG  70



>ref|XP_009374774.1| PREDICTED: glu S.griseus protease inhibitor-like [Pyrus x bretschneideri]
Length=70

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK SWPELVG  G  AKA +ESEN LV  V+V +   VT D+RCDRVR+ VD +
Sbjct  1    MSSECEGKDSWPELVGAKGKDAKAIIESENRLVHVVIVKEGLFVTMDYRCDRVRVWVDKH  60

Query  224  NLVIAPPTIG  195
            ++V   P  G
Sbjct  61   DIVTKIPQSG  70



>ref|XP_009782003.1| PREDICTED: glu S.griseus protease inhibitor-like [Nicotiana sylvestris]
Length=68

 Score = 75.5 bits (184),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK +WPELVG +G  AK T+E EN LVTA V     P T DFRCDRVR+ VD +N V+
Sbjct  3    CPGKDAWPELVGENGQTAKETIERENPLVTANVALVGSPGTTDFRCDRVRVFVDRDNSVV  62

Query  212  APPTIG  195
              P IG
Sbjct  63   QVPVIG  68



>ref|XP_004288449.1| PREDICTED: glu S.griseus protease inhibitor-like [Fragaria vesca 
subsp. vesca]
Length=72

 Score = 75.5 bits (184),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -1

Query  404  MSFICN--GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVD  231
            MS  C   GKSSWPEL+G  G  AKAT+ESENS VTAV+V +   VT D RCDRVR+ VD
Sbjct  1    MSDQCQSEGKSSWPELLGAQGTDAKATIESENSSVTAVIVQEGSIVTQDIRCDRVRVWVD  60

Query  230  CNNLVIAPPTI  198
               +V   P I
Sbjct  61   SYGIVTRVPII  71



>emb|CDO99178.1| unnamed protein product [Coffea canephora]
Length=83

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GKSSWPEL+GVDG  AKA +E EN LVTA++V +   V  DFRCDRV + V+ NN+V   
Sbjct  20   GKSSWPELLGVDGDYAKAVIEKENPLVTAMIVPEGSSVILDFRCDRVWVWVNKNNIVTEV  79

Query  206  PTIG  195
            P IG
Sbjct  80   PHIG  83



>ref|XP_002314644.1| hypothetical protein POPTR_0010s08610g [Populus trichocarpa]
 ref|XP_006387618.1| hypothetical protein POPTR_0770s00210g [Populus trichocarpa]
 gb|EEF00815.1| hypothetical protein POPTR_0010s08610g [Populus trichocarpa]
 gb|ERP46532.1| hypothetical protein POPTR_0770s00210g [Populus trichocarpa]
Length=70

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+ IC GKSSWPEL+GVDG  A AT+E EN LV A++V +   +  +FRCDRV + VD +
Sbjct  1    MASICQGKSSWPELLGVDGKCAVATIERENPLVEAIIVPEGSSIIENFRCDRVWVWVDKD  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVYIVPVIG  70



>ref|XP_007144065.1| hypothetical protein PHAVU_007G125500g [Phaseolus vulgaris]
 gb|ESW16059.1| hypothetical protein PHAVU_007G125500g [Phaseolus vulgaris]
Length=70

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GKSSWPELVGV+G VA+AT+E EN LV A +V +   V  DFRCDRV + ++ +
Sbjct  1    MSEDCKGKSSWPELVGVEGKVAEATIERENPLVNAQIVAEGSSVPFDFRCDRVWVWINKD  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVKQVPHIG  70



>ref|XP_002284454.1| PREDICTED: inhibitor of trypsin and hageman factor [Vitis vinifera]
 emb|CBI26386.3| unnamed protein product [Vitis vinifera]
Length=71

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDC  228
            M+  C GKSSWPELVGV G VA  T++ EN  +T V +V +   VT DF C RVR+ VD 
Sbjct  1    MASECEGKSSWPELVGVQGEVAAETIKRENPHITTVDIVLEGTSVTKDFYCTRVRVWVDE  60

Query  227  NNLVIAPPTIG  195
            N +VI+ PTIG
Sbjct  61   NGIVISVPTIG  71



>ref|XP_008224407.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Prunus 
mume]
Length=72

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFK--KCPVTADFRCDRVRIGVD  231
            M+  C GK SWPELVG +G VAKAT+E EN LVTA+++ +    P+T D R DRVRI V+
Sbjct  1    MASGCKGKDSWPELVGAEGKVAKATIERENPLVTALILHQGPMTPMTQDLRFDRVRIWVN  60

Query  230  CNNLVIAPPTI  198
             N +V   P I
Sbjct  61   TNGIVTWIPVI  71



>ref|XP_002881621.1| hypothetical protein ARALYDRAFT_482903 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57880.1| hypothetical protein ARALYDRAFT_482903 [Arabidopsis lyrata subsp. 
lyrata]
Length=70

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C  K+SWPEL G +G  A   +E EN  V AVV+    PVTADFRCDRVR+ VD +
Sbjct  1    MSSECPRKNSWPELRGTNGDYAATVIERENPTVDAVVILDGSPVTADFRCDRVRVFVDRH  60

Query  224  NLVIAPPTIG  195
             +V+  PT G
Sbjct  61   RIVVKTPTSG  70



>ref|XP_008224409.1| PREDICTED: glu S.griseus protease inhibitor-like [Prunus mume]
Length=70

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK+ WPEL+G  G VA+A +E EN  V A +V +   VTADFRCDRVR+ VD  
Sbjct  1    MSSECRGKNRWPELLGAQGTVAEAKIERENPSVDAQIVPEGSVVTADFRCDRVRVWVDTE  60

Query  224  NLVIAPPTIG  195
             +V   P+IG
Sbjct  61   GIVTRVPSIG  70



>ref|XP_002521007.1| Proteinase inhibitor, putative [Ricinus communis]
 gb|EEF41424.1| Proteinase inhibitor, putative [Ricinus communis]
Length=70

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS +C GK SWPELVG  G  A ATVE EN  V A+V+ +  PVT DFRC+RV + VD N
Sbjct  1    MSNVCLGKDSWPELVGAKGDDAAATVEKENKHVHAIVLKEGTPVTRDFRCNRVWVWVDEN  60

Query  224  NLVIAPPTIG  195
             +V   P  G
Sbjct  61   GVVTRAPKTG  70



>gb|ADD51184.1| protease inhibitor 1 [Vitis cinerea var. helleri x Vitis riparia]
Length=71

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDC  228
            M+  C GKSSWPELVGV G VA  T++ EN  +T V +V +   VT DF C RVR+ VD 
Sbjct  1    MASECEGKSSWPELVGVQGEVAAETIKRENPHITTVDIVLEGTIVTQDFYCTRVRVWVDE  60

Query  227  NNLVIAPPTIG  195
            N +VI+ PTIG
Sbjct  61   NGIVISVPTIG  71



>ref|XP_006295369.1| hypothetical protein CARUB_v10024461mg [Capsella rubella]
 gb|EOA28267.1| hypothetical protein CARUB_v10024461mg [Capsella rubella]
Length=71

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICN-GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDC  228
            MSF C  GK+SWPELV  +G  A + +E EN+ V AVV+    PVTAD RCDRVR+ VD 
Sbjct  1    MSFGCTAGKNSWPELVRTNGDYAASVIERENTSVDAVVILDGSPVTADIRCDRVRVFVDR  60

Query  227  NNLVIAPPTIG  195
            N +V+  P  G
Sbjct  61   NRIVVRTPVTG  71



>gb|AFT92003.1| potato inhibitor I family protein [Populus tomentosa]
 gb|AFT92015.1| potato inhibitor I family protein [Populus tomentosa]
Length=72

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPEL+G +G VA AT+E EN LV A +V +   V  DFRCDRV + VD   +VI
Sbjct  7    CQGKSSWPELLGAEGKVAAATIERENPLVDAKIVLEGSVVPLDFRCDRVWVWVDKRGIVI  66

Query  212  APPTIG  195
              P IG
Sbjct  67   QVPRIG  72



>ref|XP_003556369.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Glycine 
max]
 gb|KHN13147.1| Proteinase inhibitor [Glycine soja]
Length=70

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GKSSWPELVGV G VA+AT+E EN LV A++V +   V  D+RCDRV + ++ +
Sbjct  1    MSDDCKGKSSWPELVGVQGTVAEATIERENPLVNAIIVPEGNRVITDYRCDRVWVWINKD  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVKEVPHIG  70



>ref|XP_006420158.1| hypothetical protein CICLE_v10007123mg [Citrus clementina]
 gb|ESR33398.1| hypothetical protein CICLE_v10007123mg [Citrus clementina]
Length=94

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGV  234
            K  M+  C GKSSWPEL+G  G  A ATVE EN LV A +V +   VTADF C RVR+ V
Sbjct  22   KEEMASECRGKSSWPELLGAQGVEAAATVERENPLVNAQIVLEGSFVTADFLCTRVRVWV  81

Query  233  DCNNLVIAPPTIG  195
            +    V   PTIG
Sbjct  82   NTRGTVTRVPTIG  94



>ref|NP_030435.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
 gb|AAC79626.2| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAM61318.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAO41943.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAO50715.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AEC09597.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
Length=70

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C  K+SWPEL G +G  A   +E EN  V A V+    PVTADFRCDRVR+ VD N
Sbjct  1    MSTECPRKNSWPELTGTNGDYAAVVIERENPTVNAAVILDGSPVTADFRCDRVRVFVDGN  60

Query  224  NLVIAPPTIG  195
             +V+  P  G
Sbjct  61   RIVVKTPKSG  70



>pdb|1VBW|A Chain A, Crystal Structure Of Bitter Gourd Trypsin Inhibitor
 prf||2111250B trypsin inhibitor BGIT
Length=68

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWP+LVG  G  AKA +E EN  V AV++      T DFRCDRVR+ V    +V 
Sbjct  3    CQGKSSWPQLVGSTGAAAKAVIERENPRVRAVIIKVGSGATKDFRCDRVRVWVTERGIVA  62

Query  212  APPTIG  195
             PPTIG
Sbjct  63   RPPTIG  68



>dbj|BAB32588.1| inhibitor against trypsin [Momordica charantia]
Length=66

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWP+LVG  G  AKA +E EN  V AV++      T DFRCDRVR+ V    +V 
Sbjct  1    CQGKSSWPQLVGSTGAAAKAVIERENPRVRAVIIKVGSGATKDFRCDRVRVWVTERGIVA  60

Query  212  APPTIG  195
             PPTIG
Sbjct  61   RPPTIG  66



>ref|XP_006387620.1| hypothetical protein POPTR_0770s00230g [Populus trichocarpa]
 gb|ERP46534.1| hypothetical protein POPTR_0770s00230g [Populus trichocarpa]
Length=70

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+ IC GKSSWPEL+GVDG  A  T+E EN LV A++V +   +  +FRCDRV + VD +
Sbjct  1    MASICQGKSSWPELLGVDGKCAVTTIERENPLVEAIIVPEGSSIIENFRCDRVWVWVDKD  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVYIVPVIG  70



>gb|AAN85825.1| protease inhibitor [Vitis vinifera]
 emb|CAN62712.1| hypothetical protein VITISV_025108 [Vitis vinifera]
Length=71

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDC  228
            M+  C GKSSWPELVGV G VA  T++ EN  +T V ++ +   VT DF C RVR+ VD 
Sbjct  1    MASECEGKSSWPELVGVQGEVAAETIKRENPHITTVDILLEGTIVTQDFYCTRVRVWVDE  60

Query  227  NNLVIAPPTIG  195
            N +VI+ PTIG
Sbjct  61   NGIVISVPTIG  71



>ref|XP_011030541.1| PREDICTED: glu S.griseus protease inhibitor [Populus euphratica]
Length=72

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPEL+G +G VA AT+E EN LV A +V +   V  DFRCDRV + VD   +V+
Sbjct  7    CQGKSSWPELLGAEGKVAAATIERENPLVDAKIVLEGSVVPLDFRCDRVWVWVDKRGIVV  66

Query  212  APPTIG  195
              P IG
Sbjct  67   QVPRIG  72



>ref|XP_009603954.1| PREDICTED: glu S.griseus protease inhibitor-like [Nicotiana tomentosiformis]
Length=68

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -1

Query  398  FICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNL  219
              C GKSSWPELVG +G  AK T+E EN LVTA V       T DFRCDRVR+ VD +N 
Sbjct  1    MACQGKSSWPELVGENGQTAKETIERENPLVTANVAPVGSSGTTDFRCDRVRVFVDRDNN  60

Query  218  VIAPPTIG  195
            V   P IG
Sbjct  61   VAQVPVIG  68



>ref|XP_004134091.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
sativus]
 gb|KGN56905.1| hypothetical protein Csa_3G142970 [Cucumis sativus]
Length=71

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GKSSWPELVGV G +A+  +E EN  V A++V +   VT DFRCDRV + VD +
Sbjct  1    MSIDCKGKSSWPELVGVSGNIAEKIIEKENCYVNAIIVEQGKFVTQDFRCDRVWVWVDKH  60

Query  224  -NLVIAPPTIG  195
             ++VI  P IG
Sbjct  61   THIVIKTPIIG  71



>gb|KFK29320.1| hypothetical protein AALP_AA7G118100 [Arabis alpina]
Length=72

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -1

Query  404  MSFIC--NGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVD  231
            MS  C   GK+SWPELV  +G  A + +ESENS V AVV+     VTAD RCDRVR+ VD
Sbjct  1    MSSECPGTGKNSWPELVETNGDYAASVIESENSKVDAVVILVGSMVTADIRCDRVRVWVD  60

Query  230  CNNLVIAPPTIG  195
             N +V+  PTIG
Sbjct  61   KNRIVVKIPTIG  72



>ref|XP_006378352.1| hypothetical protein POPTR_0010s08600g [Populus trichocarpa]
 gb|ERP56149.1| hypothetical protein POPTR_0010s08600g [Populus trichocarpa]
Length=72

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPEL+G +G VA AT+E EN LV A++V +   V  DFRCDRV + VD   +V 
Sbjct  7    CQGKSSWPELLGAEGKVAAATIERENPLVEAIIVPEGSMVILDFRCDRVWVWVDKRGIVF  66

Query  212  APPTIG  195
              P IG
Sbjct  67   QVPGIG  72



>ref|XP_006381983.1| hypothetical protein POPTR_0006s22880g [Populus trichocarpa]
 gb|ERP59780.1| hypothetical protein POPTR_0006s22880g [Populus trichocarpa]
Length=70

 Score = 72.8 bits (177),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GKSSWPEL+G    VA AT+E+EN  V   VV +  PVT +F C RVR+ +D N
Sbjct  1    MASECQGKSSWPELLGAQARVAVATIETENPYVDTQVVLEGTPVTGEFSCTRVRVWIDRN  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   RIVTRVPVIG  70



>ref|XP_002521006.1| Proteinase inhibitor, putative [Ricinus communis]
 gb|EEF41423.1| Proteinase inhibitor, putative [Ricinus communis]
Length=69

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK+SWPELVG +G  A A +E EN  V A+V+ +  PVT DFRC RV + VD N +V 
Sbjct  4    CLGKNSWPELVGANGDEAAAAIEKENKYVDAIVLKEGTPVTKDFRCSRVWVWVDENGVVT  63

Query  212  APPTIG  195
              PTIG
Sbjct  64   RTPTIG  69



>ref|XP_006378353.1| hypothetical protein POPTR_0010s08630g [Populus trichocarpa]
 gb|ERP56150.1| hypothetical protein POPTR_0010s08630g [Populus trichocarpa]
Length=70

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+ IC GKSSWPEL+GVDG  A  T+E EN LV A++V +   V  +F+CDRV + VD +
Sbjct  1    MASICQGKSSWPELLGVDGKCAVTTIERENPLVEAIIVPEGSSVIMNFQCDRVWVWVDKD  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVYIVPVIG  70



>gb|KDO41812.1| hypothetical protein CISIN_1g044806mg [Citrus sinensis]
Length=70

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M F C GKSSWPELVGV+G VA  T+E EN +V+A ++ +   V  D  C RV + VD N
Sbjct  1    MDFECKGKSSWPELVGVEGKVAAETIERENPIVSAHILLEGSIVFLDRYCRRVYVWVDTN  60

Query  224  NLVIAPPTIG  195
             +V+  PTIG
Sbjct  61   GIVVDVPTIG  70



>ref|XP_006387619.1| hypothetical protein POPTR_0770s00220g [Populus trichocarpa]
 gb|ERP46533.1| hypothetical protein POPTR_0770s00220g [Populus trichocarpa]
Length=72

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPEL+G +G VA AT+E EN LV A +V +   V  DFRCDRV + VD   +VI
Sbjct  7    CQGKSSWPELLGAEGKVAAATIERENPLVDAKIVPEGSIVPLDFRCDRVWVWVDKRGIVI  66

Query  212  APPTIG  195
              P IG
Sbjct  67   QVPRIG  72



>gb|AFT92004.1| potato inhibitor I family protein [Populus alba x Populus glandulosa]
 gb|AFT92016.1| potato inhibitor I family protein [Populus alba x Populus glandulosa]
Length=72

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPEL+G +G VA AT+E EN LV A +V +   V  DFRCDRV + VD   +VI
Sbjct  7    CQGKSSWPELLGAEGKVAAATIERENPLVDAKIVPEGSVVPLDFRCDRVWVWVDKRGIVI  66

Query  212  APPTIG  195
              P IG
Sbjct  67   QVPRIG  72



>ref|XP_003614151.1| Trypsin inhibitor [Medicago truncatula]
 gb|AES97109.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=69

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK +WPELVGV+G  A   + SENSLVTA  + +    TADFRCDRVR+ VD  ++V 
Sbjct  4    CKGKKTWPELVGVNGEAAAQIIMSENSLVTASTLPEDSVFTADFRCDRVRVFVDKQDVVT  63

Query  212  APPTIG  195
              P IG
Sbjct  64   RVPKIG  69



>ref|XP_007201476.1| hypothetical protein PRUPE_ppa014449mg [Prunus persica]
 gb|EMJ02675.1| hypothetical protein PRUPE_ppa014449mg [Prunus persica]
Length=69

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -1

Query  398  FICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNL  219
              C GK +WPE+VG  G  A A +E EN  V A+V+ +  P T D RCDRVR+ ++ N +
Sbjct  2    LHCPGKQAWPEVVGHSGQDAAAKIERENHNVRAIVILEGSPATKDLRCDRVRVWINRNGV  61

Query  218  VIAPPTIG  195
            V+ PP +G
Sbjct  62   VVRPPHVG  69



>dbj|BAC10910.1| protease inhibitor 2 [Zinnia elegans]
Length=67

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPELVG  G  A+ T+E EN LV A+V+     VT DFRCDRV + V+   +VI
Sbjct  2    CKGKSSWPELVGEKGEAARLTIEKENPLVNAIVLLDGTGVTKDFRCDRVWVWVNSKGIVI  61

Query  212  APPTI  198
              P I
Sbjct  62   RTPII  66



>ref|XP_006421631.1| hypothetical protein CICLE_v10006306mg [Citrus clementina]
 gb|ESR34871.1| hypothetical protein CICLE_v10006306mg [Citrus clementina]
Length=97

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C+GK+SWPELVG  G VA AT++ +N +V  +++    PVT DFRCDRV + VD  
Sbjct  28   MATFCSGKTSWPELVGEIGAVAAATIKLQNPIVNPIILMLGTPVTRDFRCDRVWVWVDAI  87

Query  224  NLVIAPPTIG  195
              V  PP +G
Sbjct  88   GRVSKPPVVG  97



>ref|XP_006420961.1| hypothetical protein CICLE_v10006680mg [Citrus clementina]
 gb|ESR34201.1| hypothetical protein CICLE_v10006680mg [Citrus clementina]
 gb|KDO41811.1| hypothetical protein CISIN_1g035202mg [Citrus sinensis]
Length=70

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GKSSWPEL+G  G  A ATVES+N LV A +V +   VT DF C RVR+ V+  
Sbjct  1    MASECRGKSSWPELLGAQGVEAAATVESDNPLVNAQIVLEGSFVTGDFLCTRVRVWVNTR  60

Query  224  NLVIAPPTIG  195
              V   PTIG
Sbjct  61   GTVTRVPTIG  70



>ref|XP_006373842.1| hypothetical protein POPTR_0016s07990g [Populus trichocarpa]
 gb|ERP51639.1| hypothetical protein POPTR_0016s07990g [Populus trichocarpa]
Length=70

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GKSSWPEL+G    VA  T+E++N  V   VV +  PVT DF C RVR+ +D N
Sbjct  1    MASDCQGKSSWPELLGAQARVAVVTIETQNPYVDTQVVLEGTPVTKDFSCSRVRVWIDQN  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   RIVTRVPVIG  70



>gb|KFK36788.1| hypothetical protein AALP_AA4G170800 [Arabis alpina]
Length=70

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK+SWPELVG +G  A + +E ENS V A+V+    PV  DFRCDRV + V+ N
Sbjct  1    MSSECPGKNSWPELVGTNGDYAASVIERENSKVNAIVILDGTPVITDFRCDRVWVRVNRN  60

Query  224  NLVIAPPTIG  195
              V+  P  G
Sbjct  61   RTVVKVPKAG  70



>ref|XP_007226170.1| hypothetical protein PRUPE_ppa015379mg [Prunus persica]
 gb|EMJ27369.1| hypothetical protein PRUPE_ppa015379mg [Prunus persica]
Length=68

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  383  KSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAPP  204
            K SWPELVG +G VAKAT+E EN LVTA+++    P+T D R DRVR+ V+ N +V   P
Sbjct  6    KDSWPELVGAEGKVAKATIERENPLVTALILHLGAPITQDLRFDRVRVWVNTNGIVTWIP  65

Query  203  TI  198
             I
Sbjct  66   VI  67



>ref|XP_007050380.1| Inhibitor of trypsin and hageman factor [Theobroma cacao]
 gb|EOX94537.1| Inhibitor of trypsin and hageman factor [Theobroma cacao]
Length=69

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C+GKSSWPELVGV+G  A A +  EN  V AV+V +   VT DFRCDRVR+ VD   +V 
Sbjct  4    CSGKSSWPELVGVNGEAAAAIIVKENPKVGAVIVKEGMMVTMDFRCDRVRVWVDKYGIVK  63

Query  212  APPTIG  195
              P IG
Sbjct  64   RKPQIG  69



>gb|KDP36380.1| hypothetical protein JCGZ_08649 [Jatropha curcas]
Length=71

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = -1

Query  404  MSFICN-GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDC  228
            M+ IC  GKSSWPEL+G +G  A A +E ENS V A+V+ +  PVTADFRCDRVR+ V+ 
Sbjct  1    MADICPPGKSSWPELLGANGKAAAALIEKENSNVNAIVLKEGTPVTADFRCDRVRVWVNE  60

Query  227  NNLVIAPPTI  198
              +V+  P I
Sbjct  61   CGVVVQVPII  70



>ref|XP_006489606.1| PREDICTED: uncharacterized protein LOC102620214 [Citrus sinensis]
Length=196

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M F C GKSSW ELVGV+G VA  T+E EN +V+A ++ +   V  D  C RV +GVD N
Sbjct  1    MDFECKGKSSWSELVGVEGKVAAETIERENPIVSAHILLEGSNVFLDKYCGRVYVGVDTN  60

Query  224  NLVIAPPTIG  195
            ++V+  PTIG
Sbjct  61   SIVVEVPTIG  70


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GKSSWPEL+G  G  A ATVE EN LV A +V +   VTADF C RVR+ V+    V   
Sbjct  70   GKSSWPELLGAQGVEAAATVERENPLVNAQIVLEGSFVTADFLCTRVRVWVNTRGTVTRV  129

Query  206  PTIG  195
            PTIG
Sbjct  130  PTIG  133


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GK+SWPEL+G  G VA A +E +N  V+A +V +   VT +F C RVR+ V+ + +V   
Sbjct  133  GKNSWPELLGAKGDVAAAKIEKQNRYVSAQIVLEGTFVTLEFSCSRVRVWVNTSGIVTRA  192

Query  206  PTIG  195
            P IG
Sbjct  193  PAIG  196



>ref|XP_002309424.2| hypothetical protein POPTR_0006s22860g [Populus trichocarpa]
 gb|EEE92947.2| hypothetical protein POPTR_0006s22860g [Populus trichocarpa]
Length=70

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GKSSWPEL+G    VA AT+E+EN  V   VV +   VT +F C RVR+ +D N
Sbjct  1    MSSECQGKSSWPELLGAQASVAVATIETENPYVDTQVVLEGTIVTGEFSCTRVRVWIDSN  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   RIVTRVPMIG  70



>gb|KDO49926.1| hypothetical protein CISIN_1g035225mg [Citrus sinensis]
Length=70

 Score = 70.5 bits (171),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C+GK+SWPELVG  G VA AT++ +N +V  +++    PVT +FRCDRV + VD  
Sbjct  1    MATFCSGKTSWPELVGEIGAVAAATIKLQNPIVNPIILMLGTPVTREFRCDRVWVWVDAI  60

Query  224  NLVIAPPTIG  195
              V  PP +G
Sbjct  61   GRVSKPPVVG  70



>gb|EYU32852.1| hypothetical protein MIMGU_mgv1a019023mg [Erythranthe guttata]
Length=70

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK SWPELVGV G  A AT+E EN LV A++V     V  DFRCDRV + V+ N
Sbjct  1    MSTECRGKRSWPELVGVPGNAAAATIERENRLVNAIIVPPGNSVITDFRCDRVWVFVNGN  60

Query  224  NLVIAPPTIG  195
              V   P+IG
Sbjct  61   GNVTRVPSIG  70



>gb|AAZ08249.1| proteinase inhibitor 1 PPI3A4 [Solanum tuberosum]
 gb|AIT42230.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIG  237
            +L   F CNGK  WPEL+GV    AK  +E EN+L+  V ++    PVTADF C+RVRI 
Sbjct  34   ELLKEFECNGKQRWPELIGVPAQYAKGIIEKENTLIADVQIILNGSPVTADFSCNRVRIA  93

Query  236  VDCNNLVIAPPTIG  195
            V+  +  ++ P +G
Sbjct  94   VNILDYAVSMPVVG  107



>ref|XP_009396358.1| PREDICTED: glu S.griseus protease inhibitor-like [Musa acuminata 
subsp. malaccensis]
Length=69

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPELVGV G  A  T+ESEN  V AV+V     VT DF CDRVR+ VD   +V 
Sbjct  4    CTGKSSWPELVGVKGETAVTTIESENPTVKAVIVEVGTIVTGDFLCDRVRVWVDKAGIVA  63

Query  212  APPTIG  195
              P IG
Sbjct  64   EIPRIG  69



>ref|XP_008224480.1| PREDICTED: FHA domain-containing protein At4g14490-like [Prunus 
mume]
Length=359

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK SWPELVG  G  A AT+ESEN L+TAV+V +   VTADFRCDRVR+ V+  
Sbjct  1    MSSECEGKDSWPELVGDKGKDAAATIESENHLLTAVIVKEGTFVTADFRCDRVRVWVNKR  60

Query  224  NLV  216
             +V
Sbjct  61   GIV  63



>gb|KFK36789.1| hypothetical protein AALP_AA4G170900 [Arabis alpina]
Length=70

 Score = 70.1 bits (170),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C  K++WPEL G +G  A + +E EN+ V AVV+ +  PVT DFRCDRVR+ V+  
Sbjct  1    MSSTCPPKNAWPELRGTNGDFAVSVIERENTRVDAVVILEGSPVTTDFRCDRVRVFVNRY  60

Query  224  NLVIAPPTIG  195
             +V+  PT G
Sbjct  61   RIVVGVPTTG  70



>ref|XP_011004115.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Populus 
euphratica]
Length=135

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 51/94 (54%), Gaps = 11/94 (12%)
 Frame = -1

Query  473  QSHTRRKQTLLSDP*PSPNTKLR-MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV  297
            Q H R K+            K+R ++  C GKSSWPEL+G    VA  T+E++N  V   
Sbjct  52   QQHQRSKR----------GKKIRDIASDCQGKSSWPELLGAQARVAVVTIETQNPYVDTQ  101

Query  296  VVFKKCPVTADFRCDRVRIGVDCNNLVIAPPTIG  195
            VV +  PVT DF C RVR+ +D N +V   P IG
Sbjct  102  VVLEGTPVTKDFSCSRVRVWIDQNRIVTRVPVIG  135



>gb|EYU32855.1| hypothetical protein MIMGU_mgv1a021802mg [Erythranthe guttata]
Length=70

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK SWPELVGV G VA AT+E EN LV AV+V     V  DFRCDRV + VD N
Sbjct  1    MSDECKGKESWPELVGVPGNVAVATIERENPLVNAVIVPPGNSVITDFRCDRVWVFVDDN  60

Query  224  NLVIAPPTIG  195
              V   P IG
Sbjct  61   GNVKDVPFIG  70



>gb|KDP21344.1| hypothetical protein JCGZ_21815 [Jatropha curcas]
Length=70

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GKSSWPEL+G +G  A AT+E EN  V A++V +   V  DFRCDRV + V+ N
Sbjct  1    MASECEGKSSWPELLGANGKAAAATIEKENGNVDAILVKEGSSVILDFRCDRVWVWVNEN  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GVVTRVPIIG  70



>ref|XP_010509102.1| PREDICTED: protease inhibitor HPI [Camelina sativa]
Length=74

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GK+SWPEL+G +G  A + ++ ENS +  +V+    PVTAD RCDRVR+ VD + +V+  
Sbjct  11   GKNSWPELLGTNGDYAASVIKGENSSLKVIVILVGSPVTADLRCDRVRVRVDKSRIVVKT  70

Query  206  PTIG  195
            PT G
Sbjct  71   PTAG  74



>ref|XP_002323424.2| hypothetical protein POPTR_0016s07980g, partial [Populus trichocarpa]
 gb|EEF05185.2| hypothetical protein POPTR_0016s07980g, partial [Populus trichocarpa]
Length=83

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -1

Query  413  KLR-MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIG  237
            K+R M+  C GKSSWPEL+G    VA  T+E++N  V   VV +  PVT DF C RVR+ 
Sbjct  10   KIRDMASDCQGKSSWPELLGAQARVAVVTIETQNPYVDTQVVLEGTPVTKDFSCSRVRVW  69

Query  236  VDCNNLVIAPPTIG  195
            +D N +V   P  G
Sbjct  70   IDQNRIVTRVPVSG  83



>gb|EYU32854.1| hypothetical protein MIMGU_mgv1a018761mg [Erythranthe guttata]
Length=70

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK SWPELVGV G VA AT+E EN LV A+++  +     DFRCDRV + VD N
Sbjct  1    MSDECKGKESWPELVGVPGNVAVATIERENPLVNAIILQPRTFPILDFRCDRVWVYVDGN  60

Query  224  NLVIAPPTIG  195
              V   P IG
Sbjct  61   GNVRRVPMIG  70



>gb|AIT42231.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIG  237
            +L   F CNGK  WPEL+GV    AK  +E EN+L+  V ++    PVTADF C+RVRI 
Sbjct  34   ELLKEFECNGKLRWPELIGVPAQYAKGIIEKENTLIADVQIILNGSPVTADFSCNRVRIA  93

Query  236  VDCNNLVIAPPTIG  195
            V+  +  ++ P +G
Sbjct  94   VNILDYAVSMPVVG  107



>gb|AAC49603.1| wound-inducible proteinase inhibitor I, partial [Solanum tuberosum]
Length=101

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRI  240
            +L+  F CNGK SWPEL+GV    AK  +E ENSL+T V ++    PVT D+RC+RVR+
Sbjct  28   ELQKEFECNGKLSWPELIGVPAHYAKGIIEKENSLITNVQILLNGSPVTMDYRCNRVRL  86



>ref|XP_006421576.1| hypothetical protein CICLE_v10006211mg [Citrus clementina]
 gb|ESR34816.1| hypothetical protein CICLE_v10006211mg [Citrus clementina]
Length=128

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN  222
            +F C  KSSWPELVG +G VA A +E EN  V A+V+ +  PVT D+R DRVR+ V+   
Sbjct  60   AFDCPRKSSWPELVGKNGKVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKG  119

Query  221  LVIAPPTIG  195
             VI  P IG
Sbjct  120  KVIRVPRIG  128



>ref|XP_006421577.1| hypothetical protein CICLE_v10006203mg [Citrus clementina]
 gb|ESR34817.1| hypothetical protein CICLE_v10006203mg [Citrus clementina]
Length=131

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN  222
            +F C  KSSWPELVG +G VA A +E EN  V A+V+ +  PVT D+R DRVR+ V+   
Sbjct  63   AFDCPRKSSWPELVGKNGKVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKG  122

Query  221  LVIAPPTIG  195
             VI  P IG
Sbjct  123  KVIRVPRIG  131



>gb|AAN76363.1| type I proteinase inhibitor-like protein [Citrus x paradisi]
Length=128

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN  222
            +F C  KSSWPELVG +G VA A +E EN  V A+V+ +  PVT D+R DRVR+ V+   
Sbjct  60   AFDCPRKSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKG  119

Query  221  LVIAPPTIG  195
             VI  P IG
Sbjct  120  KVIRVPRIG  128



>ref|XP_006490176.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Citrus 
sinensis]
Length=128

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN  222
            +F C  KSSWPELVG +G VA A +E EN  V A+V+ +  PVT D+R DRVR+ V+   
Sbjct  60   AFDCPRKSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKG  119

Query  221  LVIAPPTIG  195
             VI  P IG
Sbjct  120  KVIRVPRIG  128



>emb|CBI26387.3| unnamed protein product [Vitis vinifera]
Length=70

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+   +GKSSWPELVGV G  A A +E EN  V A VV +   VT DFRCDRVR+ VD  
Sbjct  1    MTTCPDGKSSWPELVGVHGEAAAAIIERENLNVKAGVVKEGTLVTTDFRCDRVRVWVDSY  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVSMAPKIG  70



>gb|EYU40892.1| hypothetical protein MIMGU_mgv1a017848mg [Erythranthe guttata]
Length=69

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK+ WPEL+G +G+ A A +E +N  V AVV     P T DFRCDRV I VD N +V+
Sbjct  4    CPGKNFWPELLGANGYAAAAVIERQNPNVNAVVSTNPTPTTRDFRCDRVWIWVDANGVVL  63

Query  212  APPTIG  195
              P  G
Sbjct  64   RAPRAG  69



>ref|XP_006421578.1| hypothetical protein CICLE_v10006212mg [Citrus clementina]
 gb|ESR34818.1| hypothetical protein CICLE_v10006212mg [Citrus clementina]
Length=128

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN  222
            +F C  KSSWPELVG +G VA A +E EN  V A+V+ +  PVT D+R DRVR+ V+   
Sbjct  60   AFDCPRKSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTRDYRIDRVRVWVNKKG  119

Query  221  LVIAPPTIG  195
             VI  P IG
Sbjct  120  KVIRVPRIG  128



>ref|XP_006367782.1| PREDICTED: serine protease inhibitor isoform X1 [Solanum tuberosum]
 gb|AIT42236.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIG  237
            +L   F CNGK SWPEL+GV   +AK  +E ENSL++ V ++    PVT DFRCDRVR+ 
Sbjct  34   ELLKEFQCNGKLSWPELIGVPTKLAKEIIEKENSLISNVHILLNGSPVTLDFRCDRVRLF  93

Query  236  VDCNNLVIAPPTIG  195
             +    V+  P +G
Sbjct  94   DNILGDVVQLPVVG  107



>gb|EPS59152.1| hypothetical protein M569_15657, partial [Genlisea aurea]
Length=61

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GK SWPELVG +G  A A VE EN  V  +V+    PVT DFRCDRV + VD   +VI P
Sbjct  1    GKLSWPELVGFNGREAAAVVERENPFVHPIVILDGTPVTRDFRCDRVWVWVDRRGIVIRP  60

Query  206  P  204
            P
Sbjct  61   P  61



>gb|AIT42233.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIG  237
            +L   F CNGK SWPEL+GV   +AK  +E ENSL++ V ++    PVT DFRCDRVR+ 
Sbjct  34   ELLKEFQCNGKLSWPELIGVPTKLAKGIIEKENSLISNVHILLNGSPVTLDFRCDRVRLF  93

Query  236  VDCNNLVIAPPTIG  195
             +    V+  P +G
Sbjct  94   DNILGDVVQIPVVG  107



>dbj|BAC10909.1| protease inhibitor 1 [Zinnia elegans]
Length=67

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFK-KCPVTADFRCDRVRIGVDCNNLV  216
            C GK SWPELVG  G  A+A  E EN  V A+VV + +  VTADFRCDRV + V+ N +V
Sbjct  1    CKGKRSWPELVGARGTTAEARFERENPRVNAIVVVEGRDMVTADFRCDRVWVWVNSNGVV  60

Query  215  IAPPTIG  195
            +  P+IG
Sbjct  61   LRTPSIG  67



>gb|KDO45261.1| hypothetical protein CISIN_1g033055mg [Citrus sinensis]
Length=128

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN  222
            +F C  KSSWPELVG +G VA A +E EN  V A+V+ +  PVT D+R DRVR+ V+   
Sbjct  60   AFDCPRKSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTRDYRIDRVRVWVNKKG  119

Query  221  LVIAPPTIG  195
             VI  P IG
Sbjct  120  KVIRVPRIG  128



>gb|KDP42134.1| hypothetical protein JCGZ_03191 [Jatropha curcas]
Length=71

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICN-GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDC  228
            M+ +C  GKSSWPEL+G +G  A A +E EN  V A+V+ ++ PVT DFRCDRVR+ V+ 
Sbjct  1    MANLCPPGKSSWPELLGANGQAAAALIEKENGNVNAIVLNERSPVTPDFRCDRVRVFVND  60

Query  227  NNLVIAPPTIG  195
              +V+  P +G
Sbjct  61   CGVVVRVPIVG  71



>ref|XP_004490203.1| PREDICTED: glu S.griseus protease inhibitor-like [Cicer arietinum]
Length=69

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK +WPELVG++G  A   +  EN+ VTA  + ++  VT DFRCDRVR+ VD  ++V 
Sbjct  4    CKGKKTWPELVGINGEAASQIIMRENTRVTASTLPQESVVTTDFRCDRVRVFVDNQDIVT  63

Query  212  APPTIG  195
              P IG
Sbjct  64   RVPNIG  69



>ref|XP_011004117.1| PREDICTED: uncharacterized protein LOC105110701 [Populus euphratica]
Length=503

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPEL+G    VA  T+E++N  V   VV +  PVT DF C RVR+ +D N +V 
Sbjct  438  CQGKSSWPELLGAQARVAVVTIETQNPYVDTQVVLEGTPVTKDFSCTRVRVWIDQNRIVT  497

Query  212  APPTIG  195
              P IG
Sbjct  498  RVPVIG  503



>ref|XP_010687945.1| PREDICTED: glu S.griseus protease inhibitor-like [Beta vulgaris 
subsp. vulgaris]
Length=71

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK+ WPELVG +G  A   VE EN  V A VV +   VTADFRCDRVR+ V+ N +V 
Sbjct  6    CPGKNEWPELVGENGPEAANIVERENPNVEAHVVLQGSIVTADFRCDRVRVWVNTNGVVY  65

Query  212  APPTIG  195
              P IG
Sbjct  66   RSPRIG  71



>emb|CAN75275.1| hypothetical protein VITISV_043736 [Vitis vinifera]
Length=70

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+   +GKSSWPELVGV G  A A +E EN  V A VV +   VT DFRCDRVR+ VD  
Sbjct  1    MATCPDGKSSWPELVGVHGEAAAAIIERENLNVKAGVVKEGTLVTTDFRCDRVRVWVDSY  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVSMVPKIG  70



>ref|XP_007009882.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18692.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPELVG  G  A A +E EN  V AV+V +   VTADF C RVR+ V+   +V 
Sbjct  6    CKGKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGSFVTADFLCTRVRVWVNTYGIVT  65

Query  212  APPTIG  195
              PTIG
Sbjct  66   RVPTIG  71



>ref|XP_010100072.1| Proteinase inhibitor [Morus notabilis]
 gb|EXB81308.1| Proteinase inhibitor [Morus notabilis]
Length=71

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK SWPELVGV G +A AT+E EN  V A++  +   VT D +C+RV + VD + +V 
Sbjct  6    CQGKKSWPELVGVSGEIATATIERENPTVHAIIKRQGTGVTDDLKCNRVWVWVDAHGVVT  65

Query  212  APPTIG  195
              P IG
Sbjct  66   TVPMIG  71



>gb|KDP36376.1| hypothetical protein JCGZ_08645 [Jatropha curcas]
Length=70

 Score = 67.4 bits (163),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GKSSWPEL+G +G  A A +E EN  V A+V+ +  PVT DFRCDRV + V+  
Sbjct  1    MASECPGKSSWPELLGANGKAAAALIEKENKHVNAIVLKEGTPVTRDFRCDRVWVWVNEC  60

Query  224  NLVIAPPTI  198
             +V+  P I
Sbjct  61   GVVVRVPII  69



>ref|XP_004247658.1| PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]
Length=111

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = -1

Query  398  FICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCNN  222
             +C GK SWPEL+GV    AK  ++ EN  VT V +V    PVTADFRC RVRI V+  N
Sbjct  43   LMCKGKLSWPELIGVPAQYAKGIIQKENPFVTDVQIVLNGSPVTADFRCFRVRIVVNILN  102

Query  221  LVIAPPTIG  195
            + ++ P +G
Sbjct  103  VAVSIPVVG  111



>gb|ADB85100.1| proteinase inhibitor [Jatropha curcas]
Length=70

 Score = 67.4 bits (163),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GKSSWPEL+G +G  A A +E EN  V A+V+ +  PVT DFRCDRV + V+  
Sbjct  1    MASECPGKSSWPELLGANGKAAAALIEKENRHVNAIVLKEGTPVTRDFRCDRVWVWVNEC  60

Query  224  NLVIAPPTI  198
             +V+  P I
Sbjct  61   GVVVRVPII  69



>gb|EYU32851.1| hypothetical protein MIMGU_mgv1a022632mg [Erythranthe guttata]
Length=71

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK SWPELVGV G VA AT+E EN LV A+++      T DFRCDRV + V+ N  V 
Sbjct  6    CRGKRSWPELVGVPGNVAVATIERENPLVNAIILPPGTLPTLDFRCDRVWVYVNSNGNVT  65

Query  212  APPTIG  195
              P IG
Sbjct  66   RVPVIG  71



>ref|NP_001274835.1| proteinase inhibitor 1 PPI3A2 precursor [Solanum tuberosum]
 gb|AAZ08248.1| proteinase inhibitor 1 PPI3A2 [Solanum tuberosum]
Length=107

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIG  237
            +L   F CNGK  WP L+GV    AK  +E EN+L+  V ++    PVTADF C+RVRI 
Sbjct  34   ELLKEFECNGKQRWPGLIGVPAQYAKGIIEKENTLIADVQIILNGSPVTADFSCNRVRIA  93

Query  236  VDCNNLVIAPPTIG  195
            V+  +  ++ P +G
Sbjct  94   VNILDYAVSMPVVG  107



>gb|EYU32853.1| hypothetical protein MIMGU_mgv1a024582mg [Erythranthe guttata]
Length=70

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK SWPEL+GV G VA AT+E+EN LV A++V     V  +FRCDRV + VD N
Sbjct  1    MSDECKGKDSWPELIGVPGNVAVATIETENPLVNAIIVPPGNFVITNFRCDRVWVFVDDN  60

Query  224  NLVIAPPTIG  195
              V   P IG
Sbjct  61   GNVKDVPLIG  70



>ref|XP_002517007.1| Glu S.griseus protease inhibitor, putative [Ricinus communis]
 gb|EEF45170.1| Glu S.griseus protease inhibitor, putative [Ricinus communis]
Length=70

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS    GKSSWPELVG +G  A A +  EN  V A  V +  PV+ DFR DRVR+ +D N
Sbjct  1    MSIEFAGKSSWPELVGNNGEAATAIIMRENPRVKANTVKEGSPVSGDFRSDRVRVFIDDN  60

Query  224  NLVIAPPTIG  195
            ++V   P IG
Sbjct  61   HIVTLVPKIG  70



>gb|KDP35355.1| hypothetical protein JCGZ_10339 [Jatropha curcas]
 gb|KDP42131.1| hypothetical protein JCGZ_03188 [Jatropha curcas]
Length=71

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICN-GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDC  228
            M+ +C+ GK+SWPEL+G +G  A A +E EN  + A+V+ +  PVT D R DRVR+ VD 
Sbjct  1    MANMCSPGKTSWPELLGENGKAAAALIEKENKDLHAIVLKEGTPVTKDLRWDRVRVWVDE  60

Query  227  NNLVIAPPTIG  195
              +VI  PTIG
Sbjct  61   CGVVILVPTIG  71



>ref|XP_006420157.1| hypothetical protein CICLE_v10007070mg [Citrus clementina]
 gb|ESR33397.1| hypothetical protein CICLE_v10007070mg [Citrus clementina]
Length=70

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK+SWPEL+G  G VA A +E +N  V+A +V +   VT +F C RVR+ V+ +
Sbjct  1    MSSECKGKNSWPELLGAKGDVAAAKIEKQNPYVSAQIVLEGTFVTLEFSCSRVRVWVNTS  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GIVTRAPAIG  70



>sp|P08454.2|ICID_SOLTU RecName: Full=Wound-induced proteinase inhibitor 1; AltName: 
Full=Chymotrypsin inhibitor I, D subunit; AltName: Full=Wound-induced 
proteinase inhibitor I; Flags: Precursor [Solanum 
tuberosum]
 gb|AAA69781.1| proteinase inhibitor I [Solanum tuberosum]
Length=107

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRI  240
            +L+  F CNGK  WPEL+GV   +AK  +E ENSL+T V ++    PVT D+RC+RVR+
Sbjct  34   ELQKEFECNGKQRWPELIGVPTKLAKGIIEKENSLITNVQILLNGSPVTMDYRCNRVRL  92



>gb|KDP34823.1| hypothetical protein JCGZ_11185 [Jatropha curcas]
Length=69

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPELVG +G  A   + +EN  V A  V +   V+ DFRCDRVR+ +D N++V 
Sbjct  4    CEGKSSWPELVGTNGEAATVIIMTENPKVKANTVKEGSRVSGDFRCDRVRVFIDDNHVVT  63

Query  212  APPTIG  195
              P IG
Sbjct  64   MVPKIG  69



>ref|XP_007138379.1| hypothetical protein PHAVU_009G203600g [Phaseolus vulgaris]
 gb|ESW10373.1| hypothetical protein PHAVU_009G203600g [Phaseolus vulgaris]
Length=70

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GK SWPELVG++G  A   +  EN  V A+ V +   V+ DFRCDRVR+ V+  
Sbjct  1    MSSYCKGKRSWPELVGINGETATQIIVKENPRVEALTVPEGSFVSTDFRCDRVRVFVNYK  60

Query  224  NLVIAPPTIG  195
            N V   P IG
Sbjct  61   NTVTRVPNIG  70



>prf||1314299A proteinase inhibitor I
Length=107

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRI  240
            +L+  F CNGK  WPEL+GV   +AK  +E ENSL+T V ++    PVT D+RC+RVR+
Sbjct  34   ELQKEFECNGKERWPELIGVPTKLAKGIIEKENSLITNVQILLNGSPVTMDYRCNRVRL  92



>ref|XP_008438570.1| PREDICTED: glu S.griseus protease inhibitor-like [Cucumis melo]
Length=71

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GKSSWPELVG  G  A+ T+E EN LV A++V +   V  DFRCDRV + VD  
Sbjct  1    MSTTCKGKSSWPELVGKAGKEAEKTIERENPLVDAIIVDEGSVVIQDFRCDRVWVWVDPK  60

Query  224  N-LVIAPPTIG  195
              +V   P IG
Sbjct  61   TAIVTRTPFIG  71



>ref|XP_007009886.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18696.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPELVG  G  A AT+E EN  V AV+V +   VT DF C RVR+ V+   +V 
Sbjct  6    CEGKSSWPELVGKKGEDAAATIEKENPRVNAVIVLEGSFVTGDFLCTRVRVWVNTYGIVT  65

Query  212  APPTIG  195
              P IG
Sbjct  66   RVPIIG  71



>ref|XP_007009890.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18700.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPEL+G  G  A AT+E EN  V AV+V +   VT DF C RVR+ V+ + +V 
Sbjct  6    CQGKSSWPELLGAKGEEAAATIERENPNVNAVIVLEGSFVTPDFLCTRVRVWVNTDGIVT  65

Query  212  APPTIG  195
              P IG
Sbjct  66   RVPVIG  71



>ref|XP_007009887.1| Serine protease inhibitor, putative [Theobroma cacao]
 gb|EOY18697.1| Serine protease inhibitor, putative [Theobroma cacao]
Length=71

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPELVG  G  A A +E EN  V AV+V +   VTADF C RVR+ V+   +V 
Sbjct  6    CKGKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGSFVTADFLCTRVRVWVNTYGIVT  65

Query  212  APPTIG  195
              P IG
Sbjct  66   RVPMIG  71



>gb|AAS46024.1| serine protease inhibitor [Solanum tuberosum]
Length=71

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCN  225
             F CNGK SWPEL+GV   +AK  +E ENSL++ V ++    PVT DF CDRVR+  +  
Sbjct  2    EFQCNGKLSWPELIGVPTKLAKGIIEKENSLISNVHILLNGSPVTLDFHCDRVRLFDNIL  61

Query  224  NLVIAPPTIG  195
              V+  P +G
Sbjct  62   GDVVQIPVVG  71



>emb|CAA87073.1| pathogenesis-related protein PR-6 type [Sambucus nigra]
Length=79

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GK++WPEL G  G  A ATVE+EN  VTAV+V +   VT D RCDRVR+ VD N +V   
Sbjct  16   GKNTWPELCGARGEEAAATVETENPSVTAVIVPEGSIVTTDERCDRVRVWVDENGIVTRV  75

Query  206  PTIG  195
            P IG
Sbjct  76   PVIG  79



>ref|XP_007009885.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18695.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPELVG  G  A A +E EN  V AV+V +   VTADF C RVR+ V+   +V 
Sbjct  6    CKGKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGSFVTADFLCTRVRVWVNTYGIVT  65

Query  212  APPTIG  195
              P IG
Sbjct  66   RVPIIG  71



>ref|XP_007227504.1| hypothetical protein PRUPE_ppa014371mg [Prunus persica]
 gb|EMJ28703.1| hypothetical protein PRUPE_ppa014371mg [Prunus persica]
Length=72

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTA-VVVFKKCPVTADFRCDRVRIGVDC  228
            M   C GK SWPELVGV+G VAKAT+E EN +VTA +VV  +  V  ++ C RV + VD 
Sbjct  1    MGSECEGKGSWPELVGVEGEVAKATIERENPIVTAKIVVEGETYVITNYDCYRVWVWVDK  60

Query  227  NN-LVIAPPTIG  195
            ++ LV  PP IG
Sbjct  61   DDRLVTRPPIIG  72



>ref|XP_006383697.1| hypothetical protein POPTR_0005s24230g [Populus trichocarpa]
 gb|ERP61494.1| hypothetical protein POPTR_0005s24230g [Populus trichocarpa]
Length=72

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -1

Query  404  MSFICN--GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVD  231
            M+ +C+  GKSSWPELVG++G VA   +ESEN  V   +V +   VT + RCDRVR+ VD
Sbjct  1    MTDVCSDTGKSSWPELVGINGEVAAKIIESENPKVRVSIVEEGMMVTQEIRCDRVRVWVD  60

Query  230  CNNLVIAPPTI  198
             N +V   P+I
Sbjct  61   KNGIVKDIPSI  71



>ref|XP_010038018.1| PREDICTED: proteinase inhibitor-like [Eucalyptus grandis]
Length=73

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKS+WPELVG  G VA   +E EN    A V+ +  PVT DFRCDRV + +D N  V 
Sbjct  8    CPGKSAWPELVGRSGKVAAEIIERENRDARARVLPEGTPVTRDFRCDRVWVWIDRNGKVT  67

Query  212  APPTIG  195
              P IG
Sbjct  68   QVPHIG  73



>gb|KDP21343.1| hypothetical protein JCGZ_21814 [Jatropha curcas]
Length=114

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -1

Query  395  ICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLV  216
            +C GKSSWPEL+G +G  A AT+E EN+ V A+VV +   V  DFRC+RV + V+   +V
Sbjct  48   LCPGKSSWPELLGTNGEAAAATIEKENTNVDAIVVKEGTGVIEDFRCNRVWVWVNEYGVV  107

Query  215  IAPPTIG  195
               PT+G
Sbjct  108  TQVPTVG  114



>ref|XP_004134090.1| PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]
 ref|XP_004165329.1| PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]
 gb|KGN56904.1| hypothetical protein Csa_3G142960 [Cucumis sativus]
Length=71

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            MS  C GKSSWPELVG  G  A+  +E EN  V AV+V +   VT DFRCDRV + VD  
Sbjct  1    MSTTCKGKSSWPELVGKAGKEAEKIIEKENPSVDAVIVDEGSVVTQDFRCDRVWVWVDSK  60

Query  224  -NLVIAPPTIG  195
             ++V   P IG
Sbjct  61   TSIVTRTPFIG  71



>ref|XP_007199579.1| hypothetical protein PRUPE_ppb023174mg [Prunus persica]
 gb|EMJ00778.1| hypothetical protein PRUPE_ppb023174mg [Prunus persica]
Length=124

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  425  SPNTKLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRV  246
            S   +   S  C GKSSWPE+VG DG VA A +E E   V A+V+ +   +T + RC+RV
Sbjct  48   SEGERRMASAYCPGKSSWPEIVGEDGEVAAAKIEQEKPDVHAIVIPEGTIITQELRCNRV  107

Query  245  RIGVDCNNLVIAPPTIG  195
            R+ VD N +V   P +G
Sbjct  108  RVWVDENGVVTTVPRVG  124



>ref|XP_002323423.1| hypothetical protein POPTR_0016s07970g [Populus trichocarpa]
 gb|EEF05184.1| hypothetical protein POPTR_0016s07970g [Populus trichocarpa]
Length=70

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GKSSWPEL+G    VA  TVE++N  V A VV +   VT +F C RVR+ +D N
Sbjct  1    MASECQGKSSWPELLGAQARVAIVTVETQNPNVDAQVVLEGTFVTGEFSCTRVRVWIDRN  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   RIVTRVPIIG  70



>gb|KDP42135.1| hypothetical protein JCGZ_03192 [Jatropha curcas]
Length=70

 Score = 65.5 bits (158),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+F+C GKSSWPEL+G +   A A +E +NS V A+V+ +  PV  DFRCDRV + V+  
Sbjct  1    MAFVCPGKSSWPELLGANVKAAAALIEKQNSNVNAIVLKEGSPVPLDFRCDRVWVVVNEC  60

Query  224  NLVIAPPTIG  195
             +V+  PTIG
Sbjct  61   GVVVQVPTIG  70



>ref|XP_004288448.1| PREDICTED: glu S.griseus protease inhibitor-like [Fragaria vesca 
subsp. vesca]
Length=106

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -1

Query  407  RMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADF--RCDRVRIGV  234
            +M+  C GK  WPEL+G +G VAK T+E ENS V A +V +   V AD    CDRVR+ V
Sbjct  34   KMAGQCVGKEDWPELLGAEGTVAKETIERENSTVKAEIVLEGTIVPADLVRVCDRVRVWV  93

Query  233  DCNNLVIAPPTIG  195
            D   +V   PTIG
Sbjct  94   DTCGIVTRVPTIG  106



>gb|KDP36377.1| hypothetical protein JCGZ_08646 [Jatropha curcas]
Length=71

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -1

Query  404  MSFICN-GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDC  228
            M+ IC  GKSSWPEL+G +G  A A +E ENS V A+V+ +  PVT DFRCDRV + V+ 
Sbjct  1    MADICPPGKSSWPELLGANGKPAAALIEKENSNVNAIVLKEGTPVTKDFRCDRVWVWVNE  60

Query  227  NNLVIAPPTI  198
              +V+  P I
Sbjct  61   CGVVVQVPII  70



>ref|XP_007009884.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18694.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPEL+G  G  A AT+E EN  V AV+V +   VT DF C RVR+ V+ + +V 
Sbjct  6    CQGKSSWPELLGAKGEEAAATIERENPNVNAVIVSEGSFVTPDFLCTRVRVWVNTDGIVT  65

Query  212  APPTIG  195
              P IG
Sbjct  66   RVPVIG  71



>gb|AIT42232.1| proteinase inhibitor 1 [Solanum tuberosum]
 gb|AIT42238.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIG  237
            +L   F C GK SWPEL+GV   +AK  +E ENSL++ V ++    PVT D RCDRVR+ 
Sbjct  34   ELLKEFQCKGKLSWPELIGVPTKLAKGIIEKENSLISNVHILLNGSPVTLDLRCDRVRLF  93

Query  236  VDCNNLVIAPPTIG  195
             +    V+  P +G
Sbjct  94   DNILGYVVDIPVVG  107



>ref|XP_010100074.1| Proteinase inhibitor [Morus notabilis]
 gb|EXB81310.1| Proteinase inhibitor [Morus notabilis]
Length=71

 Score = 64.7 bits (156),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK SWPELVGV G +A A +E EN  V A+V  +  PV  D+RC+RV I V+ + +V 
Sbjct  6    CPGKKSWPELVGVCGEIAAAKIEKENPNVDAIVKLQGTPVIQDYRCNRVWIWVNTHGVVS  65

Query  212  APPTIG  195
              P +G
Sbjct  66   TVPHVG  71



>gb|KDP35352.1| hypothetical protein JCGZ_10336 [Jatropha curcas]
Length=70

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GK+SWPEL+G +G  A A +E EN  V A+V+ +  PV  DFRCDRV + V+  
Sbjct  1    MASECPGKNSWPELLGANGKAAAALIEKENKYVHAIVLKEGTPVPRDFRCDRVWVWVNEC  60

Query  224  NLVIAPPTI  198
             +V+  P I
Sbjct  61   GVVVRVPII  69



>ref|XP_009396722.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Musa 
acuminata subsp. malaccensis]
Length=70

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M  IC GK SWPEL+GV+G  A   +ESEN  V A +V     V  DFRCDRV + V+ +
Sbjct  1    MQNICAGKYSWPELLGVEGEKAATIIESENPTVKARIVEDGKVVIQDFRCDRVWVWVNKH  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   GVVARVPHIG  70



>gb|AAA33816.1| proteinase inhibitor I [Solanum tuberosum]
Length=107

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRI  240
            +L+  F CNGK  WPEL+GV   +AK  +E ENSL+T V ++    PVT D+R +RVR+
Sbjct  34   ELQKEFECNGKQRWPELIGVPTKLAKGIIEKENSLITNVQILLNGSPVTMDYRSNRVRL  92



>ref|XP_002879773.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56032.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=73

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GK+SWPEL+G +G  A + ++ ENS +   V+    PVT D RCDRVR+ V+ + LV+  
Sbjct  10   GKNSWPELLGTNGDYAASVIKGENSSLQVNVILVGTPVTPDLRCDRVRVWVNESRLVVKN  69

Query  206  PTIG  195
            PT G
Sbjct  70   PTAG  73



>ref|XP_006367784.1| PREDICTED: proteinase inhibitor 1 PPI2C1A [Solanum tuberosum]
Length=107

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRI  240
            +L   F CNGK SWPEL+GV   +AK  +E ENSL+T V ++    PVT DF C+RVR+
Sbjct  34   ELLKEFQCNGKLSWPELIGVPTKLAKEIIEKENSLITNVQILLNGSPVTKDFSCNRVRL  92



>ref|XP_006377750.1| hypothetical protein POPTR_0011s11170g, partial [Populus trichocarpa]
 ref|XP_006387186.1| hypothetical protein POPTR_1585s00210g, partial [Populus trichocarpa]
 gb|ERP46100.1| hypothetical protein POPTR_1585s00210g, partial [Populus trichocarpa]
 gb|ERP55547.1| hypothetical protein POPTR_0011s11170g, partial [Populus trichocarpa]
Length=65

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GKSSWPELVG++G VA   +  EN  V A +V +   VT DFRCDRVR+ VD   +V   
Sbjct  2    GKSSWPELVGINGEVAAKIIVRENPKVRAGIVKEGMMVTMDFRCDRVRVWVDKYGIVKDI  61

Query  206  PTIG  195
            P IG
Sbjct  62   PQIG  65



>ref|XP_007224127.1| hypothetical protein PRUPE_ppa015912mg [Prunus persica]
 ref|XP_008224411.1| PREDICTED: glu S.griseus protease inhibitor-like [Prunus mume]
 gb|EMJ25326.1| hypothetical protein PRUPE_ppa015912mg [Prunus persica]
Length=76

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = -1

Query  389  NGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRC--DRVRIGVDCNNLV  216
             GK  WPEL+GV+G VA+AT+E ENS V   VV +   V ADF C  DRVR+ VD + LV
Sbjct  10   TGKYVWPELLGVEGTVAEATIERENSTVKVEVVLEGTIVPADFVCVPDRVRVWVDTDGLV  69

Query  215  IAPPTIG  195
               P IG
Sbjct  70   TRVPVIG  76



>gb|AIT42237.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRI  240
            +L   F CNGK SWPEL+GV   +AK  +E ENSL+T V ++    PVT DF C+RVR+
Sbjct  34   ELLKEFQCNGKLSWPELIGVPTKLAKEIIEKENSLITNVQILLNGSPVTKDFSCNRVRL  92



>ref|XP_003535093.2| PREDICTED: glu S.griseus protease inhibitor-like [Glycine max]
 gb|KHM98960.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=69

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -1

Query  395  ICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLV  216
            + NGK SWPELVGV G VA+AT+E EN  V A++V     VT D R DRV + V+ + +V
Sbjct  3    VINGKFSWPELVGVQGTVAEATIERENPSVNAIIVPLGSVVTTDLRSDRVWVWVNKDGIV  62

Query  215  IAPPTIG  195
               P IG
Sbjct  63   NRVPKIG  69



>gb|EYU17889.1| hypothetical protein MIMGU_mgv1a022666mg [Erythranthe guttata]
Length=69

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GK+ WPEL+G +G  A A +E +N  V AVV     P T DFRCDRV + V+ N +V+
Sbjct  4    CPGKNFWPELLGANGDAAAAVIERQNPNVNAVVSTNPTPTTRDFRCDRVWVWVNANGVVL  63

Query  212  APPTIG  195
              P  G
Sbjct  64   RAPRAG  69



>ref|WP_017626123.1| hypothetical protein [Nocardiopsis chromatogenes]
Length=110

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRI---GVDCNN  222
            C GK SWPEL G D   A+  +E EN  V AV+V K   VT DFRCDRVR+   G D   
Sbjct  41   CQGKQSWPELAGADAHTAERVIERENPRVDAVLVPKGSYVTMDFRCDRVRVFHEGDDPAP  100

Query  221  LVIA-PPTIG  195
            L++A  P +G
Sbjct  101  LIVARAPQVG  110



>emb|CAN75276.1| hypothetical protein VITISV_043737 [Vitis vinifera]
 gb|ADD51185.1| protease inhibitor 2 [Vitis cinerea var. helleri x Vitis riparia]
 emb|CBI26388.3| unnamed protein product [Vitis vinifera]
Length=73

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADF--RCDRVRIGV  234
            M+F C GK+SWPEL+GV   VAKATVE EN  VT V +V +   V AD    C RVRI V
Sbjct  1    MAFECRGKTSWPELLGVQKAVAKATVERENPYVTDVEIVLEGTIVPADLVPVCTRVRIWV  60

Query  233  DCNNLVIAPPTIG  195
            D + +V   P +G
Sbjct  61   DESGIVTRVPVVG  73



>ref|XP_004247695.1| PREDICTED: proteinase inhibitor 1-like [Solanum lycopersicum]
Length=114

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 41/78 (53%), Gaps = 6/78 (8%)
 Frame = -1

Query  428  PSPNTKLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDR  249
            P PN +      C GK  WPEL+GV    AK  +E EN L    +V    P+T D  C+R
Sbjct  43   PKPNLE------CQGKLMWPELIGVPAQYAKGIIEKENPLTHVQIVLNGSPITTDLSCNR  96

Query  248  VRIGVDCNNLVIAPPTIG  195
            VRI V+  +  ++ P +G
Sbjct  97   VRIAVNILDYAVSMPVVG  114



>sp|Q6XNP7.2|HPI_HEVBR RecName: Full=Protease inhibitor HPI; AltName: Full=HbPI1; AltName: 
Full=Protease inhibitor 1 [Hevea brasiliensis]
Length=70

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C  K+SWPELVG +G +A   +++EN+ V A+VV +  P+T D   +RVR+ VD N
Sbjct  1    MASQCPVKNSWPELVGTNGDIAAGIIQTENANVKAIVVKEGLPITQDLNFNRVRVFVDEN  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   RVVTQVPAIG  70



>sp|Q00783.1|ICI1_SOLTU RecName: Full=Proteinase inhibitor 1; AltName: Full=Proteinase 
inhibitor I; Flags: Precursor [Solanum tuberosum]
 emb|CAA78259.1| proteinase inhibitor I [Solanum tuberosum]
Length=107

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIG  237
            +L   F C GK  WPEL+GV   +AK  +E ENSL++ V ++    PVT D RCDRVR+ 
Sbjct  34   QLLKEFQCKGKLRWPELIGVPTKLAKGIIEKENSLISNVHILLNGSPVTLDIRCDRVRLF  93

Query  236  VDCNNLVIAPPTIG  195
             +    V+  P +G
Sbjct  94   DNILGYVVDIPVVG  107



>ref|XP_002317460.1| hypothetical protein POPTR_0011s11140g [Populus trichocarpa]
 gb|EEE98072.1| hypothetical protein POPTR_0011s11140g [Populus trichocarpa]
Length=72

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = -1

Query  404  MSFIC--NGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVD  231
            M+ +C   GKSSWPELVG++G VA   +  EN  V A +V +   VT DFRCDRVR+ VD
Sbjct  1    MTDVCPDAGKSSWPELVGINGEVAAKIIVRENPKVRAGIVKEGMMVTMDFRCDRVRVWVD  60

Query  230  CNNLVIAPPTIG  195
               +V   P IG
Sbjct  61   KYGIVKDIPQIG  72



>ref|XP_007009891.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18701.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPELVG  G  A A +E EN  V AV+V +   VT +F C RVR+ V+ + +V 
Sbjct  6    CKGKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGTFVTLEFLCTRVRVWVNTDGIVT  65

Query  212  APPTIG  195
              P IG
Sbjct  66   RVPIIG  71



>ref|NP_001275446.1| proteinase inhibitor I precursor [Solanum tuberosum]
 gb|AAZ94190.1| proteinase inhibitor I precursor [Solanum tuberosum]
Length=107

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIG  237
            +L   F C GK SWPEL+GV   +AK  +E +NSL++ V ++    PVT D RCDRVR+ 
Sbjct  34   ELLKEFECKGKLSWPELIGVPTKLAKGIIEKQNSLISNVHILLNGSPVTLDIRCDRVRLF  93

Query  236  VDCNNLVIAPPTIG  195
             +    V+  P +G
Sbjct  94   DNILGAVVQIPVVG  107



>ref|XP_010100075.1| Proteinase inhibitor [Morus notabilis]
 gb|EXB81311.1| Proteinase inhibitor [Morus notabilis]
Length=130

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GKSSWPEL+G +G  A   +E EN  V A V+ +   VT DFRCDRV + V+  
Sbjct  1    MASECQGKSSWPELLGKNGEEAAKQIEKENKNVDAKVILEGTAVTKDFRCDRVWVWVNNY  60

Query  224  NLVIAPPTIG  195
              V   P +G
Sbjct  61   GTVTEVPRVG  70


 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GK+SWPELVGV+G  A+  +E EN  V A+VV +  PV  DFRC RV + V+ + +V   
Sbjct  70   GKNSWPELVGVNGKEAEKQIEKENDNVDAIVVLEGTPVPEDFRCTRVWVWVNDSGIVTQL  129

Query  206  P  204
            P
Sbjct  130  P  130



>sp|P82381.1|ICI_LINUS RecName: Full=Proteinase inhibitor; AltName: Full=LUTI [Linum 
usitatissimum]
Length=69

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN  222
            S  C GK++WPELVG  G +A ATVE EN  V A+V+ +   +T DFRCDRV + V+ + 
Sbjct  1    SRRCPGKNAWPELVGKSGNMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHG  60

Query  221  LVIAPPTI  198
            +V + P I
Sbjct  61   VVTSVPHI  68



>pdb|1DWM|A Chain A, Solution Structure Of Linum Usitatissinum Trypsin Inhibitor 
(Luti)
Length=70

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN  222
            S  C GK++WPELVG  G +A ATVE EN  V A+V+ +   +T DFRCDRV + V+ + 
Sbjct  2    SRRCPGKNAWPELVGKSGNMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHG  61

Query  221  LVIAPPTI  198
            +V + P I
Sbjct  62   VVTSVPHI  69



>gb|KDO68501.1| hypothetical protein CISIN_1g039274mg, partial [Citrus sinensis]
Length=96

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -1

Query  389  NGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIA  210
            + KSSWPELVGV G VA   +  EN  V A++V +   VT D+RCDRV + VD + +V  
Sbjct  32   SSKSSWPELVGVKGEVAAEIIMRENGKVVAIIVKEGFEVTMDYRCDRVWVWVDHHGIVKY  91

Query  209  PPTIG  195
             P IG
Sbjct  92   TPRIG  96



>emb|CDY04060.1| BnaC02g37750D [Brassica napus]
Length=74

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADF--RCDRVRIGVD  231
            MSFIC+GK+SWPELVG  G  A + +E EN  VTA V+  + PV  ++  RC+RV + VD
Sbjct  1    MSFICSGKTSWPELVGTKGDYAASVIERENPGVTAAVIVVRSPVPFEYNIRCNRVWVWVD  60

Query  230  --CNNLVIAPPTIG  195
               +  V+  P +G
Sbjct  61   KKVDGTVVVVPIVG  74



>ref|XP_002521005.1| Inhibitor of trypsin and hageman factor, putative [Ricinus communis]
 gb|EEF41422.1| Inhibitor of trypsin and hageman factor, putative [Ricinus communis]
Length=72

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -1

Query  404  MSFICN--GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVD  231
            M+ IC   GK SWPELVG+ G VA   +  EN  V A +V +   VT DFRCDRVR+ VD
Sbjct  1    MADICTDPGKRSWPELVGIKGEVAVEIIVQENPKVGATIVKEGMMVTMDFRCDRVRVWVD  60

Query  230  CNNLVIAPPTIG  195
               +V   P IG
Sbjct  61   KYGIVKDVPHIG  72



>gb|AAA72133.1| proteinase inhibitor I, partial [Solanum tuberosum]
Length=106

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRI  240
            +L   F CNGK  WPEL+GV   +AK  +E ENSL+  V ++    PVT D+RC+RVR+
Sbjct  33   ELLKEFECNGKQFWPELIGVPTKLAKEIIEKENSLINNVQILLNGSPVTMDYRCNRVRL  91



>ref|XP_006443889.1| hypothetical protein CICLE_v10023822mg, partial [Citrus clementina]
 gb|ESR57129.1| hypothetical protein CICLE_v10023822mg, partial [Citrus clementina]
Length=104

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -1

Query  389  NGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIA  210
            + KSSWPELVGV G VA   +  EN  V A++V +   VT D+RCDRV + VD + +V  
Sbjct  40   SSKSSWPELVGVKGEVAAEIIMRENGKVVAIIVKEGFEVTMDYRCDRVWVWVDHHGIVKY  99

Query  209  PPTIG  195
             P IG
Sbjct  100  TPRIG  104



>ref|WP_017542056.1| hypothetical protein [Nocardiopsis halophila]
Length=110

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = -1

Query  395  ICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN--  222
            +C GK +WPEL G D   A ATVE EN  VT VVV +   VT DFRCDRVR+  + +   
Sbjct  40   LCTGKQAWPELEGADVHEAVATVERENPAVTTVVVPEGSAVTMDFRCDRVRVFHEGDTPA  99

Query  221  --LVIAPPTIG  195
               V  PP +G
Sbjct  100  PLTVSRPPQVG  110



>emb|CDX93297.1| BnaC04g45990D [Brassica napus]
Length=70

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCD  252
            MS  C GK+SWPEL+G +G  A + +E ENS V A+V+    PVT DFRCD
Sbjct  1    MSSECAGKNSWPELLGTNGDYAASVIERENSRVDAMVILDGTPVTGDFRCD  51



>ref|WP_017556242.1| hypothetical protein [Nocardiopsis baichengensis]
Length=110

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = -1

Query  395  ICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN--  222
            +C GK +WPEL G D   A ATVE EN  VT VVV +   VT DFRCDRVR+  + +   
Sbjct  40   LCTGKQAWPELEGADVHEAVATVERENPAVTTVVVPEGSAVTMDFRCDRVRVFHEGDTPA  99

Query  221  --LVIAPPTIG  195
               V  PP +G
Sbjct  100  PLTVSRPPQVG  110



>ref|XP_002983045.1| hypothetical protein SELMODRAFT_117696, partial [Selaginella 
moellendorffii]
 gb|EFJ15854.1| hypothetical protein SELMODRAFT_117696, partial [Selaginella 
moellendorffii]
Length=64

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -1

Query  383  KSSWPELVGVDGFVAKATVESEN-SLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            K++WPELVG D   A+  + ++N  L   +V ++ C VTADF  +RVRI  DC+N V+  
Sbjct  1    KTAWPELVGKDAIYAREQILADNPKLEIHIVFYESCSVTADFDTNRVRIYTDCSNRVVRT  60

Query  206  PTIG  195
            P+IG
Sbjct  61   PSIG  64



>ref|NP_001274985.1| proteinase inhibitor 1 PPI3B2 precursor [Solanum tuberosum]
 gb|AAZ08245.1| proteinase inhibitor 1 PPI3B2 [Solanum tuberosum]
Length=107

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIG  237
            +L   F C GK  WPEL+GV   +AK  +E ENSL+T V ++    PVT DF C+RVR+ 
Sbjct  34   ELPKEFECKGKLQWPELIGVPTKLAKEIIEKENSLITNVQILLNGSPVTLDFSCNRVRLF  93

Query  236  VDCNNLVIAPPTIG  195
             +   +V+  P +G
Sbjct  94   DNILGVVVDMPVVG  107



>ref|XP_003542413.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Glycine 
max]
Length=71

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNN  222
            S +C GKSSWPE+VG +G VA   +E EN  V A +V +   VT DF C+RV + VD   
Sbjct  3    SLLCQGKSSWPEVVGTNGVVAVEKIERENDNVRARLVGEGSMVTMDFWCNRVWVWVDKIG  62

Query  221  LVIAPPTIG  195
            +V   P IG
Sbjct  63   VVTRVPKIG  71



>gb|KDP36378.1| hypothetical protein JCGZ_08647 [Jatropha curcas]
Length=71

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICN-GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDC  228
            M+ +C+ GK+SWPEL+G +G  A A +E EN  + A+V+ +  PVT +FR DRVR+ VD 
Sbjct  1    MANMCSPGKTSWPELLGENGKAAAALIEKENKDLHAIVLKEGTPVTMEFRWDRVRVWVDE  60

Query  227  NNLVIAPPTIG  195
              +VI  P  G
Sbjct  61   CGVVILVPING  71



>gb|AAA69780.1| proteinase inhibitor I [Solanum tuberosum]
Length=107

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRI  240
            +L   F CNGK  WPEL+GV   +AK  +E ENSL+  V ++    PVT D+RC+RVR+
Sbjct  34   ELLKEFECNGKQFWPELIGVPTKLAKEIIEKENSLINNVQILLNGSPVTMDYRCNRVRL  92



>gb|KDO37763.1| hypothetical protein CISIN_1g040548mg [Citrus sinensis]
Length=71

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFIC-NGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDC  228
            MS  C  GK SWPELVG++G  A   + +EN  V A  V +   VTADFRCDRVR+ V+ 
Sbjct  1    MSSSCPAGKGSWPELVGMNGEAAAHIIMAENPKVGATTVDENAIVTADFRCDRVRVFVND  60

Query  227  NNLVIAPPTIG  195
            + +V   P IG
Sbjct  61   HGIVTRVPRIG  71



>sp|P01052.1|ICIA_SOLTU RecName: Full=Chymotrypsin inhibitor I, A, B and C subunits [Solanum 
tuberosum]
Length=71

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCN  225
             F C+GK  WPEL+GV   +AK  +E +NSL++ V ++    PVT DFRC+RVR+  D  
Sbjct  2    EFECDGKLQWPELIGVPTKLAKEIIEKQNSLISNVHILLNGSPVTMDFRCNRVRLFDDIL  61

Query  224  NLVIAPPTIG  195
              V+  P + 
Sbjct  62   GSVVQIPRVA  71



>gb|ABP01766.1| proteinase inhibitor 1 [Salvia miltiorrhiza]
Length=73

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GKSSWPELVGV G VA AT+E EN  V AVV+  +   T    CDRV + VD N +V + 
Sbjct  10   GKSSWPELVGVAGDVAVATIEKENPSVNAVVITPETVWTPAIFCDRVLVFVDANGIVNSV  69

Query  206  PTIG  195
            PT+G
Sbjct  70   PTVG  73



>gb|AAZ08246.1| proteinase inhibitor 1 PPI2C1A [Solanum tuberosum]
Length=107

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRI  240
            +L   F CNGK SWPEL+G    +AK  +E ENSL+T V ++    PVT DF C+RVR+
Sbjct  34   ELLKEFQCNGKLSWPELIGEPTKLAKEIIEKENSLITNVQILLNGSPVTKDFSCNRVRL  92



>gb|KDP35354.1| hypothetical protein JCGZ_10338 [Jatropha curcas]
Length=71

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  404  MSFICN-GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVR  243
            M+ IC  GK SWPEL+G +G  A A +E ENS V A+V+ +  PVT DFRC RVR
Sbjct  1    MADICPPGKRSWPELLGANGKAAAALIEKENSNVNAIVLNEMSPVTPDFRCGRVR  55



>gb|KDP42132.1| hypothetical protein JCGZ_03189 [Jatropha curcas]
Length=71

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  404  MSFICN-GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVR  243
            M+ IC  GK SWPEL+G +G  A A +E ENS V A+V+ +  PVT DFRC RVR
Sbjct  1    MADICPPGKRSWPELLGANGKAAAALIEKENSNVNAIVLNEMSPVTPDFRCGRVR  55



>gb|AAP46156.1| protease inhibitor protein 1 [Hevea brasiliensis]
Length=70

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C  K +WPELVG +G +A   +++EN+ V A+VV +  P+T D   +RVR+ VD N
Sbjct  1    MASQCPVKDAWPELVGTNGDIAAGIIQTENANVKAIVVKEGLPITQDLNFNRVRVFVDEN  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   RVVTQVPAIG  70



>gb|KCW59399.1| hypothetical protein EUGRSUZ_H02107 [Eucalyptus grandis]
Length=73

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  383  KSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAPP  204
            KSSWPELVGV+G  AK  +E+EN  VT V+  ++ P + D  C+RV I VD    ++  P
Sbjct  11   KSSWPELVGVNGAKAKLIIENENKRVTGVIQLERTPHSLDICCNRVFIWVDNKGNIVKVP  70

Query  203  TIG  195
            TIG
Sbjct  71   TIG  73



>ref|XP_002300791.1| hypothetical protein POPTR_0002s04350g [Populus trichocarpa]
 gb|EEE80064.1| hypothetical protein POPTR_0002s04350g [Populus trichocarpa]
Length=66

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRV  246
            M+  C GKSSWPELV   G  A AT+E EN  V A+V+ +  PVT DFRC+RV
Sbjct  1    MASRCPGKSSWPELVRAYGEAAAATIERENRNVDAIVLREGTPVTKDFRCNRV  53



>ref|XP_010932900.1| PREDICTED: glu S.griseus protease inhibitor-like [Elaeis guineensis]
Length=68

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C GKSSWPELVGV+G  A+  +E EN  V A++V     V  +F C+RV + VD + +V 
Sbjct  3    CTGKSSWPELVGVNGKEAEKIIEKENPAVDAIIVMVGESVVLNFSCERVWVWVDKDGIVA  62

Query  212  APPTIG  195
              P IG
Sbjct  63   QVPKIG  68



>dbj|BAA02823.1| genetic tumor-related proteinase inhibitor I precursor [Nicotiana 
glauca x Nicotiana langsdorffii]
Length=94

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 3/70 (4%)
 Frame = -1

Query  395  ICNG--KSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCN  225
            IC G  K +WPEL+GV   +A+ T++ ENS +T V  V    PVT D RCDRVR+ V+  
Sbjct  25   ICPGVKKETWPELIGVPAKLARETIQKENSKLTNVPSVLNGSPVTQDLRCDRVRLFVNLL  84

Query  224  NLVIAPPTIG  195
            ++V+  P +G
Sbjct  85   DIVVQIPRVG  94



>ref|XP_008447238.1| PREDICTED: glu S.griseus protease inhibitor-like [Cucumis melo]
Length=70

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GK +WPELVG     AK+ +E EN  V   V+ +   VT D RCDRVR+ ++ +
Sbjct  1    MALWCRGKMAWPELVGTRSEEAKSRIEKENPYVDVAVIREGRVVTLDIRCDRVRVWINRD  60

Query  224  NLVIAPPTIG  195
             +V   P +G
Sbjct  61   GIVTRIPFVG  70



>ref|WP_017593962.1| hypothetical protein [Nocardiopsis potens]
Length=114

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRI  240
            C GK SWPELVGV   +A  T+E +N  VTA+ V +   VT DFRCDRVRI
Sbjct  42   CIGKQSWPELVGVPTDIAIRTIEEQNPFVTALEVPEDTAVTTDFRCDRVRI  92



>ref|XP_002965559.1| hypothetical protein SELMODRAFT_84301, partial [Selaginella moellendorffii]
 gb|EFJ32979.1| hypothetical protein SELMODRAFT_84301, partial [Selaginella moellendorffii]
Length=64

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -1

Query  383  KSSWPELVGVDGFVAKATVESEN-SLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            K++WPELVG D   A+  + ++N  L   +V ++ C VTADF  +RVRI  DC+N V+  
Sbjct  1    KTAWPELVGKDAIYAREQILADNPKLEIHIVFYEACLVTADFDKNRVRIYTDCSNRVVRT  60

Query  206  PTIG  195
            P+IG
Sbjct  61   PSIG  64



>ref|XP_004247654.1| PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]
Length=111

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVV-FKKCPVTADFRCDRVRIGVDCN  225
            + +C GK  WPEL+GV    AK  +E EN  +T V +     P TADF+C RVRI V+  
Sbjct  42   NLMCKGKRMWPELIGVPAQYAKGIIEKENPFITDVRIGLIGSPGTADFKCFRVRIAVNIL  101

Query  224  NLVIAPPTIG  195
            ++ ++ P IG
Sbjct  102  DVAVSMPVIG  111



>sp|P16231.1|ICI1_SOLPE RecName: Full=Wound-induced proteinase inhibitor 1; AltName: 
Full=Wound-induced proteinase inhibitor I; Flags: Precursor 
[Solanum peruvianum]
 gb|AAA34180.1| proteinase inhibitor I precursor [Solanum peruvianum]
Length=111

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCNNLV  216
            C GK  WPEL+GV    AK  +E EN  +T + ++    PVT DFRCDRVR+ V+    V
Sbjct  45   CKGKQFWPELIGVPALYAKGIIEKENPSITNIPILLNGSPVTKDFRCDRVRLFVNILGDV  104

Query  215  IAPPTI  198
            +  P +
Sbjct  105  VQIPRV  110



>gb|KEH42587.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=70

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M   C GK+ WPE+VG+DG  A   +E EN  V A+VV +   VT DF+C RV + VD +
Sbjct  1    MEGRCLGKNKWPEVVGMDGDEAAEKIERENEKVNAIVVPEGSVVTMDFKCTRVWVWVDKH  60

Query  224  NLVIAPPTIG  195
              V   P IG
Sbjct  61   GRVTRMPKIG  70



>gb|AAA34198.1| proteinase inhibitor I [Solanum peruvianum]
Length=111

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCNNLV  216
            C GK  WPEL+GV    AK  +E EN  +T + ++    PVT DFRCDRVR+ V+    V
Sbjct  45   CKGKQFWPELIGVPALYAKGIIEKENPSITNIPILLNGSPVTKDFRCDRVRLFVNILGDV  104

Query  215  IAPPTI  198
            +  P +
Sbjct  105  VQIPRV  110



>ref|XP_004247655.1| PREDICTED: wound-induced proteinase inhibitor 1-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010326723.1| PREDICTED: wound-induced proteinase inhibitor 1-like isoform 
X2 [Solanum lycopersicum]
Length=111

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCN  225
             F C GK  WPEL+GV   +AK  +E EN  ++ + ++    PVT DFRCDRVR+  +  
Sbjct  42   EFWCKGKQFWPELIGVPAKLAKEIIEKENPSISDIPILLNGSPVTMDFRCDRVRLFDNIL  101

Query  224  NLVIAPPTI  198
              V+  PT+
Sbjct  102  GYVVQIPTV  110



>ref|XP_006489607.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Citrus 
sinensis]
 gb|KDO41754.1| hypothetical protein CISIN_1g038500mg [Citrus sinensis]
Length=71

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFIC-NGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDC  228
            MS  C  GK SWPELVG++G  A   + +EN  V A  V +   VT DFRCDRVR+ V+ 
Sbjct  1    MSSSCPAGKGSWPELVGMNGEAAAHIIMAENPKVGATTVDENAIVTTDFRCDRVRVFVND  60

Query  227  NNLVIAPPTIG  195
            + +V   P IG
Sbjct  61   HGIVTRVPRIG  71



>emb|CAA47907.1| proteinase inhibitor I [Solanum tuberosum]
 emb|CAA48136.1| protease inhibitor I [Solanum tuberosum]
Length=107

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRI  240
            +L   F CNGK  WPEL+GV   +AK  +E ENSL+  V ++    PV  D+RC+RVR+
Sbjct  34   ELLKEFECNGKQFWPELIGVPTKLAKEIIEKENSLINNVQILLNGSPVAMDYRCNRVRL  92



>gb|KDP35356.1| hypothetical protein JCGZ_10340 [Jatropha curcas]
Length=71

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -1

Query  404  MSFICN-GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDC  228
            M+ IC  GKSSWPEL+  +G  A A +E ENS V A+V+ +  PVT+D RCDRV + V+ 
Sbjct  1    MADICPPGKSSWPELLRANGKAAAALIEKENSNVNAIVLKEGTPVTSDLRCDRVWVFVNE  60

Query  227  NNLVIAPPTI  198
              +V+  P I
Sbjct  61   CGVVVQVPFI  70



>ref|XP_006295810.1| hypothetical protein CARUB_v10024936mg [Capsella rubella]
 gb|EOA28708.1| hypothetical protein CARUB_v10024936mg [Capsella rubella]
Length=70

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCD  252
            MS  C GK+SWPELV  +G  A + +E EN  V AVV+    PVTADFRCD
Sbjct  1    MSSECAGKNSWPELVRTNGDYAASVIERENPSVDAVVILDGTPVTADFRCD  51



>gb|EYU46483.1| hypothetical protein MIMGU_mgv1a023325mg [Erythranthe guttata]
Length=70

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GKS WPELV  +G  A   +E +N  V A+VV +   VT D RCDRV + V+ +N+V+  
Sbjct  7    GKSMWPELVRANGDAAATVIERQNRNVNAIVVREGTSVTEDLRCDRVWVWVNASNVVVRV  66

Query  206  PTIG  195
            P IG
Sbjct  67   PRIG  70



>gb|KFK29321.1| hypothetical protein AALP_AA7G118200 [Arabis alpina]
Length=72

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  383  KSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAPP  204
            K+SWPELVG +G  A + ++ ENS +   V      V  D RC+RVR+ VD N +V+  P
Sbjct  10   KTSWPELVGTNGDYAASVIKGENSGLDVAVFLDGTWVYEDLRCNRVRVWVDGNRIVVKVP  69

Query  203  TIG  195
            T+G
Sbjct  70   TVG  72



>ref|XP_008391169.1| PREDICTED: glu S.griseus protease inhibitor-like [Malus domestica]
Length=76

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -1

Query  389  NGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRC--DRVRIGVDCNNLV  216
             GK  WPEL+G  G VAKAT++ ENS V   +V +   V AD RC  DRVR+ VD +  V
Sbjct  10   EGKYVWPELLGAKGTVAKATIKRENSTVKVEIVVEGTIVPADLRCVADRVRVWVDTDGFV  69

Query  215  IAPPTIG  195
               P IG
Sbjct  70   TRVPIIG  76



>ref|XP_006363695.1| PREDICTED: trypsin inhibitor 1-like [Solanum tuberosum]
Length=89

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -1

Query  392  CNG-KSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCNNL  219
            C G K +WPELVGV   +A+ T++ ENS +T V  V    PVTADF C+RVR+ V+  + 
Sbjct  22   CPGLKVTWPELVGVPAKLARETIQKENSRLTIVPSVLSGSPVTADFSCNRVRLFVNVIDF  81

Query  218  VIAPPTIG  195
            V+  P IG
Sbjct  82   VVQVPRIG  89



>ref|XP_010650045.1| PREDICTED: uncharacterized protein LOC104879281 [Vitis vinifera]
Length=418

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVD  231
            M+   +GKSSWPELVGV G  A A +E EN  V A VV +   VT DFRCDRVR+ VD
Sbjct  1    MTTCPDGKSSWPELVGVHGEAAAAIIERENLNVKAGVVKEGTLVTTDFRCDRVRVWVD  58



>ref|XP_008224405.1| PREDICTED: glu S.griseus protease inhibitor-like [Prunus mume]
Length=75

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GKSSWPELVG  G  A AT+  EN  + A  + +   +T DFR DRVR+ +D   +V A 
Sbjct  12   GKSSWPELVGTKGEEAVATIMKENPSLKAHTINQGSFITMDFRRDRVRVWIDEQGVVTAA  71

Query  206  PTI  198
            P I
Sbjct  72   PKI  74



>ref|XP_006281379.1| hypothetical protein CARUB_v10027439mg, partial [Capsella rubella]
 gb|EOA14277.1| hypothetical protein CARUB_v10027439mg, partial [Capsella rubella]
Length=97

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = -1

Query  416  TKLRMSFICN--GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVR  243
            T+ +M+ IC   GKSSWPEL+G  G  AK  +E EN  + AV++ +   V   F C RV 
Sbjct  22   TQEKMTSICEDPGKSSWPELMGTRGEYAKEVIERENPKMRAVIILEGTAVREIFICSRVY  81

Query  242  IGVDCNNLVIAPPTIG  195
            + V+   +V+  PTIG
Sbjct  82   VWVNDYGVVVLVPTIG  97



>ref|WP_017621294.1| hypothetical protein [Nocardiopsis gilva]
Length=111

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 2/63 (3%)
 Frame = -1

Query  395  ICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRI--GVDCNN  222
             C GK  WPEL G    +AK  +E EN  VTA ++ +  PVT DFRCDRV +   VD   
Sbjct  42   FCKGKQEWPELAGAPAKMAKEIIERENPYVTAKILPEGSPVTLDFRCDRVWLFHEVDSPQ  101

Query  221  LVI  213
            L++
Sbjct  102  LLL  104



>ref|XP_009774947.1| PREDICTED: trypsin inhibitor 1 [Nicotiana sylvestris]
 sp|Q02214.1|ITR1_NICSY RecName: Full=Trypsin inhibitor 1; AltName: Full=NSTI-I; AltName: 
Full=Trypsin inhibitor I; Flags: Precursor [Nicotiana sylvestris]
 gb|AAA34067.1| pre-pro-proteinase inhibitor I [Nicotiana sylvestris]
Length=94

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -1

Query  389  NGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            N K +WPEL+GV    A+  ++ ENS +T V  V    PVT DFRC+RVR+ V+  + V+
Sbjct  29   NKKETWPELIGVPAKFAREIIQKENSKLTNVPSVLNGSPVTKDFRCERVRLFVNVLDFVV  88

Query  212  APPTIG  195
              P +G
Sbjct  89   QIPRVG  94



>ref|XP_006363673.1| PREDICTED: trypsin inhibitor 1-like [Solanum tuberosum]
Length=95

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = -1

Query  392  CNG--KSSWPELVGVDGFVAKATVESENSLVTAVV-VFKKCPVTADFRCDRVRIGVDCNN  222
            C G  KSSWPEL+GV   +A+  ++ EN  +T V+ V     VTADFRCDRVR+ V+  +
Sbjct  27   CQGVTKSSWPELLGVPAKLAREIIQKENPKLTKVLNVPNGSIVTADFRCDRVRLYVNILD  86

Query  221  LVIAPPTIG  195
              +  P+IG
Sbjct  87   FTVRTPSIG  95



>ref|XP_006363669.1| PREDICTED: trypsin inhibitor 1-like [Solanum tuberosum]
Length=94

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -1

Query  383  KSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            K +WPEL+GV   +A+ T++ EN  +T V  V    PVT DFRCDRVR+ V+  + V+  
Sbjct  31   KDTWPELLGVPARLARETIQKENPRLTNVGNVLNGSPVTQDFRCDRVRLFVNVLDFVVQI  90

Query  206  PTIG  195
            P +G
Sbjct  91   PRVG  94



>gb|AIT42235.1| proteinase inhibitor 1, partial [Solanum tuberosum]
Length=104

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRI  240
            +L   F CNGK  WP+L+GV   +A   +E ENSL+  V ++    PVT D+RC+R+R+
Sbjct  42   ELLKEFECNGKQFWPKLIGVPTKLANEIIEKENSLINNVQILLNGSPVTMDYRCNRLRL  100



>ref|XP_004247656.1| PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]
Length=111

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESEN-SLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLV  216
            C GK  WPEL+GV    AK  +E EN S+    ++    PVT DFRCDRVR+ V+    V
Sbjct  45   CKGKQFWPELIGVPAQYAKGIIEKENPSIANIPILLNGSPVTKDFRCDRVRLFVNILGDV  104

Query  215  IAPPTI  198
            +  P +
Sbjct  105  VQIPRV  110



>ref|XP_006420156.1| hypothetical protein CICLE_v10007022mg, partial [Citrus clementina]
 gb|ESR33396.1| hypothetical protein CICLE_v10007022mg, partial [Citrus clementina]
Length=62

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            GK SWPELVG++G  A   + +EN  V A  V +   VTADFRCDRVR+ V+ +
Sbjct  8    GKGSWPELVGMNGEAAAHIIMAENPKVGATTVDENAIVTADFRCDRVRVFVNAH  61



>ref|XP_010094275.1| Glu S.griseus protease inhibitor [Morus notabilis]
 gb|EXB55549.1| Glu S.griseus protease inhibitor [Morus notabilis]
Length=75

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -1

Query  410  LRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGV  234
            L M+    GK+SWPELVG++  VA+  ++SEN  VT+V +V +   VT + R DR R+ V
Sbjct  3    LNMASNSQGKNSWPELVGMNSDVAEKKIKSENPSVTSVNIVPEGSFVTMEIRSDRARVWV  62

Query  233  DCNNLVIAPPTIG  195
            + N +V   P IG
Sbjct  63   NENGIVTRVPIIG  75



>gb|KDP42136.1| hypothetical protein JCGZ_03193 [Jatropha curcas]
Length=181

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 5/72 (7%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGV  234
            KL +S     K+SWPEL+G +G  A A +E EN  V A+V+ +  PV  DFRCDRV + V
Sbjct  114  KLELS-----KNSWPELLGANGKAAAALIEKENKYVHAIVLKEGTPVPRDFRCDRVWVWV  168

Query  233  DCNNLVIAPPTI  198
            +   +V+  P I
Sbjct  169  NECGVVVRVPII  180



>ref|NP_001189707.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
 gb|AEC09609.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
Length=88

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGV  234
                SF   GK+SWPEL+G +G  A + ++ ENS +  VVV     VT D  C RVR+ V
Sbjct  16   NFYFSFFDIGKNSWPELLGTNGDYAASVIKGENSSLNVVVVSDGNYVTEDLSCYRVRVWV  75

Query  233  DCNNLVIAPPTIG  195
            D   +V+  PT G
Sbjct  76   DEIRIVVRNPTAG  88



>emb|CCW27997.1| serine protease inhibitor [Hevea brasiliensis]
Length=70

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C  K +WPEL+G +G +A   +E+EN+ V A+V+ K  P+T ++   RV + VD N
Sbjct  1    MASQCPVKDAWPELIGTNGDIAAGIIETENANVKAIVLKKGSPMTMEYNLCRVLVFVDDN  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   RVVTQAPAIG  70



>ref|XP_006281404.1| hypothetical protein CARUB_v10027471mg [Capsella rubella]
 gb|EOA14302.1| hypothetical protein CARUB_v10027471mg [Capsella rubella]
Length=76

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (58%), Gaps = 6/76 (8%)
 Frame = -1

Query  404  MSFICNG------KSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVR  243
            MS IC        KSSWPELVG  G  AK  ++ EN+ VTA ++ +   V A F CDRV 
Sbjct  1    MSDICEDTAGEGMKSSWPELVGRRGEEAKEIIDRENTKVTAKIISENAIVLAVFVCDRVY  60

Query  242  IGVDCNNLVIAPPTIG  195
            + V+ N +V   P++G
Sbjct  61   VRVNDNGIVTQTPSVG  76



>gb|ABZ88804.1| protease inhibitor protein [Hevea brasiliensis]
Length=70

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C  K +WPEL+G +G +A   +E+EN+ V A+V+ K  P+T ++   RV + VD N
Sbjct  1    MASQCPVKDAWPELIGTNGDIAAGIIETENANVKAIVLKKGSPMTMEYNLCRVLVFVDDN  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   RVVTQAPVIG  70



>sp|P86971.1|ITI_FAGTA RecName: Full=Trypsin inhibitor; Short=FtTI [Fagopyrum tataricum]
Length=86

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 43/73 (59%), Gaps = 13/73 (18%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCP--------VTADFRCDRVRIGVD  231
            GK SWPELVG  G  A AT++ EN+ VTAV+    CP         T DFRCDRVR+ ++
Sbjct  18   GKQSWPELVGTKGKTAAATIDKENTHVTAVL----CPPLTTLAACRTFDFRCDRVRVLIN  73

Query  230  -CNNLVIAPPTIG  195
                +V   PT+G
Sbjct  74   RIGGVVTKTPTVG  86



>ref|XP_007224909.1| hypothetical protein PRUPE_ppa021973mg [Prunus persica]
 gb|EMJ26108.1| hypothetical protein PRUPE_ppa021973mg [Prunus persica]
Length=75

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GKSSWPELVG  G  A AT+  EN  + A  + +   +T D R DRVR+ +D   +V A 
Sbjct  12   GKSSWPELVGTKGEEAVATIMKENPSLKAHTINQGSFITMDHRRDRVRVWIDEQGVVTAA  71

Query  206  PTI  198
            P I
Sbjct  72   PKI  74



>gb|AGI36543.1| trypsin inhibitor [Fagopyrum tataricum]
Length=87

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 43/73 (59%), Gaps = 13/73 (18%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCP--------VTADFRCDRVRIGVD  231
            GK SWPELVG  G  A AT++ EN+ VTAV+    CP         T DFRCDRVR+ ++
Sbjct  19   GKQSWPELVGTKGKTAAATIDKENAHVTAVL----CPPLTTLATCRTFDFRCDRVRVLIN  74

Query  230  -CNNLVIAPPTIG  195
                +V   PT+G
Sbjct  75   RIGGVVTKTPTVG  87



>ref|NP_001275282.1| proteinase inhibitor 1 PPI2C1A precursor [Solanum tuberosum]
 gb|AAZ08247.1| proteinase inhibitor 1 PPI2C4 [Solanum tuberosum]
Length=100

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -1

Query  413  KLRMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRC  255
            +L   F CNGK SWPEL+GV   +AK  +E ENSL+T V ++    PVT DF C
Sbjct  34   ELLKEFQCNGKLSWPELIGVPTKLAKEIIEKENSLITNVQILLNGSPVTKDFSC  87



>gb|AID52862.1| serine protease inhibitor [Hevea brasiliensis]
Length=70

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C  K +WPEL+G +G +A   +E+EN+ V A+VV +  P+T ++   RV + VD N
Sbjct  1    MASQCPVKDAWPELIGTNGDIAAGIIETENANVKAIVVKEGSPMTMEYNLCRVLVFVDDN  60

Query  224  NLVIAPPTIG  195
             +V   P IG
Sbjct  61   RVVTQAPAIG  70



>ref|XP_004288453.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Fragaria 
vesca subsp. vesca]
Length=72

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTA-VVVFKKCPVTADFRCDRVRIGVDC  228
            MS  C GK SWPELVG  G VAK  +E EN  VTA +VV  +  V  D+ C RV + VD 
Sbjct  1    MSSECEGKGSWPELVGEHGEVAKGKIERENPNVTARIVVDGEMYVITDYDCFRVWVWVDK  60

Query  227  NN-LVIAPPTIG  195
            ++  V+  P IG
Sbjct  61   DDGTVVKTPIIG  72



>gb|KCW57407.1| hypothetical protein EUGRSUZ_H00190 [Eucalyptus grandis]
Length=70

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GKS WPELVGV+  VA ATV++EN  V  V+V     V  DF C RV I V+  
Sbjct  1    MADGCKGKSKWPELVGVEEHVAAATVDAENPNVKTVIVPGGSLVPDDFVCTRVWIWVNKA  60

Query  224  NLVIAPPTIG  195
              V   P IG
Sbjct  61   GYVFQVPIIG  70



>ref|XP_006367783.1| PREDICTED: proteinase inhibitor 1-like [Solanum tuberosum]
Length=90

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCNNLV  216
            C GK  WPEL+GV   +AK  +E ENSL+  V ++    PV  D+RC+RVR+  +    V
Sbjct  24   CKGKLFWPELIGVPTKLAKEIIEKENSLINDVQIILSGSPVPLDYRCNRVRLVDNILGSV  83

Query  215  IAPPTIG  195
            +  P +G
Sbjct  84   VQIPVVG  90



>gb|ABP01767.1| ptoteinase inhibitor 2 [Salvia miltiorrhiza]
Length=71

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GK SWPELVGV G  A   +  ENSLV  ++  +  P+T DFRCDRV + V+ + +V   
Sbjct  8    GKDSWPELVGVCGREAAKVISEENSLVNPLIWGENQPITRDFRCDRVFVFVNDSGIVTRV  67

Query  206  PTI  198
            P +
Sbjct  68   PMV  70



>gb|KGN44697.1| hypothetical protein Csa_7G372910 [Cucumis sativus]
Length=70

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCN  225
            M+  C GK +WPEL+G     AK+ +  EN  V   V+ +   VT D RCDRVR+ V+ +
Sbjct  1    MALWCRGKMAWPELLGTRSEEAKSRIVKENPYVDVAVIREGRVVTFDIRCDRVRVWVNRD  60

Query  224  NLVIAPPTIG  195
             +V   P +G
Sbjct  61   GVVTRIPFVG  70



>gb|KGN49621.1| hypothetical protein Csa_5G027950 [Cucumis sativus]
Length=75

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -1

Query  407  RMSFICNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDC  228
            ++ F  +GKSSWPELV V   VA   +E +   V  VV+    PVT D R +RVRI V+ 
Sbjct  5    KIVFPSSGKSSWPELVFVKSSVAVHWIERDRPDVKPVVLLAGSPVTEDLRPNRVRIFVNM  64

Query  227  NNLVIAPPTIG  195
            N+ V+  P  G
Sbjct  65   NDRVVEVPRTG  75



>emb|CDO99179.1| unnamed protein product [Coffea canephora]
Length=71

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = -1

Query  404  MSFICNGKSSWPELVGVDGFVAKATVESENSLV-TAVVVFKKCPVTADFRCDRVRIGVDC  228
            MS    GK+SWPELVG DG  A A +E EN  V  A+VV +   VT DFRC RV + V+ 
Sbjct  1    MSECPAGKNSWPELVGEDGDKAAAKIEQENQRVKKAIVVDESAIVTTDFRCARVWVFVNK  60

Query  227  NNLVIAPPTIG  195
               V   P IG
Sbjct  61   EGKVSVVPKIG  71



>ref|XP_009047357.1| hypothetical protein LOTGIDRAFT_230585 [Lottia gigantea]
 gb|ESP02199.1| hypothetical protein LOTGIDRAFT_230585 [Lottia gigantea]
Length=65

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
             K+ WPELVG+    A+A ++ ENS +T  ++ +  PVT D+R DRVRI  +  N V   
Sbjct  2    SKTEWPELVGLPAQEAEAKIKEENSNLTVHILPELSPVTMDYREDRVRIFTNAENKVSQV  61

Query  206  PTIG  195
            P  G
Sbjct  62   PRTG  65



>ref|NP_030438.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
 gb|AAC79627.2| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAM62978.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAO42265.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAO63946.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AEC09608.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
Length=73

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GK+SWPEL+G +G  A + ++ ENS +  VVV     VT D  C RVR+ VD   +V+  
Sbjct  10   GKNSWPELLGTNGDYAASVIKGENSSLNVVVVSDGNYVTEDLSCYRVRVWVDEIRIVVRN  69

Query  206  PTIG  195
            PT G
Sbjct  70   PTAG  73



>ref|XP_004247660.1| PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]
 sp|P05118.1|ICI1_SOLLC RecName: Full=Wound-induced proteinase inhibitor 1; AltName: 
Full=Wound-induced proteinase inhibitor I; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34199.1| wound-induced proteinase inhibitor I prepropeptide [Solanum lycopersicum]
 gb|AAA34200.1| proteinase inhibitor I [Solanum lycopersicum]
Length=111

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = -1

Query  401  SFICNGKSSWPELVGVDGFVAKATVESENSLVTAV-VVFKKCPVTADFRCDRVRIGVDCN  225
            + +C GK  WPEL+GV   +AK  +E EN  +T + ++    P+T D+ CDRVR+  +  
Sbjct  42   NLMCEGKQMWPELIGVPTKLAKEIIEKENPSITNIPILLSGSPITLDYLCDRVRLFDNIL  101

Query  224  NLVIAPPTI  198
              V+  P +
Sbjct  102  GFVVQMPVV  110



>gb|ABB96723.1| proteinase inhibitor BTIw1 [Fagopyrum esculentum]
Length=72

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = -1

Query  404  MSFI--CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVD  231
            M+++  C+GK  WPELVG  G  A   +E+EN  V A+V+ +   V  D RCDRV + VD
Sbjct  1    MAYLRQCSGKQEWPELVGERGSKAAKIIENENEDVRAIVLPEGSGVPRDLRCDRVWVFVD  60

Query  230  CNNLVIAPPTI  198
               +V+  P +
Sbjct  61   ERGVVVDTPVV  71



>gb|AAB35320.1| BWI-1=protease inhibitor/trypsin inhibitor [Fagopyrum esculentum=buckwheat 
plants, cv. Shatilovskaya-5, seeds, Peptide, 69 
aa]
 gb|AAP84344.2| proteinase inhibitor [Fagopyrum esculentum]
Length=69

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVI  213
            C+GK  WPELVG  G  A   +E+EN  V A+V+ +   V  D RCDRV + VD   +V+
Sbjct  4    CSGKQEWPELVGERGSKAAKIIENENEDVRAIVLPEGSAVPRDLRCDRVWVFVDERGVVV  63

Query  212  APPTI  198
              P +
Sbjct  64   DTPVV  68



>ref|XP_008235797.1| PREDICTED: proteinase inhibitor-like [Prunus mume]
Length=125

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = -1

Query  386  GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVDCNNLVIAP  207
            GK SWPE+VG  G  A A +E EN  V A+V+ +    T D RCDRV + V+ N  V   
Sbjct  62   GKKSWPEVVGQSGEDAAAKIERENHNVRAIVIPEGSATTLDRRCDRVWVWVNRNGTVTKA  121

Query  206  PTIG  195
            P +G
Sbjct  122  PKVG  125


 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = -1

Query  392  CNGKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVR  243
            C  K SWPE+VG  G  A A +E EN  V A+V+ K  P T D R  R R
Sbjct  4    CPSKKSWPEVVGQSGEDAAARIERENHNVIAIVILKGSPTTRDMRRKRAR  53



>ref|XP_006281417.1| hypothetical protein CARUB_v10027484mg [Capsella rubella]
 gb|EOA14315.1| hypothetical protein CARUB_v10027484mg [Capsella rubella]
Length=72

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = -1

Query  404  MSFICN--GKSSWPELVGVDGFVAKATVESENSLVTAVVVFKKCPVTADFRCDRVRIGVD  231
            M+ IC   GKSSWPEL+G  G  AK  +E EN  + AV++     V   F C RV + V+
Sbjct  1    MTSICEDPGKSSWPELIGTRGEYAKEVIERENPKMGAVIILDGTAVPEIFICSRVYVWVN  60

Query  230  CNNLVIAPPTIG  195
               +V+  PTIG
Sbjct  61   DLGVVVQVPTIG  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508381126058