BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9496_g1_i1 len=1354 path=[1332:0-1353]

Length=1354
                                                                      Score     E

ref|XP_009621417.1|  PREDICTED: putative pectinesterase 11              469   4e-160   
emb|CAN79458.1|  hypothetical protein VITISV_004378                     466   2e-159   Vitis vinifera
ref|XP_009803587.1|  PREDICTED: putative pectinesterase 11              466   3e-159   
emb|CBI37658.3|  unnamed protein product                                462   2e-157   
ref|XP_002280496.3|  PREDICTED: putative pectinesterase 11              461   2e-157   Vitis vinifera
ref|XP_006365130.1|  PREDICTED: putative pectinesterase 11-like         454   7e-155   
emb|CDO97038.1|  unnamed protein product                                449   1e-152   
ref|XP_010315307.1|  PREDICTED: putative pectinesterase 11              447   1e-151   
ref|XP_006469311.1|  PREDICTED: putative pectinesterase 11-like         446   5e-151   
ref|XP_006423289.1|  hypothetical protein CICLE_v10029966mg             444   5e-151   
ref|XP_007017570.1|  Pectinesterase 11                                  442   6e-150   
ref|XP_010088935.1|  Putative pectinesterase 11                         440   2e-149   
ref|XP_010102075.1|  Putative pectinesterase 11                         434   9e-145   
ref|XP_002512914.1|  Pectinesterase-3 precursor, putative               428   2e-144   Ricinus communis
ref|XP_008220902.1|  PREDICTED: putative pectinesterase 11              426   2e-143   
ref|XP_007042164.1|  Laccase 11                                         442   4e-143   
ref|XP_002281308.1|  PREDICTED: putative pectinesterase 11              424   1e-142   Vitis vinifera
emb|CBI19714.3|  unnamed protein product                                424   1e-141   
ref|XP_004295972.1|  PREDICTED: putative pectinesterase 11-like         421   2e-141   
ref|XP_011074601.1|  PREDICTED: putative pectinesterase 11              418   1e-140   
ref|XP_007224477.1|  hypothetical protein PRUPE_ppa022374mg             417   3e-140   
ref|XP_008460943.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    416   3e-140   
ref|XP_009366010.1|  PREDICTED: putative pectinesterase 11              417   5e-140   
ref|XP_010064558.1|  PREDICTED: putative pectinesterase 11              416   6e-140   
ref|XP_008388044.1|  PREDICTED: putative pectinesterase 11              415   3e-139   
ref|XP_010526612.1|  PREDICTED: putative pectinesterase 11              416   3e-139   
ref|XP_010263632.1|  PREDICTED: laccase-11-like                         430   3e-138   
ref|XP_010064557.1|  PREDICTED: putative pectinesterase 11              410   9e-138   
ref|XP_010066169.1|  PREDICTED: putative pectinesterase 11              410   2e-137   
gb|KGN61801.1|  hypothetical protein Csa_2G248110                       408   4e-137   
ref|XP_004148862.1|  PREDICTED: putative pectinesterase 11-like         408   7e-137   
ref|XP_009336855.1|  PREDICTED: putative pectinesterase 11              408   2e-136   
ref|XP_009407032.1|  PREDICTED: putative pectinesterase 11              408   4e-136   
emb|CDY59753.1|  BnaC08g49280D                                          407   6e-136   
ref|XP_006469306.1|  PREDICTED: putative pectinesterase 11-like         407   8e-136   
ref|XP_009778331.1|  PREDICTED: putative pectinesterase 11              406   1e-135   
ref|XP_006404616.1|  hypothetical protein EUTSA_v10000702mg             405   2e-135   
gb|KDO47531.1|  hypothetical protein CISIN_1g046674mg                   402   2e-135   
ref|XP_006295983.1|  hypothetical protein CARUB_v10025126mg             405   3e-135   
ref|XP_009612493.1|  PREDICTED: putative pectinesterase 11              404   4e-135   
ref|XP_004238288.1|  PREDICTED: putative pectinesterase 11              405   5e-135   
ref|XP_010690859.1|  PREDICTED: putative pectinesterase 11              405   6e-135   
ref|XP_010254791.1|  PREDICTED: laccase-11-like                         421   1e-134   
ref|NP_179755.1|  pectinesterase 11                                     403   2e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472159.1|  PREDICTED: putative pectinesterase 11              402   4e-134   
ref|XP_006423292.1|  hypothetical protein CICLE_v10030026mg             401   8e-134   
ref|XP_006469308.1|  PREDICTED: putative pectinesterase 11-like         401   1e-133   
ref|XP_002880391.1|  pectinesterase family protein                      400   2e-133   
ref|XP_009117678.1|  PREDICTED: putative pectinesterase 11              400   4e-133   
ref|XP_009365658.1|  PREDICTED: putative pectinesterase 11              398   1e-132   
ref|XP_006469309.1|  PREDICTED: putative pectinesterase 11-like         398   2e-132   
ref|XP_006423291.1|  hypothetical protein CICLE_v10030015mg             396   3e-132   
ref|XP_006342220.1|  PREDICTED: putative pectinesterase 11-like         397   3e-132   
ref|XP_006469310.1|  PREDICTED: putative pectinesterase 11-like         396   1e-131   
gb|KDO47532.1|  hypothetical protein CISIN_1g042845mg                   395   1e-131   
ref|XP_010926015.1|  PREDICTED: laccase-11-like                         412   2e-131   
ref|XP_006423290.1|  hypothetical protein CICLE_v10029855mg             395   4e-131   
gb|KDO47533.1|  hypothetical protein CISIN_1g038331mg                   392   2e-130   
ref|XP_010429084.1|  PREDICTED: putative pectinesterase 11              390   3e-129   
ref|XP_008351045.1|  PREDICTED: putative pectinesterase 11              388   1e-128   
ref|XP_010672815.1|  PREDICTED: putative pectinesterase 11              387   2e-128   
ref|XP_010674600.1|  PREDICTED: putative pectinesterase 11              384   1e-127   
ref|XP_010672810.1|  PREDICTED: putative pectinesterase 11              383   4e-127   
ref|XP_009356538.1|  PREDICTED: uncharacterized protein LOC103947357    395   7e-127   
ref|XP_008797558.1|  PREDICTED: laccase-11-like                         399   2e-126   
ref|XP_008444730.1|  PREDICTED: putative pectinesterase 11              379   3e-125   
ref|XP_010419255.1|  PREDICTED: putative pectinesterase 11              379   5e-125   
ref|XP_004152775.1|  PREDICTED: putative pectinesterase 11-like         367   1e-120   
emb|CDY15882.1|  BnaA04g12290D                                          359   2e-117   
ref|XP_004972026.1|  PREDICTED: putative pectinesterase 11-like         355   2e-116   
ref|NP_001043660.2|  Os01g0634600                                       350   5e-114   Oryza sativa Japonica Group [Japonica rice]
gb|EMS68195.1|  Putative pectinesterase 11                              346   9e-113   
dbj|BAB90734.1|  pectinesterase-like                                    345   1e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003566924.2|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    345   2e-112   
gb|KDO43670.1|  hypothetical protein CISIN_1g039481mg                   342   2e-112   
gb|EEC71149.1|  hypothetical protein OsI_02978                          346   3e-112   Oryza sativa Indica Group [Indian rice]
gb|KCW67860.1|  hypothetical protein EUGRSUZ_F01581                     344   3e-112   
ref|XP_006423293.1|  hypothetical protein CICLE_v10030318mg             343   8e-112   
ref|XP_002458207.1|  hypothetical protein SORBIDRAFT_03g028930          343   2e-111   Sorghum bicolor [broomcorn]
gb|KDP41783.1|  hypothetical protein JCGZ_26801                         359   2e-111   
ref|XP_002305435.2|  hypothetical protein POPTR_0004s16360g             342   2e-111   Populus trichocarpa [western balsam poplar]
ref|XP_008656697.1|  PREDICTED: putative pectinesterase 11 isofor...    342   7e-111   
ref|XP_006646134.1|  PREDICTED: putative pectinesterase 11-like         340   4e-110   
ref|XP_009335295.1|  PREDICTED: putative pectinesterase 11              341   2e-109   
ref|XP_009350041.1|  PREDICTED: putative pectinesterase 11              340   2e-109   
emb|CDM83479.1|  unnamed protein product                                338   5e-109   
ref|XP_008387960.1|  PREDICTED: putative pectinesterase 11              337   4e-108   
ref|XP_007224036.1|  hypothetical protein PRUPE_ppa015184mg             337   3e-107   
ref|XP_008656696.1|  PREDICTED: putative pectinesterase 11 isofor...    330   3e-106   
ref|XP_008220903.1|  PREDICTED: putative pectinesterase 11              337   3e-106   
ref|XP_007221726.1|  hypothetical protein PRUPE_ppb020245mg             321   2e-102   
ref|XP_008220901.1|  PREDICTED: putative pectinesterase 11              320   9e-102   
ref|XP_008388162.1|  PREDICTED: putative pectinesterase 11              316   4e-98    
gb|AFW83376.1|  hypothetical protein ZEAMMB73_849858                    308   4e-97    
ref|XP_009365999.1|  PREDICTED: putative pectinesterase 11              313   6e-97    
ref|XP_009336866.1|  PREDICTED: putative pectinesterase 11              313   6e-97    
gb|EMT14397.1|  Putative pectinesterase 11                              299   4e-95    
ref|XP_004293209.1|  PREDICTED: putative pectinesterase 11-like         300   1e-92    
ref|XP_010535938.1|  PREDICTED: probable pectinesterase 53              296   4e-92    
ref|XP_006287923.1|  hypothetical protein CARUB_v10001159mg             295   6e-92    
emb|CBI27989.3|  unnamed protein product                                292   1e-91    
ref|XP_006400534.1|  hypothetical protein EUTSA_v10013810mg             294   2e-91    
ref|XP_009120862.1|  PREDICTED: probable pectinesterase 53              293   3e-91    
emb|CDY68784.1|  BnaCnng60500D                                          290   4e-91    
ref|XP_010656255.1|  PREDICTED: probable pectinesterase 53              293   5e-91    
ref|XP_001769817.1|  predicted protein                                  291   8e-91    
emb|CAN63186.1|  hypothetical protein VITISV_037092                     292   9e-91    Vitis vinifera
ref|XP_010420786.1|  PREDICTED: probable pectinesterase 53 isofor...    292   9e-91    
ref|XP_010493050.1|  PREDICTED: probable pectinesterase 53              292   1e-90    
ref|XP_004287482.1|  PREDICTED: probable pectinesterase 53-like         291   2e-90    
ref|NP_197474.1|  probable pectinesterase 53                            291   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454257.1|  PREDICTED: probable pectinesterase 53              291   3e-90    
ref|XP_010324275.1|  PREDICTED: pectinesterase QRT1                     290   3e-90    
ref|XP_006346251.1|  PREDICTED: pectinesterase QRT1-like                290   3e-90    
ref|XP_006371972.1|  hypothetical protein POPTR_0018s06820g             291   6e-90    
ref|XP_011009863.1|  PREDICTED: probable pectinesterase 53              290   9e-90    
ref|XP_010267113.1|  PREDICTED: probable pectinesterase 53              289   1e-89    
ref|XP_006475590.1|  PREDICTED: probable pectinesterase 53-like i...    286   4e-89    
ref|XP_006853729.1|  hypothetical protein AMTR_s00056p00166920          288   4e-89    
ref|XP_010688346.1|  PREDICTED: probable pectinesterase 53              288   5e-89    
ref|XP_006475589.1|  PREDICTED: probable pectinesterase 53-like i...    287   6e-89    
ref|XP_010249481.1|  PREDICTED: probable pectinesterase 53              287   7e-89    
gb|KEH27219.1|  pectinesterase                                          287   7e-89    
ref|XP_002962215.1|  hypothetical protein SELMODRAFT_165098             286   8e-89    
ref|XP_002965129.1|  hypothetical protein SELMODRAFT_167160             286   1e-88    
ref|XP_010915080.1|  PREDICTED: probable pectinesterase 53 isofor...    286   1e-88    
ref|XP_002871903.1|  pectinesterase family protein                      286   1e-88    
ref|XP_004969916.1|  PREDICTED: probable pectinesterase 53-like         287   2e-88    
gb|KHG26932.1|  putative pectinesterase 53 -like protein                285   4e-88    
ref|XP_004503496.1|  PREDICTED: probable pectinesterase 53-like         285   4e-88    
ref|XP_008387348.1|  PREDICTED: probable pectinesterase 53              285   4e-88    
ref|XP_008804057.1|  PREDICTED: probable pectinesterase 53              285   6e-88    
emb|CDY42290.1|  BnaC02g08960D                                          285   6e-88    
ref|XP_003567104.1|  PREDICTED: probable pectinesterase 53 isofor...    285   6e-88    
ref|XP_009126386.1|  PREDICTED: probable pectinesterase 53              285   6e-88    
ref|XP_007204399.1|  hypothetical protein PRUPE_ppa007112mg             284   1e-87    
ref|XP_002964788.1|  hypothetical protein SELMODRAFT_83442              282   1e-87    
ref|NP_001044216.1|  Os01g0743200                                       284   1e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406173.1|  PREDICTED: probable pectinesterase 53 isofor...    284   1e-87    
ref|XP_004251642.1|  PREDICTED: probable pectinesterase 53              284   2e-87    
ref|XP_004961453.1|  PREDICTED: probable pectinesterase 53-like i...    284   2e-87    
ref|XP_006451320.1|  hypothetical protein CICLE_v10010616mg             283   2e-87    
ref|XP_002968924.1|  hypothetical protein SELMODRAFT_65663              280   3e-87    
ref|XP_008242479.1|  PREDICTED: probable pectinesterase 53              283   3e-87    
ref|XP_004135808.1|  PREDICTED: probable pectinesterase 53-like         283   3e-87    
ref|XP_010049610.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    283   3e-87    
ref|XP_002961718.1|  hypothetical protein SELMODRAFT_76693              281   4e-87    
ref|XP_008450789.1|  PREDICTED: probable pectinesterase 53              283   4e-87    
gb|KGN66185.1|  hypothetical protein Csa_1G575010                       283   4e-87    
ref|XP_004158420.1|  PREDICTED: probable pectinesterase 53-like         283   4e-87    
ref|XP_008337605.1|  PREDICTED: probable pectinesterase 53              283   5e-87    
ref|XP_002976448.1|  hypothetical protein SELMODRAFT_104861             282   5e-87    
ref|XP_011093645.1|  PREDICTED: probable pectinesterase 53 isofor...    283   5e-87    
gb|KDP33787.1|  hypothetical protein JCGZ_07358                         282   5e-87    
ref|XP_008656475.1|  PREDICTED: probable pectinesterase 53 isofor...    283   6e-87    
ref|XP_008352338.1|  PREDICTED: probable pectinesterase 53              282   6e-87    
ref|XP_007013011.1|  Pectin lyase-like superfamily protein isoform 1    282   6e-87    
ref|XP_007152966.1|  hypothetical protein PHAVU_004G175200g             282   7e-87    
ref|XP_010915072.1|  PREDICTED: probable pectinesterase 53 isofor...    282   7e-87    
ref|XP_002514210.1|  Pectinesterase PPE8B precursor, putative           282   8e-87    Ricinus communis
gb|EEC79546.1|  hypothetical protein OsI_20666                          282   8e-87    Oryza sativa Indica Group [Indian rice]
ref|NP_001056077.1|  Os05g0521600                                       282   8e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008649911.1|  PREDICTED: probable pectinesterase 53              283   1e-86    
ref|XP_008657240.1|  PREDICTED: probable pectinesterase 53              282   1e-86    
ref|XP_009764658.1|  PREDICTED: pectinesterase QRT1                     280   2e-86    
ref|XP_003530551.1|  PREDICTED: probable pectinesterase 53-like i...    281   2e-86    
ref|XP_004513038.1|  PREDICTED: probable pectinesterase 53-like         281   2e-86    
ref|XP_009352561.1|  PREDICTED: probable pectinesterase 53              281   2e-86    
ref|XP_008673062.1|  PREDICTED: pectinesterase isoform X1               281   3e-86    
ref|XP_003524409.1|  PREDICTED: probable pectinesterase 53-like         280   3e-86    
ref|XP_006353578.1|  PREDICTED: probable pectinesterase 53-like         280   3e-86    
gb|KHG28421.1|  putative pectinesterase 53 -like protein                280   3e-86    
ref|XP_002440102.1|  hypothetical protein SORBIDRAFT_09g026060          281   4e-86    Sorghum bicolor [broomcorn]
ref|XP_002975044.1|  hypothetical protein SELMODRAFT_102829             278   5e-86    
ref|XP_010110876.1|  putative pectinesterase 53                         280   5e-86    
ref|XP_002979836.1|  hypothetical protein SELMODRAFT_55472              276   6e-86    
ref|XP_009591684.1|  PREDICTED: probable pectinesterase 53              280   7e-86    
ref|XP_003630703.1|  Pectinesterase                                     279   9e-86    
ref|XP_003566023.2|  PREDICTED: probable pectinesterase 53              278   1e-85    
ref|XP_009602719.1|  PREDICTED: pectinesterase QRT1                     278   2e-85    
gb|KHN26987.1|  Putative pectinesterase 53                              278   2e-85    
emb|CDY44939.1|  BnaA02g04440D                                          281   2e-85    
ref|XP_003529058.2|  PREDICTED: probable pectinesterase 53-like         278   2e-85    
ref|XP_006646312.1|  PREDICTED: probable pectinesterase 53-like         278   2e-85    
ref|XP_002974192.1|  hypothetical protein SELMODRAFT_101090             276   2e-85    
ref|XP_008656474.1|  PREDICTED: probable pectinesterase 53 isofor...    278   3e-85    
gb|AFK39158.1|  unknown                                                 278   3e-85    
ref|XP_001774315.1|  predicted protein                                  275   4e-85    
gb|EYU30697.1|  hypothetical protein MIMGU_mgv1a024695mg                277   4e-85    
ref|XP_007160279.1|  hypothetical protein PHAVU_002G308000g             277   4e-85    
gb|EMT24197.1|  Pectinesterase QRT1                                     277   5e-85    
ref|XP_011093643.1|  PREDICTED: probable pectinesterase 53 isofor...    277   5e-85    
ref|XP_010679844.1|  PREDICTED: probable pectinesterase 53              277   6e-85    
gb|KHN40374.1|  Putative pectinesterase 53                              275   6e-85    
emb|CDP03246.1|  unnamed protein product                                276   6e-85    
ref|XP_011078244.1|  PREDICTED: probable pectinesterase 53              277   6e-85    
ref|XP_009602721.1|  PREDICTED: pectinesterase QRT1-like                276   7e-85    
ref|XP_009402793.1|  PREDICTED: probable pectinesterase 53              277   7e-85    
ref|XP_002962216.1|  hypothetical protein SELMODRAFT_76951              276   9e-85    
emb|CDY06568.1|  BnaC02g12920D                                          276   1e-84    
ref|XP_010064980.1|  PREDICTED: pectinesterase QRT1                     275   2e-84    
ref|XP_003516527.2|  PREDICTED: probable pectinesterase 53-like         276   2e-84    
gb|KCW70485.1|  hypothetical protein EUGRSUZ_F03696                     275   2e-84    
ref|XP_002965130.1|  hypothetical protein SELMODRAFT_83276              275   2e-84    
ref|XP_008653334.1|  PREDICTED: pectinesterase QRT1 isoform X1          275   3e-84    
gb|KHN14256.1|  Putative pectinesterase 53                              275   4e-84    
ref|XP_001752210.1|  predicted protein                                  275   4e-84    
emb|CDY20756.1|  BnaA02g08960D                                          275   4e-84    
ref|XP_010271483.1|  PREDICTED: probable pectinesterase 53              275   5e-84    
ref|XP_001785334.1|  predicted protein                                  272   6e-84    
ref|XP_010505218.1|  PREDICTED: probable pectinesterase 15              275   7e-84    
gb|KDP46694.1|  hypothetical protein JCGZ_06482                         274   8e-84    
ref|XP_002458469.1|  hypothetical protein SORBIDRAFT_03g034250          275   8e-84    Sorghum bicolor [broomcorn]
gb|EYU27429.1|  hypothetical protein MIMGU_mgv1a008712mg                273   8e-84    
ref|XP_009599854.1|  PREDICTED: probable pectinesterase 53              273   1e-83    
ref|XP_009126995.1|  PREDICTED: pectinesterase QRT1-like                273   2e-83    
ref|XP_011095807.1|  PREDICTED: pectinesterase QRT1-like                273   2e-83    
ref|XP_006654665.1|  PREDICTED: probable pectinesterase 53-like         273   2e-83    
ref|XP_004244060.1|  PREDICTED: pectinesterase QRT1-like                272   3e-83    
ref|XP_010936490.1|  PREDICTED: pectinesterase QRT1-like                272   3e-83    
ref|XP_010675900.1|  PREDICTED: pectinesterase QRT1                     272   3e-83    
ref|NP_001167796.1|  pectinesterase precursor                           273   3e-83    Zea mays [maize]
ref|XP_010037120.1|  PREDICTED: probable pectinesterase 15              273   4e-83    
ref|XP_009411137.1|  PREDICTED: pectinesterase QRT1                     271   4e-83    
ref|XP_006340937.1|  PREDICTED: probable pectinesterase 53-like         271   6e-83    
ref|XP_010936491.1|  PREDICTED: pectinesterase QRT1-like                271   6e-83    
ref|XP_010316821.1|  PREDICTED: probable pectinesterase 53              271   6e-83    
ref|XP_007145123.1|  hypothetical protein PHAVU_007G212000g             271   1e-82    
ref|XP_003631899.2|  PREDICTED: probable pectinesterase 53              271   1e-82    
ref|XP_010516895.1|  PREDICTED: probable pectinesterase 15              271   2e-82    
gb|EYU24077.1|  hypothetical protein MIMGU_mgv1a008262mg                271   2e-82    
ref|XP_009802490.1|  PREDICTED: probable pectinesterase 53              270   2e-82    
ref|XP_008355312.1|  PREDICTED: pectinesterase QRT1-like                270   2e-82    
gb|EYU27253.1|  hypothetical protein MIMGU_mgv1a022744mg                268   2e-82    
ref|XP_002531506.1|  Pectinesterase-2 precursor, putative               270   3e-82    Ricinus communis
ref|XP_001766064.1|  predicted protein                                  267   4e-82    
ref|XP_010509442.1|  PREDICTED: probable pectinesterase 15              270   4e-82    
ref|XP_010270248.1|  PREDICTED: pectinesterase QRT1                     268   7e-82    
ref|XP_002879623.1|  pectinesterase family protein                      270   8e-82    
gb|EYU27258.1|  hypothetical protein MIMGU_mgv1a025960mg                266   1e-81    
ref|XP_009406172.1|  PREDICTED: probable pectinesterase 53 isofor...    269   1e-81    
ref|XP_006452563.1|  hypothetical protein CICLE_v10010593mg             267   2e-81    
ref|XP_002459865.1|  hypothetical protein SORBIDRAFT_02g012560          270   2e-81    Sorghum bicolor [broomcorn]
ref|NP_001131435.1|  uncharacterized protein LOC100192767 precursor     266   2e-81    Zea mays [maize]
ref|XP_003559976.2|  PREDICTED: pectinesterase QRT1-like                268   2e-81    
ref|XP_002988891.1|  hypothetical protein SELMODRAFT_128677             266   3e-81    
ref|XP_009386766.1|  PREDICTED: putative pectinesterase 14              270   3e-81    
gb|KHG12413.1|  putative pectinesterase 15 -like protein                268   3e-81    
ref|XP_004961452.1|  PREDICTED: probable pectinesterase 53-like i...    269   3e-81    
ref|XP_002310842.1|  hypothetical protein POPTR_0007s13780g             266   4e-81    Populus trichocarpa [western balsam poplar]
ref|NP_181209.1|  putative pectinesterase 15                            268   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006475118.1|  PREDICTED: pectinesterase QRT1-like                266   4e-81    
ref|XP_004495886.1|  PREDICTED: probable pectinesterase 53-like         267   4e-81    
ref|XP_006380792.1|  hypothetical protein POPTR_0007s13780g             266   4e-81    
ref|XP_006401435.1|  hypothetical protein EUTSA_v10013811mg             267   5e-81    
ref|XP_007046753.1|  Pectin lyase-like superfamily protein isoform 1    266   7e-81    
gb|EPS63895.1|  pectinesterase                                          264   8e-81    
gb|KDP28296.1|  hypothetical protein JCGZ_14067                         266   8e-81    
ref|XP_011025911.1|  PREDICTED: probable pectinesterase 53              266   8e-81    
emb|CDM64037.1|  pectin methylesterase                                  265   1e-80    
ref|XP_010683975.1|  PREDICTED: probable pectinesterase 15 isofor...    267   1e-80    
gb|EMS68573.1|  Pectinesterase QRT1                                     266   1e-80    
ref|XP_009376799.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    265   1e-80    
gb|EPS61453.1|  hypothetical protein M569_13345                         263   2e-80    
ref|XP_010522833.1|  PREDICTED: probable pectinesterase 53              265   2e-80    
ref|XP_011077480.1|  PREDICTED: probable pectinesterase 15              267   2e-80    
ref|XP_007027515.1|  Pectin lyase-like superfamily protein              266   2e-80    
ref|XP_006425546.1|  hypothetical protein CICLE_v10027321mg             265   2e-80    
ref|XP_002264297.1|  PREDICTED: pectinesterase QRT1                     265   2e-80    Vitis vinifera
ref|XP_006346252.1|  PREDICTED: pectinesterase QRT1-like                263   3e-80    
ref|XP_011100946.1|  PREDICTED: probable pectinesterase 53              265   3e-80    
ref|XP_007020544.1|  Pectin lyase-like superfamily protein              264   3e-80    
ref|XP_006282268.1|  hypothetical protein CARUB_v10028546mg             265   4e-80    
ref|XP_011018831.1|  PREDICTED: probable pectinesterase 15 isofor...    266   4e-80    
gb|AAO22722.1|  putative pectinesterase family protein                  265   5e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294321.1|  hypothetical protein CARUB_v10023328mg             265   5e-80    
ref|XP_006398447.1|  hypothetical protein EUTSA_v10000935mg             263   7e-80    
ref|XP_001758990.1|  predicted protein                                  261   8e-80    
ref|XP_010935867.1|  PREDICTED: putative pectinesterase 14              265   1e-79    
ref|XP_010258939.1|  PREDICTED: probable pectinesterase 68 isofor...    262   1e-79    
ref|XP_006381362.1|  hypothetical protein POPTR_0006s12170g             265   1e-79    
ref|XP_007013013.1|  Pectin lyase-like superfamily protein isoform 3    263   1e-79    
dbj|BAK04032.1|  predicted protein                                      260   1e-79    
ref|XP_006339309.1|  PREDICTED: probable pectinesterase 15-like         261   1e-79    
emb|CDP09966.1|  unnamed protein product                                263   1e-79    
ref|XP_004249469.1|  PREDICTED: probable pectinesterase 15              263   2e-79    
ref|XP_010264302.1|  PREDICTED: probable pectinesterase 68              262   2e-79    
gb|ABD64977.1|  pectinesterase family protein                           262   2e-79    
ref|NP_200370.1|  pectinesterase QRT1                                   262   3e-79    
ref|XP_010534682.1|  PREDICTED: probable pectinesterase 15              261   3e-79    
ref|XP_001756557.1|  predicted protein                                  259   3e-79    
ref|XP_001777828.1|  predicted protein                                  259   3e-79    
ref|XP_004491500.1|  PREDICTED: pectinesterase QRT1-like                261   3e-79    
ref|XP_002964173.1|  hypothetical protein SELMODRAFT_81583              259   4e-79    
gb|EMT17971.1|  Putative pectinesterase 53                              258   4e-79    
ref|XP_010679463.1|  PREDICTED: probable pectinesterase 53              262   4e-79    
emb|CDX77772.1|  BnaC07g20260D                                          260   5e-79    
gb|EEE67559.1|  hypothetical protein OsJ_25062                          262   5e-79    
gb|EEC82420.1|  hypothetical protein OsI_26811                          262   5e-79    
ref|XP_004494095.1|  PREDICTED: probable pectinesterase 15-like         262   6e-79    
ref|XP_004293039.1|  PREDICTED: pectinesterase QRT1-like                261   8e-79    
emb|CDY59290.1|  BnaA06g39970D                                          260   8e-79    
ref|XP_002522727.1|  Pectinesterase U1 precursor, putative              261   9e-79    
ref|XP_006848989.1|  hypothetical protein AMTR_s00028p00077900          260   1e-78    
ref|XP_008809346.1|  PREDICTED: probable pectinesterase 8               261   1e-78    
ref|XP_001785149.1|  predicted protein                                  257   2e-78    
ref|XP_010098841.1|  putative pectinesterase 15                         262   2e-78    
ref|XP_010088469.1|  Pectinesterase QRT1                                259   2e-78    
ref|XP_003538735.1|  PREDICTED: probable pectinesterase 68-like         259   2e-78    
emb|CDP13731.1|  unnamed protein product                                259   2e-78    
ref|XP_007162815.1|  hypothetical protein PHAVU_001G183100g             261   2e-78    
ref|XP_003617789.1|  Pectinesterase                                     259   2e-78    
ref|XP_008787556.1|  PREDICTED: putative pectinesterase 14              262   3e-78    
gb|AFW82525.1|  hypothetical protein ZEAMMB73_386621                    260   3e-78    
gb|KDP39260.1|  hypothetical protein JCGZ_01017                         258   3e-78    
ref|XP_007142407.1|  hypothetical protein PHAVU_008G277900g             259   3e-78    
gb|KHG28220.1|  putative pectinesterase 53 -like protein                259   3e-78    
ref|XP_009101416.1|  PREDICTED: probable pectinesterase 68              259   4e-78    
ref|XP_002519425.1|  Pectinesterase PPE8B precursor, putative           259   4e-78    
ref|XP_009399936.1|  PREDICTED: probable pectinesterase 68              258   4e-78    
ref|XP_008244619.1|  PREDICTED: pectinesterase QRT1                     258   5e-78    
ref|NP_199561.1|  pectin methylesterase 5                               258   6e-78    
ref|XP_009144121.1|  PREDICTED: probable pectinesterase 15              257   7e-78    
ref|XP_002863340.1|  pectinesterase family protein                      258   7e-78    
ref|XP_006838145.1|  hypothetical protein AMTR_s00106p00092510          258   7e-78    
ref|XP_009414378.1|  PREDICTED: probable pectinesterase 53 isofor...    259   8e-78    
ref|XP_011040796.1|  PREDICTED: probable pectinesterase 53              259   8e-78    
ref|XP_004494018.1|  PREDICTED: probable pectinesterase 15-like         259   1e-77    
ref|XP_006491830.1|  PREDICTED: probable pectinesterase 15-like         258   1e-77    
ref|XP_009631932.1|  PREDICTED: putative pectinesterase 14 isofor...    259   1e-77    
ref|XP_010276487.1|  PREDICTED: probable pectinesterase 53 isofor...    258   2e-77    
ref|XP_007051206.1|  Pectinesterase                                     258   2e-77    
emb|CDY33185.1|  BnaC04g08540D                                          256   2e-77    
gb|KCW60565.1|  hypothetical protein EUGRSUZ_H03297                     256   2e-77    
ref|XP_003611307.1|  Pectinesterase                                     257   2e-77    
ref|XP_010481313.1|  PREDICTED: probable pectinesterase 68              257   2e-77    
ref|XP_010536718.1|  PREDICTED: pectinesterase QRT1                     257   2e-77    
ref|XP_009143563.1|  PREDICTED: probable pectinesterase 15              258   2e-77    
gb|EYU27427.1|  hypothetical protein MIMGU_mgv1a025315mg                257   2e-77    
ref|XP_001769271.1|  predicted protein                                  257   2e-77    
ref|XP_010449917.1|  PREDICTED: pectinesterase QRT1-like                258   2e-77    
emb|CBI31927.3|  unnamed protein product                                256   2e-77    
ref|XP_006285001.1|  hypothetical protein CARUB_v10006308mg             256   2e-77    
emb|CDP01931.1|  unnamed protein product                                257   2e-77    
ref|XP_002320279.2|  hypothetical protein POPTR_0014s11240g             257   3e-77    
gb|EPS73183.1|  pectinesterase                                          255   3e-77    
ref|XP_008653773.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    259   3e-77    
ref|XP_006428522.1|  hypothetical protein CICLE_v10013444mg             258   3e-77    
emb|CDY69057.1|  BnaCnng61650D                                          256   4e-77    
ref|XP_006280682.1|  hypothetical protein CARUB_v10026646mg             256   4e-77    
gb|ABD65006.1|  pectinesterase family protein                           255   4e-77    
ref|XP_009128974.1|  PREDICTED: probable pectinesterase 68 isofor...    256   5e-77    
ref|XP_008786957.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    255   5e-77    
ref|XP_010113388.1|  putative pectinesterase 53                         256   5e-77    
ref|XP_002266321.3|  PREDICTED: probable pectinesterase 68              257   5e-77    
gb|EYU27259.1|  hypothetical protein MIMGU_mgv1a018528mg                254   6e-77    
ref|XP_009414379.1|  PREDICTED: probable pectinesterase 53 isofor...    256   6e-77    
ref|XP_010483011.1|  PREDICTED: pectinesterase QRT1-like                256   6e-77    
gb|KDP39870.1|  hypothetical protein JCGZ_03401                         256   7e-77    
gb|EYU33537.1|  hypothetical protein MIMGU_mgv1a008469mg                256   7e-77    
gb|ABG46325.1|  putative pectin methylesterase                          255   7e-77    
ref|XP_007162301.1|  hypothetical protein PHAVU_001G140600g             256   7e-77    
ref|XP_002864400.1|  hypothetical protein ARALYDRAFT_495646             256   1e-76    
ref|XP_007214470.1|  hypothetical protein PRUPE_ppa023424mg             256   1e-76    
ref|XP_006843862.1|  hypothetical protein AMTR_s00007p00264370          255   1e-76    
ref|XP_009362614.1|  PREDICTED: probable pectinesterase 29              254   2e-76    
ref|XP_006387630.1|  hypothetical protein POPTR_0746s00200g             252   2e-76    
gb|KHG12918.1|  putative pectinesterase 53 -like protein                255   2e-76    
ref|XP_009397881.1|  PREDICTED: probable pectinesterase 68              254   2e-76    
gb|KHN42698.1|  Putative pectinesterase 68                              254   2e-76    
ref|XP_003517421.1|  PREDICTED: probable pectinesterase 68              254   2e-76    
ref|XP_011038907.1|  PREDICTED: pectinesterase QRT1                     254   2e-76    
dbj|BAB09076.1|  pectin methylesterase-like                             254   2e-76    
ref|XP_010267309.1|  PREDICTED: putative pectinesterase 14 isofor...    256   2e-76    
ref|XP_003625222.1|  hypothetical protein MTR_7g092780                  254   3e-76    
ref|XP_010443199.1|  PREDICTED: pectinesterase QRT1-like                254   3e-76    
ref|XP_008442748.1|  PREDICTED: putative pectinesterase 14 isofor...    255   3e-76    
ref|XP_006401814.1|  hypothetical protein EUTSA_v10015978mg             255   3e-76    
ref|XP_004165876.1|  PREDICTED: pectinesterase QRT1-like                253   4e-76    
gb|KDP42780.1|  hypothetical protein JCGZ_00479                         254   4e-76    
ref|XP_003571529.1|  PREDICTED: probable pectinesterase 8               254   4e-76    
gb|KFK42874.1|  hypothetical protein AALP_AA1G050100                    254   4e-76    
ref|XP_001760885.1|  predicted protein                                  250   4e-76    
gb|EYU27262.1|  hypothetical protein MIMGU_mgv1a011822mg                250   4e-76    
ref|XP_009341090.1|  PREDICTED: probable pectinesterase 15              255   5e-76    
ref|XP_009120081.1|  PREDICTED: pectinesterase QRT1                     254   5e-76    
emb|CDY17342.1|  BnaA10g09760D                                          254   5e-76    
ref|XP_010276488.1|  PREDICTED: probable pectinesterase 53 isofor...    254   5e-76    
gb|KDO54339.1|  hypothetical protein CISIN_1g039329mg                   255   7e-76    
ref|XP_011070218.1|  PREDICTED: probable pectinesterase 68              251   7e-76    
ref|XP_004150299.1|  PREDICTED: pectinesterase QRT1-like                253   8e-76    
ref|NP_001063991.1|  Os09g0571100                                       254   9e-76    
gb|ABR18283.1|  unknown                                                 252   9e-76    
gb|KGN44067.1|  hypothetical protein Csa_7G160530                       253   9e-76    
gb|KHN43888.1|  Pectinesterase QRT1                                     252   9e-76    
ref|XP_003518547.2|  PREDICTED: pectinesterase QRT1-like                253   9e-76    
ref|XP_008344163.1|  PREDICTED: putative pectinesterase 63              251   1e-75    
ref|XP_010548999.1|  PREDICTED: probable pectinesterase 67              252   1e-75    
ref|XP_003632380.2|  PREDICTED: probable pectinesterase 53              253   1e-75    
ref|XP_009118594.1|  PREDICTED: probable pectinesterase 8               253   1e-75    
emb|CDY28653.1|  BnaC09g32220D                                          253   1e-75    
gb|KHG03314.1|  putative pectinesterase 8 -like protein                 251   2e-75    
ref|XP_008241442.1|  PREDICTED: probable pectinesterase 15              253   2e-75    
ref|XP_001769270.1|  predicted protein                                  253   2e-75    
ref|XP_010026907.1|  PREDICTED: probable pectinesterase 55              251   2e-75    
ref|XP_006661576.1|  PREDICTED: probable pectinesterase 15-like         252   2e-75    
ref|XP_009374635.1|  PREDICTED: probable pectinesterase 29              251   2e-75    
ref|XP_003553567.1|  PREDICTED: probable pectinesterase 15-like         253   2e-75    
gb|EMT14071.1|  Putative pectinesterase 68                              251   2e-75    
ref|XP_002881462.1|  hypothetical protein ARALYDRAFT_902790             251   3e-75    
ref|XP_008391732.1|  PREDICTED: putative pectinesterase 63              251   3e-75    
emb|CDY33182.1|  BnaC04g08570D                                          253   3e-75    
ref|XP_003553427.1|  PREDICTED: probable pectinesterase 8-like          252   3e-75    
ref|XP_002263748.1|  PREDICTED: probable pectinesterase 29              250   3e-75    
gb|KHN26371.1|  Putative pectinesterase 8                               252   4e-75    
ref|XP_008437714.1|  PREDICTED: probable pectinesterase 68              251   4e-75    
ref|XP_004164282.1|  PREDICTED: probable pectinesterase 68-like         250   4e-75    
ref|XP_008348431.1|  PREDICTED: probable pectinesterase 29              250   5e-75    
ref|XP_004305897.1|  PREDICTED: probable pectinesterase 8-like          252   5e-75    
ref|XP_002871271.1|  pectinesterase family protein                      251   5e-75    
ref|XP_004152402.1|  PREDICTED: probable pectinesterase 68-like         250   5e-75    
ref|XP_006429777.1|  hypothetical protein CICLE_v10011953mg             251   5e-75    
ref|XP_010423208.1|  PREDICTED: probable pectinesterase 50 isofor...    251   5e-75    
gb|KFK31368.1|  hypothetical protein AALP_AA6G103300                    251   5e-75    
ref|XP_001777108.1|  predicted protein                                  248   6e-75    
ref|XP_007202075.1|  hypothetical protein PRUPE_ppa005976mg             253   6e-75    
gb|KCW60563.1|  hypothetical protein EUGRSUZ_H03295                     248   6e-75    
ref|XP_002298857.2|  hypothetical protein POPTR_0001s37440g             250   6e-75    
emb|CBI40838.3|  unnamed protein product                                249   6e-75    
ref|XP_010491359.1|  PREDICTED: probable pectinesterase 50              250   7e-75    
ref|XP_002448293.1|  hypothetical protein SORBIDRAFT_06g024730          250   7e-75    
ref|XP_010914653.1|  PREDICTED: probable pectinesterase 53              251   7e-75    
ref|XP_008242288.1|  PREDICTED: putative pectinesterase 63              250   8e-75    
ref|XP_007203100.1|  hypothetical protein PRUPE_ppa023784mg             252   8e-75    
ref|NP_196360.1|  putative pectinesterase 50                            250   8e-75    
ref|XP_009119166.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    251   9e-75    
ref|XP_008465244.1|  PREDICTED: probable pectinesterase 53              250   9e-75    
gb|EYU38584.1|  hypothetical protein MIMGU_mgv1a007131mg                252   1e-74    
gb|EEC85099.1|  hypothetical protein OsI_32473                          254   1e-74    
ref|XP_002885186.1|  pectinesterase family protein                      249   1e-74    
ref|XP_010094410.1|  putative pectinesterase 53                         250   1e-74    
gb|KCW71970.1|  hypothetical protein EUGRSUZ_E00425                     250   1e-74    
ref|XP_010240218.1|  PREDICTED: probable pectinesterase 68              249   1e-74    
ref|XP_008385919.1|  PREDICTED: pectinesterase QRT1                     249   1e-74    
ref|XP_011073122.1|  PREDICTED: probable pectinesterase 8               251   1e-74    
ref|XP_009348900.1|  PREDICTED: putative pectinesterase 63 isofor...    249   1e-74    
ref|NP_172023.1|  putative pectinesterase 8                             251   1e-74    
ref|XP_007215489.1|  hypothetical protein PRUPE_ppa006779mg             251   1e-74    
ref|XP_008224542.1|  PREDICTED: probable pectinesterase 29              249   1e-74    
ref|XP_004172449.1|  PREDICTED: probable pectinesterase 53-like         249   1e-74    
ref|XP_010654005.1|  PREDICTED: probable pectinesterase 15 isofor...    251   2e-74    
ref|XP_008669043.1|  PREDICTED: probable pectinesterase 68              249   2e-74    
ref|XP_010530051.1|  PREDICTED: probable pectinesterase 68              249   2e-74    
gb|ABK27127.1|  unknown                                                 249   2e-74    
ref|XP_010543016.1|  PREDICTED: probable pectinesterase 8               251   2e-74    
emb|CDP08865.1|  unnamed protein product                                250   2e-74    
ref|XP_001758971.1|  predicted protein                                  247   2e-74    
ref|XP_002303355.2|  hypothetical protein POPTR_0003s07460g             249   2e-74    
gb|KCW58194.1|  hypothetical protein EUGRSUZ_H00909                     250   2e-74    
ref|XP_008463039.1|  PREDICTED: pectinesterase QRT1                     249   2e-74    
gb|KFK36544.1|  hypothetical protein AALP_AA4G137600                    248   2e-74    
ref|XP_009343360.1|  PREDICTED: putative pectinesterase 63              249   2e-74    
ref|XP_004146488.1|  PREDICTED: probable pectinesterase 53-like         249   3e-74    
emb|CDX75019.1|  BnaA05g07650D                                          250   3e-74    
ref|XP_009801166.1|  PREDICTED: pectinesterase 31                       247   3e-74    
ref|XP_007224981.1|  hypothetical protein PRUPE_ppa020682mg             247   3e-74    
ref|XP_010069754.1|  PREDICTED: probable pectinesterase 53 isofor...    250   3e-74    
ref|XP_006299552.1|  hypothetical protein CARUB_v10015726mg             248   3e-74    
ref|XP_006418040.1|  hypothetical protein EUTSA_v10009800mg             250   3e-74    
ref|XP_008451885.1|  PREDICTED: probable pectinesterase 8               249   3e-74    
ref|XP_001764301.1|  predicted protein                                  246   3e-74    
ref|NP_188331.1|  putative pectinesterase                               248   3e-74    
ref|XP_010528360.1|  PREDICTED: pectinesterase 31                       247   3e-74    
ref|XP_004144054.1|  PREDICTED: probable pectinesterase 50-like         249   3e-74    
ref|XP_007142408.1|  hypothetical protein PHAVU_008G278000g             248   4e-74    
ref|XP_010267308.1|  PREDICTED: putative pectinesterase 14 isofor...    250   4e-74    
ref|XP_002892282.1|  predicted protein                                  249   4e-74    
ref|XP_004137990.1|  PREDICTED: probable pectinesterase 15-like         249   5e-74    
ref|XP_009605554.1|  PREDICTED: probable pectinesterase 68              248   5e-74    
ref|XP_010055495.1|  PREDICTED: probable pectinesterase 68              250   5e-74    
ref|XP_006440314.1|  hypothetical protein CICLE_v10020787mg             248   5e-74    
dbj|BAJ99366.1|  predicted protein                                      249   6e-74    
ref|XP_001770774.1|  predicted protein                                  246   6e-74    
ref|XP_006481444.1|  PREDICTED: probable pectinesterase 8-like          248   6e-74    
ref|XP_007039841.1|  Pectin lyase-like superfamily protein              248   7e-74    
ref|XP_009780329.1|  PREDICTED: probable pectinesterase 15              249   7e-74    
ref|XP_003625727.1|  Pectinesterase                                     249   7e-74    
ref|XP_011031878.1|  PREDICTED: probable pectinesterase 68              248   7e-74    
gb|KDO61446.1|  hypothetical protein CISIN_1g018249mg                   248   7e-74    
ref|XP_006477195.1|  PREDICTED: probable pectinesterase 68-like         248   7e-74    
emb|CAD41229.2|  OSJNBa0010H02.16                                       247   7e-74    
ref|XP_006399226.1|  hypothetical protein EUTSA_v10013913mg             248   8e-74    
ref|XP_009796875.1|  PREDICTED: probable pectinesterase 15              249   9e-74    
emb|CDX92113.1|  BnaA05g22940D                                          247   1e-73    
ref|XP_010919565.1|  PREDICTED: probable pectinesterase 68              247   1e-73    
emb|CDX95886.1|  BnaC05g36370D                                          247   1e-73    
ref|XP_002323773.2|  hypothetical protein POPTR_0017s08180g             246   1e-73    
ref|XP_009130989.1|  PREDICTED: probable pectinesterase 50              247   1e-73    
gb|KDP27179.1|  hypothetical protein JCGZ_19878                         246   1e-73    
ref|XP_010258408.1|  PREDICTED: pectinesterase 31 isoform X2            246   1e-73    



>ref|XP_009621417.1| PREDICTED: putative pectinesterase 11 [Nicotiana tomentosiformis]
Length=347

 Score =   469 bits (1206),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 227/298 (76%), Positives = 252/298 (85%), Gaps = 3/298 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSG GD+ KIQDAID+VPS NSEL +I VKPGTYREK+VVP DKPFITLSG
Sbjct  44    STAILIRVDQSGQGDFKKIQDAIDAVPSNNSELFFIWVKPGTYREKIVVPGDKPFITLSG  103

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              +ASNT+ITWSDGGDI  SPTLTV ASDFV RYLTI N+FG SGK VAL+V GDR A+YG
Sbjct  104   TEASNTIITWSDGGDITDSPTLTVLASDFVARYLTIQNSFGTSGKAVALKVKGDRVAFYG  163

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI+SYQDTLLD+AG+HYYSNCYIEG VDFIFGNAASL+E C IHS+A   GAITAQ RE
Sbjct  164   CRIQSYQDTLLDDAGRHYYSNCYIEGAVDFIFGNAASLYERCHIHSVAA--GAITAQGRE  221

Query  783   SAEENTGFTFLGCKITGT-GTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQR  959
             S  ENTGFTFLGCKITGT G+T LGRPWG YSRVV+V ++MSS IQPEGWNDW D  +Q 
Sbjct  222   SPLENTGFTFLGCKITGTGGSTALGRPWGSYSRVVFVYTFMSSIIQPEGWNDWGDSSKQS  281

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSS  1133
             T YYGEYKCYG GA+RSKRV WSRSLS  EA PF+TK MI G+ WLR APT+FKR S+
Sbjct  282   TAYYGEYKCYGAGANRSKRVGWSRSLSNEEAAPFLTKNMIGGRSWLRPAPTHFKRRST  339



>emb|CAN79458.1| hypothetical protein VITISV_004378 [Vitis vinifera]
Length=342

 Score =   466 bits (1200),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/297 (74%), Positives = 251/297 (85%), Gaps = 0/297 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSG+GDY KIQDAID+VPS NS+L +I VKPGTYREK+VVP DKPFITLSG
Sbjct  41    STAILIRVDQSGNGDYGKIQDAIDAVPSNNSQLYFILVKPGTYREKIVVPADKPFITLSG  100

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               AS T+ITW DGG+I  SPTL++ ASDFVGRYLTI NTFG SGK VA+RVSGDR+A+Y 
Sbjct  101   TQASTTIITWGDGGEIFESPTLSILASDFVGRYLTIQNTFGTSGKAVAVRVSGDRAAFYN  160

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI SYQDTLLD+AG+HYY NCYIEG  DFI G+AASLFE C +HS++ G GAITAQ+R 
Sbjct  161   CRILSYQDTLLDDAGRHYYRNCYIEGATDFICGSAASLFEKCHLHSLSEGNGAITAQQRG  220

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  ENTGFTFLGCKITG GT  LGRPWGPYSRVV+V S+MSS +QP+GW+DW D  +Q T
Sbjct  221   STSENTGFTFLGCKITGVGTPYLGRPWGPYSRVVFVLSFMSSVVQPQGWDDWGDSNKQST  280

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSS  1133
             VYYGEYKCYGPGA+R++RVEWSRSLS  EA PF+TK+MI GQ WLR APT+F R SS
Sbjct  281   VYYGEYKCYGPGANRTERVEWSRSLSSDEAVPFLTKEMIGGQGWLRPAPTHFMRGSS  337



>ref|XP_009803587.1| PREDICTED: putative pectinesterase 11 [Nicotiana sylvestris]
Length=347

 Score =   466 bits (1199),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 225/298 (76%), Positives = 251/298 (84%), Gaps = 3/298 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSG GD+ KIQDAID+VPS NSEL +I VKPGTYREK+VVP DKPFITLSG
Sbjct  44    STAILIRVDQSGQGDFKKIQDAIDAVPSNNSELFFIWVKPGTYREKIVVPGDKPFITLSG  103

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              +ASNT+ITWS+GGDI  SPTLTV ASDFV RYLTI N+FG SGK VAL+V GDR A+YG
Sbjct  104   TEASNTIITWSEGGDITDSPTLTVLASDFVARYLTIQNSFGTSGKAVALKVKGDRVAFYG  163

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI+SYQDTLLD+AG+HYYSNCYIEG VDFIFGNAASL+E C IHS+A   GAITAQ RE
Sbjct  164   CRIQSYQDTLLDDAGRHYYSNCYIEGAVDFIFGNAASLYERCHIHSVAA--GAITAQGRE  221

Query  783   SAEENTGFTFLGCKITGT-GTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQR  959
             S  ENTGFTFLGCKITGT G+T LGRPWG YSRVV+  ++MSS IQPEGWNDW D  +Q 
Sbjct  222   SPLENTGFTFLGCKITGTGGSTALGRPWGSYSRVVFAYTFMSSIIQPEGWNDWGDSTKQS  281

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSS  1133
             T YYGEYKCYG GA+RSKRV WSRSLS  EA PF+TK MI G+ WLR APT+FKR S+
Sbjct  282   TAYYGEYKCYGAGANRSKRVGWSRSLSNEEAAPFLTKNMIGGRSWLRPAPTHFKRRST  339



>emb|CBI37658.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   462 bits (1189),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 218/301 (72%), Positives = 249/301 (83%), Gaps = 0/301 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSG+GDY KIQDAID+VPS NS+L +I VKPGTYREK+VVP DKPFITLSG
Sbjct  59    STAILIRVDQSGNGDYGKIQDAIDAVPSNNSQLYFILVKPGTYREKIVVPADKPFITLSG  118

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               AS T+ITW DGG+I  SPTL++ ASDFVGRYLTI NTFG S K VA+RVSGDR+A+Y 
Sbjct  119   TQASTTIITWGDGGEIFESPTLSILASDFVGRYLTIQNTFGTSSKAVAVRVSGDRAAFYN  178

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI SYQDTLLD+AG+HYY NCYIEG  DFI G+AASLFE C +HS++ G GAITAQ+R 
Sbjct  179   CRILSYQDTLLDDAGRHYYRNCYIEGATDFICGSAASLFEKCHLHSLSEGNGAITAQQRG  238

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  EN GFTFLGCKITG GT  LGRPWGPYSRVV+V S+MSS +QP+GW+DW D  +Q T
Sbjct  239   STSENNGFTFLGCKITGVGTPYLGRPWGPYSRVVFVLSFMSSVVQPQGWDDWGDSNKQST  298

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSSCKD  1142
             VYYGEYKCYGPGA+R++RVEWSRSLS  EA PF+TK+MI GQ WLR APT F R SS   
Sbjct  299   VYYGEYKCYGPGANRTERVEWSRSLSSDEAVPFLTKEMIGGQGWLRPAPTYFMRGSSVIT  358

Query  1143  M  1145
             M
Sbjct  359   M  359



>ref|XP_002280496.3| PREDICTED: putative pectinesterase 11 [Vitis vinifera]
Length=342

 Score =   461 bits (1187),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 217/297 (73%), Positives = 248/297 (84%), Gaps = 0/297 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSG+GDY KIQDAID+VPS NS+L +I VKPGTYREK+VVP DKPFITLSG
Sbjct  41    STAILIRVDQSGNGDYGKIQDAIDAVPSNNSQLYFILVKPGTYREKIVVPADKPFITLSG  100

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               AS T+ITW DGG+I  SPTL++ ASDFVGRYLTI NTFG S K VA+RVSGDR+A+Y 
Sbjct  101   TQASTTIITWGDGGEIFESPTLSILASDFVGRYLTIQNTFGTSSKAVAVRVSGDRAAFYN  160

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI SYQDTLLD+AG+HYY NCYIEG  DFI G+AASLFE C +HS++ G GAITAQ+R 
Sbjct  161   CRILSYQDTLLDDAGRHYYRNCYIEGATDFICGSAASLFEKCHLHSLSEGNGAITAQQRG  220

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  EN GFTFLGCKITG GT  LGRPWGPYSRVV+V S+MSS +QP+GW+DW D  +Q T
Sbjct  221   STSENNGFTFLGCKITGVGTPYLGRPWGPYSRVVFVLSFMSSVVQPQGWDDWGDSNKQST  280

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSS  1133
             VYYGEYKCYGPGA+R++RVEWSRSLS  EA PF+TK+MI GQ WLR APT F R SS
Sbjct  281   VYYGEYKCYGPGANRTERVEWSRSLSSDEAVPFLTKEMIGGQGWLRPAPTYFMRGSS  337



>ref|XP_006365130.1| PREDICTED: putative pectinesterase 11-like [Solanum tuberosum]
Length=316

 Score =   454 bits (1168),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 218/300 (73%), Positives = 248/300 (83%), Gaps = 3/300 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSGHGD+ KIQDAID+VPS N+EL +I VKPGTYREK++VP DKPFITLSG
Sbjct  11    STAILIRVDQSGHGDFKKIQDAIDAVPSNNTELFFIWVKPGTYREKIIVPADKPFITLSG  70

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              +ASNT+IT SDGGDI  SPTLTV ASDFV RYLTI N FG SGK VAL+V GDR A+YG
Sbjct  71    TEASNTIITSSDGGDITESPTLTVLASDFVARYLTIQNLFGTSGKAVALKVKGDRGAFYG  130

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI+SYQDTLLD+AG+HYY+NCYIEG VDFIFG+AASL+E C IHS+A   GAITAQ RE
Sbjct  131   CRIQSYQDTLLDDAGRHYYNNCYIEGAVDFIFGSAASLYERCHIHSVAA--GAITAQGRE  188

Query  783   SAEENTGFTFLGCKITGT-GTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQR  959
             S  EN+GFTFLGCKITGT G T LGRPWG YSRVV+  ++M++ IQPEGWNDW D  +Q 
Sbjct  189   SPLENSGFTFLGCKITGTGGNTSLGRPWGSYSRVVFAYTFMANIIQPEGWNDWGDSTKQS  248

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSSCK  1139
             T YYGEYKCYG GA+RSKRV WSRSLS  +A PF+TK MI G+ WLR APT+FKR  S  
Sbjct  249   TSYYGEYKCYGAGANRSKRVGWSRSLSNEDAAPFLTKNMIGGRSWLRLAPTHFKRSGSAN  308



>emb|CDO97038.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   449 bits (1155),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 212/296 (72%), Positives = 243/296 (82%), Gaps = 0/296 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSG GDY KIQDAI++ PS NSELV+I VKPG YREK+VVP DKPFITLSG
Sbjct  38    STAILIRVDQSGMGDYDKIQDAINAAPSNNSELVFIWVKPGVYREKIVVPADKPFITLSG  97

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              +AS T+ITW+D G+I  SPT+ V ASDFVGRYLTI NT+G SGK VALRVSGDR+A+YG
Sbjct  98    TEASKTIITWNDTGEIYDSPTMAVLASDFVGRYLTIQNTYGTSGKAVALRVSGDRAAFYG  157

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             C I SYQDTLLD+AG+HYYSNCYIEGGVDFI GN ASLFE C +HS A   GAITAQ+R 
Sbjct  158   CAIVSYQDTLLDDAGRHYYSNCYIEGGVDFICGNGASLFERCHLHSTAENEGAITAQQRS  217

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  ENTGFTFLG KITG G+TVLGRPWG YSRVV+  +YMSS I PEGWNDW DP++Q T
Sbjct  218   SPLENTGFTFLGGKITGAGSTVLGRPWGSYSRVVFALTYMSSVILPEGWNDWGDPRKQST  277

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMS  1130
              Y+GEYKCYGPGA+RS RV+W  SLS  +A PF+TK MI G+ WLR  PT+FK+ +
Sbjct  278   AYFGEYKCYGPGANRSNRVKWYHSLSNHDAAPFLTKTMIGGRAWLRPVPTHFKQQT  333



>ref|XP_010315307.1| PREDICTED: putative pectinesterase 11 [Solanum lycopersicum]
Length=343

 Score =   447 bits (1149),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 213/298 (71%), Positives = 246/298 (83%), Gaps = 3/298 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSG GD+ KIQDAID+VPS N+EL +I VKPGTYREK+VVP DKPFITLSG
Sbjct  38    STAILIRVDQSGQGDFKKIQDAIDAVPSNNTELFFIWVKPGTYREKIVVPADKPFITLSG  97

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              +ASNT+IT S+GGDI  SPT+TV ASDFV RYLTI N FG SGK VAL+V GDR A+Y 
Sbjct  98    TEASNTIITSSEGGDITESPTVTVLASDFVARYLTIQNLFGTSGKAVALKVKGDRGAFYS  157

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI+SYQDTLLD++G+HYY+NCYIEG VDFIFG+AASL+E C IHS+A   GAITAQ RE
Sbjct  158   CRIQSYQDTLLDDSGRHYYNNCYIEGAVDFIFGSAASLYERCHIHSVA--AGAITAQGRE  215

Query  783   SAEENTGFTFLGCKITGT-GTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQR  959
             +  EN+GFTFLGCKITGT G T LGRPWG YSRVV+  ++M++ IQPEGWNDW D  +Q 
Sbjct  216   TPLENSGFTFLGCKITGTGGNTSLGRPWGSYSRVVFAYTFMANIIQPEGWNDWGDSTKQS  275

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSS  1133
             T YYGEYKCYGPGA+RSKRV WSRSLS  +A PF+TK MI G+ WLR  PT+FKR  S
Sbjct  276   TSYYGEYKCYGPGANRSKRVVWSRSLSNEDAAPFLTKNMIGGRSWLRPTPTHFKRSGS  333



>ref|XP_006469311.1| PREDICTED: putative pectinesterase 11-like [Citrus sinensis]
Length=348

 Score =   446 bits (1146),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 208/293 (71%), Positives = 238/293 (81%), Gaps = 0/293 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             ST +LI VDQSG GD+ KIQDAIDSVPS NS+L +I +KPGTYREK+VVP DKPFIT+SG
Sbjct  41    STTILIRVDQSGRGDFKKIQDAIDSVPSNNSKLYFIWIKPGTYREKIVVPADKPFITISG  100

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               ASNT+ITWSDGG+I  S T TV ASDFVGR+LTI NT+G +GK VALRVS +R+A+YG
Sbjct  101   TKASNTIITWSDGGEIFQSATFTVLASDFVGRFLTIENTYGSAGKAVALRVSANRAAFYG  160

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI SYQDTLLD+ G HYYS+CYIEG  DFI GNAASLFE C IHS++ G GAITAQ+R 
Sbjct  161   CRILSYQDTLLDDTGNHYYSSCYIEGATDFICGNAASLFERCHIHSLSTGNGAITAQKRV  220

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S+EENTGFTFLGCKITG G  VLGRPWGPYSRVV+  +YMS  + P+GWNDW D  +   
Sbjct  221   SSEENTGFTFLGCKITGVGKGVLGRPWGPYSRVVYALTYMSGLVLPQGWNDWHDYAKHTN  280

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             VYYGEYKCYGPGADRS RV WS SLS+ EA  F+TK  I G+ WLR AP+NFK
Sbjct  281   VYYGEYKCYGPGADRSNRVAWSLSLSENEAATFLTKDTIGGRAWLRPAPSNFK  333



>ref|XP_006423289.1| hypothetical protein CICLE_v10029966mg [Citrus clementina]
 gb|ESR36529.1| hypothetical protein CICLE_v10029966mg [Citrus clementina]
Length=321

 Score =   444 bits (1143),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 208/293 (71%), Positives = 238/293 (81%), Gaps = 0/293 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             ST +LI VDQSG GD+ KIQDAIDSVPS NS+L +I +KPGTYREK+VVP DKPFIT+SG
Sbjct  14    STTILIRVDQSGRGDFKKIQDAIDSVPSNNSKLYFIWIKPGTYREKIVVPADKPFITISG  73

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               ASNT+ITWSDGG+I  S T TV ASDFVGR+LTI NT+G +GK VALRVS +R+A+YG
Sbjct  74    TKASNTIITWSDGGEIFQSATFTVLASDFVGRFLTIENTYGSAGKAVALRVSANRAAFYG  133

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI SYQDTLLD+ G HYYS+CYIEG  DFI GNAASLFE C IHS++ G GAITAQ+R 
Sbjct  134   CRILSYQDTLLDDTGNHYYSSCYIEGATDFICGNAASLFERCHIHSLSTGNGAITAQKRV  193

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S+EENTGFTFLGCKITG G  VLGRPWGPYSRVV+  +YMS  + P+GWNDW D  +   
Sbjct  194   SSEENTGFTFLGCKITGVGKGVLGRPWGPYSRVVYALTYMSGLVLPQGWNDWHDYAKHTN  253

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             VYYGEYKCYGPGADRS RV WS SLS+ EA  F+TK  I G+ WLR AP+NFK
Sbjct  254   VYYGEYKCYGPGADRSNRVAWSLSLSENEAATFLTKDTIGGRAWLRPAPSNFK  306



>ref|XP_007017570.1| Pectinesterase 11 [Theobroma cacao]
 gb|EOY14795.1| Pectinesterase 11 [Theobroma cacao]
Length=340

 Score =   442 bits (1137),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 206/301 (68%), Positives = 243/301 (81%), Gaps = 2/301 (1%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             +TSTA+LI VDQSG GDY KIQDAI++VPS N+EL++I VKPG Y+EKVVVP DKPFIT+
Sbjct  30    ETSTALLISVDQSGKGDYRKIQDAINAVPSNNTELIFILVKPGIYKEKVVVPADKPFITI  89

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSG--KGVALRVSGDRS  590
             SG  A+ T+ITW+D GDI  SPT TV ASDFVGRYLTI NTFG     K VALRVSGDR+
Sbjct  90    SGSKANATIITWNDSGDIFESPTFTVLASDFVGRYLTIQNTFGTGAGAKAVALRVSGDRA  149

Query  591   AWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITA  770
             A++GC I SYQDTLLD+ G+HYYS+CYIEG VDFI GNAASLFE C +HS++VG  AITA
Sbjct  150   AFFGCSILSYQDTLLDDTGRHYYSHCYIEGAVDFICGNAASLFERCHLHSLSVGDAAITA  209

Query  771   QRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPK  950
             QRRES  E TGFTFLGCK+TG  T VLGRPWGPYSRVV+  +YMS+ I P+GW+DW D  
Sbjct  210   QRRESPSEQTGFTFLGCKVTGVRTAVLGRPWGPYSRVVFALTYMSNVILPQGWDDWGDFA  269

Query  951   RQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMS  1130
             +Q TV+YGEYKCYGPGA+  KRVEWS+ L+  EA+ F+TK MI G+ W+R  PT FK+ S
Sbjct  270   KQSTVFYGEYKCYGPGANTKKRVEWSQKLTSQEAELFLTKNMIGGKSWIRSTPTRFKKAS  329

Query  1131  S  1133
             S
Sbjct  330   S  330



>ref|XP_010088935.1| Putative pectinesterase 11 [Morus notabilis]
 gb|EXB37139.1| Putative pectinesterase 11 [Morus notabilis]
Length=323

 Score =   440 bits (1132),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 207/296 (70%), Positives = 244/296 (82%), Gaps = 1/296 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQ+G GD+ KIQDAIDSVPS NSELV+IS+KPGTYREK+VVP DKPFITLSG
Sbjct  17    STAILIRVDQTGKGDFGKIQDAIDSVPSNNSELVFISIKPGTYREKIVVPADKPFITLSG  76

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               +S+T+ITW+D G+I  SPTL+V ASDFVGRY+TI NT+G SGK VALRVSGDR+A+Y 
Sbjct  77    TKSSDTIITWNDSGEIFASPTLSVLASDFVGRYITIQNTYGTSGKAVALRVSGDRAAFYS  136

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             C+I SYQDTLLD+ GKHY++NC IEG +DFIFGNAASL+E C +HS++   GAITAQ R 
Sbjct  137   CKILSYQDTLLDDVGKHYFNNC-IEGAIDFIFGNAASLYEKCHLHSLSERDGAITAQHRV  195

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S+ ENTGFTFLGC ITG G + LGRPWG  SRVV+   +MSSAI P+GWNDW D  +QR+
Sbjct  196   SSAENTGFTFLGCNITGVGASFLGRPWGASSRVVFTYCHMSSAIIPQGWNDWGDETKQRS  255

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMS  1130
             VYYGEYKCYGPGA+RSKRV WSRSL+  EA  F+TK MI G+ WLR  P +FKR S
Sbjct  256   VYYGEYKCYGPGANRSKRVGWSRSLTSDEAAQFLTKDMIGGKNWLRDPPIHFKRAS  311



>ref|XP_010102075.1| Putative pectinesterase 11 [Morus notabilis]
 gb|EXB91925.1| Putative pectinesterase 11 [Morus notabilis]
Length=462

 Score =   434 bits (1115),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 202/294 (69%), Positives = 237/294 (81%), Gaps = 0/294 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             S+AVL+ VDQSG GDY KIQDAID+VP+ N ELV+I VKPG Y+EKV VP DKPFITLSG
Sbjct  156   SSAVLLRVDQSGKGDYKKIQDAIDAVPANNKELVFILVKPGIYKEKVFVPADKPFITLSG  215

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               AS TVITWS+ GDI  SPT+TV ASDFVGR+LTI NT+G  GK VAL VS DR+A+YG
Sbjct  216   TKASETVITWSESGDIFESPTMTVLASDFVGRHLTIQNTYGSGGKAVALWVSADRAAFYG  275

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI SYQDTLLD+ G+HYY +CYI+GG DFI GNAASLFE C IHS+A G GAITAQRRE
Sbjct  276   CRIISYQDTLLDDTGRHYYKSCYIQGGTDFICGNAASLFEKCHIHSLAEGTGAITAQRRE  335

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  E+TGFTFLGC ITGT T +LGRPWG YSRVV+  SYMS+ I P+GW DW D  +Q T
Sbjct  336   SPSEDTGFTFLGCTITGTRTAMLGRPWGDYSRVVFALSYMSNVILPQGWEDWGDSSKQST  395

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
             V+YG+YKCYGPGA  SKRV+W+R+L+  EA+PF+TK  I+ ++W+R  PT F R
Sbjct  396   VFYGQYKCYGPGAVTSKRVKWARNLTAQEAEPFLTKDWIDAKDWIRPVPTTFTR  449


 Score =   154 bits (388),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 103/158 (65%), Gaps = 8/158 (5%)
 Frame = +3

Query  243  STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
            S+AVL+ VDQSG GDY KIQDAID+VP+ N ELV+I VKPG Y+EKV VP DKPFITLSG
Sbjct  39   SSAVLLRVDQSGKGDYKKIQDAIDAVPANNKELVFILVKPGIYKEKVFVPADKPFITLSG  98

Query  423  DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              AS TVITWS+ GDI  SPT+TV ASDFVGR+LTI       G  V+L V+   +    
Sbjct  99   TKASETVITWSESGDIFESPTMTVLASDFVGRHLTIQVPLSACGTAVSLSVTNSTTKSSA  158

Query  603  CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              ++      +D++GK  Y    I+  +D +  N   L
Sbjct  159  VLLR------VDQSGKGDYKK--IQDAIDAVPANNKEL  188



>ref|XP_002512914.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF49417.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=346

 Score =   428 bits (1101),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 207/294 (70%), Positives = 227/294 (77%), Gaps = 0/294 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSG GD+  IQDAIDSVP  NS+LV+I VKPG YRE+VVVP DKPFITLSG
Sbjct  39    STAILIRVDQSGKGDFKTIQDAIDSVPPNNSQLVFIWVKPGIYRERVVVPADKPFITLSG  98

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               ASNT+ITWS GGDI  SPTL+V ASDFVGRYLTI NTFG   K VALRVSGD++A+YG
Sbjct  99    TTASNTIITWSAGGDIYESPTLSVLASDFVGRYLTIQNTFGSGDKAVALRVSGDKAAFYG  158

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI SYQDTLLDE G HYYSNCYIEG  DFI GNAASLFE C +HSI+   G+ITAQ R 
Sbjct  159   CRILSYQDTLLDETGSHYYSNCYIEGATDFICGNAASLFEKCHLHSISRNNGSITAQHRA  218

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  +NTGFTFLG KITG G+  LGRPWG YSRVV+  SYMS  I P GW+ W    RQ T
Sbjct  219   SQSDNTGFTFLGSKITGIGSAYLGRPWGAYSRVVFALSYMSGVIVPPGWDSWSGQTRQST  278

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
             V+Y EYKCYGPG  +SKRVEWS  LS  EA PF+TK MI GQ WLR  P  FKR
Sbjct  279   VFYAEYKCYGPGVVKSKRVEWSHELSAEEAAPFLTKDMIGGQSWLRPDPAYFKR  332



>ref|XP_008220902.1| PREDICTED: putative pectinesterase 11 [Prunus mume]
Length=335

 Score =   426 bits (1094),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 237/297 (80%), Gaps = 1/297 (0%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q STAVLI VDQSG GDY KIQDAID+VPS N +LV+I V+PG Y EK+ VP DKPFIT+
Sbjct  32    QGSTAVLITVDQSGKGDYKKIQDAIDAVPSNNVDLVFIRVRPGVYEEKISVPADKPFITI  91

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG  A++T+ITW+DGG+I  SPT +V ASDF+GRYLTI NT+G  GK VALRVSGDR+A+
Sbjct  92    SGTKANDTIITWNDGGEIFESPTFSVLASDFIGRYLTIQNTYGAGGKAVALRVSGDRAAF  151

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             YGCRI SYQDTLLD+ G+HYY+NCYIEG  DFI GNAAS FE C +HSI+ G GAITAQR
Sbjct  152   YGCRILSYQDTLLDDTGRHYYNNCYIEGATDFICGNAASFFERCHLHSISGGAGAITAQR  211

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDW-DDPKR  953
             R S  E+TGFTF  CKI+G  T +LGRPWG YSRVV+  +YMSSAI P+GW+DW + P +
Sbjct  212   RMSPSEDTGFTFFSCKISGVKTAMLGRPWGGYSRVVFAFTYMSSAILPQGWDDWGNSPDQ  271

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
               TVYYG+Y+C G GA  SKRVEW+R L+  EA PF+TK  I+G+ W+R APT+FK+
Sbjct  272   LSTVYYGQYRCSGAGAATSKRVEWARKLTSEEAAPFLTKDSIDGKAWIRSAPTSFKK  328



>ref|XP_007042164.1| Laccase 11 [Theobroma cacao]
 gb|EOX97995.1| Laccase 11 [Theobroma cacao]
Length=837

 Score =   442 bits (1136),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 203/294 (69%), Positives = 238/294 (81%), Gaps = 0/294 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+L+ VDQ+GHGD+ KIQDAID+VPS NSEL +I VKPGTYREK+VVP DKPFITLSG
Sbjct  2     STAILLRVDQAGHGDFKKIQDAIDAVPSNNSELYFILVKPGTYREKIVVPADKPFITLSG  61

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               A +T+ITW++ G I  S  LTV ASDFVG+YLTI NTFG  GK VA+RVSGDR+A+ G
Sbjct  62    TRAQDTIITWNESGGIFDSAALTVLASDFVGQYLTIQNTFGTGGKAVAMRVSGDRAAFDG  121

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI SYQDTLLD+ GKHY+ NCYIEGG DFI GNA+S +EGC +HS++   G+ITAQ R 
Sbjct  122   CRILSYQDTLLDDTGKHYFKNCYIEGGTDFICGNASSFYEGCHLHSLSTKSGSITAQHRN  181

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  ENTGFTFLGCKITG G   LGRPWG +SRVV+  +YMS+ I P+GW+DW DP++QRT
Sbjct  182   SPSENTGFTFLGCKITGIGAAFLGRPWGAFSRVVFAETYMSNVIIPQGWDDWQDPRKQRT  241

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
              YYGEYKCYGPGAD SKRV+WS  LS+ EA PF+T  MI G+ WLR APTNFKR
Sbjct  242   AYYGEYKCYGPGADASKRVQWSHRLSQNEAAPFLTMDMIGGRGWLRPAPTNFKR  295



>ref|XP_002281308.1| PREDICTED: putative pectinesterase 11 [Vitis vinifera]
Length=365

 Score =   424 bits (1091),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 237/297 (80%), Gaps = 0/297 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+L+ VDQSG GDY KIQDAID+VPS N+E+V+I VKPG YREK+VVP DKPFITLSG
Sbjct  59    STAILMRVDQSGKGDYQKIQDAIDAVPSNNTEVVFIWVKPGIYREKIVVPADKPFITLSG  118

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               A+ T+ITW+D G+I  SPT +V A+DFVGR+LTI NT+G   K VALRVS DR A++ 
Sbjct  119   TKATTTIITWNDTGEIFDSPTFSVLATDFVGRFLTIQNTYGAGAKAVALRVSADRVAFFE  178

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI S+QDTLLD+ G+H+Y NC+I+G  DFI GNAASLFE C +HS++   GAITAQRRE
Sbjct  179   CRILSHQDTLLDDTGRHFYRNCFIQGDTDFICGNAASLFEKCHLHSLSEESGAITAQRRE  238

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  E+TGF FLGCK+TG  + +LGRPWG YSRVV+  +YMS+AI P+GW+DW D  +Q T
Sbjct  239   SPAEDTGFIFLGCKLTGLKSALLGRPWGDYSRVVFAFTYMSNAILPQGWDDWSDTSKQST  298

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSS  1133
              +YG+YKCYGPGA  SKRVEWSR+L+  EA PF+TK +I G  W+R APT+FKR S+
Sbjct  299   AFYGQYKCYGPGAITSKRVEWSRNLTSQEAAPFLTKNLIGGNSWIRPAPTHFKRAST  355



>emb|CBI19714.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   424 bits (1090),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 237/297 (80%), Gaps = 0/297 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+L+ VDQSG GDY KIQDAID+VPS N+E+V+I VKPG YREK+VVP DKPFITLSG
Sbjct  116   STAILMRVDQSGKGDYQKIQDAIDAVPSNNTEVVFIWVKPGIYREKIVVPADKPFITLSG  175

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               A+ T+ITW+D G+I  SPT +V A+DFVGR+LTI NT+G   K VALRVS DR A++ 
Sbjct  176   TKATTTIITWNDTGEIFDSPTFSVLATDFVGRFLTIQNTYGAGAKAVALRVSADRVAFFE  235

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI S+QDTLLD+ G+H+Y NC+I+G  DFI GNAASLFE C +HS++   GAITAQRRE
Sbjct  236   CRILSHQDTLLDDTGRHFYRNCFIQGDTDFICGNAASLFEKCHLHSLSEESGAITAQRRE  295

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  E+TGF FLGCK+TG  + +LGRPWG YSRVV+  +YMS+AI P+GW+DW D  +Q T
Sbjct  296   SPAEDTGFIFLGCKLTGLKSALLGRPWGDYSRVVFAFTYMSNAILPQGWDDWSDTSKQST  355

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSS  1133
              +YG+YKCYGPGA  SKRVEWSR+L+  EA PF+TK +I G  W+R APT+FKR S+
Sbjct  356   AFYGQYKCYGPGAITSKRVEWSRNLTSQEAAPFLTKNLIGGNSWIRPAPTHFKRAST  412



>ref|XP_004295972.1| PREDICTED: putative pectinesterase 11-like [Fragaria vesca subsp. 
vesca]
Length=337

 Score =   421 bits (1081),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/296 (66%), Positives = 235/296 (79%), Gaps = 1/296 (0%)
 Frame = +3

Query  240   TSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLS  419
             +++A+LI VDQSG GDY KIQ+AIDSV S N+ELV+I VKPG Y EKV VP DKPFIT+S
Sbjct  31    SASAILITVDQSGKGDYKKIQEAIDSVASNNAELVFIRVKPGVYEEKVTVPADKPFITIS  90

Query  420   GDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWY  599
             G  A++TVITW+D G+I  SPT +V ASDFVGRYLTI NT+G  GK VALRVSGDR+A+Y
Sbjct  91    GTKAADTVITWNDSGEIFESPTFSVLASDFVGRYLTIQNTYGSGGKAVALRVSGDRAAFY  150

Query  600   GCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRR  779
             GCRI S QDTLLD+ G+HYY+NCYIEG VDFI GNAAS +E C +HS+++G GAITAQRR
Sbjct  151   GCRILSRQDTLLDDTGRHYYNNCYIEGDVDFICGNAASFYEKCHLHSLSLGTGAITAQRR  210

Query  780   ESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ-  956
              S  E+TGFTF GCKITG  T VLGRPWG YSRVV+  SYM+SA+ P+GW+DW +   Q 
Sbjct  211   MSPAEDTGFTFFGCKITGVKTAVLGRPWGTYSRVVFAFSYMTSAVLPQGWDDWGNSANQL  270

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
              TVYYG+YKC G GA  SKRVEW+R L+  E +PF+TK  I+   WLR APT+FK+
Sbjct  271   STVYYGQYKCSGRGATTSKRVEWARDLTSEEVEPFLTKDSIDANAWLRSAPTSFKK  326



>ref|XP_011074601.1| PREDICTED: putative pectinesterase 11 [Sesamum indicum]
Length=335

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/303 (64%), Positives = 235/303 (78%), Gaps = 4/303 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSG+GDY KIQDAIDSVPS NS+ ++I VKPG Y EK+VVP DKPFITLSG
Sbjct  27    STAILIEVDQSGNGDYRKIQDAIDSVPSNNSDHIFILVKPGVYEEKIVVPADKPFITLSG  86

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              +A+ T+ITWSD G+I  SPT +V ASDF+ RYLTI N +G   K VALRVSGDR+A+  
Sbjct  87    TEATKTIITWSDSGEIFESPTFSVLASDFMARYLTIQNNYGAGAKAVALRVSGDRAAFMN  146

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI S+QDTLLD+ G+HYYSNCY+EG  DFIFGN AS+F+ C +HS+A G GAITAQRR+
Sbjct  147   CRILSHQDTLLDDKGRHYYSNCYVEGDTDFIFGNGASIFQKCHLHSLARGMGAITAQRRQ  206

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ--  956
              AEE TGFTF+ CKITG  + VLGRPWG YSRVV+  +YMS  + PEGW+DW +  +Q  
Sbjct  207   RAEEETGFTFVKCKITGVKSAVLGRPWGKYSRVVFALTYMSKVVVPEGWDDWGESSKQRY  266

Query  957   --RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMS  1130
               RT YYGEYKCYG GA  SKRV+WSRSLS  EA PF+ + MI G  W+R  P++F+R+S
Sbjct  267   YYRTAYYGEYKCYGAGASTSKRVKWSRSLSSQEAAPFLREDMIGGSSWIRSVPSHFRRIS  326

Query  1131  SCK  1139
               +
Sbjct  327   GAQ  329



>ref|XP_007224477.1| hypothetical protein PRUPE_ppa022374mg, partial [Prunus persica]
 gb|EMJ25676.1| hypothetical protein PRUPE_ppa022374mg, partial [Prunus persica]
Length=308

 Score =   417 bits (1071),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 237/297 (80%), Gaps = 1/297 (0%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q STAVLI VDQSG GDY KIQDAID+VPS N +LV+I V+ G Y EK+ VP DKPFIT+
Sbjct  5     QGSTAVLITVDQSGKGDYKKIQDAIDAVPSNNVDLVFIRVRRGVYEEKISVPADKPFITI  64

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG  A++T+ITW+DGG+I  SPT +V ASDF+GRYLTI NT+G  GK VALRVSGDR+A+
Sbjct  65    SGTKANDTIITWNDGGEIFESPTFSVLASDFIGRYLTIQNTYGAGGKAVALRVSGDRAAF  124

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             YGC+I SYQDTLLD+ G+HYY+NCYIEG  DFI GNAAS FE C +HSI+ G GAITAQR
Sbjct  125   YGCKILSYQDTLLDDTGRHYYNNCYIEGATDFICGNAASFFERCHLHSISGGAGAITAQR  184

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDW-DDPKR  953
             R S  E+TGFTF  CKI+G  T +LGRPWG YSRVV+  +YMS+AI P+GW+DW + P +
Sbjct  185   RMSPSEDTGFTFFSCKISGVKTAMLGRPWGGYSRVVFAFTYMSNAILPQGWDDWGNSPDQ  244

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
               TVYYG+Y+C G GA  SKRVEW+R+L+  EA PF+TK  I+G+ W+R APT+FK+
Sbjct  245   LSTVYYGQYRCSGAGAATSKRVEWARNLTGEEAAPFLTKDSIDGKAWIRSAPTSFKK  301



>ref|XP_008460943.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase 11 [Cucumis 
melo]
Length=302

 Score =   416 bits (1070),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 195/296 (66%), Positives = 242/296 (82%), Gaps = 0/296 (0%)
 Frame = +3

Query  234   KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
             +   TA LI VD SG+GD+ KIQ AIDSVPS+N+ELV+I VKPGTYREK+VVP DKP+IT
Sbjct  5     RDKRTARLIRVDGSGNGDFKKIQQAIDSVPSQNNELVFIWVKPGTYREKIVVPEDKPYIT  64

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             +SG  AS+T+ITW+ G D++ SP +++FASDFVGR+LTI NTFG SG  VALRVS DR+A
Sbjct  65    ISGSKASDTIITWNQGRDLLQSPVVSIFASDFVGRFLTIENTFGTSGIAVALRVSADRAA  124

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +YGCRI S+QDTLLD++G+HY++NCYIEG  DFI GNAASL+E C +HS +  GGA+TAQ
Sbjct  125   FYGCRIISFQDTLLDDSGRHYFNNCYIEGATDFICGNAASLYERCHLHSTSDRGGAMTAQ  184

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
              R +AEENTGF FLG KITG+G+  LGRPWG +S+VV+  +YMS+ ++PEGWNDW DP +
Sbjct  185   HRNTAEENTGFVFLGGKITGSGSMFLGRPWGGFSKVVFGYTYMSNVVEPEGWNDWGDPTK  244

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             QRTV YGEYKCYGPGA+R+KRV WSRSLS  EA    TK +I G+ WLR AP++FK
Sbjct  245   QRTVSYGEYKCYGPGANRAKRVVWSRSLSTDEATKLFTKDIIGGRAWLRPAPSHFK  300



>ref|XP_009366010.1| PREDICTED: putative pectinesterase 11 [Pyrus x bretschneideri]
Length=336

 Score =   417 bits (1071),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 232/297 (78%), Gaps = 1/297 (0%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q STA+LI VDQSG GDY KIQDAID+VPS N +LV+I VKPG Y+EK+ VP DKPF+T+
Sbjct  35    QGSTAILITVDQSGKGDYEKIQDAIDAVPSNNVDLVFIRVKPGVYKEKITVPADKPFVTI  94

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG  A +T+ITW+D GDI  S T +V ASDF+GRYLTI NT+G  GK VALRVSGDR+A+
Sbjct  95    SGTKAVDTIITWNDSGDIFESATFSVLASDFIGRYLTIQNTYGSGGKAVALRVSGDRAAF  154

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             Y CRI SYQDTLLD+ G+HYY+NCYIEG  DFI GN AS FE C +HSI+ GGGAITAQR
Sbjct  155   YVCRILSYQDTLLDDTGRHYYNNCYIEGATDFICGNGASFFEKCHLHSISNGGGAITAQR  214

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             R S  E+TGF F GCKITG  T VLGRPWG YSRV++  +YM + I P+GWNDW D   Q
Sbjct  215   RMSPSEDTGFFFFGCKITGVKTAVLGRPWGVYSRVIFAFTYMPNIILPQGWNDWGDSADQ  274

Query  957   -RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
               +VYYG+YKC GPGA  +KRV+WSR L+  EA PF+TK  I+G+ W+R APT+FK+
Sbjct  275   LSSVYYGQYKCSGPGAVTAKRVDWSRVLTSEEAAPFITKDSIDGKAWIRAAPTSFKK  331



>ref|XP_010064558.1| PREDICTED: putative pectinesterase 11 [Eucalyptus grandis]
 gb|KCW67859.1| hypothetical protein EUGRSUZ_F01580 [Eucalyptus grandis]
Length=325

 Score =   416 bits (1070),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 225/291 (77%), Gaps = 0/291 (0%)
 Frame = +3

Query  249   AVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD  428
             A LI+VD SG G++ KIQDAID+VPS NSELV+I V+PGTYREK+VVP DKPFITLSG  
Sbjct  35    ARLILVDPSGKGNFTKIQDAIDAVPSNNSELVFIRVEPGTYREKLVVPADKPFITLSGKK  94

Query  429   ASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCR  608
             AS+T++T  D GDI  SPT++V ASDFVGRYLTI NTFG   K VALRVSGDR  +  CR
Sbjct  95    ASSTIVTGDDSGDIFGSPTVSVLASDFVGRYLTIQNTFGLGAKAVALRVSGDRVVFSACR  154

Query  609   IKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESA  788
             I S+QDTLLD+ G+HYY NCYIEG VDFIFGNAASLF+ C I+S++ GGG ITAQ R S 
Sbjct  155   ITSHQDTLLDDVGRHYYRNCYIEGDVDFIFGNAASLFQKCHINSVSRGGGFITAQHRASP  214

Query  789   EENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRTVY  968
              ENTGF FLGC ITG   T LGRPWGPYSRV++  SYMSSA+ P+GW+DW D  +QRT Y
Sbjct  215   LENTGFVFLGCTITGLTNTFLGRPWGPYSRVIFALSYMSSAVLPQGWDDWGDSTKQRTAY  274

Query  969   YGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             YG+Y+CYGPGAD SKRV WSR L+  E  P +T  M+  Q W R APT F 
Sbjct  275   YGQYECYGPGADTSKRVPWSRVLTGEEVSPLLTTDMVNQQSWFRNAPTIFN  325



>ref|XP_008388044.1| PREDICTED: putative pectinesterase 11 [Malus domestica]
Length=338

 Score =   415 bits (1067),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 231/297 (78%), Gaps = 1/297 (0%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q STA+LI VDQSG GDY KIQDAID+VPS N +LV+I VKPG Y+EK+ VP DKPFIT+
Sbjct  35    QGSTAILITVDQSGKGDYEKIQDAIDAVPSNNVDLVFIRVKPGVYKEKITVPADKPFITI  94

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG  A +T+ITW+D GDI  S T +V ASDF+GRYLTI NT+G  GK VALR SGDR+A+
Sbjct  95    SGTKAVDTIITWNDSGDIFESATFSVLASDFIGRYLTIQNTYGSGGKAVALRASGDRAAF  154

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             Y CRI SYQDTLLD+ G+HYY+NCYIEG  DFI GN AS FE C +HSI+ GGGAITAQR
Sbjct  155   YVCRILSYQDTLLDDTGRHYYNNCYIEGATDFICGNGASFFEKCHLHSISNGGGAITAQR  214

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             R S  E+TGF F GCKITG  T VLGRPWG YSRV++  +YM + I P+GWNDW +   Q
Sbjct  215   RMSPSEDTGFFFFGCKITGVKTAVLGRPWGVYSRVIFAFTYMPNIILPQGWNDWGNSADQ  274

Query  957   -RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
               +VYYG+YKC GPGA  SKRV+WSR L+  EA PF+TK  I+G+ W+R APT+FK+
Sbjct  275   LSSVYYGQYKCSGPGAVTSKRVDWSRVLTSEEAAPFITKDSIDGKAWIRAAPTSFKK  331



>ref|XP_010526612.1| PREDICTED: putative pectinesterase 11 [Tarenaya hassleriana]
Length=355

 Score =   416 bits (1068),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 192/301 (64%), Positives = 240/301 (80%), Gaps = 2/301 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSK--NSELVYISVKPGTYREKVVVPVDKPFITL  416
             STAVLI VDQSG GD+ KIQ+AID+VP    ++ L +I VKPG YREKVVV  DKP+ITL
Sbjct  54    STAVLIRVDQSGKGDFTKIQEAIDAVPPNLNDTHLYFIWVKPGIYREKVVVAEDKPYITL  113

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG  ASNT++TW+DG DI+ SPTLTVFASDFV R+LTI NTFG +G+ VALRV+ +R+A+
Sbjct  114   SGTQASNTILTWNDGQDILASPTLTVFASDFVCRFLTIQNTFGTAGQAVALRVAAERAAF  173

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             YGC IKSYQDTLLD+ G HY+ NCYIEG  DFI G+A+SLFE C +HS++   G+ITAQ 
Sbjct  174   YGCAIKSYQDTLLDDNGNHYFKNCYIEGATDFICGSASSLFERCHLHSLSSNNGSITAQM  233

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             R SA E +GFTFLGCK+TG G+T LGRPWG YSRVV+  S++S+ + P+GWN+W DP ++
Sbjct  234   RSSATEKSGFTFLGCKVTGLGSTFLGRPWGAYSRVVFAYSFLSNVVSPDGWNEWGDPSKE  293

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSSC  1136
              TVYYGEY+CYG GADRSKRV+WS+ LS  EA  F++K MI G++WLR AP++F+  S  
Sbjct  294   STVYYGEYRCYGDGADRSKRVKWSKQLSDEEAAAFLSKDMIGGKDWLRPAPSHFRTSSHI  353

Query  1137  K  1139
             K
Sbjct  354   K  354



>ref|XP_010263632.1| PREDICTED: laccase-11-like [Nelumbo nucifera]
Length=871

 Score =   430 bits (1106),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 201/296 (68%), Positives = 240/296 (81%), Gaps = 0/296 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSG+GD+ KIQDAID+VPS NS +V+I VKPGTYREK+VVP DKP+ITLSG
Sbjct  36    STALLIRVDQSGNGDFKKIQDAIDAVPSNNSNVVFIWVKPGTYREKIVVPADKPYITLSG  95

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              + + T++TW++ G+I  +PT++V ASDFVGRYLTI NT G   + VALRVS DR+A+YG
Sbjct  96    SNPTTTIVTWNESGEIFQTPTVSVLASDFVGRYLTIQNTHGPGSQAVALRVSADRAAFYG  155

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI SYQDTLLD+ G+HYYSNCYI+G  DFI GNAASLFE C +HS+A G GAITAQRRE
Sbjct  156   CRILSYQDTLLDDTGRHYYSNCYIQGQTDFICGNAASLFEKCHLHSLAEGSGAITAQRRE  215

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  ENTGFTFLG KITG GT+VLGRPWG YSRVV+  +YMSS I P+GW+DW DP +Q T
Sbjct  216   SPAENTGFTFLGGKITGVGTSVLGRPWGAYSRVVFALTYMSSVILPQGWDDWGDPTKQST  275

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMS  1130
             VYYG++KCYG GA+ S RV WSR+LS AEA PF+TK MI G+ WLR  P  + R S
Sbjct  276   VYYGQHKCYGAGANISGRVGWSRNLSDAEAAPFLTKDMIGGRGWLRPLPKRYNRTS  331



>ref|XP_010064557.1| PREDICTED: putative pectinesterase 11 [Eucalyptus grandis]
 gb|KCW67858.1| hypothetical protein EUGRSUZ_F01579 [Eucalyptus grandis]
Length=325

 Score =   410 bits (1055),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 191/300 (64%), Positives = 225/300 (75%), Gaps = 0/300 (0%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
             G+  +      LI V+ SG GD+ +IQDAID+VPS N ELV+I V+PGTY EK++VPVDK
Sbjct  26    GIATRAPKIGRLIRVEPSGKGDFTRIQDAIDAVPSNNLELVFIRVEPGTYHEKIMVPVDK  85

Query  402   PFITLSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSG  581
             PFITLSG  ASNT+IT SD GDI  SPT+++ AS+FVGRYLTI NT+G   K VALRVSG
Sbjct  86    PFITLSGRSASNTIITGSDSGDIFGSPTVSILASNFVGRYLTIQNTYGSGAKAVALRVSG  145

Query  582   DRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGA  761
             D   +  CRI S+QDTLLD  G+HYYSNCYIEG VDFIFGNAASLF  C +HS++ GGG 
Sbjct  146   DIVTFLACRITSHQDTLLDHVGRHYYSNCYIEGDVDFIFGNAASLFRKCHVHSVSRGGGF  205

Query  762   ITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD  941
             ITAQ R S  ENTGF FLGC ITG   T LGRPWGPYSRVV+  SYMSSA+ P+GW+DW 
Sbjct  206   ITAQHRASPSENTGFVFLGCTITGLTNTFLGRPWGPYSRVVFALSYMSSAVLPQGWDDWG  265

Query  942   DPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             D  +QRT YYG+Y+CYGPGAD SKRV WSR L+  E  P +T  M++ Q W R AP+ F 
Sbjct  266   DASKQRTAYYGQYECYGPGADMSKRVPWSRVLTGEEVSPLLTTDMVDQQSWFRNAPSLFN  325



>ref|XP_010066169.1| PREDICTED: putative pectinesterase 11 [Eucalyptus grandis]
 gb|KCW63999.1| hypothetical protein EUGRSUZ_G01685 [Eucalyptus grandis]
Length=329

 Score =   410 bits (1054),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 189/296 (64%), Positives = 234/296 (79%), Gaps = 0/296 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             S A  ++VDQSG+GD+ +IQDAID+VPSKN   V+IS+KPGTYREK+VVPV+K FITLSG
Sbjct  33    SEATHVVVDQSGNGDFRRIQDAIDAVPSKNDRQVFISIKPGTYREKIVVPVNKRFITLSG  92

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               ASNT+ITWSD GDI +SPT+++ AS+FVG  LTI NTFG   + VALRV+GD++A+Y 
Sbjct  93    TKASNTIITWSDSGDIFYSPTVSILASNFVGTDLTIQNTFGEGERAVALRVAGDQAAFYR  152

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             C+I SYQDTLLD+AG+HYY NCYIEGG DFI G+AASLFE C +HSI+   G ITAQ R+
Sbjct  153   CKILSYQDTLLDDAGRHYYKNCYIEGGTDFICGDAASLFEKCHVHSISKENGPITAQHRQ  212

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  +NTG+ FL CKIT      LGRPWG YSRVV+  SY+S+ I P+GW DWDD K   T
Sbjct  213   SGTDNTGYVFLDCKITAANGAFLGRPWGEYSRVVFALSYLSATILPQGWEDWDDQKSHST  272

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMS  1130
             VYYGEYKC GPGA+RS+RV+WSRSL+ +EA P++TK +I GQ+WL + PT  +R S
Sbjct  273   VYYGEYKCSGPGANRSERVDWSRSLTDSEAAPYLTKALIGGQDWLARKPTPLRRRS  328



>gb|KGN61801.1| hypothetical protein Csa_2G248110 [Cucumis sativus]
Length=305

 Score =   408 bits (1049),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 192/293 (66%), Positives = 237/293 (81%), Gaps = 0/293 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             +TA LI VD SG+GD+ KIQ AIDSVPS+N+ELV+I VKPGTYREK+VVP DKP+IT+SG
Sbjct  9     TTARLIRVDGSGNGDFKKIQQAIDSVPSQNNELVFIWVKPGTYREKIVVPEDKPYITISG  68

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               AS+T ITW+ G D++ SP +++FASDFVGR+LTI NTFG +G  VALRVS DR+A+YG
Sbjct  69    SKASDTKITWNQGRDLLESPVVSIFASDFVGRFLTIENTFGTTGIAVALRVSADRAAFYG  128

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI S+QDTLLD+ G+HY++NCYIEG  DFI GNAASL+E C +HS +  GGA+TAQ R 
Sbjct  129   CRIISFQDTLLDDTGRHYFNNCYIEGATDFICGNAASLYEKCHLHSTSDRGGAMTAQHRN  188

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             + EENTGF FLG KITG+G+  LGRPWG +S+VV+  +YMS+ ++PEGWNDW DP +QRT
Sbjct  189   TGEENTGFVFLGGKITGSGSMFLGRPWGDFSKVVFGYTYMSNVVEPEGWNDWGDPTKQRT  248

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             V YGEYKCYG GA+R KRV WSRSLS  EA    TK +I G+ WLR AP++FK
Sbjct  249   VLYGEYKCYGLGANRDKRVVWSRSLSTDEASKLFTKDIIGGRAWLRPAPSHFK  301



>ref|XP_004148862.1| PREDICTED: putative pectinesterase 11-like [Cucumis sativus]
 ref|XP_004163009.1| PREDICTED: putative pectinesterase 11-like [Cucumis sativus]
Length=314

 Score =   408 bits (1048),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 192/293 (66%), Positives = 237/293 (81%), Gaps = 0/293 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             +TA LI VD SG+GD+ KIQ AIDSVPS+N+ELV+I VKPGTYREK+VVP DKP+IT+SG
Sbjct  18    TTARLIRVDGSGNGDFKKIQQAIDSVPSQNNELVFIWVKPGTYREKIVVPEDKPYITISG  77

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               AS+T ITW+ G D++ SP +++FASDFVGR+LTI NTFG +G  VALRVS DR+A+YG
Sbjct  78    SKASDTKITWNQGRDLLESPVVSIFASDFVGRFLTIENTFGTTGIAVALRVSADRAAFYG  137

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI S+QDTLLD+ G+HY++NCYIEG  DFI GNAASL+E C +HS +  GGA+TAQ R 
Sbjct  138   CRIISFQDTLLDDTGRHYFNNCYIEGATDFICGNAASLYEKCHLHSTSDRGGAMTAQHRN  197

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             + EENTGF FLG KITG+G+  LGRPWG +S+VV+  +YMS+ ++PEGWNDW DP +QRT
Sbjct  198   TGEENTGFVFLGGKITGSGSMFLGRPWGDFSKVVFGYTYMSNVVEPEGWNDWGDPTKQRT  257

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             V YGEYKCYG GA+R KRV WSRSLS  EA    TK +I G+ WLR AP++FK
Sbjct  258   VLYGEYKCYGLGANRDKRVVWSRSLSTDEASKLFTKDIIGGRAWLRPAPSHFK  310



>ref|XP_009336855.1| PREDICTED: putative pectinesterase 11 [Pyrus x bretschneideri]
Length=336

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 229/297 (77%), Gaps = 1/297 (0%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q STA+LI VDQSG GDY KIQDAID+VPS N +LV+I VKPG Y+EK+ VP DKPF+T+
Sbjct  35    QGSTAILITVDQSGKGDYEKIQDAIDAVPSNNVDLVFIRVKPGVYKEKITVPADKPFVTI  94

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG  A NT+ITW+D GDI  S T +V ASDF+GRYLTI NT+G  GK VALRVSGDR+A+
Sbjct  95    SGTKAVNTIITWNDSGDIFESATFSVLASDFIGRYLTIQNTYGSGGKAVALRVSGDRAAF  154

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             Y CRI SYQDTLLD+ G+H+Y   +IEG  DFI GN AS FE C +HSI+ GGGAITAQR
Sbjct  155   YVCRILSYQDTLLDDTGRHHYKQRFIEGATDFICGNGASFFEKCHLHSISNGGGAITAQR  214

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             R S  E+TGF F GCKITG  T VLGRPWG YSRV++  +YM + I P+GWNDW D   Q
Sbjct  215   RMSPSEDTGFFFFGCKITGVKTAVLGRPWGVYSRVIFAFTYMPNIILPQGWNDWGDSADQ  274

Query  957   -RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
               +VYYG+YKC GPGA  +KRV+WSR L+  EA PF+TK  I+G+ W+R APT+FK+
Sbjct  275   LSSVYYGQYKCSGPGAVTAKRVDWSRVLTSEEAAPFITKDSIDGKAWIRAAPTSFKK  331



>ref|XP_009407032.1| PREDICTED: putative pectinesterase 11 [Musa acuminata subsp. 
malaccensis]
Length=373

 Score =   408 bits (1049),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 190/299 (64%), Positives = 232/299 (78%), Gaps = 2/299 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             S+A+L+ VDQSG GD+  IQ AID+VPS N+E V+I + PGTYREKV VP DKPFITLSG
Sbjct  65    SSAILVRVDQSGKGDFRNIQAAIDAVPSNNAEPVFILITPGTYREKVTVPADKPFITLSG  124

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              +A +TVITW +G     SPT++V ASDFVGRYLTI NTFG +G  +AL V+GDR+A+Y 
Sbjct  125   SNAMSTVITWGEGWTSSESPTVSVLASDFVGRYLTIQNTFGPNGPAIALHVAGDRAAFYS  184

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI  +QDTLLD+ G+HYYSNCYIEG  DFI GN  +LFE C +HS + GGGAITAQRR 
Sbjct  185   CRIIGFQDTLLDDTGRHYYSNCYIEGATDFICGNGLALFEKCHLHSTSPGGGAITAQRRS  244

Query  783   SAEENTGFTFLGCKITGT--GTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             SA E+TG++FL CKITGT  GT +LGRPWGPYSRVV+  +YMS A+ PEGWNDW+DP+ Q
Sbjct  245   SAAESTGYSFLQCKITGTGAGTAILGRPWGPYSRVVFAFTYMSDAVLPEGWNDWNDPRNQ  304

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSS  1133
             RT YYGEY C+G G+D + RV WS  L+  EA+PF TK  I+GQ+WLR  P  F+R S+
Sbjct  305   RTAYYGEYSCFGRGSDVTGRVAWSHRLTPLEAEPFATKSWIDGQDWLRPTPRYFRRSSA  363



>emb|CDY59753.1| BnaC08g49280D [Brassica napus]
Length=350

 Score =   407 bits (1046),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 232/295 (79%), Gaps = 2/295 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSK--NSELVYISVKPGTYREKVVVPVDKPFITL  416
             STA+LI VDQSG GD+ KIQ+AIDS+P    NS+L +I VKPG YREKVV+P DKP+ITL
Sbjct  44    STAILIRVDQSGKGDFNKIQEAIDSIPPNLNNSQLYFIWVKPGVYREKVVIPADKPYITL  103

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG  ASNTV+ WSDG DI+ SPTLTVFASDF+ R+LTI N FG +G+ VALRV+ D +A+
Sbjct  104   SGTKASNTVLIWSDGEDILESPTLTVFASDFICRFLTIQNKFGTAGQAVALRVAADNAAF  163

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             YGC I SYQDTLLD+ G HY+ NCYIEG  DFI G+A+SL+E C +HS++   G+ITAQ 
Sbjct  164   YGCVITSYQDTLLDDNGNHYFKNCYIEGATDFICGSASSLYEKCHLHSLSPNNGSITAQM  223

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             R SA E +GF+FLGCK+TGTG+T LGRPWG YSRVV+  S+ S  + P+GWN+W D  + 
Sbjct  224   RSSATEKSGFSFLGCKLTGTGSTYLGRPWGAYSRVVFAYSFFSDVVAPQGWNEWGDSSKN  283

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
              TVYYGEYKCYGPGADR +RV+WS+ LS  EA  FM+K  I G++WLR AP++FK
Sbjct  284   NTVYYGEYKCYGPGADRRERVKWSKQLSDEEATIFMSKDFIGGKDWLRPAPSHFK  338



>ref|XP_006469306.1| PREDICTED: putative pectinesterase 11-like [Citrus sinensis]
Length=348

 Score =   407 bits (1045),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 195/296 (66%), Positives = 224/296 (76%), Gaps = 0/296 (0%)
 Frame = +3

Query  234   KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
             K  STAVLI V++ G GD+  IQ+AIDSVP  NSELV+ISV PG YREK++VP +KPFIT
Sbjct  39    KDFSTAVLIRVEKYGRGDFRTIQEAIDSVPDNNSELVFISVAPGIYREKIIVPANKPFIT  98

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             +SG  AS T ITWSDGG I+ S TLTV AS FV R LTI NT+G  GK VALRVS DR+A
Sbjct  99    ISGTKASRTKITWSDGGSILDSATLTVLASHFVARSLTIQNTYGSYGKAVALRVSADRAA  158

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +YGCRI SYQ TLLD+ G HYYS CYIEG  DFI GNA SLFE C IHS++  GGAITAQ
Sbjct  159   FYGCRILSYQHTLLDDTGNHYYSKCYIEGATDFISGNANSLFERCLIHSLSTWGGAITAQ  218

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             +R S+EENTGFTFL CKI+G G  VLGRPWGPYSRVV+  +YMS  I P+GWND +D   
Sbjct  219   KRVSSEENTGFTFLDCKISGVGKAVLGRPWGPYSRVVYALTYMSDVILPQGWNDLNDHAM  278

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             Q+ +YYGEY+C GPGADRSKRV WS SLS  EA  F++K +  G  WLR A   FK
Sbjct  279   QKKLYYGEYRCSGPGADRSKRVAWSNSLSDVEASMFLSKDLTGGGAWLRNAALKFK  334



>ref|XP_009778331.1| PREDICTED: putative pectinesterase 11 [Nicotiana sylvestris]
 ref|XP_009778332.1| PREDICTED: putative pectinesterase 11 [Nicotiana sylvestris]
Length=342

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 187/299 (63%), Positives = 230/299 (77%), Gaps = 1/299 (0%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q STA+LI VDQSG+GD+ KIQDAID+VPS NS+ ++ISVKPG YREK+VVP DKPFIT+
Sbjct  30    QLSTAILIKVDQSGNGDFKKIQDAIDAVPSHNSQHIFISVKPGIYREKIVVPADKPFITI  89

Query  417   SG-DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             SG    +NT+IT +D GDI  S T TVFASDFV R+LTI NT+G   K VALRV GDR  
Sbjct  90    SGRKPVNNTIITGNDFGDIFESSTFTVFASDFVARHLTIQNTYGTGAKAVALRVEGDRVG  149

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             + GCRIKS+QDTLLD+ G+HYY NCYIEG  DFI GN ASLFE C +HS++ G GAITAQ
Sbjct  150   FVGCRIKSHQDTLLDDVGRHYYKNCYIEGDTDFICGNGASLFEKCHLHSLSEGNGAITAQ  209

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
              R+S++ENTGFTF+GCKITG  + +LGRPWGPY+RVV+  +YMSS I P GW DW+ P R
Sbjct  210   HRQSSQENTGFTFVGCKITGVKSAILGRPWGPYARVVFAQTYMSSVILPYGWEDWNVPSR  269

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMS  1130
             QRT Y+ EYKCYGPGA   KRV W R+LS  +A P++ + ++  + W+R  PT+   +S
Sbjct  270   QRTSYFAEYKCYGPGASSDKRVNWLRTLSSEDAVPYLKESIMGPKSWIRSKPTHLIPLS  328



>ref|XP_006404616.1| hypothetical protein EUTSA_v10000702mg [Eutrema salsugineum]
 gb|ESQ46069.1| hypothetical protein EUTSA_v10000702mg [Eutrema salsugineum]
Length=346

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 233/296 (79%), Gaps = 2/296 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSK--NSELVYISVKPGTYREKVVVPVDKPFITL  416
             STA+LI VDQSG GD+IKIQ+AI+S+P    NS+L +I VKPGTYREKVV+P DKP+ITL
Sbjct  45    STAILIRVDQSGKGDFIKIQEAIESIPPNLNNSQLYFIWVKPGTYREKVVIPADKPYITL  104

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG  ASNT++ WSDG DI+ SPTLT+F SDFV R+LTI N FG +G+ VALRV+ D +A+
Sbjct  105   SGTQASNTILVWSDGEDILESPTLTIFGSDFVCRFLTIQNRFGTTGQAVALRVAADNAAF  164

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             YGC I SYQDTLLD+ G HY+ NCYIEG  DFI G+A+SL+E C +HS++   G+ITAQ 
Sbjct  165   YGCVITSYQDTLLDDNGNHYFKNCYIEGATDFICGSASSLYERCHLHSLSPNNGSITAQM  224

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             R SA E +GFTFLGCK+TG+G+T LGRPWG YSRVV+  S+ S  + P+GWN+W D  ++
Sbjct  225   RSSASEKSGFTFLGCKLTGSGSTFLGRPWGAYSRVVFAYSFFSDVVAPQGWNEWGDSSKE  284

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
              TVYYGEYKCYGPGADR  RV+WS+ LS  EA  F++K  I G++WLR AP++FK 
Sbjct  285   NTVYYGEYKCYGPGADRGPRVKWSKQLSYDEAAVFLSKDFIGGKDWLRPAPSHFKN  340



>gb|KDO47531.1| hypothetical protein CISIN_1g046674mg, partial [Citrus sinensis]
Length=261

 Score =   402 bits (1034),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/259 (73%), Positives = 214/259 (83%), Gaps = 0/259 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             ST +LI VDQSG GD+ KIQDAIDSVPS NS+L +I +KPGTYREK+VVP DKPFIT+SG
Sbjct  2     STTILIRVDQSGRGDFKKIQDAIDSVPSNNSKLYFIWIKPGTYREKIVVPADKPFITISG  61

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               ASNT+ITWSDGG+I  S T TV ASDFVGR+LTI NT+G +GK VALRVS +R+A+YG
Sbjct  62    TKASNTIITWSDGGEIFQSATFTVMASDFVGRFLTIENTYGSAGKAVALRVSANRAAFYG  121

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI SYQDTLLD+ G HYYS+CYIEG  DFI GNAASLFE C IHS++ G GAITAQ+R 
Sbjct  122   CRILSYQDTLLDDTGNHYYSSCYIEGATDFICGNAASLFERCHIHSLSTGNGAITAQKRV  181

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S+EENTGFTFLGCKITG G  VLGRPWGPYSRVV+  +YMS  + P+GWNDW D  +   
Sbjct  182   SSEENTGFTFLGCKITGVGKAVLGRPWGPYSRVVYALTYMSGLVLPQGWNDWHDYAKHTN  241

Query  963   VYYGEYKCYGPGADRSKRV  1019
             VYYGEYKCYGPGADRS RV
Sbjct  242   VYYGEYKCYGPGADRSSRV  260



>ref|XP_006295983.1| hypothetical protein CARUB_v10025126mg [Capsella rubella]
 gb|EOA28881.1| hypothetical protein CARUB_v10025126mg [Capsella rubella]
Length=344

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 233/295 (79%), Gaps = 2/295 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSK--NSELVYISVKPGTYREKVVVPVDKPFITL  416
             STA+LI VDQSG GD+ KIQ+AI+S+P    N +L YI VKPG YREKVV+P DKP+ITL
Sbjct  45    STAILIRVDQSGKGDFTKIQEAIESIPPNLNNIQLYYIWVKPGIYREKVVIPADKPYITL  104

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG  ASNT + W+DG DI+ SPTLT+FASDFV R+LTI N FG +G+ VALRV+ DR+A+
Sbjct  105   SGTRASNTFLIWNDGEDILESPTLTIFASDFVCRFLTIQNKFGTAGRAVALRVAADRAAF  164

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             YGC I SYQDTLLD+ G HY++NCYIEG  DFI G+A+SL+E C +HS++   G+ITAQ 
Sbjct  165   YGCVITSYQDTLLDDNGNHYFNNCYIEGATDFICGSASSLYEKCHLHSLSPNNGSITAQM  224

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             R SA E +GFTFLGCK+TG+G+T LGRPWG YSRVV+  S+ S+ + P+GWN W D  +Q
Sbjct  225   RTSATEKSGFTFLGCKLTGSGSTYLGRPWGAYSRVVFAYSFFSNVVAPQGWNQWGDSTKQ  284

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
              TVYYGEYKCYGPGADR +RV+WS+ LS  EA  F++K  I G++WLR AP++FK
Sbjct  285   NTVYYGEYKCYGPGADRGQRVKWSKQLSNNEATVFLSKDFIGGKDWLRPAPSHFK  339



>ref|XP_009612493.1| PREDICTED: putative pectinesterase 11 [Nicotiana tomentosiformis]
 ref|XP_009612494.1| PREDICTED: putative pectinesterase 11 [Nicotiana tomentosiformis]
 ref|XP_009612495.1| PREDICTED: putative pectinesterase 11 [Nicotiana tomentosiformis]
 ref|XP_009612496.1| PREDICTED: putative pectinesterase 11 [Nicotiana tomentosiformis]
 ref|XP_009612497.1| PREDICTED: putative pectinesterase 11 [Nicotiana tomentosiformis]
Length=341

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 228/299 (76%), Gaps = 1/299 (0%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q S+A+LI VDQSG GDY KIQDAID+VPS NS+ ++ISVKPG YREK+VVP DKPFIT+
Sbjct  29    QLSSAILIKVDQSGKGDYKKIQDAIDAVPSHNSQHIFISVKPGIYREKIVVPADKPFITI  88

Query  417   SG-DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             SG    +NT+IT ++ GDI  S T TVFASDFV R+LTI NT+G   K VALRV GDR  
Sbjct  89    SGRKPVNNTIITGNNFGDIFKSSTFTVFASDFVARHLTIQNTYGTGAKAVALRVEGDRVG  148

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             + GCRIKS+QDTLLD+ G+HYY NCYIEG  DFI GN ASLFE C +HS++ G GAITAQ
Sbjct  149   FVGCRIKSHQDTLLDDVGRHYYKNCYIEGDTDFICGNGASLFEKCHLHSLSQGNGAITAQ  208

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
              R+S++ENTGFTF+GCKITG  + +LGRPWGPY+RV++  +YMSS I P GW DW+ P R
Sbjct  209   HRQSSQENTGFTFVGCKITGVKSAILGRPWGPYARVIFAQTYMSSVILPYGWEDWNVPSR  268

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMS  1130
             QRT Y+ EYKCYGPGA   KRV W R+LS  EA P++ + ++  + W+R  P N   +S
Sbjct  269   QRTSYFAEYKCYGPGASSDKRVNWLRTLSSEEAVPYLKESIMGPKSWIRSKPINLIPLS  327



>ref|XP_004238288.1| PREDICTED: putative pectinesterase 11 [Solanum lycopersicum]
Length=347

 Score =   405 bits (1040),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 187/300 (62%), Positives = 226/300 (75%), Gaps = 2/300 (1%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q S A+LI VDQSG GDY KIQDAID+VPSKN++ V+I VKPG YREKVVVP DKPFIT+
Sbjct  34    QLSNAILIKVDQSGKGDYKKIQDAIDAVPSKNTQHVFILVKPGVYREKVVVPSDKPFITI  93

Query  417   SGDDAS--NTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRS  590
             SG   +  NT+IT +D GDI  SPT TVFASDFV RYLTI NT+G   K VALRV GD++
Sbjct  94    SGRKTTVKNTIITGNDYGDIFKSPTFTVFASDFVARYLTIQNTYGSGAKAVALRVEGDKA  153

Query  591   AWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITA  770
              + GCRI S+QDTLLD+ G+HYY NCYIEG  DFI GNAASLFE C +HS++   GAITA
Sbjct  154   TFVGCRIMSHQDTLLDDVGRHYYKNCYIEGDTDFICGNAASLFEKCHLHSLSQSNGAITA  213

Query  771   QRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPK  950
             Q R+S +ENTGFTF GCKITG  + +LGRPWG Y+RVV+  +YMSS I P GW DW+D  
Sbjct  214   QHRQSPQENTGFTFYGCKITGVKSAILGRPWGAYARVVFAQTYMSSVILPNGWEDWNDSS  273

Query  951   RQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMS  1130
             RQRT Y+ EYKCYGPGA  +KRV W ++LS  EA P++ + ++  + W R  PT+   +S
Sbjct  274   RQRTSYFAEYKCYGPGASSNKRVNWLKTLSSEEAVPYLKESIMGPKSWTRSKPTHLTPLS  333



>ref|XP_010690859.1| PREDICTED: putative pectinesterase 11 [Beta vulgaris subsp. vulgaris]
Length=370

 Score =   405 bits (1041),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 195/297 (66%), Positives = 238/297 (80%), Gaps = 3/297 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STAVLI VDQSG G+Y KIQDAID+VPS N+E V+I VKPGTYREK+VVP  KP+ITLSG
Sbjct  65    STAVLIRVDQSGQGNYRKIQDAIDAVPSNNTEFVFIWVKPGTYREKIVVPATKPYITLSG  124

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
             + A++T+ITW  GG I  S T++VFAS+FVGRYLT  NT+G  G GVALRV+GD++A+YG
Sbjct  125   NRANDTIITWDAGGHIYDSATVSVFASNFVGRYLTFENTYGTRGVGVALRVAGDKAAFYG  184

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHS-IAVGGGAITAQRR  779
             CR+ SYQDTLLD+ G+HYY +CYIEG  DFI GNAASLFE C +HS I VG  AITAQ+R
Sbjct  185   CRMVSYQDTLLDDTGRHYYKSCYIEGATDFICGNAASLFEKCHVHSVIEVGVAAITAQKR  244

Query  780   ESAEENTGFTFLGCKITGTG--TTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             E+  E+TGF FLGCKITG G  TT LGRPWG +SRV++  SY+SSAI   GW++W D K+
Sbjct  245   ETPLESTGFIFLGCKITGKGVETTFLGRPWGVHSRVIFTLSYLSSAISTVGWDNWGDSKK  304

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
             +RTV YGEYKCYGPGA+R+KRV WS+ L+  EA PF++K MI G+ W+R AP  FK+
Sbjct  305   ERTVTYGEYKCYGPGANRAKRVGWSKGLTNEEAAPFLSKDMIGGRGWIRPAPIKFKK  361



>ref|XP_010254791.1| PREDICTED: laccase-11-like [Nelumbo nucifera]
Length=875

 Score =   421 bits (1082),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/296 (67%), Positives = 231/296 (78%), Gaps = 0/296 (0%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
               STA+LI VDQSG GD+  +QDAIDSVPS NS +V+I VKPGTYREKVVVP  KP+ITL
Sbjct  38    HMSTALLIRVDQSGKGDFKTVQDAIDSVPSNNSNVVFIWVKPGTYREKVVVPAGKPYITL  97

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG + + T+ITW+D G I  SPTL+V A+DFV RYLTI NT G   + VALRVS DR+A+
Sbjct  98    SGSNPTTTIITWNDSGVIFQSPTLSVLATDFVARYLTIQNTHGPGSQAVALRVSADRAAF  157

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             Y CRI SYQDT+LD+ G+HYY NCYIEG  DFI GN ASLFE C +HS++ G GAITAQ 
Sbjct  158   YACRILSYQDTILDDTGRHYYRNCYIEGQTDFICGNGASLFEKCHLHSLSEGAGAITAQH  217

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             RES  ENTGFTFLGC+ITG GT VLGRPWG YSRVV+  SY+S+ I P+GW++W DP +Q
Sbjct  218   RESPAENTGFTFLGCRITGVGTAVLGRPWGAYSRVVFALSYISNVILPQGWDNWGDPTKQ  277

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
              T YYGEYKCYG GA+ S RVEWS +LS AEA PF+TK MI G+ WLR +PT F R
Sbjct  278   STAYYGEYKCYGAGANVSGRVEWSHNLSNAEAAPFLTKDMIGGRGWLRPSPTRFLR  333



>ref|NP_179755.1| pectinesterase 11 [Arabidopsis thaliana]
 sp|Q9SIJ9.1|PME11_ARATH RecName: Full=Putative pectinesterase 11; Short=PE 11; AltName: 
Full=Pectin methylesterase 11; Short=AtPME11 [Arabidopsis 
thaliana]
 gb|AAD23644.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEC07202.1| pectinesterase 11 [Arabidopsis thaliana]
Length=352

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 184/294 (63%), Positives = 232/294 (79%), Gaps = 2/294 (1%)
 Frame = +3

Query  246   TAVLIIVDQSGHGDYIKIQDAIDSVPSK--NSELVYISVKPGTYREKVVVPVDKPFITLS  419
             TA+LI VDQSG GD+ KIQ+AI+S+P    NS+L +I VKPG YREKVV+P +KP+ITLS
Sbjct  47    TAILIRVDQSGKGDFSKIQEAIESIPPNLNNSQLYFIWVKPGIYREKVVIPAEKPYITLS  106

Query  420   GDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWY  599
             G  ASNT + WSDG DI+ SPTLT+FASDFV R+LTI N FG +G+ VALRV+ D++A+Y
Sbjct  107   GTQASNTFLIWSDGEDILESPTLTIFASDFVCRFLTIQNKFGTAGRAVALRVAADKAAFY  166

Query  600   GCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRR  779
             GC I SYQDTLLD+ G HY+ NCYIEG  DFI G+A+SL+E C +HS++   G+ITAQ R
Sbjct  167   GCVITSYQDTLLDDNGNHYFKNCYIEGATDFICGSASSLYERCHLHSLSPNNGSITAQMR  226

Query  780   ESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQR  959
              SA E +GFTFLGCK+TG+G+T LGRPWG YSRVV+  S+ S+ + P+GWN W D  ++ 
Sbjct  227   TSATEKSGFTFLGCKLTGSGSTFLGRPWGAYSRVVFAYSFFSNVVAPQGWNQWGDSTKEN  286

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             TVYYGEYKCYGPGADR +RVEWS+ LS  EA  F++K  I G++WLR AP++FK
Sbjct  287   TVYYGEYKCYGPGADREQRVEWSKQLSDEEATVFLSKDFIGGKDWLRPAPSHFK  340



>ref|XP_010472159.1| PREDICTED: putative pectinesterase 11 [Camelina sativa]
Length=349

 Score =   402 bits (1034),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 186/294 (63%), Positives = 231/294 (79%), Gaps = 2/294 (1%)
 Frame = +3

Query  246   TAVLIIVDQSGHGDYIKIQDAIDSVPSK--NSELVYISVKPGTYREKVVVPVDKPFITLS  419
             TA+LI VDQSG GD+ KIQ+AI+S+P    NS+L YI VKPG YREKVV+P DK +ITLS
Sbjct  52    TAILIRVDQSGKGDFNKIQEAIESIPPNLNNSQLYYIWVKPGIYREKVVIPADKSYITLS  111

Query  420   GDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWY  599
             G  ASNT + WSDG DI+ SPTLT+FASDFV R+LTI N FG +G+ VALRV+ D++A+Y
Sbjct  112   GTRASNTFLIWSDGEDILESPTLTIFASDFVCRFLTIQNKFGTAGRAVALRVAADKAAFY  171

Query  600   GCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRR  779
             GC I SYQDTLLD+ G HY+ NCYIEG  DFI G+A+SL+E C +HS++   G+ITAQ R
Sbjct  172   GCVITSYQDTLLDDNGNHYFKNCYIEGATDFICGSASSLYEKCHLHSLSPNNGSITAQMR  231

Query  780   ESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQR  959
              SA E +GFTFLGCKITG+G+T LGRPWG YSRVV+  S+ S+ + P+GWN W D  +Q 
Sbjct  232   TSATEKSGFTFLGCKITGSGSTFLGRPWGAYSRVVFAYSFFSNVVAPQGWNQWGDSTKQN  291

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             TVYYGEYKCYGPGADR +RV+WS+ LS  EA  F++K  I G++WLR AP++FK
Sbjct  292   TVYYGEYKCYGPGADRGQRVKWSKQLSDDEATVFLSKDFIGGKDWLRPAPSHFK  345



>ref|XP_006423292.1| hypothetical protein CICLE_v10030026mg [Citrus clementina]
 gb|ESR36532.1| hypothetical protein CICLE_v10030026mg [Citrus clementina]
Length=343

 Score =   401 bits (1031),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 222/296 (75%), Gaps = 0/296 (0%)
 Frame = +3

Query  234   KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
             K  S AVLI V++ G GD+  IQ AIDSVP  NSELV+ISV PG YREK++VP +KPFIT
Sbjct  34    KDFSAAVLIRVEKYGRGDFRTIQGAIDSVPDNNSELVFISVAPGIYREKIIVPANKPFIT  93

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             +SG  AS+T ITWSDGG I+ S T TV AS FV R LTI NT+G  GK VALRVS DR+A
Sbjct  94    ISGTKASHTKITWSDGGSILDSATFTVLASHFVARSLTIQNTYGSYGKAVALRVSADRAA  153

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +YGCRI SYQ TLLD+ G HYYS CYIEG  DFI GNA SLFE C IHS++  GGAITAQ
Sbjct  154   FYGCRILSYQHTLLDDTGNHYYSKCYIEGATDFISGNANSLFERCLIHSLSTWGGAITAQ  213

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             +R S+EENTGFTFL CKI+G G  VLGRPWGPYSRVV+  +YMS  I P+GWND +D   
Sbjct  214   KRVSSEENTGFTFLDCKISGVGKAVLGRPWGPYSRVVYALTYMSDVILPQGWNDLNDHAM  273

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             Q+ +YYGEY+C GPGADRSKR+ WS SLS  EA  F++K +  G  WLR A   FK
Sbjct  274   QKKLYYGEYRCSGPGADRSKRIAWSNSLSDVEAYMFLSKDLTGGGAWLRNAALKFK  329



>ref|XP_006469308.1| PREDICTED: putative pectinesterase 11-like [Citrus sinensis]
Length=348

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 222/296 (75%), Gaps = 0/296 (0%)
 Frame = +3

Query  234   KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
             K  S AVLI V++ G GD+  IQ AIDSVP  NSELV+ISV PG YREK++VP +KPFIT
Sbjct  39    KDFSAAVLIRVEKYGRGDFRTIQGAIDSVPDNNSELVFISVAPGIYREKIIVPANKPFIT  98

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             +SG  AS+T ITWSDGG I+ S T TV AS FV R LTI NT+G  GK VALRVS DR+A
Sbjct  99    ISGTKASHTKITWSDGGSILDSATFTVLASHFVARSLTIQNTYGSYGKAVALRVSADRAA  158

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +YGCRI SYQ TLLD+ G HYYS CYIEG  DFI GNA SLFE C IHS++  GGAITAQ
Sbjct  159   FYGCRILSYQHTLLDDTGNHYYSKCYIEGATDFISGNANSLFERCLIHSLSTWGGAITAQ  218

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             +R S+EENTGFTFL CKI+G G  VLGRPWGPYSRVV+  +YMS  I P+GWND +D   
Sbjct  219   KRVSSEENTGFTFLDCKISGVGKAVLGRPWGPYSRVVYALTYMSDVILPQGWNDLNDHAM  278

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             Q+ +YYGEY+C GPGADRSKR+ WS SLS  EA  F++K +  G  WLR A   FK
Sbjct  279   QKKLYYGEYRCSGPGADRSKRIAWSNSLSDVEAYMFLSKDLTGGGAWLRNAALKFK  334



>ref|XP_002880391.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56650.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/297 (62%), Positives = 232/297 (78%), Gaps = 2/297 (1%)
 Frame = +3

Query  246   TAVLIIVDQSGHGDYIKIQDAIDSVPSK--NSELVYISVKPGTYREKVVVPVDKPFITLS  419
             TA+LI VDQSG GD+ KIQ+AI+S+P    NS+L YI VKPG YREKVV+P DKP+ITLS
Sbjct  48    TAILIRVDQSGKGDFSKIQEAIESIPPNLNNSQLYYIWVKPGIYREKVVIPADKPYITLS  107

Query  420   GDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWY  599
             G  ASNT + WSDGGDI+ SPTLT+FA+DFV R+LTI N  G +G+ VALRV+ D++A+Y
Sbjct  108   GTQASNTFLIWSDGGDILESPTLTIFATDFVCRFLTIQNKLGTAGRAVALRVAADKAAFY  167

Query  600   GCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRR  779
             GC I SYQDTLLD+ G HY+ NCYIEG  DFI G+A+SL+E C +HS++   G+ITAQ R
Sbjct  168   GCVITSYQDTLLDDNGNHYFKNCYIEGATDFICGSASSLYERCHLHSLSPTKGSITAQMR  227

Query  780   ESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQR  959
              SA E +GF FLGCK+TG+ +T LGRPWGPYSRV++  S+ S+ + P GWN W D  ++ 
Sbjct  228   TSATEKSGFIFLGCKLTGSSSTYLGRPWGPYSRVIFAYSFFSNVVAPRGWNQWGDSTKEN  287

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMS  1130
             TVYYGEYKCYGPGADR +RV+WS+ LS  EA  F++K  I G++WLR AP++FK+ S
Sbjct  288   TVYYGEYKCYGPGADRGQRVKWSKQLSDDEATVFLSKDFIGGKDWLRPAPSHFKKWS  344



>ref|XP_009117678.1| PREDICTED: putative pectinesterase 11 [Brassica rapa]
 emb|CDY13802.1| BnaA09g43040D [Brassica napus]
Length=356

 Score =   400 bits (1028),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 230/295 (78%), Gaps = 2/295 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSK--NSELVYISVKPGTYREKVVVPVDKPFITL  416
             STA+LI VDQSG GD+ KIQ+AIDS+P    NS+L +I VKPG YREKVV+P DKP+ITL
Sbjct  44    STAILIRVDQSGKGDFNKIQEAIDSIPPNLNNSQLYFIWVKPGVYREKVVIPADKPYITL  103

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG  AS TV+ WSDG DI+ S TLTVFASDFV R+LTI N FG +G+ VALRV+ D +A+
Sbjct  104   SGTKASTTVLIWSDGEDILESSTLTVFASDFVCRFLTIQNKFGTAGQAVALRVAADNAAF  163

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             YGC I SYQDTLLD+ G HY+ NCYIEG  DFI G+A+SL+E C +HS++   G++TAQ 
Sbjct  164   YGCVIMSYQDTLLDDNGNHYFKNCYIEGATDFICGSASSLYEKCHLHSLSPNNGSMTAQM  223

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             R SA + +GF+FLGCK+TGTG+T LGRPWG YSRVV+  S+ S  + P+GWN+W D  + 
Sbjct  224   RSSATDKSGFSFLGCKLTGTGSTYLGRPWGAYSRVVFAYSFFSDVVAPQGWNEWGDSSKN  283

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
              TVYYGEYKCYGPGADR +RV+WS+ LS  EA  FM+K  I G++WLR AP++FK
Sbjct  284   NTVYYGEYKCYGPGADRRERVKWSKQLSDEEATVFMSKDFIGGKDWLRPAPSHFK  338



>ref|XP_009365658.1| PREDICTED: putative pectinesterase 11 [Pyrus x bretschneideri]
Length=337

 Score =   398 bits (1023),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/297 (62%), Positives = 225/297 (76%), Gaps = 1/297 (0%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q STA+LI VDQ+G GDY KIQDAID+VPS N +LV++ V PG Y+EK+ VP DKPFIT+
Sbjct  34    QGSTAILITVDQTGKGDYKKIQDAIDAVPSNNVDLVFVKVNPGVYKEKITVPADKPFITI  93

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
             SG  A  TVITW+D G+I  S T +V ASDF+GRYLTI NT+GR  K VALRVSGDR+A+
Sbjct  94    SGTTAGGTVITWNDSGNIFESATFSVLASDFIGRYLTIQNTYGRGDKAVALRVSGDRAAF  153

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             Y CRI SYQDTLLD+  +HYY+NCYIEG  DFI GNAAS FE C +HSI+ GGGAITAQR
Sbjct  154   YVCRILSYQDTLLDDTSRHYYNNCYIEGATDFICGNAASFFEKCHLHSISDGGGAITAQR  213

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             R S  E+TGF F GCKIT   T VLGRPWG YSRV++  +YM +AI P+GW++W     Q
Sbjct  214   RMSPSEDTGFIFFGCKITSVKTAVLGRPWGVYSRVIFAFTYMPNAILPQGWDNWGHSADQ  273

Query  957   -RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKR  1124
               +VYYG+Y+C GPGA  SKRV+W+R L+  EA P +TK  I+ + W+R  P +FK+
Sbjct  274   LSSVYYGQYECSGPGAVTSKRVDWARVLTSEEAAPLITKDSIDAKAWIRATPNSFKK  330



>ref|XP_006469309.1| PREDICTED: putative pectinesterase 11-like [Citrus sinensis]
Length=348

 Score =   398 bits (1023),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/296 (64%), Positives = 223/296 (75%), Gaps = 0/296 (0%)
 Frame = +3

Query  234   KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
             K  STAVLI V++ G GD+  IQ+AIDSVP+ N+ELV+ISV PG YREK++VP +KPFIT
Sbjct  39    KDFSTAVLIRVEKYGRGDFRTIQEAIDSVPANNAELVFISVAPGIYREKIIVPANKPFIT  98

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             +SG  AS+T ITWSDGG I+ S TLTV AS F+ R LTI NT+G  GK VALRVS DR+A
Sbjct  99    ISGTRASHTKITWSDGGSILDSATLTVLASHFIARSLTIQNTYGSYGKAVALRVSADRAA  158

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +YGCRI SY  TLLD+ G HYYS CYIEG  DFI GNA S FE C +HS++  GGAITAQ
Sbjct  159   FYGCRILSYNHTLLDDTGNHYYSKCYIEGATDFISGNANSFFERCLLHSLSTWGGAITAQ  218

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             +R S+EENTGFTFL CKI+G G  VLGRPWGPYSRVV+  +YMS  I P+GWND +D  +
Sbjct  219   KRVSSEENTGFTFLDCKISGVGKAVLGRPWGPYSRVVYALTYMSDEIVPQGWNDLNDHAK  278

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
                +YYGEY+C GPGAD SKRV WS SLS AEA  F++K +  G  WLR A   FK
Sbjct  279   HNKLYYGEYRCSGPGADGSKRVAWSNSLSDAEASMFLSKDLTGGGAWLRNAALKFK  334



>ref|XP_006423291.1| hypothetical protein CICLE_v10030015mg [Citrus clementina]
 gb|ESR36531.1| hypothetical protein CICLE_v10030015mg [Citrus clementina]
Length=321

 Score =   396 bits (1018),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 189/296 (64%), Positives = 223/296 (75%), Gaps = 0/296 (0%)
 Frame = +3

Query  234   KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
             K  STAVLI V++ G GD+  IQ+AIDSVP+ N+ELV+ISV PG YREK++VP +KPFIT
Sbjct  12    KDFSTAVLIRVEKYGRGDFRTIQEAIDSVPANNAELVFISVAPGIYREKIIVPANKPFIT  71

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             +SG  AS+T ITWSDGG I+ S TLTV AS F+ R LTI NT+G  GK VALRVS DR+A
Sbjct  72    ISGTRASHTKITWSDGGSILDSATLTVLASHFIARSLTIQNTYGSYGKAVALRVSADRAA  131

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +YGCRI SY  TLLD+ G HYYS CYIEG  DFI GNA S FE C +HS++  GGAITAQ
Sbjct  132   FYGCRILSYNHTLLDDTGNHYYSKCYIEGATDFISGNANSFFERCLLHSLSTWGGAITAQ  191

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             +R S+EENTGFTFL CKI+G G  VLGRPWGPYSRVV+  +YMS  I P+GWND +D  +
Sbjct  192   KRVSSEENTGFTFLDCKISGVGKAVLGRPWGPYSRVVYALTYMSDEIVPQGWNDLNDHAK  251

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
                +YYGEY+C GPGAD SKRV WS SLS AEA  F++K +  G  WLR A   FK
Sbjct  252   HNKLYYGEYRCSGPGADGSKRVAWSNSLSDAEASMFLSKDLTGGGAWLRNAALKFK  307



>ref|XP_006342220.1| PREDICTED: putative pectinesterase 11-like [Solanum tuberosum]
Length=347

 Score =   397 bits (1021),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 184/296 (62%), Positives = 223/296 (75%), Gaps = 2/296 (1%)
 Frame = +3

Query  249   AVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD  428
             A+LIIVDQSG+GDY KIQDAID+VPSKN++ V+I VKPG Y EKVVVP DKPFIT+SG  
Sbjct  38    AILIIVDQSGNGDYKKIQDAIDAVPSKNTQHVFILVKPGVYTEKVVVPSDKPFITISGRK  97

Query  429   AS--NTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              +  NT+IT SD GDI  SPT TVFASDFV RYLTI NT+G   K VALRV GD++ + G
Sbjct  98    TTVKNTIITGSDYGDIFKSPTFTVFASDFVARYLTIQNTYGSGEKAVALRVEGDKATFLG  157

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI S+QDTLLD+ G+HYY NCYIEG  DFI GNAASLFE C +HS++   GAITA  R+
Sbjct  158   CRIMSHQDTLLDDVGRHYYKNCYIEGDTDFICGNAASLFEKCHLHSLSQSNGAITAHHRQ  217

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S +ENTGFTF GCKITG  + +LGRPWG Y+RVV+  +YMSS I P GW DW+D  RQRT
Sbjct  218   SPQENTGFTFYGCKITGVKSAILGRPWGAYARVVFAQTYMSSVILPNGWEDWNDSSRQRT  277

Query  963   VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMS  1130
              Y+ EYKCYGPGA  + RV+W R+LS  E  P++ + ++  + W R  PT+   +S
Sbjct  278   SYFAEYKCYGPGASSNNRVDWLRTLSSEEDVPYLKESIMGPKSWTRSKPTHLTPLS  333



>ref|XP_006469310.1| PREDICTED: putative pectinesterase 11-like [Citrus sinensis]
Length=348

 Score =   396 bits (1018),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/296 (64%), Positives = 221/296 (75%), Gaps = 0/296 (0%)
 Frame = +3

Query  234   KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
             K  STAVLI V++ G GD+  IQ+AIDSVP+ NSELV+ISV PG YREK++VP +KPFIT
Sbjct  39    KDISTAVLIRVEKYGRGDFRTIQEAIDSVPANNSELVFISVAPGIYREKIIVPANKPFIT  98

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             +S   AS+T ITWSDGG I+ S TLTV AS FV R LTI NT+G  GK VALRVS D++A
Sbjct  99    ISATKASHTKITWSDGGSILDSATLTVLASHFVARSLTIQNTYGSFGKAVALRVSADKAA  158

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +YGCRI SYQ TLLD+ G HYYS CYIEG  DFI GNA S FE C IHS++  GGAITAQ
Sbjct  159   FYGCRILSYQHTLLDDTGNHYYSKCYIEGATDFISGNANSFFERCLIHSLSTWGGAITAQ  218

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             +R S+EENTGFTFL CKI+G G  VLGRPWG YSRVV+  +YMS  I P+GWND +D  +
Sbjct  219   KRVSSEENTGFTFLDCKISGVGKAVLGRPWGAYSRVVYALTYMSDVIVPQGWNDLNDHAK  278

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
                +YYGEY+C GPGADRSKR+ WS SLS  EA  F++K +     WLR A   FK
Sbjct  279   HNKLYYGEYRCSGPGADRSKRIAWSNSLSDVEASTFLSKDLTGRGTWLRNAALKFK  334



>gb|KDO47532.1| hypothetical protein CISIN_1g042845mg, partial [Citrus sinensis]
Length=327

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/296 (64%), Positives = 222/296 (75%), Gaps = 0/296 (0%)
 Frame = +3

Query  234   KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
             K  STAVLI V++ G GD+  IQ+AIDSVP+ NSELV+ISV PG Y+EK++VP +KPFIT
Sbjct  18    KDISTAVLIRVEKYGRGDFRTIQEAIDSVPANNSELVFISVAPGIYKEKIIVPANKPFIT  77

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             +SG  AS+T ITWSDGG I+ S TLTV AS FV R LTI NT+G  GK VALRVS D++A
Sbjct  78    ISGTKASHTKITWSDGGSILDSATLTVLASHFVARSLTIQNTYGSFGKAVALRVSADKAA  137

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +YGCRI SYQ TLLD+ G HYYS CYIEG  DFI GNA S FE C IHS++  GGAITAQ
Sbjct  138   FYGCRILSYQHTLLDDTGNHYYSKCYIEGATDFISGNANSFFERCLIHSLSTWGGAITAQ  197

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             +R S+EENTGFTFL CKI+G G  VLGRPWG YSRVV+  +YMS  I P+GWND +D  +
Sbjct  198   KRVSSEENTGFTFLDCKISGVGKAVLGRPWGAYSRVVYALTYMSDVIVPQGWNDLNDHAK  257

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
                +YYGEY+C GPGADRSKR+ WS SLS  EA  F++K +     WLR A   FK
Sbjct  258   HNKLYYGEYRCSGPGADRSKRIAWSNSLSDVEASTFLSKDLTGRGTWLRNAALKFK  313



>ref|XP_010926015.1| PREDICTED: laccase-11-like [Elaeis guineensis]
Length=847

 Score =   412 bits (1058),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/299 (62%), Positives = 239/299 (80%), Gaps = 2/299 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             S+A+LIIVDQSG GD+ KIQDAID+VPS N+E ++I ++PG YREK+VVP DKPFITLSG
Sbjct  12    SSAILIIVDQSGKGDFTKIQDAIDAVPSNNTEPIFIRIEPGIYREKIVVPADKPFITLSG  71

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               A +T+ITW++G + + SPT +V ASDFVGRYLTI NTFG SG+ +ALRV+GDR A+YG
Sbjct  72    TKAKSTIITWNEGWNTVESPTASVLASDFVGRYLTIQNTFGSSGQAIALRVAGDRVAFYG  131

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CR  S+QDTLLD+ G+HYY+NCYIEG  DFI GN  +LFE C +HS++  GGAITAQRRE
Sbjct  132   CRFFSFQDTLLDDTGRHYYTNCYIEGATDFICGNGQALFEKCHLHSVSTNGGAITAQRRE  191

Query  783   SAEENTGFTFLGCKIT--GTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             SA +NTG++F+ CK+T  G GTT LGRPWG YSRVV+  +YM++++  +GW+DW DP +Q
Sbjct  192   SALDNTGYSFVSCKVTGVGVGTTFLGRPWGAYSRVVFAFTYMTNSVAAQGWDDWGDPNKQ  251

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSS  1133
             RT +YG+Y+CYGPG+D S RV WSR LS +EA  F+TK  I+G+ WLR  P +F+  S+
Sbjct  252   RTAFYGQYRCYGPGSDLSGRVGWSRPLSVSEASQFVTKSWIDGRNWLRPRPAHFRNFST  310



>ref|XP_006423290.1| hypothetical protein CICLE_v10029855mg, partial [Citrus clementina]
 gb|ESR36530.1| hypothetical protein CICLE_v10029855mg, partial [Citrus clementina]
Length=362

 Score =   395 bits (1015),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 188/296 (64%), Positives = 221/296 (75%), Gaps = 0/296 (0%)
 Frame = +3

Query  234   KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
             K  STAVLI V++ G GD+  IQ+AIDSVP+ NSELV+ISV PG YREK++VP +KPFIT
Sbjct  53    KDISTAVLIRVEKYGRGDFRTIQEAIDSVPANNSELVFISVAPGIYREKIIVPANKPFIT  112

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             +S   AS+T ITWSDGG I+ S TLTV AS FV R LTI NT+G  GK VALRVS D++A
Sbjct  113   ISATKASHTKITWSDGGSILDSATLTVLASHFVARSLTIQNTYGSFGKAVALRVSADKAA  172

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +YGCRI SYQ TLLD+ G HYYS CYIEG  DFI GNA S FE C IHS++  GGAITAQ
Sbjct  173   FYGCRILSYQHTLLDDTGNHYYSKCYIEGATDFISGNANSFFERCLIHSLSTWGGAITAQ  232

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             +R S+EENTGFTFL CKI+G G  VLGRPWG YSRVV+  +YMS  I P+GWND +D  +
Sbjct  233   KRVSSEENTGFTFLDCKISGVGKAVLGRPWGAYSRVVYALTYMSDVIVPQGWNDLNDHAK  292

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
                +YYGEY+C GPGADRSKR+ WS SLS  EA  F++K +     WLR A   FK
Sbjct  293   HNKLYYGEYRCSGPGADRSKRIAWSNSLSDVEASTFLSKDLTGRGTWLRNAALKFK  348



>gb|KDO47533.1| hypothetical protein CISIN_1g038331mg [Citrus sinensis]
Length=321

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/296 (63%), Positives = 221/296 (75%), Gaps = 0/296 (0%)
 Frame = +3

Query  234   KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
             K  STAVLI V++ G GD+  IQ+AIDSVP+ N+ELV+ISV PG YREK++VP +KPFIT
Sbjct  12    KDFSTAVLIRVEKYGRGDFRTIQEAIDSVPANNAELVFISVAPGIYREKIIVPANKPFIT  71

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             +SG  AS+T ITWSDGG I+ S TLTV AS F+ R LTI NT+G  GK VALRVS DR+A
Sbjct  72    ISGTRASHTKITWSDGGSILDSATLTVLASHFIARSLTIQNTYGSYGKAVALRVSADRAA  131

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +YGCRI SY  TLLD+ G HYYS CYIEG  DFI GNA S FE C IHS++  GGAITAQ
Sbjct  132   FYGCRILSYNHTLLDDTGNHYYSKCYIEGATDFISGNANSFFERCLIHSLSTWGGAITAQ  191

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             +R S++ENTGFTFL CKI+G G  VLGR WGPYSRVV+  +YMS  I P+GWND +D  +
Sbjct  192   KRVSSQENTGFTFLDCKISGVGKAVLGRTWGPYSRVVYALTYMSDVIVPQGWNDLNDHAK  251

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
                +YYGEY+C GPGAD SKRV WS SLS AEA  F++K +  G  WLR A    K
Sbjct  252   HNKLYYGEYRCSGPGADGSKRVAWSNSLSDAEASMFLSKDLTGGGAWLRNAALKLK  307



>ref|XP_010429084.1| PREDICTED: putative pectinesterase 11 [Camelina sativa]
Length=353

 Score =   390 bits (1002),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/294 (63%), Positives = 232/294 (79%), Gaps = 2/294 (1%)
 Frame = +3

Query  246   TAVLIIVDQSGHGDYIKIQDAIDSVPSK--NSELVYISVKPGTYREKVVVPVDKPFITLS  419
             TA+LI VDQSG GD+ KIQ+AI+S+P    NS+L YI VKPG YREKVV+P DKP+ITLS
Sbjct  52    TAILIRVDQSGKGDFNKIQEAIESIPPNLNNSQLYYIWVKPGIYREKVVIPADKPYITLS  111

Query  420   GDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWY  599
             G  ASNT + W+DG DI+ SPTLT+FASDFV R+LTI N FG +G+ VALR + D++A+Y
Sbjct  112   GTRASNTFLIWNDGEDILESPTLTIFASDFVCRFLTIQNKFGTAGRAVALRAAADKAAFY  171

Query  600   GCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRR  779
             GC I SYQDTLLD+ G HY+ NCYIEG  DFI G+A+SL+E C +HS++   G+ITAQ R
Sbjct  172   GCVITSYQDTLLDDNGNHYFKNCYIEGATDFICGSASSLYEKCHLHSLSPNNGSITAQMR  231

Query  780   ESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQR  959
              SA E +GFTFLGCKITG+G+T LGRPWG YSRVV+  SY S+ + P+GWN W D  +Q 
Sbjct  232   TSATEKSGFTFLGCKITGSGSTFLGRPWGAYSRVVFAYSYFSNVVAPQGWNQWGDSTKQN  291

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             TVYYGEYKCYGPGADR++RV+WS+ LS  EA  F++K  I G++WLR AP++FK
Sbjct  292   TVYYGEYKCYGPGADRTQRVKWSKQLSDDEATVFLSKDFIGGKDWLRPAPSHFK  345



>ref|XP_008351045.1| PREDICTED: putative pectinesterase 11 [Malus domestica]
Length=345

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/298 (60%), Positives = 223/298 (75%), Gaps = 1/298 (0%)
 Frame = +3

Query  249   AVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD  428
             A+LI VDQSG G Y KIQDAID+VPS N+E VYI+VKPGTY EK+ VP DKPFIT++G  
Sbjct  38    AILITVDQSGKGXYWKIQDAIDAVPSNNAENVYIAVKPGTYTEKIWVPADKPFITIAGAG  97

Query  429   ASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCR  608
                T+ITWS GG+I  +PT TV ASDF GR LTI NT+G+  + VALR SGDR+A+Y C 
Sbjct  98    XXETIITWSQGGEIYDTPTFTVLASDFTGRTLTIQNTYGKGARAVALRASGDRAAFYDCS  157

Query  609   IKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESA  788
             IKSYQDTLL E GK YY NCYIEG VDFIFG++A+LF+ C +HS A   G ITA RR++A
Sbjct  158   IKSYQDTLLSENGKQYYXNCYIEGAVDFIFGSSAALFQNCHLHSTADEVGFITAHRRDNA  217

Query  789   EENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD-DPKRQRTV  965
              EN GF+F+GCKI+G   T LGRPW PYSRV++  ++MS+ + P+GW+DW   P    TV
Sbjct  218   SENLGFSFVGCKISGLSKTTLGRPWSPYSRVIFALTHMSNVVAPQGWDDWGRSPDELSTV  277

Query  966   YYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSSCK  1139
             Y+G+Y+C+G GAD S+RV+W+R L+  EA P MT   I G  WLRQAPT FK +S+ +
Sbjct  278   YFGQYRCWGAGADTSQRVKWARELTFQEAAPLMTSGFIGGTYWLRQAPTRFKSISALR  335



>ref|XP_010672815.1| PREDICTED: putative pectinesterase 11 [Beta vulgaris subsp. vulgaris]
Length=316

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/283 (62%), Positives = 221/283 (78%), Gaps = 1/283 (0%)
 Frame = +3

Query  255   LIIVDQSGH-GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDA  431
             ++ VDQSG  G ++KIQDAID+VPS N   ++I V+PG Y+EK++VP DKPFITLSG +A
Sbjct  33    VLTVDQSGKTGQFVKIQDAIDAVPSNNVHPIFIRVEPGIYKEKIIVPQDKPFITLSGRNA  92

Query  432   SNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCRI  611
               TVITW+DGGDI  SPT++VF+SDFVGRYLTI NT+G  GK VALRV  DR+ +Y CRI
Sbjct  93    YTTVITWNDGGDIFKSPTVSVFSSDFVGRYLTIQNTYGTRGKAVALRVRSDRAVFYACRI  152

Query  612   KSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESAE  791
              SYQDTLLDE+G+H+Y NCYIEG  DFI GNAASLF+ C +HS +   GAITAQRR S E
Sbjct  153   ISYQDTLLDESGRHFYYNCYIEGATDFICGNAASLFKQCHLHSTSEYNGAITAQRRVSEE  212

Query  792   ENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRTVYY  971
             ++TGF F+GCK+TG  +  LGRPWGPYSRVV+  +YMSSA+ P+GW+DW      RT YY
Sbjct  213   DDTGFYFVGCKVTGIKSCTLGRPWGPYSRVVFTRTYMSSAVLPQGWDDWGKTSTHRTAYY  272

Query  972   GEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GEY+CYGPGA R++RV+WS SLS  +A P+MT  ++  + WL+
Sbjct  273   GEYECYGPGAKRTRRVQWSVSLSNQQALPYMTMNLMSERTWLK  315



>ref|XP_010674600.1| PREDICTED: putative pectinesterase 11 [Beta vulgaris subsp. vulgaris]
Length=321

 Score =   384 bits (987),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/281 (65%), Positives = 213/281 (76%), Gaps = 0/281 (0%)
 Frame = +3

Query  258   IIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASN  437
             IIVDQ G GDY  IQDAIDSVPSKN +   I VKPG Y+EKV +P DKPFI LSG +A  
Sbjct  40    IIVDQLGKGDYRTIQDAIDSVPSKNVDSTLILVKPGIYKEKVTIPEDKPFIMLSGRNALE  99

Query  438   TVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCRIKS  617
             T ITW D GDI+ SPTL+VFASDFV RYLTI NTFG   K VALRVS  R+ +Y CRI S
Sbjct  100   TTITWDDSGDILTSPTLSVFASDFVARYLTIQNTFGPGEKAVALRVSSVRAEFYACRIIS  159

Query  618   YQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESAEEN  797
             YQDTLLDE G H+YSNCYIEGG DFI GNAAS+F+ C IHSI+   GAITAQRR  +EE+
Sbjct  160   YQDTLLDEQGSHFYSNCYIEGGTDFICGNAASIFQKCRIHSISNQNGAITAQRRMKSEED  219

Query  798   TGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRTVYYGE  977
             TGF F+ CKITG  +  LGRPWGPYSRVV+++SY+S+ I P GW+DW       +VYYGE
Sbjct  220   TGFYFVDCKITGIKSFTLGRPWGPYSRVVYINSYLSNTINPHGWDDWGKSSTHSSVYYGE  279

Query  978   YKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             YKCYGPGA+RSKRVEWS++L+  EA   +TK MI  +  ++
Sbjct  280   YKCYGPGANRSKRVEWSQTLNSEEATTIITKTMISSKTGIK  320



>ref|XP_010672810.1| PREDICTED: putative pectinesterase 11 [Beta vulgaris subsp. vulgaris]
Length=321

 Score =   383 bits (984),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/278 (63%), Positives = 212/278 (76%), Gaps = 0/278 (0%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             LIIVDQSG G+Y+KIQDAID+VPS N +   I VKPG Y+EK++VP DKPFI LSG +A 
Sbjct  39    LIIVDQSGKGNYMKIQDAIDAVPSNNVDSTLILVKPGIYKEKLIVPEDKPFIMLSGRNAL  98

Query  435   NTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCRIK  614
             NT ITW D GDI  SPTL+VFASDFV RYLTI NT+G   K VALRV+ +R+ ++ CRI 
Sbjct  99    NTTITWDDSGDIFTSPTLSVFASDFVARYLTIQNTYGPGAKAVALRVTSERADFFACRII  158

Query  615   SYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESAEE  794
             SYQDTLLDE G H+YSNCYIEGG DFI GN ASLF+ C IHS++   GAITAQRR   EE
Sbjct  159   SYQDTLLDERGSHFYSNCYIEGGTDFICGNGASLFQKCRIHSVSDQNGAITAQRRMKLEE  218

Query  795   NTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRTVYYG  974
             +TGF F+ CK+TG  +  LGRPWGP+SRVV++ SY+S+ + P GW+DW  P    +VYYG
Sbjct  219   DTGFYFVDCKVTGIKSCTLGRPWGPHSRVVFIRSYLSNVVNPHGWDDWGKPSTHSSVYYG  278

Query  975   EYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQ  1088
             EYKCYGPGA+RS RV+WS+SLS  EA   +TK  I  +
Sbjct  279   EYKCYGPGANRSNRVQWSQSLSNEEATTLITKTTISSK  316



>ref|XP_009356538.1| PREDICTED: uncharacterized protein LOC103947357 [Pyrus x bretschneideri]
Length=672

 Score =   395 bits (1014),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 181/298 (61%), Positives = 226/298 (76%), Gaps = 1/298 (0%)
 Frame = +3

Query  249   AVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD  428
             A+LI VDQSG GDY KIQDAID+VPS N E VYI+VKPGTY EK+ VP DKPFIT++G  
Sbjct  38    AILITVDQSGKGDYWKIQDAIDAVPSNNVENVYIAVKPGTYTEKIWVPADKPFITIAGAG  97

Query  429   ASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCR  608
                T+ITWS GG+I  +PT TV ASDF GR LTI NT+G+  + VALR SGDR+A+Y C 
Sbjct  98    PGETIITWSQGGEIYDTPTFTVLASDFTGRTLTIQNTYGKGARAVALRASGDRAAFYDCS  157

Query  609   IKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESA  788
             IKSYQDTLL E GK YYSNCYIEG VDFIFG++A+LF+ C +HS A   G ITA RR++A
Sbjct  158   IKSYQDTLLSENGKQYYSNCYIEGAVDFIFGSSAALFQNCHLHSTADEVGFITAHRRDNA  217

Query  789   EENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDW-DDPKRQRTV  965
              EN GF+F+GCKI+G   T LGRPW PYSRV++  ++MS+ + P+GW+DW   P+   TV
Sbjct  218   SENLGFSFVGCKISGLSKTTLGRPWSPYSRVIFSLTHMSNVVAPQGWDDWGRSPEELSTV  277

Query  966   YYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSSCK  1139
             Y+G+Y+C+GPGAD S+RV+W+R L+  EA P MT   I G+ WLRQAPT F  +S+ +
Sbjct  278   YFGQYRCWGPGADTSQRVKWARELTFQEAAPLMTSGFIGGRYWLRQAPTRFNSISALR  335



>ref|XP_008797558.1| PREDICTED: laccase-11-like [Phoenix dactylifera]
Length=859

 Score =   399 bits (1026),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/299 (62%), Positives = 239/299 (80%), Gaps = 2/299 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             S+A++I VDQSG GD+ KIQDAID+VPS N++ ++I +KPG YREK+VVP DKPFITLSG
Sbjct  31    SSAIVIRVDQSGKGDFTKIQDAIDAVPSSNTDPIFIRIKPGIYREKIVVPADKPFITLSG  90

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               A +T+ITW++G + + SPT++V ASDFVGRYLTI NTFG SG+ +ALRV+GDR A+YG
Sbjct  91    TKAKSTIITWNEGWNTVESPTVSVLASDFVGRYLTIQNTFGSSGQAIALRVAGDRVAFYG  150

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             C+  S+QDTLLD+ G+HYY NCYIEG  DFI GN  +LFE C +HS++  GGAITAQ+R+
Sbjct  151   CKFFSFQDTLLDDTGRHYYRNCYIEGATDFICGNGQALFEKCHLHSVSKNGGAITAQKRD  210

Query  783   SAEENTGFTFLGCK--ITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             SA ENTG++F+GCK    G GTTVLGRPWG YSRVV+  +YM+ ++  +GWNDW DP +Q
Sbjct  211   SASENTGYSFVGCKVTGVGVGTTVLGRPWGAYSRVVFALTYMTDSVAAQGWNDWGDPNKQ  270

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSS  1133
             RT +YG+Y+CYGPG+D S+RV WSR LS  EA  F+TK  I G++WLR  PT+F++ S+
Sbjct  271   RTAFYGQYRCYGPGSDLSRRVGWSRQLSVREASHFITKSWINGRDWLRSPPTHFRKFSA  329



>ref|XP_008444730.1| PREDICTED: putative pectinesterase 11 [Cucumis melo]
Length=328

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/303 (58%), Positives = 221/303 (73%), Gaps = 1/303 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             +TAVLI VDQSG G++ KIQ AID+VP  N E V+I VK G YREKVVVP +KPFIT+SG
Sbjct  26    TTAVLITVDQSGKGNFTKIQQAIDAVPENNREEVFIVVKAGIYREKVVVPANKPFITISG  85

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               A++T+I+W+D  +  +S TL V ASDFVGRYLTI N +G   + VALRVSGDR ++  
Sbjct  86    RRAADTIISWNDSKNTYNSATLAVLASDFVGRYLTIQNEYGAGAQAVALRVSGDRVSFTA  145

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CR   +QDTLLD+ G+HYY +CYI+G  DFI GNAASLFE C + S++   G ITAQRRE
Sbjct  146   CRFLGHQDTLLDDIGRHYYKSCYIQGATDFICGNAASLFENCHLRSVSDDVGTITAQRRE  205

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRT  962
             S  ENTGF FLGCKITG  + VLGRPWG +SRVV+  ++MS  I PEGW++W DP +Q T
Sbjct  206   SPSENTGFVFLGCKITGINSAVLGRPWGAFSRVVFGFTFMSDVILPEGWDNWQDPSKQST  265

Query  963   VYYGEYKCYGPGADRSKRVEWS-RSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSSCK  1139
             VYYG+YKCYG GA+ S+RV WS  +++  +A PF TK  I   +WLR  P +FKR  S +
Sbjct  266   VYYGQYKCYGKGANPSRRVSWSFTNMTAQDAAPFFTKSFIGAADWLRPLPKHFKRAFSSR  325

Query  1140  DMP  1148
               P
Sbjct  326   SHP  328



>ref|XP_010419255.1| PREDICTED: putative pectinesterase 11 [Camelina sativa]
Length=337

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 222/294 (76%), Gaps = 14/294 (5%)
 Frame = +3

Query  246   TAVLIIVDQSGHGDYIKIQDAIDSVPSK--NSELVYISVKPGTYREKVVVPVDKPFITLS  419
             TA+LI VDQSG GD+ KIQ+AI+S+P    NS+L YI VKPG YREKVV+P DKP+ITLS
Sbjct  52    TAILIRVDQSGKGDFNKIQEAIESIPPNLNNSQLYYIWVKPGIYREKVVIPADKPYITLS  111

Query  420   GDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWY  599
             G  ASNT + WSDG DI+ SPTLT+F            N FG +G+ VALRV+ D++A+Y
Sbjct  112   GTRASNTFLIWSDGEDILESPTLTIF------------NKFGTAGRAVALRVAADKAAFY  159

Query  600   GCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRR  779
             GC I SYQDTLLD+ G HY+ NCYIEG  DFI G+A+SL+E C +HS++   G+ITAQ R
Sbjct  160   GCVITSYQDTLLDDNGNHYFKNCYIEGATDFICGSASSLYEKCHLHSLSPNNGSITAQMR  219

Query  780   ESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQR  959
              SA E +GFTFLGCKITG+G+T LGRPWG YSRVV+  S+ S+ + P+GWN W D  +Q 
Sbjct  220   TSATEKSGFTFLGCKITGSGSTFLGRPWGAYSRVVFAYSFFSNVVAPQGWNQWGDSTKQN  279

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             TVYYGEYKCYGPGADR +RV+WS+ LS  EA  F++K  I G++WLR AP++FK
Sbjct  280   TVYYGEYKCYGPGADRGQRVKWSKQLSDDEATVFLSKDFIGGKDWLRPAPSHFK  333



>ref|XP_004152775.1| PREDICTED: putative pectinesterase 11-like [Cucumis sativus]
 ref|XP_004164917.1| PREDICTED: putative pectinesterase 11-like [Cucumis sativus]
 gb|KGN62612.1| hypothetical protein Csa_2G361760 [Cucumis sativus]
Length=327

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/293 (59%), Positives = 213/293 (73%), Gaps = 1/293 (0%)
 Frame = +3

Query  258   IIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASN  437
             I VDQSG G++ KIQ AID+VP  N E V+ISVK G YREKVVVP +KPFIT+SG  A +
Sbjct  32    ITVDQSGKGNFTKIQQAIDAVPINNKEEVFISVKAGIYREKVVVPANKPFITISGRRAVD  91

Query  438   TVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCRIKS  617
             T+I+W+D  +  +S TL V ASDFVGRYLTI N +G   + VALRVSGDR ++  CR   
Sbjct  92    TIISWNDSKNTYNSATLAVLASDFVGRYLTIQNGYGPGAQAVALRVSGDRVSFTACRFLG  151

Query  618   YQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESAEEN  797
             +QDTLLD+ G+HYY +CYI+G  DFI GNAASLFE C + S++   G ITAQRRES  EN
Sbjct  152   HQDTLLDDIGRHYYKSCYIQGATDFICGNAASLFENCHLRSVSEDVGTITAQRRESPSEN  211

Query  798   TGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRTVYYGE  977
             TGF F+GCKITG  + VLGRPWG +SRVV+  ++MS  I PEGW++W DP +Q TVYYG+
Sbjct  212   TGFVFMGCKITGINSAVLGRPWGAFSRVVFGFTFMSDVILPEGWDNWQDPSKQSTVYYGQ  271

Query  978   YKCYGPGADRSKRVEWS-RSLSKAEAKPFMTKKMIEGQEWLRQAPTNFKRMSS  1133
             YKCYG GA+ S+RV WS  +++  +A PF TK  I   +WLR  P  FKR  S
Sbjct  272   YKCYGKGANTSRRVSWSFTNMTAQDAAPFFTKSFIGAADWLRPVPNRFKRAFS  324



>emb|CDY15882.1| BnaA04g12290D [Brassica napus]
Length=337

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 159/250 (64%), Positives = 200/250 (80%), Gaps = 0/250 (0%)
 Frame = +3

Query  372   REKVVVPVDKPFITLSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRS  551
             +EKVV+PVDKP+ITLSG  AS+T++ WSDG D++ SPTLTVFASDFV R+LTI N FG+ 
Sbjct  80    KEKVVIPVDKPYITLSGTKASSTILVWSDGKDLLDSPTLTVFASDFVCRFLTIQNKFGKG  139

Query  552   GKGVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCE  731
             G+ VA+RV+GD +A+YGC I SYQDTLLD+ G HY+ NCYIEG  DFI GNA+SL+E C 
Sbjct  140   GQAVAVRVAGDNAAFYGCVITSYQDTLLDDDGNHYFKNCYIEGATDFICGNASSLYERCH  199

Query  732   IHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSA  911
             +HS++   G+ITAQ+R SA E +GF FLGCK+TG+G T LGRPWG YSRVV+  S+ S  
Sbjct  200   LHSLSPKNGSITAQKRTSATEKSGFIFLGCKLTGSGLTFLGRPWGAYSRVVFAYSFFSDV  259

Query  912   IQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQE  1091
             + P+GWN+W DP R+ TVYYGEYKCYGPGADR +RV+WS+ LS  EA  F++K  I G+E
Sbjct  260   VAPQGWNEWRDPSRKDTVYYGEYKCYGPGADRKQRVQWSKQLSDEEATVFLSKDFIGGKE  319

Query  1092  WLRQAPTNFK  1121
             WLR AP++FK
Sbjct  320   WLRPAPSHFK  329



>ref|XP_004972026.1| PREDICTED: putative pectinesterase 11-like [Setaria italica]
Length=291

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/290 (58%), Positives = 215/290 (74%), Gaps = 6/290 (2%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSEL--VYISVKPGTYREKVVVPVDKPFITL  416
             S  +++ VDQSG GD+ +IQDAID+ P+ +     V I +KPG YREKVVV  DKP ITL
Sbjct  4     SRQLVLTVDQSGRGDHRRIQDAIDAAPANDDSAGSVVIRIKPGVYREKVVV--DKPCITL  61

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAW  596
              G  AS+TVITW++      SPT++V ASDF+ + LT  NTFG SG  VA+RV+GDR+A+
Sbjct  62    VGTSASSTVITWNESWVAAESPTVSVLASDFIAKRLTFQNTFGTSGPAVAMRVAGDRAAF  121

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
             YGCR  S+QDTLLD+ G+HYY  CYIEGG DF+FGN  +LF+ C + S ++ GGA TA +
Sbjct  122   YGCRFVSFQDTLLDDTGRHYYRGCYIEGGTDFVFGNGKALFDKCHLRSTSLVGGAFTAHK  181

Query  777   RESAEENTGFTFLGCKIT--GTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPK  950
             R S  E+TGF+F+GCK+T  G GT++LGRPWGPYSRVV   SYMSS ++PEGW+DW DP 
Sbjct  182   RSSELEDTGFSFVGCKLTGLGVGTSILGRPWGPYSRVVVALSYMSSTVRPEGWDDWSDPA  241

Query  951   RQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             +QRT +YG+Y+CYG G+    RV WS  LS+AEA PF+TK  + GQEWLR
Sbjct  242   KQRTAFYGQYQCYGEGSKTDGRVAWSHDLSQAEAAPFITKVWVGGQEWLR  291



>ref|NP_001043660.2| Os01g0634600 [Oryza sativa Japonica Group]
 dbj|BAF05574.2| Os01g0634600 [Oryza sativa Japonica Group]
Length=325

 Score =   350 bits (898),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 160/288 (56%), Positives = 214/288 (74%), Gaps = 6/288 (2%)
 Frame = +3

Query  249   AVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD  428
             +V++ VDQSG GD+ +IQDAID+ P+ +S    I +KPG YR KVVV  DKP++TL+G  
Sbjct  40    SVVVTVDQSGKGDHRRIQDAIDAAPANDSSRTVIRIKPGVYRRKVVV--DKPYVTLTGTS  97

Query  429   ASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCR  608
             A++TVI W++      SPT++V ASDFV + LT  NTFG S   VA+RV+GDR+A+YGCR
Sbjct  98    ATSTVIAWNESWVSDESPTVSVLASDFVAKRLTFQNTFGDSAPAVAVRVAGDRAAFYGCR  157

Query  609   IKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV--GGGAITAQRRE  782
               S+QDTLLDE G+HYY  CY++G  DFIFGN  +LF+ C +HS +    GGA TAQ+R 
Sbjct  158   FVSFQDTLLDETGRHYYRGCYVQGATDFIFGNGRALFDKCHLHSTSPDGAGGAFTAQQRS  217

Query  783   SAEENTGFTFLGCKIT--GTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             S  E TG++F+GCK+T  G GT++LGRPWGPYSRVV+  +YMSS ++P+GW+DW DP  Q
Sbjct  218   SESEETGYSFVGCKLTGLGAGTSILGRPWGPYSRVVFALTYMSSTVRPQGWDDWGDPSNQ  277

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             RT +YG+Y+CYG G+    RV WS  L++AEA PF+TK  ++GQ+WLR
Sbjct  278   RTAFYGQYQCYGDGSKTDGRVAWSHDLTQAEAAPFITKAWVDGQQWLR  325



>gb|EMS68195.1| Putative pectinesterase 11 [Triticum urartu]
Length=298

 Score =   346 bits (887),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/288 (57%), Positives = 208/288 (72%), Gaps = 3/288 (1%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L+ VDQSG GDY KI +AI + P  +S    I +KPG Y+EK+VVPVDKP ITL G  A+
Sbjct  9     LLTVDQSGKGDYRKIHEAIAAAPVNSSARTVILIKPGVYKEKIVVPVDKPNITLFGTSAN  68

Query  435   NTVITWSDGG-DIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCRI  611
              TVITW++       SPT+TV ASDFV   LT  NTFG S + +A+RV+GDR+A+YGC  
Sbjct  69    TTVITWNEPWLSTDTSPTVTVRASDFVASRLTFRNTFGTSKQAIAVRVAGDRAAFYGCSF  128

Query  612   KSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESAE  791
              S+QDTLLD+ G+HYY  CYIEGG DFI GN  +LFE C +HS ++ GGA TAQ+R S  
Sbjct  129   SSFQDTLLDDNGRHYYCGCYIEGGTDFICGNGRALFEKCHLHSTSLTGGAFTAQKRASES  188

Query  792   ENTGFTFLGCKITGTG--TTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRTV  965
               TG++F+GCK+TG G  T++LGRPW PYSRVV+  +YMS+A+ P GWNDW+    QRT 
Sbjct  189   NYTGYSFVGCKLTGVGVSTSILGRPWEPYSRVVFALTYMSAAVSPRGWNDWNHTANQRTA  248

Query  966   YYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAP  1109
             +YG+Y+CYG GA    RV+W+R+LS  EA PFMTK  I+GQ+WL + P
Sbjct  249   FYGQYQCYGQGAKTDGRVKWARNLSPTEAAPFMTKAWIDGQQWLPKQP  296



>dbj|BAB90734.1| pectinesterase-like [Oryza sativa Japonica Group]
Length=293

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 215/293 (73%), Gaps = 11/293 (4%)
 Frame = +3

Query  249   AVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYR-----EKVVVPVDKPFIT  413
             +V++ VDQSG GD+ +IQDAID+ P+ +S    I +KPG YR     EKVVV  DKP++T
Sbjct  3     SVVVTVDQSGKGDHRRIQDAIDAAPANDSSRTVIRIKPGVYRRVGNQEKVVV--DKPYVT  60

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             L+G  A++TVI W++      SPT++V ASDFV + LT  NTFG S   VA+RV+GDR+A
Sbjct  61    LTGTSATSTVIAWNESWVSDESPTVSVLASDFVAKRLTFQNTFGDSAPAVAVRVAGDRAA  120

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV--GGGAIT  767
             +YGCR  S+QDTLLDE G+HYY  CY++G  DFIFGN  +LF+ C +HS +    GGA T
Sbjct  121   FYGCRFVSFQDTLLDETGRHYYRGCYVQGATDFIFGNGRALFDKCHLHSTSPDGAGGAFT  180

Query  768   AQRRESAEENTGFTFLGCKIT--GTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD  941
             AQ+R S  E TG++F+GCK+T  G GT++LGRPWGPYSRVV+  +YMSS ++P+GW+DW 
Sbjct  181   AQQRSSESEETGYSFVGCKLTGLGAGTSILGRPWGPYSRVVFALTYMSSTVRPQGWDDWG  240

Query  942   DPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             DP  QRT +YG+Y+CYG G+    RV WS  L++AEA PF+TK  ++GQ+WLR
Sbjct  241   DPSNQRTAFYGQYQCYGDGSKTDGRVAWSHDLTQAEAAPFITKAWVDGQQWLR  293



>ref|XP_003566924.2| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase 11 [Brachypodium 
distachyon]
Length=288

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/285 (56%), Positives = 210/285 (74%), Gaps = 4/285 (1%)
 Frame = +3

Query  252   VLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDA  431
             +L+ VDQSG GD+ +IQDA ++ P+ NS    I +KPG YR+KV+V  DKP+ITL+G  A
Sbjct  6     ILLAVDQSGKGDHRRIQDADNAAPANNSAGTVIRIKPGVYRQKVMV--DKPYITLAGTSA  63

Query  432   SNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCRI  611
             + TVIT +D      SPT++V ASDFV + LT  NT G S   VA+RV+GDR+A+YGC  
Sbjct  64    NTTVITRNDAWVSDDSPTVSVLASDFVAKRLTFQNTSGSSAAAVAMRVAGDRAAFYGCSF  123

Query  612   KSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESAE  791
              S+QDTLLD+ G+HYY  CY+EGG DF+FGN  +LF+ C +H  +  GGA TAQ+R S  
Sbjct  124   LSFQDTLLDDTGRHYYRGCYVEGGTDFVFGNGKALFDKCHLHLTSRIGGAFTAQQRASES  183

Query  792   ENTGFTFLGCKITGTG--TTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRTV  965
             E+TGF+F+GCK+TG G  T++LGRPWGPYSRVV+  SYMSS + P+GW+DW D  RQRT 
Sbjct  184   EDTGFSFVGCKLTGVGVRTSILGRPWGPYSRVVFGLSYMSSTVSPQGWDDWGDHHRQRTA  243

Query  966   YYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             +YG+Y+CYG G+    RV WSR LS+AEA PF+TK  + GQ+WLR
Sbjct  244   FYGQYQCYGQGSKTDDRVXWSRELSQAEAAPFITKAWVGGQQWLR  288



>gb|KDO43670.1| hypothetical protein CISIN_1g039481mg, partial [Citrus sinensis]
Length=229

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = +3

Query  267  DQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVI  446
            DQSG GD+ KIQDAIDSVPS NSE V+I VKPGTYREK+ VP DKPFIT+SG  AS+T+I
Sbjct  1    DQSGKGDFKKIQDAIDSVPSNNSETVFIRVKPGTYREKIAVPADKPFITISGTKASSTII  60

Query  447  TWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCRIKSYQD  626
            TWSDGG+I  S T TV A DFVGR+LTI NT+G +GK VALRVS DR+A+YGCRI SYQD
Sbjct  61   TWSDGGEIFESATFTVLADDFVGRFLTIENTYGSAGKAVALRVSADRAAFYGCRILSYQD  120

Query  627  TLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESAEENTGF  806
            TLLD+ G HYY NCYIEG  DFI G+AASLFE C IHS++ G GAITAQ+R   EENTG 
Sbjct  121  TLLDDTGNHYYCNCYIEGATDFICGDAASLFESCHIHSLSTGNGAITAQKRVLPEENTGI  180

Query  807  TFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDD  944
             FLGCKITG G  VLGRPWG YSRVV+  +YMS  IQP GW+DW D
Sbjct  181  NFLGCKITGVGKAVLGRPWGTYSRVVYALTYMSGVIQPPGWDDWHD  226



>gb|EEC71149.1| hypothetical protein OsI_02978 [Oryza sativa Indica Group]
 gb|EEE55044.1| hypothetical protein OsJ_02732 [Oryza sativa Japonica Group]
Length=330

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 215/293 (73%), Gaps = 11/293 (4%)
 Frame = +3

Query  249   AVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYR-----EKVVVPVDKPFIT  413
             +V++ VDQSG GD+ +IQDAID+ P+ +S    I +KPG YR     EKVVV  DKP++T
Sbjct  40    SVVVTVDQSGKGDHRRIQDAIDAAPANDSSRTVIRIKPGVYRRVGNQEKVVV--DKPYVT  97

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             L+G  A++TVI W++      SPT++V ASDFV + LT  NTFG S   VA+RV+GDR+A
Sbjct  98    LTGTSATSTVIAWNESWVSDESPTVSVLASDFVAKRLTFQNTFGDSAPAVAVRVAGDRAA  157

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV--GGGAIT  767
             +YGCR  S+QDTLLDE G+HYY  CY++G  DFIFGN  +LF+ C +HS +    GGA T
Sbjct  158   FYGCRFVSFQDTLLDETGRHYYRGCYVQGATDFIFGNGRALFDKCHLHSTSPDGAGGAFT  217

Query  768   AQRRESAEENTGFTFLGCKIT--GTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD  941
             AQ+R S  E TG++F+GCK+T  G GT++LGRPWGPYSRVV+  +YMSS ++P+GW+DW 
Sbjct  218   AQQRSSESEETGYSFVGCKLTGLGAGTSILGRPWGPYSRVVFALTYMSSTVRPQGWDDWG  277

Query  942   DPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             DP  QRT +YG+Y+CYG G+    RV WS  L++AEA PF+TK  ++GQ+WLR
Sbjct  278   DPSNQRTAFYGQYQCYGDGSKTDGRVAWSHDLTQAEAAPFITKAWVDGQQWLR  330



>gb|KCW67860.1| hypothetical protein EUGRSUZ_F01581 [Eucalyptus grandis]
Length=286

 Score =   344 bits (883),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/291 (59%), Positives = 200/291 (69%), Gaps = 39/291 (13%)
 Frame = +3

Query  249   AVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD  428
             A LI+VD SG G++ KIQDAID+VPS NSELV+I V+PGTYREK+VVP DKPFITLSG  
Sbjct  35    ARLILVDPSGKGNFRKIQDAIDAVPSNNSELVFIRVEPGTYREKLVVPADKPFITLSGKK  94

Query  429   ASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCR  608
             AS+T++T  D GDI  SPT++V ASDFVGRYLTI NT+G   K V LRVSGDR A+  CR
Sbjct  95    ASSTIVTGDDSGDIFGSPTISVLASDFVGRYLTIQNTYGSGAKAVVLRVSGDRVAFSACR  154

Query  609   IKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESA  788
             I S+QDTLLD+ G+HYYSNCYIEG VDFIFGNAASLF                 Q R S 
Sbjct  155   ITSHQDTLLDDVGRHYYSNCYIEGDVDFIFGNAASLF-----------------QHRASP  197

Query  789   EENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRTVY  968
              ENTGF FLGC            PWGPYSRVV+  SYMSSA+ P+GW+D  D  +QRT Y
Sbjct  198   LENTGFIFLGC------------PWGPYSRVVFALSYMSSAVLPQGWDDRGDSTKQRTAY  245

Query  969   YGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNFK  1121
             YG+Y+CYGPGAD SKR          E  P +T  M++ Q W + APT F 
Sbjct  246   YGQYECYGPGADTSKR----------EVSPLLTMDMVDQQSWFKNAPTIFN  286



>ref|XP_006423293.1| hypothetical protein CICLE_v10030318mg [Citrus clementina]
 gb|ESR36533.1| hypothetical protein CICLE_v10030318mg [Citrus clementina]
Length=284

 Score =   343 bits (879),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 190/246 (77%), Gaps = 0/246 (0%)
 Frame = +3

Query  234  KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
            K  STAVLI V++ G GD+  IQ+AIDSVP  NSELV+ISV PG YREK++VP +KPFIT
Sbjct  34   KDFSTAVLIRVEKYGRGDFRTIQEAIDSVPDNNSELVFISVAPGIYREKIIVPANKPFIT  93

Query  414  LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
            +SG  AS T ITWSDGG I+ S TLTV AS FV R LTI NT+G  GK VALRVS DR+A
Sbjct  94   ISGTKASRTKITWSDGGSILDSATLTVLASHFVARSLTIQNTYGSYGKAVALRVSADRAA  153

Query  594  WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
            +YGCRI SYQ TLLD+ G HYYS CYIEG  DFI GNA SLFE C IHS++  GGAITAQ
Sbjct  154  FYGCRILSYQHTLLDDTGNHYYSKCYIEGATDFISGNANSLFERCLIHSLSTWGGAITAQ  213

Query  774  RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
            +R S+EENTGFTFL CKI+G G  VLGRPWGPYSRVV+  +YMS  I P+GWND +D  +
Sbjct  214  KRVSSEENTGFTFLDCKISGVGKAVLGRPWGPYSRVVYALTYMSDVILPQGWNDLNDHAK  273

Query  954  QRTVYY  971
            Q+ + Y
Sbjct  274  QKYIIY  279



>ref|XP_002458207.1| hypothetical protein SORBIDRAFT_03g028930 [Sorghum bicolor]
 gb|EES03327.1| hypothetical protein SORBIDRAFT_03g028930 [Sorghum bicolor]
Length=301

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/294 (54%), Positives = 214/294 (73%), Gaps = 8/294 (3%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSEL----VYISVKPGTYREKVVVPVDKPFI  410
             S  ++++VDQSG GD+ +IQDAID+ P+  S      V I +KPG YR+   V VDKP I
Sbjct  8     SRQLVLLVDQSGKGDHRRIQDAIDAAPAGGSGSGGGGVVIRIKPGVYRQVEKVVVDKPCI  67

Query  411   TLSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRS  590
             TL G  AS+T+ITW++      SPT++V ASDF+ + L   NTFG SG  VA+RV+GDR+
Sbjct  68    TLVGTSASSTIITWNESWVASESPTVSVLASDFIAKRLAFQNTFGSSGPAVAMRVAGDRA  127

Query  591   AWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITA  770
             A+YGCR  S+QDTLLD+ G+HYY  CY++G  DFIFGN  +LF+ C +HS++  GGA TA
Sbjct  128   AFYGCRFVSFQDTLLDDTGRHYYRGCYVQGATDFIFGNGKALFDKCHLHSVSAAGGAFTA  187

Query  771   QRRESAEENTGFTFLGCKIT--GTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD-  941
              +R S  E+TGF+F+GCK+T  G GT++LGRPWGPYSRVV+  SYMSS ++P+GW+DW  
Sbjct  188   HKRWSESEDTGFSFVGCKLTGLGAGTSILGRPWGPYSRVVFALSYMSSTVRPQGWDDWTD  247

Query  942   -DPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
              D +RQRT +YG+Y+CYG G+    RV WS  +S+A+A PF+TK  + GQEWLR
Sbjct  248   GDKQRQRTAFYGQYQCYGEGSKTDGRVAWSHDMSQAQAAPFITKGWVGGQEWLR  301



>gb|KDP41783.1| hypothetical protein JCGZ_26801 [Jatropha curcas]
Length=840

 Score =   359 bits (922),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 211/294 (72%), Gaps = 26/294 (9%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             STA+LI VDQSG GD+ KIQDAIDSVP  NS LV+I VKPG YRE+VVVP DKPFITLSG
Sbjct  34    STAILIRVDQSGKGDFKKIQDAIDSVPPNNSNLVFIWVKPGIYREQVVVPADKPFITLSG  93

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
             +DA+ T+ITWSDGGDII SPTL+V ASDFVGR LT+ NT+G   + VA+RV+GDR+A+YG
Sbjct  94    NDANTTIITWSDGGDIIKSPTLSVLASDFVGRLLTVQNTYGNGDRAVAVRVTGDRAAFYG  153

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI SYQDTLLDE+G HYYS+CYIEG  DFI                        +Q R 
Sbjct  154   CRILSYQDTLLDESGSHYYSSCYIEGATDFI------------------------SQHRN  189

Query  783   SAEENTGFTFLGCKITG--TGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             S  ENTGF FLGCKITG  T ++ LGRPWG YSRVV+  +Y+S AI P GW+ W    +Q
Sbjct  190   SPSENTGFIFLGCKITGVATASSYLGRPWGDYSRVVFALNYISGAIVPTGWDSWAGLTKQ  249

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAPTNF  1118
              TV+YGEYK YGPGA  S+RVEWS SLS  EA  F+TK +I G  WL    T+F
Sbjct  250   STVFYGEYKNYGPGAKTSERVEWSHSLSSEEAAQFLTKDIIGGPTWLSFLLTSF  303



>ref|XP_002305435.2| hypothetical protein POPTR_0004s16360g, partial [Populus trichocarpa]
 gb|EEE85946.2| hypothetical protein POPTR_0004s16360g, partial [Populus trichocarpa]
Length=299

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 213/308 (69%), Gaps = 19/308 (6%)
 Frame = +3

Query  33   TLQRTNCLMKPLFSAFRLGENRSAAHMDVSSLGIHVRRlvsllltctvtiilaaaaasta  212
            T  +TN    P  S+F    ++S AHM  +++ ++   +  +L    +  +++AA   + 
Sbjct  11   TTSKTN---NPCMSSFTKKSDQSHAHMGSATMKVYAAYIAVILAHFALLSLMSAATTGSI  67

Query  213  aSDGVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVP  392
                      STA+LI V+QSG GD+ KIQDAIDSVPS NSELV+I VKPGTYREK+VVP
Sbjct  68   --------DMSTAILIRVEQSGKGDFKKIQDAIDSVPSNNSELVFIWVKPGTYREKIVVP  119

Query  393  VDKPFITLSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALR  572
             DKPFITLSG   S+T+ITW+DGG+I+ SPTLTV ASDFVGRYLTI NTFG +GK VALR
Sbjct  120  ADKPFITLSGTQPSDTIITWNDGGNIMESPTLTVLASDFVGRYLTIQNTFGSAGKAVALR  179

Query  573  VSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVG  752
            VSGDR+A+YGCRI SYQDTLLD+ G HYYSNCYIEG  DFI GNAASLFE        V 
Sbjct  180  VSGDRAAFYGCRILSYQDTLLDDTGSHYYSNCYIEGATDFICGNAASLFE--------VS  231

Query  753  GGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWN  932
                  +    A ENTG  FLGCKITG GTT LGRPWG YSRV++  +YMS  I P GW+
Sbjct  232  TTLFLLKLMNLASENTGLVFLGCKITGAGTTFLGRPWGAYSRVLYAFTYMSGVIAPAGWD  291

Query  933  DWDDPKRQ  956
            DW DP + 
Sbjct  292  DWADPSKH  299



>ref|XP_008656697.1| PREDICTED: putative pectinesterase 11 isoform X2 [Zea mays]
Length=330

 Score =   342 bits (877),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 165/294 (56%), Positives = 212/294 (72%), Gaps = 13/294 (4%)
 Frame = +3

Query  252   VLIIVDQSGHGDYIKIQDAIDSVPSKNSEL-----VYISVKPGTYREKVVVPVDKPFITL  416
             ++++VDQSG GD+ +IQDAID+ P+ N        V I +KPG YREKVVV  DKP ITL
Sbjct  39    LVLVVDQSGKGDHRRIQDAIDAAPASNRSAGGRGSVVIRIKPGVYREKVVV--DKPCITL  96

Query  417   SGDDA--SNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRS  590
              G  A  S  VITW++      SPT++V ASDFV + +   NTFG SG  VA+RV+GDR+
Sbjct  97    VGATAASSTVVITWNESWVAADSPTVSVLASDFVAKRIAFQNTFGTSGPAVAVRVAGDRA  156

Query  591   AWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITA  770
             A+YGCR  S+QDTLLD+ G+HYY  CY++GG DF+FGN  +LF+ C +HS++  GGA TA
Sbjct  157   AFYGCRFTSFQDTLLDDTGRHYYRGCYVQGGTDFVFGNGKALFDKCHLHSVSPAGGAFTA  216

Query  771   QRRESAEENTGFTFLGCKIT--GTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDD  944
              RR S  E+TGF+F+GCK+T  G GT+VLGRPWGPYSRVV+  SYMS  ++P+GW+DW D
Sbjct  217   HRRSSESEDTGFSFVGCKLTGLGAGTSVLGRPWGPYSRVVFALSYMSGTVRPQGWDDWSD  276

Query  945   PKRQ--RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
               RQ  RT +YG+Y+CYG G+    RV WS  LS+AEA PF+TK  + GQEWLR
Sbjct  277   SSRQRSRTAFYGQYQCYGEGSRTDGRVAWSHDLSQAEAAPFITKVWVGGQEWLR  330



>ref|XP_006646134.1| PREDICTED: putative pectinesterase 11-like [Oryza brachyantha]
Length=327

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/290 (55%), Positives = 213/290 (73%), Gaps = 8/290 (3%)
 Frame = +3

Query  249   AVLIIVDQSGHGDYIKIQDAIDSVPSKNSEL--VYISVKPGTYREKVVVPVDKPFITLSG  422
             + ++ VD+SG GD+  IQDAID+ P+  S      I +KPG YR KVVV  DKP++TL+G
Sbjct  40    SAVVTVDKSGKGDHRSIQDAIDAAPANGSAGGGTVIRIKPGVYRRKVVV--DKPYVTLTG  97

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
               AS+TVITW++      SPT++V ASDFV + LT  NTFG +   VA+RV+GDR+A+YG
Sbjct  98    TSASSTVITWNESWVSDESPTVSVLASDFVAKRLTFQNTFGDTAPAVAVRVAGDRAAFYG  157

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV--GGGAITAQR  776
             CR  S+QDTLLDE+G+HYY  CY++G  DFIFGN  +LF+ C +HS +    GGA TAQ+
Sbjct  158   CRFVSFQDTLLDESGRHYYRGCYVQGATDFIFGNGRALFDKCHLHSTSPPGAGGAFTAQQ  217

Query  777   RESAEENTGFTFLGCKIT--GTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPK  950
             R S  E TG++F+GCK+T  G GT++LGRPWGPYSRVV+  +YMSS ++P+GW+DW DP 
Sbjct  218   RSSESEETGYSFVGCKLTGVGVGTSILGRPWGPYSRVVFALTYMSSTVRPQGWDDWGDPA  277

Query  951   RQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             +QRT +YG+Y+CYG G+    RV WS  L++AEA PF+TK  ++GQ WLR
Sbjct  278   KQRTAFYGQYQCYGDGSKTDSRVAWSHDLTQAEAAPFITKAWVDGQRWLR  327



>ref|XP_009335295.1| PREDICTED: putative pectinesterase 11 [Pyrus x bretschneideri]
Length=389

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/301 (55%), Positives = 212/301 (70%), Gaps = 3/301 (1%)
 Frame = +3

Query  216   SDGVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPV  395
             S  V+ +  S +  I VD+SG+GDY KIQ AID+VPS N++LV+I VKPG Y EKVVVP 
Sbjct  13    SQPVEAEAISRSWFITVDKSGNGDYTKIQYAIDAVPSGNAQLVFIWVKPGVYHEKVVVPS  72

Query  396   DKPFITLSGD-DASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALR  572
             DKP+IT+SG   A  TVITW++ G+I      TV A+DF+GR++TI NT+G   K VALR
Sbjct  73    DKPYITVSGTGTAHETVITWNECGEIHDVAVFTVLATDFIGRFITIQNTYGIGAKAVALR  132

Query  573   VSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVG  752
             VS DR+A+Y CRI S QD L D  G+HYY +CYIEG  DFIFGNAAS FE C +HS++  
Sbjct  133   VSADRAAFYACRILSRQDALFDNVGRHYYGHCYIEGDTDFIFGNAASFFEKCHLHSLSEY  192

Query  753   GGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWN  932
              GAITAQRR +  + +GFTFL C ITG  T +LGRPWGPYS V++  +YMS+ I PEGW+
Sbjct  193   NGAITAQRRYAPSDQSGFTFLACSITGVKTALLGRPWGPYSTVIFAYTYMSNVILPEGWD  252

Query  933   DWD-DPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM-IEGQEWLRQA  1106
              W   P     VYYG+YKCYGPGA+ S+RV+WS+SL+  +  PF  + + +  + W  + 
Sbjct  253   GWRLAPNNLSHVYYGQYKCYGPGAETSQRVKWSQSLTSEQVTPFFDQAVALRSESWQGRW  312

Query  1107  P  1109
             P
Sbjct  313   P  313



>ref|XP_009350041.1| PREDICTED: putative pectinesterase 11 [Pyrus x bretschneideri]
Length=389

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/301 (55%), Positives = 212/301 (70%), Gaps = 3/301 (1%)
 Frame = +3

Query  216   SDGVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPV  395
             S  V+ +  S +  I VD+SG+GDY KIQ AID+VPS N++LV+I VKPG Y EKVVVP 
Sbjct  13    SQPVEAEAISRSWFITVDKSGNGDYTKIQYAIDAVPSGNAQLVFIWVKPGVYHEKVVVPS  72

Query  396   DKPFITLSGD-DASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALR  572
             DKP+IT+SG   A  TVITW++ G+I      TV A+DF+GR++TI NT+G   K VALR
Sbjct  73    DKPYITVSGTGTAHETVITWNECGEIQDVAVFTVLATDFIGRFITIQNTYGIGAKAVALR  132

Query  573   VSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVG  752
             VS DR+A+Y CRI S QD L D  G+HYY +CYIEG  DFIFGNAAS FE C +HS++  
Sbjct  133   VSADRAAFYACRILSRQDALFDNVGRHYYGHCYIEGDTDFIFGNAASFFEKCHLHSLSEY  192

Query  753   GGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWN  932
              GAITAQRR +  + +GFTFL C ITG  T +LGRPWGPYS V++  +YMS+ I PEGW+
Sbjct  193   NGAITAQRRYAPSDQSGFTFLACSITGVKTALLGRPWGPYSTVIFAYTYMSNVILPEGWD  252

Query  933   DWD-DPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM-IEGQEWLRQA  1106
              W   P     VYYG+YKCYGPGA+ S+RV+WS+SL+  +  PF  + + +  + W  + 
Sbjct  253   GWRLAPNNLSHVYYGQYKCYGPGAETSQRVKWSQSLTSEQVTPFFDQAVALRSESWQGRW  312

Query  1107  P  1109
             P
Sbjct  313   P  313



>emb|CDM83479.1| unnamed protein product [Triticum aestivum]
Length=344

 Score =   338 bits (866),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/290 (56%), Positives = 204/290 (70%), Gaps = 7/290 (2%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L+ VDQSG GDY KI +AI + P+ +S    I +KPG YREK+VVPVDKP ITL G  A+
Sbjct  55    LLTVDQSGKGDYRKIHEAIAAAPANSSARTVILIKPGIYREKIVVPVDKPNITLFGTSAN  114

Query  435   NTVITWSD---GGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGC  605
              TVITW++     D   SPT++V ASDFV   LT  NT G S   +A RV GDR+A+YGC
Sbjct  115   TTVITWNERWVSSDT--SPTVSVLASDFVASRLTFRNTLGTSAPAIAARVMGDRAAFYGC  172

Query  606   RIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRES  785
                S+QDTLLD+ G+HYY  CYIEGG DFI GN  +LFE C +HS +  GGA TAQ+R S
Sbjct  173   SFSSFQDTLLDDNGRHYYCGCYIEGGTDFICGNGRALFEKCHLHSTSPNGGAFTAQKRAS  232

Query  786   AEENTGFTFLGCKITGTG--TTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQR  959
                +TG++F+ CK+TG G  T++LGRPW PYSRVV+  +YMS+A+ P GW+DW+    QR
Sbjct  233   ELNHTGYSFVRCKLTGVGVSTSILGRPWEPYSRVVFALTYMSAAVSPRGWDDWNHTANQR  292

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAP  1109
             T +YG+Y+CYG GA    RV+W+R+LS  EA PFMTK  I GQ+WL + P
Sbjct  293   TAFYGQYQCYGQGAKTDGRVKWARNLSPIEAAPFMTKAWIGGQQWLPKQP  342



>ref|XP_008387960.1| PREDICTED: putative pectinesterase 11 [Malus domestica]
Length=391

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 206/287 (72%), Gaps = 3/287 (1%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             S+   I VD+SG+GDY KIQ AID+VPS N++LV+I VKPG Y EK+VVP DKP+IT+SG
Sbjct  24    SSKRFITVDKSGNGDYTKIQYAIDAVPSGNAQLVFIWVKPGVYHEKIVVPSDKPYITVSG  83

Query  423   D-DASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWY  599
                A  TVI W++ G+I      TV A+DF+GR++TI NT+G   K VALRVS DR+A+Y
Sbjct  84    TGTAHETVIIWNECGEIFDVAVFTVLATDFIGRFITIQNTYGIGAKAVALRVSADRAAFY  143

Query  600   GCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRR  779
              CRI S QD L D  G+HYY +CYIEG  D IFGNAAS FE C +HS++   GAITAQRR
Sbjct  144   ACRILSRQDALFDHVGRHYYGHCYIEGDTDLIFGNAASFFEKCHLHSLSEHKGAITAQRR  203

Query  780   ESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD-DPKRQ  956
              +  + +GFTFL C +TG  T +LGRPWGPYS VV+  +YMS+ I PEGW+ W   P   
Sbjct  204   YAPSDQSGFTFLACVVTGVKTALLGRPWGPYSTVVFAYTYMSNVILPEGWDGWRLAPNNL  263

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM-IEGQEW  1094
               VYYG+YKCYGPGA+ S+RV+WS+SL+  +  PF+ + + ++ + W
Sbjct  264   SHVYYGQYKCYGPGAETSQRVKWSQSLTSEQVTPFLDQAIALQSESW  310



>ref|XP_007224036.1| hypothetical protein PRUPE_ppa015184mg, partial [Prunus persica]
 gb|EMJ25235.1| hypothetical protein PRUPE_ppa015184mg, partial [Prunus persica]
Length=462

 Score =   337 bits (865),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 202/277 (73%), Gaps = 1/277 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             +  + + VDQSG+GDY KIQDAID+VPS N++ V I V+PG Y+EK+ VPVDKPFIT+SG
Sbjct  3     TPPISLTVDQSGNGDYTKIQDAIDAVPSNNAKRVSILVRPGVYQEKINVPVDKPFITMSG  62

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              +  +T+ITW+  G I  +   TV+ASDF+GR LTI NT+G   K VALRVSGDR+A+YG
Sbjct  63    TNTEHTIITWNQAGWINQTSVFTVWASDFIGRQLTIQNTYGTGDKTVALRVSGDRAAFYG  122

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI S+QD L DE GKHYY +CYI+G  DFIFG+A SL+E C +H+++   GAITAQRR 
Sbjct  123   CRILSHQDALFDEIGKHYYKDCYIQGDTDFIFGSADSLYENCHLHTLSGQNGAITAQRRT  182

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD-DPKRQR  959
             S  E +GFTFL C ITG  T +LGRPWGPY+RV++  + MS+ I P+GW+ W   P    
Sbjct  183   SPSEESGFTFLWCNITGVKTALLGRPWGPYARVIFAYTRMSNVILPQGWDSWRLSPYNLS  242

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
              V+YGEY C+GPGA  ++RV W+  L+  E  PFM +
Sbjct  243   KVFYGEYNCFGPGAVTTRRVNWAHKLTTREFAPFMAQ  279



>ref|XP_008656696.1| PREDICTED: putative pectinesterase 11 isoform X1 [Zea mays]
 gb|AFW83375.1| hypothetical protein ZEAMMB73_849858 [Zea mays]
Length=331

 Score =   330 bits (847),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 163/295 (55%), Positives = 210/295 (71%), Gaps = 14/295 (5%)
 Frame = +3

Query  252   VLIIVDQSGHGDYIKIQDAIDSVPSKNSEL-----VYISVKPGTYREKVVVPVDKPFITL  416
             ++++VDQSG GD+ +IQDAID+ P+ N        V I +KPG YREKVVV  DKP ITL
Sbjct  39    LVLVVDQSGKGDHRRIQDAIDAAPASNRSAGGRGSVVIRIKPGVYREKVVV--DKPCITL  96

Query  417   SGDDA--SNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRS  590
              G  A  S  VITW++      SPT++V ASDFV + +   NTFG SG  VA+RV+GDR+
Sbjct  97    VGATAASSTVVITWNESWVAADSPTVSVLASDFVAKRIAFQNTFGTSGPAVAVRVAGDRA  156

Query  591   AWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITA  770
             A+YGCR  S+QDTLLD+ G+HYY  CY++GG DF+FGN  +LF+ C +HS++  GGA TA
Sbjct  157   AFYGCRFTSFQDTLLDDTGRHYYRGCYVQGGTDFVFGNGKALFDKCHLHSVSPAGGAFTA  216

Query  771   QRRESAEENTGFTFLGCKIT--GTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDW--  938
              RR S  E+TGF+F+GCK+T  G GT+VLGRPWGPYSRVV+  SYMS  ++P+GW+DW  
Sbjct  217   HRRSSESEDTGFSFVGCKLTGLGAGTSVLGRPWGPYSRVVFALSYMSGTVRPQGWDDWSD  276

Query  939   -DDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
                  R RT +YG+Y+CYG G+    RV WS  LS+AEA PF+TK  + GQEWLR
Sbjct  277   SSRQSRSRTAFYGQYQCYGEGSRTDGRVAWSHDLSQAEAAPFITKVWVGGQEWLR  331



>ref|XP_008220903.1| PREDICTED: putative pectinesterase 11 [Prunus mume]
Length=536

 Score =   337 bits (864),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/277 (56%), Positives = 201/277 (73%), Gaps = 1/277 (0%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             +  + + VDQSG+GDY KIQDAID+VPS N+  V I V+PG Y+EK+ VP+DKPFIT+SG
Sbjct  31    TPPISLTVDQSGNGDYTKIQDAIDAVPSNNAARVSILVRPGVYQEKIYVPIDKPFITMSG  90

Query  423   DDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYG  602
              +  +T+ITW+  G I  +   TV+ASDF+GR LTI NT+G   K VALRVSGDR+A+YG
Sbjct  91    TNTEHTIITWNQAGWINQTSVFTVWASDFIGRQLTIQNTYGTGDKTVALRVSGDRAAFYG  150

Query  603   CRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRE  782
             CRI S+QD L DE GKHYY +CYI+G  DFIFG+A SL+E C +H+++   GAITAQRR 
Sbjct  151   CRILSHQDALFDEIGKHYYKDCYIQGDTDFIFGSADSLYENCHLHTLSGQNGAITAQRRT  210

Query  783   SAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD-DPKRQR  959
             S  E+ GFTFL C ITG  T +LGRPWGPY+RV++  + MS+ I P+GW+ W   P    
Sbjct  211   SPLEDPGFTFLWCNITGVKTALLGRPWGPYARVIFAYTQMSNVILPQGWDSWRLSPYNLS  270

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
              V+YGEY C+GPGA  ++RV W+  L+  E  PFM +
Sbjct  271   KVFYGEYNCFGPGAVTTRRVNWAHKLTTREFAPFMAQ  307



>ref|XP_007221726.1| hypothetical protein PRUPE_ppb020245mg [Prunus persica]
 gb|EMJ22925.1| hypothetical protein PRUPE_ppb020245mg [Prunus persica]
Length=346

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/278 (55%), Positives = 194/278 (70%), Gaps = 5/278 (2%)
 Frame = +3

Query  252   VLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDA  431
             + + VDQSG GDY KIQDAID+VPS N+  V I V+PG Y+EKV VP DKPFIT+SG +A
Sbjct  23    ISLTVDQSGKGDYTKIQDAIDAVPSNNAVPVSIWVRPGVYQEKVYVPADKPFITMSGTNA  82

Query  432   SNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCRI  611
               T++TW+  G I  +    V+ASDF GR LTI NT+G   K VALRVSGDR+A+YGC+I
Sbjct  83    EQTIVTWNQAGWINQTAVFAVWASDFTGRQLTIQNTYGTGDKTVALRVSGDRAAFYGCKI  142

Query  612   KSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFE----GCEIHSIAVGGGAITAQRR  779
              S+QD L DE GKHYY +C+I+G  DFIFG+A SL+      C +H+++   GAITAQRR
Sbjct  143   LSHQDALFDEIGKHYYKDCFIQGDTDFIFGSADSLYAVYIYNCHLHTLSGQNGAITAQRR  202

Query  780   ESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD-DPKRQ  956
              S  E +GFTFL C ITG  T +LGRPWGPY+RVV+  + MS+ I P+GW+ W   P   
Sbjct  203   TSPSEESGFTFLWCNITGVKTALLGRPWGPYARVVFAYTQMSNVILPQGWDSWGLSPYNL  262

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
               V+YGEY C+GPGA  ++RV W+  L+  E   FM +
Sbjct  263   SNVFYGEYNCFGPGAVTTQRVNWAHKLTTREFAHFMAQ  300



>ref|XP_008220901.1| PREDICTED: putative pectinesterase 11 [Prunus mume]
Length=370

 Score =   320 bits (820),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 193/272 (71%), Gaps = 1/272 (0%)
 Frame = +3

Query  258   IIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASN  437
             + +DQSG GDY KIQDAID VPS N   V I V+PG YREKV VPVDKPFIT+SG +A  
Sbjct  26    LTIDQSGKGDYTKIQDAIDVVPSNNVVPVSIWVRPGVYREKVFVPVDKPFITMSGTNAEQ  85

Query  438   TVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCRIKS  617
             T++TW+  G I  +    V+ASDF GR LTI N +G   K VALRVSGDR+A+YGC+I S
Sbjct  86    TIVTWNQAGWINQTAVFAVWASDFTGRQLTIQNAYGTGDKTVALRVSGDRAAFYGCKILS  145

Query  618   YQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESAEEN  797
             +QD L DE GKHYY +CYI+G  DFIFG+A SL+E C +H+++   GAITAQRR S  E 
Sbjct  146   HQDALFDEIGKHYYKDCYIQGDTDFIFGSADSLYENCHLHTLSDQNGAITAQRRTSPSEE  205

Query  798   TGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD-DPKRQRTVYYG  974
             +GFTFL C ITG  T +LGRPWGPY+RVV+  + MS+ I P+GW+ W   P     V+YG
Sbjct  206   SGFTFLWCNITGVKTALLGRPWGPYARVVFAYTQMSNVILPQGWDSWGLSPYNLSNVFYG  265

Query  975   EYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
             EY C+GPGA  ++RV W+  L+  +  PFM +
Sbjct  266   EYNCFGPGAVTTQRVNWAHKLTIRQFVPFMAQ  297



>ref|XP_008388162.1| PREDICTED: putative pectinesterase 11 [Malus domestica]
Length=524

 Score =   316 bits (809),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/285 (55%), Positives = 197/285 (69%), Gaps = 3/285 (1%)
 Frame = +3

Query  225   VKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKP  404
             V +      V I VDQSG  DY KIQDAID+VPS N+  VYI VKPG Y EK+ VP DKP
Sbjct  32    VNIPPAPPTVFITVDQSGSNDYTKIQDAIDAVPSNNALPVYIWVKPGIYYEKINVPSDKP  91

Query  405   FITLSGDD--ASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVS  578
             FIT+SG    AS+TVITW + G+I  +   T++ASDFVGR  T+ NT+G  GK VALRVS
Sbjct  92    FITISGSTSYASDTVITWKESGEINETAVFTLWASDFVGRNFTVQNTYGTGGKAVALRVS  151

Query  579   GDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGG  758
             GDR A+YGC I S+QD L  + GK YY +CYIEG  DFIFG+A+SLFE C +HS++   G
Sbjct  152   GDRVAFYGCSIMSHQDALFADIGKQYYKDCYIEGDTDFIFGSASSLFENCHMHSLSEQNG  211

Query  759   AITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDW  938
             AITAQ+R+S  ++ GF FLG +ITG G  VLGRPWGPYS V++  + MS+AI P+GW+ W
Sbjct  212   AITAQKRDSPSQDAGFLFLGGEITGVGRAVLGRPWGPYSTVIFAYTKMSNAILPQGWDSW  271

Query  939   DDPKRQRT-VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
                    + VYYGEYKC G GA  ++RV W  +++  E   FM K
Sbjct  272   GRSTDYLSKVYYGEYKCIGAGAVTAERVAWEHNVTPKEFTSFMNK  316



>gb|AFW83376.1| hypothetical protein ZEAMMB73_849858 [Zea mays]
Length=354

 Score =   308 bits (788),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 208/320 (65%), Gaps = 41/320 (13%)
 Frame = +3

Query  252   VLIIVDQSGHGDYIKIQDAIDSVPSKNSEL-----VYISVKPGTYREKVVVPVDKPFITL  416
             ++++VDQSG GD+ +IQDAID+ P+ N        V I +KPG   EKVVV  DKP ITL
Sbjct  39    LVLVVDQSGKGDHRRIQDAIDAAPASNRSAGGRGSVVIRIKPGV--EKVVV--DKPCITL  94

Query  417   SGDDA--SNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRS  590
              G  A  S  VITW++      SPT++V ASDFV + +   NTFG SG  VA+RV+GDR+
Sbjct  95    VGATAASSTVVITWNESWVAADSPTVSVLASDFVAKRIAFQNTFGTSGPAVAVRVAGDRA  154

Query  591   AWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF-----------------  719
             A+YGCR  S+QDTLLD+ G+HYY  CY++GG DF+FGN  +LF                 
Sbjct  155   AFYGCRFTSFQDTLLDDTGRHYYRGCYVQGGTDFVFGNGKALFDCTDVANQICVVTGSSN  214

Query  720   --------EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKIT--GTGTTVLGRPWGP  869
                     + C +HS++  GGA TA RR S  E+TGF+F+GCK+T  G GT+VLGRPWGP
Sbjct  215   GVRVPADVQKCHLHSVSPAGGAFTAHRRSSESEDTGFSFVGCKLTGLGAGTSVLGRPWGP  274

Query  870   YSRVVWVSSYMSSAIQPEGWNDW---DDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLS  1040
             YSRVV+  SYMS  ++P+GW+DW       R RT +YG+Y+CYG G+    RV WS  LS
Sbjct  275   YSRVVFALSYMSGTVRPQGWDDWSDSSRQSRSRTAFYGQYQCYGEGSRTDGRVAWSHDLS  334

Query  1041  KAEAKPFMTKKMIEGQEWLR  1100
             +AEA PF+TK  + GQEWLR
Sbjct  335   QAEAAPFITKVWVGGQEWLR  354



>ref|XP_009365999.1| PREDICTED: putative pectinesterase 11 [Pyrus x bretschneideri]
Length=524

 Score =   313 bits (801),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 201/312 (64%), Gaps = 12/312 (4%)
 Frame = +3

Query  225   VKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKP  404
             V +      V I VDQSG  DY KIQDAID+VPS N+  VYI VKPG Y EK+ VP DKP
Sbjct  32    VNIALAPPTVFITVDQSGSNDYTKIQDAIDAVPSNNALPVYIWVKPGIYYEKINVPSDKP  91

Query  405   FITLSGDD--ASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVS  578
             FIT+SG    AS+TVITW + G+I  +   T++ASDFVGR   + NT+G  GK VALRVS
Sbjct  92    FITISGSTSYASDTVITWKESGEINETAVFTLWASDFVGRNFKVQNTYGTGGKAVALRVS  151

Query  579   GDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGG  758
             GDR A+YGC I S+QD L  + GK YY +CYIEG  DFIFG A+SLFE C +HS++   G
Sbjct  152   GDRVAFYGCSIMSHQDALFADIGKQYYKDCYIEGDTDFIFGRASSLFENCHMHSLSEQNG  211

Query  759   AITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDW  938
             AITAQ+R+S  ++ GF FLG +ITG G  VLGRPWGPYS V++  + MS AI P+GW+ W
Sbjct  212   AITAQKRDSPSQDAGFVFLGGEITGVGRAVLGRPWGPYSTVIFAYTKMSDAILPQGWDSW  271

Query  939   DDPKRQRT-VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK---------KMIEGQ  1088
                    + VYYGEYKC G GA  ++RV W   ++  E   FM K         +  +G 
Sbjct  272   GRSTDYLSKVYYGEYKCTGAGAVTAERVAWEHKVTPKEFTSFMNKVRGFGIGSWQGSDGG  331

Query  1089  EWLRQAPTNFKR  1124
              W   AP   +R
Sbjct  332   GWKYGAPPRVRR  343



>ref|XP_009336866.1| PREDICTED: putative pectinesterase 11 [Pyrus x bretschneideri]
Length=524

 Score =   313 bits (801),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 201/312 (64%), Gaps = 12/312 (4%)
 Frame = +3

Query  225   VKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKP  404
             V +      V I VDQSG  DY KIQDAID+VPS N+  VYI VKPG Y EK+ VP DKP
Sbjct  32    VNIALAPPTVFITVDQSGSNDYTKIQDAIDAVPSNNALPVYIWVKPGIYYEKINVPSDKP  91

Query  405   FITLSGDD--ASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVS  578
             FIT+SG    AS+TVITW + G+I  +   T++ASDFVGR   + NT+G  GK VALRVS
Sbjct  92    FITISGSTSYASDTVITWKESGEINETAVFTLWASDFVGRNFKVQNTYGTGGKAVALRVS  151

Query  579   GDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGG  758
             GDR A+YGC I S+QD L  + GK YY +CYIEG  DFIFG A+SLFE C +HS++   G
Sbjct  152   GDRVAFYGCSIMSHQDALFADIGKQYYKDCYIEGDTDFIFGRASSLFENCHMHSLSEQNG  211

Query  759   AITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDW  938
             AITAQ+R+S  ++ GF FLG +ITG G  VLGRPWGPYS V++  + MS AI P+GW+ W
Sbjct  212   AITAQKRDSPSQDAGFVFLGGEITGVGRAVLGRPWGPYSTVIFAYTKMSDAILPQGWDSW  271

Query  939   DDPKRQRT-VYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK---------KMIEGQ  1088
                    + VYYGEYKC G GA  ++RV W   ++  E   FM K         +  +G 
Sbjct  272   GRSTDYLSKVYYGEYKCTGAGAVTAERVAWEHKVTPKEFTSFMNKVRGFGIGSWQGSDGG  331

Query  1089  EWLRQAPTNFKR  1124
              W   AP   +R
Sbjct  332   GWKYGAPPRVRR  343



>gb|EMT14397.1| Putative pectinesterase 11 [Aegilops tauschii]
Length=268

 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/287 (51%), Positives = 189/287 (66%), Gaps = 29/287 (10%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L+ VDQSG GDY KI +AI + P+ +S    I +KPG YR+ V               +S
Sbjct  7     LLTVDQSGKGDYRKIHEAIAAAPANSSARTVILIKPGVYRQWV---------------SS  51

Query  435   NTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCRIK  614
             +T            SPT++V ASDFV   LT  NT G S   +A+RV GDR+A+YGC   
Sbjct  52    DT------------SPTVSVLASDFVASRLTFRNTLGTSAPAIAVRVMGDRAAFYGCSFS  99

Query  615   SYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESAEE  794
             S+QDTLLD+ G+HYY  CYIEGG DFI GN  +LFE C +HS +  GGA TAQ+R S   
Sbjct  100   SFQDTLLDDNGRHYYCGCYIEGGTDFICGNGRALFEKCHLHSTSPNGGAFTAQKRASESN  159

Query  795   NTGFTFLGCKITGTG--TTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRTVY  968
             +TG++F+GCK+TG G  T++LGRPW PYSRVV+  +YMS+A+ P GW+DW+    QRT +
Sbjct  160   HTGYSFVGCKLTGVGVSTSILGRPWEPYSRVVFALTYMSAAVSPRGWDDWNRTANQRTAF  219

Query  969   YGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQAP  1109
             YG+Y+CYG GA    RV+W+R+LS  EA PFMTK  I+GQ+WL + P
Sbjct  220   YGQYQCYGQGAKTDGRVKWARNLSPTEAAPFMTKAWIDGQQWLPKQP  266



>ref|XP_004293209.1| PREDICTED: putative pectinesterase 11-like [Fragaria vesca subsp. 
vesca]
Length=472

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/288 (52%), Positives = 190/288 (66%), Gaps = 8/288 (3%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGD--D  428
             +I VDQSGHGD+ KIQDAI+S+P+ N E V IS+ PG Y+E + VP DKPFITL G    
Sbjct  26    IITVDQSGHGDFYKIQDAINSIPANNKEAVTISINPGKYKETITVPPDKPFITLRGSTTK  85

Query  429   ASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSAWYGCR  608
              S+ +ITW   GDI+   T  V ASDF+ R +T  NTFG   + VALRVSGDR ++Y C 
Sbjct  86    PSDVIITWDQSGDIVTVATFHVLASDFIARDVTFQNTFGHGHQAVALRVSGDRVSFYDCS  145

Query  609   IKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESA  788
             I  YQDTL DE G+HYY NCYIEG VDFIFG+A S F  C IHS     G ITAQRRE+ 
Sbjct  146   IIGYQDTLFDETGRHYYENCYIEGVVDFIFGSATSFFHSCHIHS--ARAGFITAQRRETP  203

Query  789   EENTGFTFLGCKITGT-GTTVLGRPW-GPYSRVVWVSSYMSSAIQPEGWND--WDDPKRQ  956
              +N GF F    ITG  G T LGRPW G Y+RV++  + M + I+P GW+D    + + +
Sbjct  204   TDNGGFVFFKGSITGEGGKTYLGRPWVGSYARVIFAYTNMENVIEPAGWSDDGIGEKELK  263

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
                + G++KC GPGA  S+RV+W+R  S+ E   F+T   I G++WL+
Sbjct  264   AKSFCGQFKCDGPGATTSERVQWAREFSEEEISKFVTTDFINGKDWLK  311



>ref|XP_010535938.1| PREDICTED: probable pectinesterase 53 [Tarenaya hassleriana]
Length=382

 Score =   296 bits (757),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 191/307 (62%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  + +      GD++KIQDAIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  75    KNKVFPSYTITVHKNPNKGDFVKIQDAIDSLPFVNLVRVVIKVHSGVYTEKVNIPPMKSF  134

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G+ A  T++ W D               +S T  V A  FV + +T  NT      
Sbjct  135   ITMEGEGAEKTIVQWGDSAQTPGARGQPLGTFNSATFAVNAPFFVAKNITFKNTTPVPPP  194

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VALRVS D + + GC+I   QDTL D  G+HYY +CYIEG VDFIFGNA SL+
Sbjct  195   GAVGKQAVALRVSADNAVFMGCQILGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLY  254

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+FL CK+TGTG   LGR WGP+SRVV+  +Y
Sbjct  255   EGCHVHAIADKMGAVTAQGRSSVLEDTGFSFLRCKVTGTGVLYLGRAWGPFSRVVFAYTY  314

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P GW +W DP R+ TV+YG+YKC GPGA+ + RV WSR L+  EAKPF++   +
Sbjct  315   MDNIILPRGWYNWGDPSREMTVFYGQYKCTGPGANHAGRVAWSRELTDEEAKPFLSLTFV  374

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  375   DGSEWIK  381



>ref|XP_006287923.1| hypothetical protein CARUB_v10001159mg [Capsella rubella]
 gb|EOA20821.1| hypothetical protein CARUB_v10001159mg [Capsella rubella]
Length=386

 Score =   295 bits (756),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/307 (48%), Positives = 195/307 (64%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +  +S  GD+ KIQDAIDS+P  N   V I V  G Y+EKV +P  K F
Sbjct  79    KNKLFPSYTLTVHKKSNKGDFTKIQDAIDSLPLINLVRVVIKVHAGVYKEKVNIPPMKAF  138

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G+ A NT++ W D               +S +  V +  FV + +T  NT      
Sbjct  139   ITIQGEGAENTIVEWGDTAQTPDSKGNPMGTFNSASFAVNSPFFVAKNITFKNTTPVPLP  198

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VALRVS D +A++GC++   QDTL D  G+HYY +CYIEG VDFIFGNA SL+
Sbjct  199   GAVGKQAVALRVSADNAAFFGCKMLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLY  258

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TGTG   LGR WGP+SRVV+  +Y
Sbjct  259   EGCHVHAIADKLGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGRAWGPFSRVVFAYTY  318

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P GW +W DP R+ TV+YG+YKC G GA+ + RV W+R L+  EAKPF++   I
Sbjct  319   MDNIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYAGRVAWARELTDEEAKPFISLNFI  378

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  379   DGSEWIK  385



>emb|CBI27989.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 190/308 (62%), Gaps = 16/308 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  + +   S  GD+  IQDAIDS+PS N   V I V  G Y EKV +P  K F
Sbjct  6     KNKLFPSYAITVNKNSAAGDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPAFKSF  65

Query  408   ITLSGDDASNTVITWSDGGDII----------HSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  TV+ W D    I          +S T  V +  F+ + +T  NT      
Sbjct  66    ITIEGAGADKTVVQWGDTARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNTTPVPAP  125

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+SGD +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLF
Sbjct  126   GAVGKQAVAFRISGDTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLF  185

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  186   EGCHVHAIAQNTGALTAQGRSSLLEDTGFSFVNCKVTGSGALFLGRAWGPFSRVVFAYTY  245

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M   I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   I
Sbjct  246   MDDIIIPKGWYNWGDPSREMTVFYGQYKCTGPGAAFAGRVSWSRELTDQEAKPFISLSYI  305

Query  1080  EGQEWLRQ  1103
             +G EW++ 
Sbjct  306   DGSEWIKM  313



>ref|XP_006400534.1| hypothetical protein EUTSA_v10013810mg [Eutrema salsugineum]
 gb|ESQ41987.1| hypothetical protein EUTSA_v10013810mg [Eutrema salsugineum]
Length=382

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/309 (48%), Positives = 194/309 (63%), Gaps = 16/309 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
               K K   +  L +  +   GD+ KIQDAIDS+P  N   V I V  G Y+EKV +P  K
Sbjct  73    AAKNKLFPSYTLTVHKKHNKGDFTKIQDAIDSLPLINLVRVVIKVHAGVYKEKVNIPPMK  132

Query  402   PFITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF---  542
              FIT+ G+ A  T++ W D               +S +  V +  FV + +T  NT    
Sbjct  133   AFITIEGEGAEKTIVEWGDTAQTPDQRGNPMGTFNSASFAVNSPFFVAKNITFKNTTPVP  192

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK  VALRVSGD +A++GCR+   QDTL D  G+HYY +CYIEG VDFIFGNA S
Sbjct  193   LPGAVGKQAVALRVSGDNAAFFGCRMLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALS  252

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             L+EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TGTG   LGR WGP+SRVV+  
Sbjct  253   LYEGCHVHAIADKLGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGRAWGPFSRVVFAY  312

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             +YM + I P GW +W DP R+ TV+YG+YKC G GA+ + RV W+R L+  EAKPF++  
Sbjct  313   TYMDNIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYAGRVAWARELTDEEAKPFISLT  372

Query  1074  MIEGQEWLR  1100
              I+G EW++
Sbjct  373   FIDGSEWIK  381



>ref|XP_009120862.1| PREDICTED: probable pectinesterase 53 [Brassica rapa]
 emb|CDX92506.1| BnaA10g15450D [Brassica napus]
Length=382

 Score =   293 bits (751),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/309 (47%), Positives = 195/309 (63%), Gaps = 16/309 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
               K K  ++  L +  +   GD+ KIQDAIDS+P  N   V I V  G Y+EKV +P  K
Sbjct  73    AAKNKLFASYTLTVHKKHNKGDFTKIQDAIDSLPLINLVRVVIKVHAGVYKEKVNIPPMK  132

Query  402   PFITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF---  542
              FIT+ G+ A  T++ W D               +S +  V +  FV + +T  NT    
Sbjct  133   AFITIEGEGADKTIVQWGDTAQTHDPKGNPMGTFNSASFAVNSPFFVAKNITFKNTTPVP  192

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK  VALRVS D +A++GC++   QDTL D  G+HYY +CYIEG VDFIFGNA S
Sbjct  193   LPGAVGKQAVALRVSADNAAFFGCKMLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALS  252

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             L+EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TGTG   LGR WGP+SRVV+  
Sbjct  253   LYEGCHVHAIADKLGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGRAWGPFSRVVFAY  312

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             +YM + I P+GW +W DP R+ TV+YG+YKC G GA+ + RV W+R L+  EAKPF++  
Sbjct  313   TYMDNIILPKGWYNWGDPSREMTVFYGQYKCTGAGANYAGRVAWARELTDEEAKPFISLT  372

Query  1074  MIEGQEWLR  1100
              I+G EW+R
Sbjct  373   FIDGSEWIR  381



>emb|CDY68784.1| BnaCnng60500D, partial [Brassica napus]
Length=294

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 188/289 (65%), Gaps = 16/289 (6%)
 Frame = +3

Query  282   GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWSDG  461
             GD+ KIQDAIDS+P  N   V I V  G Y+EKV +P  K FIT+ G+ A  T++ W D 
Sbjct  5     GDFTKIQDAIDSLPLINLVRVVIKVHAGVYKEKVNIPPMKAFITIEGEGADKTIVQWGDT  64

Query  462   GDI----------IHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSGDRSA  593
                           +S +  V +  FV + +T  NT      G  GK  VALRVS D +A
Sbjct  65    AQTHDPRGNPMGTFNSASFAVNSPFFVAKNITFKNTTPVPLPGAVGKQAVALRVSADNAA  124

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             ++GC++   QDTL D  G+HYY +CYIEG VDFIFGNA SL+EGC +H+IA   GA+TAQ
Sbjct  125   FFGCKMLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLYEGCHVHAIADKLGAVTAQ  184

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
              R S  E+TGF+F+ CK+TGTG   LGR WGP+SRVV+  +YM + I P+GW +W DP R
Sbjct  185   GRSSVLEDTGFSFVKCKVTGTGVLYLGRAWGPFSRVVFAYTYMDNIILPKGWYNWGDPSR  244

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             + TV+YG+YKC G GA+ + RV W+R L+  EAKPF++   I+G EW+R
Sbjct  245   EMTVFYGQYKCTGAGANYAGRVAWARELTDQEAKPFISLTFIDGSEWIR  293



>ref|XP_010656255.1| PREDICTED: probable pectinesterase 53 [Vitis vinifera]
Length=379

 Score =   293 bits (749),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 190/308 (62%), Gaps = 16/308 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  + +   S  GD+  IQDAIDS+PS N   V I V  G Y EKV +P  K F
Sbjct  72    KNKLFPSYAITVNKNSAAGDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPAFKSF  131

Query  408   ITLSGDDASNTVITWSDGGDII----------HSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  TV+ W D    I          +S T  V +  F+ + +T  NT      
Sbjct  132   ITIEGAGADKTVVQWGDTARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNTTPVPAP  191

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+SGD +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLF
Sbjct  192   GAVGKQAVAFRISGDTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLF  251

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  252   EGCHVHAIAQNTGALTAQGRSSLLEDTGFSFVNCKVTGSGALFLGRAWGPFSRVVFAYTY  311

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M   I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   I
Sbjct  312   MDDIIIPKGWYNWGDPSREMTVFYGQYKCTGPGAAFAGRVSWSRELTDQEAKPFISLSYI  371

Query  1080  EGQEWLRQ  1103
             +G EW++ 
Sbjct  372   DGSEWIKM  379



>ref|XP_001769817.1| predicted protein [Physcomitrella patens]
 gb|EDQ65379.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   291 bits (745),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 197/304 (65%), Gaps = 17/304 (6%)
 Frame = +3

Query  240   TSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLS  419
             T  AV+ +  + G G +  +Q AID VP  N   V+I V PG Y+EK+VVP  KP++T+ 
Sbjct  48    TPLAVIYVNRKRGVGHFTTVQAAIDHVPVNNDRRVHIIVAPGVYKEKIVVPSSKPYVTIL  107

Query  420   GDDASNTVITWSDGGDIIH----------SPTLTVFASDFVGRYLTIMNTF-----GRSG  554
             G   +NT++ W+D  D             S +L V A  F+ R +TI NT      G +G
Sbjct  108   GGGWNNTILQWNDTADCADKEGAKLGTYWSASLAVEAQYFIARNITIKNTASMPAAGAAG  167

Query  555   K-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCE  731
             K  VALRV+GD +A+YGCR  S QDTL D  G+HY+ +CYIEG +DF+FGN  SL+E C 
Sbjct  168   KQAVALRVTGDTAAFYGCRFMSTQDTLYDHVGRHYFKDCYIEGSIDFVFGNGRSLYESCH  227

Query  732   IHSIA-VGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSS  908
             +H++     G++ AQ+R +  E TGF+FL CKITG+G   LGR WG Y+RVV+  +YM +
Sbjct  228   LHALPRTTFGSVAAQKRGNVSEQTGFSFLNCKITGSGLLYLGRAWGSYARVVYSYTYMDN  287

Query  909   AIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQ  1088
              I P GW++W+DP+R +TV +G+YKC+GPGA ++ RV WS  L+  EA+PF++   ++G 
Sbjct  288   IIVPAGWSNWNDPRRNKTVIFGQYKCFGPGAKQTGRVPWSHELTDTEARPFLSLSFVDGD  347

Query  1089  EWLR  1100
             EW++
Sbjct  348   EWVQ  351



>emb|CAN63186.1| hypothetical protein VITISV_037092 [Vitis vinifera]
Length=379

 Score =   292 bits (748),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 190/308 (62%), Gaps = 16/308 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  + +   S  GD+  IQDAIDS+PS N   V I V  G Y EKV +P  K F
Sbjct  72    KNKLFPSYAITVNKNSAAGDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPXFKSF  131

Query  408   ITLSGDDASNTVITWSDGGDII----------HSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  TV+ W D    I          +S T  V +  F+ + +T  NT      
Sbjct  132   ITIEGAGADKTVVQWGDTARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNTTPVPAP  191

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+SGD +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLF
Sbjct  192   GAVGKQAVAFRISGDTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLF  251

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  252   EGCHVHAIAQNTGALTAQGRSSLLEDTGFSFVNCKVTGSGALFLGRAWGPFSRVVFAYTY  311

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M   I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   I
Sbjct  312   MDDIIIPKGWYNWGDPSREMTVFYGQYKCTGPGAAFAGRVSWSRELTDQEAKPFISLSYI  371

Query  1080  EGQEWLRQ  1103
             +G EW++ 
Sbjct  372   DGSEWIKM  379



>ref|XP_010420786.1| PREDICTED: probable pectinesterase 53 isoform X1 [Camelina sativa]
 ref|XP_010420787.1| PREDICTED: probable pectinesterase 53 isoform X2 [Camelina sativa]
Length=386

 Score =   292 bits (748),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 146/309 (47%), Positives = 194/309 (63%), Gaps = 16/309 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
               K K   +  L +  +S  GD+ KIQDAIDS+P  N   V I V  G Y+EKV +P  K
Sbjct  77    AAKNKLFPSYTLTVHKKSNKGDFTKIQDAIDSLPLINLVRVVIKVHAGVYKEKVNIPPMK  136

Query  402   PFITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF---  542
              FIT+ G+ A  T++ W D               +S +  V +  FV + +T  NT    
Sbjct  137   AFITIEGEGAEKTIVEWGDTAQTPDSKGNPMGTFNSASFAVNSPFFVAKNVTFKNTTPVP  196

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK  VALRVS D +A++GC++   QDTL D  G+HYY +CYIEG VDFIFGNA S
Sbjct  197   LPGAIGKQAVALRVSADNAAFFGCKMLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALS  256

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             L+EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TGTG   LGR WGP+SRVV+  
Sbjct  257   LYEGCHVHAIADKLGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGRAWGPFSRVVFAY  316

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             +YM + I P GW +W DP R+ TV+YG+YKC G GA+ + RV W+R L+  EAKPF++  
Sbjct  317   TYMENIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYAGRVAWARELTDEEAKPFISLT  376

Query  1074  MIEGQEWLR  1100
              I+G EW++
Sbjct  377   FIDGSEWIK  385



>ref|XP_010493050.1| PREDICTED: probable pectinesterase 53 [Camelina sativa]
Length=386

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 194/309 (63%), Gaps = 16/309 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
               K K   +  L +  +S  GD+ KIQDA+DS+P  N   V I V  G Y+EKV +P  K
Sbjct  77    AAKNKLFPSYTLTVHKKSNKGDFTKIQDAVDSLPLINLVRVVIKVHAGIYKEKVNIPPMK  136

Query  402   PFITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF---  542
              FIT+ G+ A  T++ W D               +S +  V +  FV + +T  NT    
Sbjct  137   AFITIEGEGAEKTIVEWGDTAQTPDSKGNPMGTFNSASFAVNSPFFVAKNITFKNTTPVP  196

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK  VALRVS D +A++GC++   QDTL D  G+HYY +CYIEG VDFIFGNA S
Sbjct  197   LPGAVGKQAVALRVSADNAAFFGCKMLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALS  256

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             L+EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TGTG   LGR WGP+SRVV+  
Sbjct  257   LYEGCHVHAIADKLGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGRAWGPFSRVVFAY  316

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             +YM + I P GW +W DP R+ TV+YG+YKC G GA+ + RV W+R L+  EAKPF++  
Sbjct  317   TYMENIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYAGRVAWARELTDEEAKPFISLT  376

Query  1074  MIEGQEWLR  1100
              I+G EW++
Sbjct  377   FIDGSEWIK  385



>ref|XP_004287482.1| PREDICTED: probable pectinesterase 53-like [Fragaria vesca subsp. 
vesca]
Length=381

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/308 (47%), Positives = 186/308 (60%), Gaps = 17/308 (6%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+  IQDAIDS+P  N   V I V  G Y+EKV +P  K F
Sbjct  73    KNKLFPSYTLNVDKNPSRGDFTSIQDAIDSLPFINLVRVVIKVHAGVYKEKVNIPPLKSF  132

Query  408   ITLSGDDASNTVITWSDGGDI-----------IHSPTLTVFASDFVGRYLTIMNTF----  542
             IT+ G  A  T++ W D                +S T  V +  F+ R +T  NT     
Sbjct  133   ITIEGAGAEKTIVQWGDTAQTPSGPKKQPMGTFNSATFAVNSPYFIARNITFKNTTPVPA  192

Query  543   -GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              G  GK  VA R+S D +A+ GCR    QDTL D  G+HYY +CYIEG VDFIFGN  SL
Sbjct  193   PGAIGKQAVAFRISADTAAFLGCRFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNGLSL  252

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             FEGC +H+IA   GA+TAQ R S  E TGF+F+ CK+TG+G   LGR WGP+SRVV+  +
Sbjct  253   FEGCHVHAIATNTGALTAQGRSSLLEETGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYT  312

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             YM + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   
Sbjct  313   YMDNIIMPKGWYNWGDPNREMTVFYGQYKCTGPGAQYAGRVSWSRELTDEEAKPFISLTF  372

Query  1077  IEGQEWLR  1100
             I+G EWL+
Sbjct  373   IDGSEWLK  380



>ref|NP_197474.1| probable pectinesterase 53 [Arabidopsis thaliana]
 sp|Q8VYZ3.1|PME53_ARATH RecName: Full=Probable pectinesterase 53; Short=PE 53; AltName: 
Full=Pectin methylesterase 53; Short=AtPME53; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL38872.1| putative pectin methylesterase [Arabidopsis thaliana]
 gb|AAM20209.1| putative pectin methylesterase [Arabidopsis thaliana]
 gb|AED92743.1| probable pectinesterase 53 [Arabidopsis thaliana]
Length=383

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/309 (48%), Positives = 192/309 (62%), Gaps = 16/309 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
               K K   +  L +  +S  GD+ KIQDAIDS+P  N   V I V  G Y+EKV +P  K
Sbjct  74    AAKNKLFPSYTLTVHKKSNKGDFTKIQDAIDSLPLINFVRVVIKVHAGVYKEKVSIPPLK  133

Query  402   PFITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF---  542
              FIT+ G+ A  T + W D               +S +  V +  FV + +T  NT    
Sbjct  134   AFITIEGEGAEKTTVEWGDTAQTPDSKGNPMGTYNSASFAVNSPFFVAKNITFRNTTPVP  193

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK  VALRVS D +A++GCR+   QDTL D  G+HYY +CYIEG VDFIFGNA S
Sbjct  194   LPGAVGKQAVALRVSADNAAFFGCRMLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALS  253

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             L+EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TGTG   LGR WGP+SRVV+  
Sbjct  254   LYEGCHVHAIADKLGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGRAWGPFSRVVFAY  313

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             +YM + I P GW +W DP R+ TV+YG+YKC G GA+   RV W+R L+  EAKPF++  
Sbjct  314   TYMDNIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYGGRVAWARELTDEEAKPFLSLT  373

Query  1074  MIEGQEWLR  1100
              I+G EW++
Sbjct  374   FIDGSEWIK  382



>ref|XP_010454257.1| PREDICTED: probable pectinesterase 53 [Camelina sativa]
Length=386

 Score =   291 bits (745),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 194/309 (63%), Gaps = 16/309 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
               K K   +  L +  +S  GD+ KIQDA+DS+P  N   V I V  G Y+EKV +P  K
Sbjct  77    AAKNKLFPSYTLTVHKKSNKGDFTKIQDAVDSLPLINLVRVVIKVHAGVYKEKVNIPPMK  136

Query  402   PFITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF---  542
              FIT+ G+ A  T++ W D               +S +  V +  FV + +T  NT    
Sbjct  137   AFITIEGEGAEKTIVEWGDTAQTPDSKGNPMGTFNSASFAVNSPFFVAKNITFKNTTPVP  196

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK  VALRVS D +A++GC++   QDTL D  G+HYY +CYIEG VDFIFGNA S
Sbjct  197   LPGAIGKQAVALRVSADNAAFFGCKMLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALS  256

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             L+EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TGTG   LGR WGP+SRVV+  
Sbjct  257   LYEGCHVHAIADKLGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGRAWGPFSRVVFAY  316

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             +YM + I P GW +W DP R+ TV+YG+YKC G GA+ + RV W+R L+  EAKPF++  
Sbjct  317   TYMENIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYAGRVAWARELTDDEAKPFISLT  376

Query  1074  MIEGQEWLR  1100
              I+G EW++
Sbjct  377   FIDGSEWIK  385



>ref|XP_010324275.1| PREDICTED: pectinesterase QRT1 [Solanum lycopersicum]
Length=356

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 197/299 (66%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+VDQ+G GD I +Q A+D VPS N + V I + PGTYREKV +P  KPFI+L GD   
Sbjct  57    VIVVDQNGKGDSISVQGAVDKVPSNNLQRVIIYIHPGTYREKVHIPASKPFISLVGDQNQ  116

Query  429   ASNTVITWSDG-------GDII---HSPTLTVFASDFVGRYLTIMNTF-----GRSGKGV  563
              + T+I+  D        G I+    + TLTV +  F    +TI NT      G   +GV
Sbjct  117   TTRTIISGHDKASDTDQYGSILGTSRTATLTVESDYFCATGITIENTIIPDPKGVGMQGV  176

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR++GDRS  Y  RI   QDTLLD+AG HY+  CYI+G VDFI GNA SL++ C +HSI
Sbjct  177   ALRLNGDRSVLYRVRILGSQDTLLDDAGSHYFYQCYIQGSVDFICGNARSLYKNCTLHSI  236

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A G GAI AQ R++ +++TGF+F+ CKI G+G   LGR WG YSR+++        I P+
Sbjct  237   AKGYGAIAAQHRDTEDQDTGFSFVNCKIKGSGRVFLGRAWGEYSRIIYSKCDFDPIIDPK  296

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW DW+ P R++   +GEY+C G GA+R+ RV WS++L+++EA+PF+  K IEGQ+WLR
Sbjct  297   GWTDWNQPSRRQHTVFGEYQCRGSGANRAGRVTWSKTLNQSEAEPFLDVKFIEGQQWLR  355



>ref|XP_006346251.1| PREDICTED: pectinesterase QRT1-like [Solanum tuberosum]
Length=356

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 197/299 (66%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+VDQ+G GD I +Q A+D VPS N + V I + PGTYREKV +P  KPFI+L GD   
Sbjct  57    VIVVDQNGKGDSISVQGAVDKVPSNNLQRVIIYIHPGTYREKVHIPASKPFISLVGDQNQ  116

Query  429   ASNTVITWSDG-------GDII---HSPTLTVFASDFVGRYLTIMNTF-----GRSGKGV  563
              + T+I+  D        G I+    + TLTV +  F    +TI NT      G   +GV
Sbjct  117   TARTIISGHDKASDTDQYGSILGTSRTATLTVESDYFCATGITIENTVIPDPKGVGMQGV  176

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR++GDRS  Y  RI   QDTLLD+AG HY+  CYI+G VDFI GNA SL++ C +HSI
Sbjct  177   ALRLTGDRSVLYRVRILGSQDTLLDDAGSHYFYQCYIQGSVDFICGNARSLYKNCTLHSI  236

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A G GAI AQ R+SA+++TGF+F+ CKI G+G   LGR WG YSR+++        I P+
Sbjct  237   AKGYGAIAAQHRDSADQDTGFSFVNCKIKGSGRVFLGRAWGEYSRIIYSKCDFDPIIDPK  296

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW DW+ P R++   +GEY+C G GA+R+ RV WS++L+++EA+PF+  K I GQ+WLR
Sbjct  297   GWTDWNQPSRRQHTVFGEYQCRGSGANRAGRVTWSKTLNESEAEPFLDLKFIGGQQWLR  355



>ref|XP_006371972.1| hypothetical protein POPTR_0018s06820g [Populus trichocarpa]
 gb|ERP49769.1| hypothetical protein POPTR_0018s06820g [Populus trichocarpa]
Length=422

 Score =   291 bits (746),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/299 (47%), Positives = 185/299 (62%), Gaps = 16/299 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             LI+      GD+  IQ+AIDS+P  N   V I ++ G Y+EKV +P  K FIT+ G  A 
Sbjct  124   LIVAKNPSAGDFTTIQEAIDSLPFINLVRVIIKIRAGVYKEKVNIPPLKSFITMEGAGAD  183

Query  435   NTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTFGRSGKG------VA  566
             NT++ W D                S T  V +  FV + +T  NT      G      VA
Sbjct  184   NTIVQWGDTAQTPGARGQPMGTYSSATFAVNSPFFVAKNITFKNTAPLPAPGAMGQQAVA  243

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LR+S D +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGN  SLFEGC +H+IA
Sbjct  244   LRISADTAAFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNGLSLFEGCHVHAIA  303

Query  747   VGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEG  926
                GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +YM + I P+G
Sbjct  304   QFTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTYMDNIIIPKG  363

Query  927   WNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQ  1103
             W +W DP R+ TV+YG+YKC GPGA  + RV WSR L+ +EAKPF +   I+G EW++ 
Sbjct  364   WYNWGDPNRELTVFYGQYKCTGPGASFAGRVSWSRELTDSEAKPFTSLTFIDGSEWIKM  422



>ref|XP_011009863.1| PREDICTED: probable pectinesterase 53 [Populus euphratica]
Length=381

 Score =   290 bits (741),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 143/299 (48%), Positives = 186/299 (62%), Gaps = 16/299 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             LI+      GD+  IQ+AIDS+P  N   V I ++ G Y+EKV +P  K FIT+ G  A 
Sbjct  83    LIVAKNPSAGDFTTIQEAIDSLPFINLVRVIIKIRAGVYKEKVNIPPLKSFITIEGAGAD  142

Query  435   NTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVA  566
             NT++ W D                S T  V +  FV + +T  NT      G  GK  VA
Sbjct  143   NTIVQWGDTAQTPGARGQPMGTYSSATFAVNSPFFVAKNITFKNTAPLPAPGAMGKQAVA  202

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LR+S D +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGN  SLFEGC +H+IA
Sbjct  203   LRISADTAAFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNGLSLFEGCHVHAIA  262

Query  747   VGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEG  926
                GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +YM   I P+G
Sbjct  263   QFTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTYMDGIIIPKG  322

Query  927   WNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQ  1103
             W +W DP R+ TV+YG+YKC GPGA  + RV WSR L+ +EAKPF +   I+G EW++ 
Sbjct  323   WYNWGDPNRELTVFYGQYKCTGPGARFAGRVSWSRELTDSEAKPFTSLTFIDGSEWIKM  381



>ref|XP_010267113.1| PREDICTED: probable pectinesterase 53 [Nelumbo nucifera]
Length=379

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/307 (47%), Positives = 189/307 (62%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   + +L +      GD+  IQDAIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  72    KNKLFPSYILTVSKNPAAGDFTSIQDAIDSLPFINLVRVVIKVNAGVYTEKVNIPPLKSF  131

Query  408   ITLSGDDASNTVITWSDGGDII----------HSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T++ W D    +          +S T  V ++ F+ + +T+ NT      
Sbjct  132   ITIEGAGADKTIVQWGDTAQTLGPRGQPIGTFNSATFAVNSAYFIAKNITLKNTNPLPPP  191

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+SGD +A+ GCR    QDTL D  G+HYY +CYIEG VDFIFGN  SLF
Sbjct  192   GAVGKQAVAFRISGDTAAFLGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLF  251

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +Y
Sbjct  252   EGCNVHAIAQNYGAVTAQNRMSLLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTY  311

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M   + P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF+T   I
Sbjct  312   MDDIVIPKGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVSWSRELTDEEAKPFITLSFI  371

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  372   DGSEWIK  378



>ref|XP_006475590.1| PREDICTED: probable pectinesterase 53-like isoform X2 [Citrus 
sinensis]
 gb|KDO66597.1| hypothetical protein CISIN_1g019696mg [Citrus sinensis]
Length=337

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 187/307 (61%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K      L +      GD+ KIQDAIDS+P  N   V I V  G Y+EKV +P  K F
Sbjct  30    KNKLFPAYTLTVAKNPAAGDFTKIQDAIDSLPFINLVRVVIKVHAGVYKEKVNIPPFKSF  89

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T++ W D                S T  V A  F+ + +T  NT      
Sbjct  90    ITIEGAGADKTIVQWGDTAQTRGPRGQPIGTWASATFAVNAPYFIAKNITFKNTTPVPAP  149

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D + ++GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLF
Sbjct  150   GAVGKQAVAFRISADTATFWGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNALSLF  209

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  210   EGCHVHAIAQYTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTY  269

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV W+R L+  EAKPF++   I
Sbjct  270   MDNIIIPKGWYNWGDPNREMTVFYGQYKCKGPGASFAGRVSWARELTDEEAKPFISLSFI  329

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  330   DGSEWIK  336



>ref|XP_006853729.1| hypothetical protein AMTR_s00056p00166920 [Amborella trichopoda]
 gb|ERN15196.1| hypothetical protein AMTR_s00056p00166920 [Amborella trichopoda]
Length=379

 Score =   288 bits (736),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/310 (46%), Positives = 191/310 (62%), Gaps = 17/310 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVD  398
             G  + +   +  + VD++   GD+  IQ AIDS+P  N   V I V PGTY EKV++P  
Sbjct  68    GAAINKIFPSFYLTVDKNPAKGDFTTIQSAIDSLPFINLVRVVIKVNPGTYTEKVIIPAM  127

Query  399   KPFITLSGDDASNTVITWSDGGDII----------HSPTLTVFASDFVGRYLTIMNTF--  542
             K FIT+ G  A  T + W D    +          +S T  V +  F+ + +T  NT   
Sbjct  128   KAFITIEGAGADRTEVQWGDTAQTVGPTGQPIGTFNSATFAVNSPYFIAKNITFKNTTPV  187

Query  543   ---GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAA  710
                G SGK  VA R+S D +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGN  
Sbjct  188   PKPGASGKQAVAFRISADTAAFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNGL  247

Query  711   SLFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWV  890
             SL+EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WG +SRVV+ 
Sbjct  248   SLYEGCHVHAIANNYGALTAQNRMSLLEDTGFSFVNCKVTGSGALYLGRAWGAFSRVVFA  307

Query  891   SSYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
              +YM + I P GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++ 
Sbjct  308   YTYMDNIIIPRGWYNWGDPNREMTVFYGQYKCAGPGASFAGRVSWSRELTDEEAKPFISL  367

Query  1071  KMIEGQEWLR  1100
               I+G EW++
Sbjct  368   SFIDGSEWIK  377



>ref|XP_010688346.1| PREDICTED: probable pectinesterase 53 [Beta vulgaris subsp. vulgaris]
Length=402

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/288 (48%), Positives = 184/288 (64%), Gaps = 16/288 (6%)
 Frame = +3

Query  282   GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWSDG  461
             GD+  IQDAIDS+P+ N   V I VK GTY EKV +P  K FIT+ G+ A NT++ W D 
Sbjct  113   GDFTTIQDAIDSLPAINFVRVIIKVKAGTYSEKVYIPPLKAFITIEGEGADNTIVEWGDT  172

Query  462   GDII----------HSPTLTVFASDFVGRYLTIMNTF------GRSGKGVALRVSGDRSA  593
                I          +S T  V +  F+ + +T  NT           + VA R+S D +A
Sbjct  173   AKTIGPNGKPLGTFNSATFAVNSPYFMAKNITFKNTTPVPQPGAVGAQAVAFRISADTAA  232

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             + GC+    QDTL D  G+HYY +CYIEG VDFIFGN  SLFEGC +H++A+  GA+TAQ
Sbjct  233   FVGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNGLSLFEGCHVHAVAIRYGALTAQ  292

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
              R S  ++TGF+F+ CK+TG+G   LGR WGP+SRV++  +YM + I P+GW +W DP R
Sbjct  293   GRSSMLDDTGFSFVNCKVTGSGALYLGRAWGPFSRVIFAYTYMDNIIMPKGWYNWGDPSR  352

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             + TV+YG+YKC GPGA  + RV WSR L+  EA PF++   I+G EW+
Sbjct  353   EMTVFYGQYKCTGPGASYAGRVAWSRELTDEEAGPFISLSFIDGSEWI  400



>ref|XP_006475589.1| PREDICTED: probable pectinesterase 53-like isoform X1 [Citrus 
sinensis]
Length=379

 Score =   287 bits (735),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/298 (48%), Positives = 187/298 (63%), Gaps = 16/298 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L +      GD+ KIQDAIDS+P  N   V I V  G Y+EKV +P  K FIT+ G  A 
Sbjct  81    LTVAKNPAAGDFTKIQDAIDSLPFINLVRVVIKVHAGVYKEKVNIPPFKSFITIEGAGAD  140

Query  435   NTVITWSDG-------GDII---HSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVA  566
              T++ W D        G  I    S T  V A  F+ + +T  NT      G  GK  VA
Sbjct  141   KTIVQWGDTAQTRGPRGQPIGTWASATFAVNAPYFIAKNITFKNTTPVPAPGAVGKQAVA  200

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
              R+S D + ++GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLFEGC +H+IA
Sbjct  201   FRISADTATFWGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIA  260

Query  747   VGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEG  926
                GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +YM + I P+G
Sbjct  261   QYTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTYMDNIIIPKG  320

Query  927   WNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             W +W DP R+ TV+YG+YKC GPGA  + RV W+R L+  EAKPF++   I+G EW++
Sbjct  321   WYNWGDPNREMTVFYGQYKCKGPGASFAGRVSWARELTDEEAKPFISLSFIDGSEWIK  378



>ref|XP_010249481.1| PREDICTED: probable pectinesterase 53 [Nelumbo nucifera]
Length=378

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 188/307 (61%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+  IQDAIDS+PS N   V I V  G Y EKV +P  K F
Sbjct  71    KNKLFPSYTLTVHKNPAAGDFTSIQDAIDSLPSVNLVRVVIKVNAGVYTEKVNIPPLKSF  130

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T++ W D               +S T  V +  F+ + +T  NT      
Sbjct  131   ITIEGAGADKTIVQWGDTAQTPGPNGRPIGTFNSATFAVNSPYFIAKNITFKNTTPLPPP  190

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+SGD +A++GC+    QDTL D  G+HYY +CYIEG VDFIFGN  SLF
Sbjct  191   GAIGKQAVAFRISGDTAAFWGCKFFGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLF  250

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +Y
Sbjct  251   EGCNVHAIAQKYGAVTAQSRMSLLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTY  310

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP RQ TV+YG+YKC GPGA  + RV WSR L+ AEAKPF +   I
Sbjct  311   MDNIIIPKGWYNWGDPNRQMTVFYGQYKCTGPGASFAGRVSWSRELTDAEAKPFTSLTFI  370

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  371   DGSEWIK  377



>gb|KEH27219.1| pectinesterase [Medicago truncatula]
Length=379

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 189/307 (62%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K  ++  L +      GD+  IQ+AIDS+PS N   V I V  G Y EKV +P  K F
Sbjct  72    KNKLFASYTLHVDKNPSFGDFDTIQNAIDSLPSINLVRVVIKVHAGVYTEKVNIPPLKSF  131

Query  408   ITLSGDDASNTVITWSDGG----------DIIHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ GD A  T++ W D                S T  V +  F+ + +T  NTF     
Sbjct  132   ITIEGDGADTTIVQWGDTAATPGPRGNPLGTYGSATFAVNSPYFIAKNITFKNTFPLPAP  191

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D +++ GCR    QDTL D  G+HYY +CYIEG VDFIFGNA SLF
Sbjct  192   GAIGKQAVAFRISADTASFLGCRFLGAQDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLF  251

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  ++TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  252   EGCHVHAIARNTGALTAQGRSSMLQDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTY  311

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EA+PF++   I
Sbjct  312   MDNIIIPKGWYNWGDPNREMTVFYGQYKCTGPGASFAGRVSWSRELTDEEARPFLSLTFI  371

Query  1080  EGQEWLR  1100
             +G EW+ 
Sbjct  372   DGTEWIN  378



>ref|XP_002962215.1| hypothetical protein SELMODRAFT_165098 [Selaginella moellendorffii]
 gb|EFJ37475.1| hypothetical protein SELMODRAFT_165098 [Selaginella moellendorffii]
Length=359

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 192/300 (64%), Gaps = 17/300 (6%)
 Frame = +3

Query  249   AVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD  428
             A +++VDQSG+GD++ +QDA++++P  N + V I + PG Y EKVVVP  KPF+T  G  
Sbjct  57    ARILVVDQSGNGDFVTVQDAVNAIPDGNDQRVTIRIGPGIYWEKVVVPATKPFLTFQGAG  116

Query  429   ASNTVITWS--------DGGDII--HSPTLTVFASDFVGRYLTIMNTFGRSGKGV-----  563
                ++I W+        DG  +    + ++T+  ++F+ R ++  NT      GV     
Sbjct  117   IDRSLIVWNSTASDLGPDGQPLTAYRTASVTIVGANFIARDISFQNTAPPPPPGVNGRQA  176

Query  564   -ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHS  740
              A R+SGD +A+Y C     QDTL D+ G+HY+  C+I+G +DFIFGN  SL+E CE+HS
Sbjct  177   AAFRISGDMAAFYNCGFYGAQDTLCDDVGRHYFKGCFIQGSIDFIFGNGRSLYEQCELHS  236

Query  741   IAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQP  920
             IA   G++ AQ R+S  ENTGF+F+ CK+TGTG   LGR  GPYSR+V+ +SY  + I  
Sbjct  237   IADSYGSVAAQDRQSQTENTGFSFVNCKVTGTGILYLGRAMGPYSRIVYSNSYFDNIIDV  296

Query  921   EGWNDWD-DPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
              GW+DWD D  R RTV +G+YKCYGPGA  S RV W+R LS  E  PF++   ++G +WL
Sbjct  297   RGWDDWDHDASRDRTVSFGQYKCYGPGATSSLRVPWARELSDMEVTPFLSLSFVDGTQWL  356



>ref|XP_002965129.1| hypothetical protein SELMODRAFT_167160 [Selaginella moellendorffii]
 gb|EFJ33967.1| hypothetical protein SELMODRAFT_167160 [Selaginella moellendorffii]
Length=359

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 192/300 (64%), Gaps = 17/300 (6%)
 Frame = +3

Query  249   AVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD  428
             A +++VDQSG+GD++ +QDA++++P  N + V I + PG Y EKVVVP  KPF+T  G  
Sbjct  57    ARILVVDQSGNGDFVTVQDAVNAIPDGNDQRVTIRIGPGIYWEKVVVPATKPFLTFQGAG  116

Query  429   ASNTVITWS--------DGGDII--HSPTLTVFASDFVGRYLTIMNTFGRSGKGV-----  563
                ++I W+        DG  +    + ++T+  ++F+ R ++  NT      GV     
Sbjct  117   IDRSLIVWNSTASDLGPDGQPLTAYRTASVTIVGANFIARDISFQNTAPPPPPGVNGRQA  176

Query  564   -ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHS  740
              A R+SGD +A+Y C     QDTL D+ G+HY+  C+I+G +DFIFGN  SL+E CE+HS
Sbjct  177   AAFRISGDMAAFYNCGFYGAQDTLCDDVGRHYFKGCFIQGSIDFIFGNGRSLYEQCELHS  236

Query  741   IAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQP  920
             IA   G++ AQ R+S  ENTGF+F+ CK+TGTG   LGR  GPYSR+V+ +SY  + I  
Sbjct  237   IADSYGSVAAQDRQSQTENTGFSFVNCKVTGTGILYLGRAMGPYSRIVYSNSYFDNIIDV  296

Query  921   EGWNDWD-DPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
              GW+DWD D  R RTV +G+YKCYGPGA  S RV W+R LS  E  PF++   ++G +WL
Sbjct  297   RGWDDWDHDASRDRTVSFGQYKCYGPGATSSLRVPWARELSDMEVTPFLSLSFVDGTQWL  356



>ref|XP_010915080.1| PREDICTED: probable pectinesterase 53 isoform X2 [Elaeis guineensis]
Length=380

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 191/307 (62%), Gaps = 17/307 (6%)
 Frame = +3

Query  231   LKQTSTAVLIIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             L +   +  + VD++   GD+  IQDAIDS+P  N   V I V  GTY+EKV +   K F
Sbjct  73    LNKVIPSYTLTVDKNPSKGDFTSIQDAIDSLPFVNLVRVVIKVNAGTYKEKVNISPGKAF  132

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  TV+ W D  D            +S T  V A  F+ + +T  NT      
Sbjct  133   ITIEGAGADKTVVQWGDTADTPGPRGQPIGTFNSATFGVNAPYFIAKNITFKNTTPIPPP  192

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VALR+SGD +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLF
Sbjct  193   GAMGKQAVALRISGDTAAFLGCKFLGGQDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLF  252

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WG +SRVV+  +Y
Sbjct  253   EGCHVHAIAQNYGAVTAQNRMSLLEDTGFSFVNCKVTGSGALYLGRAWGTFSRVVFAYTY  312

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M   I P GW +W DP R+ TV+YG+YKC GPGA+   RV WSR L+  EAKPF++   I
Sbjct  313   MDDIIIPRGWYNWGDPSREMTVFYGQYKCSGPGANYVGRVSWSRELTDEEAKPFISLSFI  372

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  373   DGTEWVK  379



>ref|XP_002871903.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48162.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=386

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 191/309 (62%), Gaps = 16/309 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
               K K   +  L +  +S  GD+ KIQDAIDS+P  N   V I V  G Y+EKV +   K
Sbjct  77    AAKNKLFPSYTLTVHKKSNKGDFTKIQDAIDSLPLINFVRVVIKVHAGVYKEKVNILPMK  136

Query  402   PFITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF---  542
              FIT+ G+ A  T + W D               +S +  V +  FV + +T  NT    
Sbjct  137   AFITIEGEGAEKTTVEWGDTAQTPDSKGNPMGTYNSASFAVNSPFFVAKNITFKNTTPVP  196

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK  VALR+S D +A++GCR+   QDTL D  G+HYY +CYIEG VDFIFGNA S
Sbjct  197   LPGAVGKQAVALRISADNAAFFGCRMLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALS  256

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             L+EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TGTG   LGR WGP+SRVV+  
Sbjct  257   LYEGCHVHAIADKLGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGRAWGPFSRVVFAY  316

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             +YM + I P GW +W DP R+ TV+YG+YKC G GA+   RV W+R L+  EAKPF++  
Sbjct  317   TYMDNIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYGGRVAWARELTDEEAKPFLSLT  376

Query  1074  MIEGQEWLR  1100
              I+G EW++
Sbjct  377   FIDGSEWIK  385



>ref|XP_004969916.1| PREDICTED: probable pectinesterase 53-like [Setaria italica]
Length=403

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/299 (48%), Positives = 187/299 (63%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L++      GD+  IQ AIDS+P+ N   V I V  GTY EKV +   + FITL G  A 
Sbjct  104   LVVDKNPAFGDFTTIQAAIDSLPAINLVRVVIRVNAGTYTEKVTISAMRAFITLEGAGAD  163

Query  435   NTVITWSDGGD-----------IIHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GV  563
             +T++ W D  D             +S T  V A  F+ R +T  NT      G +GK  V
Sbjct  164   STIVQWGDTADSPTGPKGRPLGTFNSATFAVNAQYFLARNITFKNTSPVPKPGATGKQAV  223

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALRVS D +A+ GC+    QDTL D +G+HYY  CYIEG VDFIFGNA SL+E C +H+I
Sbjct  224   ALRVSADNAAFVGCKFLGAQDTLYDHSGRHYYKECYIEGSVDFIFGNALSLYEDCHVHAI  283

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A   GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +YM + I P 
Sbjct  284   ARDYGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIIIPR  343

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   I+G EW+R
Sbjct  344   GWYNWGDPNRELTVFYGQYKCTGPGASYAGRVAWSRELTDDEAKPFISLSFIDGTEWVR  402



>gb|KHG26932.1| putative pectinesterase 53 -like protein [Gossypium arboreum]
Length=378

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/301 (48%), Positives = 190/301 (63%), Gaps = 23/301 (8%)
 Frame = +3

Query  258   IIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             I VD++  +GD+ KIQDAIDS+P  N   V I V  G Y EKV +P  K FIT+ G  A 
Sbjct  80    ITVDKNPKYGDFTKIQDAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKAFITIEGAGAD  139

Query  435   NTVITWSDGGDIIHSP-------------TLTVFASDFVGRYLTIMNTF-----GRSGK-  557
              T++ W   GD   +P             T  V +  F+ +++T  NT      G  GK 
Sbjct  140   KTIVQW---GDTAQTPGARGQPLGTYGSATFAVNSPYFIAKHITFKNTAPIPAPGAIGKQ  196

Query  558   GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIH  737
              VA R+S D + + GCR    QDTL D  G+HYY +CYIEG VDFIFGNA SLFEGC +H
Sbjct  197   AVAFRISADTATFVGCRFLGAQDTLYDHFGRHYYKDCYIEGSVDFIFGNALSLFEGCHVH  256

Query  738   SIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQ  917
             +IA   GA+TAQ R S  ++TGF+F+ CK+TG+G   LGR WGP+SRVV+  +YM + I 
Sbjct  257   AIARLTGAVTAQNRGSILDDTGFSFVKCKVTGSGALYLGRAWGPFSRVVFAYTYMDNIIL  316

Query  918   PEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   I+G EW+
Sbjct  317   PKGWYNWGDPNREMTVFYGQYKCTGPGASFAGRVSWSRELTDEEAKPFISLSFIDGSEWI  376

Query  1098  R  1100
             +
Sbjct  377   K  377



>ref|XP_004503496.1| PREDICTED: probable pectinesterase 53-like [Cicer arietinum]
Length=385

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 188/309 (61%), Gaps = 18/309 (6%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +  QSG G +  IQ AIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  74    KNKLFPSYTLNVYKQSGKGGFSSIQAAIDSLPFINLVRVVIKVHAGVYTEKVNIPALKAF  133

Query  408   ITLSGDDASNTVITWSDGGDIIH------------SPTLTVFASDFVGRYLTIMNTF---  542
             IT+ G  A  T++ W D     +            S T  V +  F+ + +T  NT    
Sbjct  134   ITIEGAGADKTIVQWGDTAQTPNPAAKGQTLGTYGSATFAVNSPYFIAKNMTFKNTAPVP  193

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK  VALR+S D + + GC+    QDTL D  G+HYY +CYIEG VDFIFGNA S
Sbjct  194   APGAVGKQAVALRISADTAIFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALS  253

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             LFEGC +H+IA+  GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  
Sbjct  254   LFEGCHVHAIAINTGALTAQGRSSLLEDTGFSFVHCKVTGSGALYLGRAWGPFSRVVFAY  313

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             +YM + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++  
Sbjct  314   TYMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVSWSRELTDEEAKPFISLS  373

Query  1074  MIEGQEWLR  1100
              I+G EW+ 
Sbjct  374   YIDGSEWIN  382



>ref|XP_008387348.1| PREDICTED: probable pectinesterase 53 [Malus domestica]
Length=382

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 186/310 (60%), Gaps = 17/310 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
               K K + ++ L +      GD+ KIQDAIDS+P  N   V I V  G Y EKV +P  K
Sbjct  72    AAKNKLSPSSTLHVAKNPNAGDFTKIQDAIDSLPFINLVRVVIKVHAGIYTEKVNIPPLK  131

Query  402   PFITLSGDDASNTVITWSDGGDI-----------IHSPTLTVFASDFVGRYLTIMNTF--  542
              FIT+ G  A  T++ W D                +S T  V +  F+ R +T  NT   
Sbjct  132   SFITIEGAGADKTIVQWGDTAQTPSGPKKQPMGTFNSATFAVNSPYFIARNITFKNTTPV  191

Query  543   ---GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAA  710
                G  GK  VA R+S D + ++GC     QDTL D  G+HYY +CYIEG VDFIFGN  
Sbjct  192   PKPGAIGKQAVAFRISADTATFWGCSFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGL  251

Query  711   SLFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWV  890
             SLFEGC +H+IA   GA+TAQ R S  E TGF+F+ CK+TG+G   LGR WGP+SRVV+ 
Sbjct  252   SLFEGCHVHAIAQNIGALTAQGRSSMLEETGFSFVNCKVTGSGALYLGRAWGPFSRVVFA  311

Query  891   SSYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
              +YM   I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++ 
Sbjct  312   YTYMDDIIIPKGWYNWGDPNREMTVFYGQYKCTGPGARFAGRVSWSRELTDEEAKPFISL  371

Query  1071  KMIEGQEWLR  1100
               I+G EW++
Sbjct  372   TFIDGSEWIK  381



>ref|XP_008804057.1| PREDICTED: probable pectinesterase 53 [Phoenix dactylifera]
Length=380

 Score =   285 bits (729),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 146/307 (48%), Positives = 191/307 (62%), Gaps = 17/307 (6%)
 Frame = +3

Query  231   LKQTSTAVLIIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             L +   +  + VD++   GD+  IQ+AIDS+PS N   V I V  G Y+EKV +   + F
Sbjct  73    LNKVIPSYTLTVDKNPSKGDFSSIQNAIDSLPSVNLVRVMIKVHAGIYKEKVNISPARAF  132

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  TV+ W D  D            +S T  V A  F+ + +T  NT      
Sbjct  133   ITIEGAGADETVVQWGDTADTPGPKGQPMGTFNSATFAVNAPYFIAKNITFKNTTPIPPP  192

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VALR+SGD +A  GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLF
Sbjct  193   GAMGKQAVALRISGDTAAILGCKFLGGQDTLYDHVGRHYYKDCYIEGSVDFIFGNALSLF  252

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WG +SRVV+  +Y
Sbjct  253   EGCHVHAIAQNYGAVTAQNRMSLLEDTGFSFVNCKVTGSGALYLGRAWGTFSRVVFAYTY  312

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M   I P GW +W DP R+ TV+YG+YKC GPGA+   RV WSR L++ EAKPF++   I
Sbjct  313   MDDIIIPRGWYNWGDPSREMTVFYGQYKCSGPGANYVGRVSWSRELTEEEAKPFISLSFI  372

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  373   DGTEWIK  379



>emb|CDY42290.1| BnaC02g08960D [Brassica napus]
Length=382

 Score =   285 bits (729),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/309 (46%), Positives = 190/309 (61%), Gaps = 16/309 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
               K K   +  L +      GD+  IQDAIDS+P  N   V I    G Y+EKV +P  K
Sbjct  73    AAKNKLFPSYTLTVHKNQNKGDFTNIQDAIDSLPLINLVRVVIKFHAGVYKEKVNIPPMK  132

Query  402   PFITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF---  542
              F+T+ G+ A  T++ W D               +S +  V +  FV + +T  NT    
Sbjct  133   SFVTIEGEGAETTIVEWGDTAQTPDTKGNSMGTFNSASFAVNSPFFVAKNITFKNTTPVP  192

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK  VALRVS D +A++GC++   QDTL D +G+HYY +CYIEG VDFIFGNA S
Sbjct  193   LPGAVGKQAVALRVSADNAAFFGCKMLGAQDTLYDHSGRHYYKDCYIEGSVDFIFGNALS  252

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             L+EGC +H+IA   GA+TAQ R S  E+TGF+F+ C +TGTG   LGR WGP+SRVV+  
Sbjct  253   LYEGCHVHAIADKLGAVTAQGRSSMLEDTGFSFVNCMVTGTGVLYLGRAWGPFSRVVFAY  312

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             SYM + I P GW +W DP R+ TV+YG+YKC G GA+ + RV W++ L+  EAKPF++  
Sbjct  313   SYMDNIILPRGWYNWGDPSRETTVFYGQYKCTGEGANYAGRVAWAKELTDEEAKPFISLT  372

Query  1074  MIEGQEWLR  1100
              I+G EW++
Sbjct  373   FIDGSEWIK  381



>ref|XP_003567104.1| PREDICTED: probable pectinesterase 53 isoform X2 [Brachypodium 
distachyon]
Length=389

 Score =   285 bits (729),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/299 (48%), Positives = 184/299 (62%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L++      GD+  IQ A+DS+P  N   V I V  GTY EKV +   + FITL G  A 
Sbjct  90    LVVDKNPSSGDFTSIQAAVDSLPPINLVRVVIKVNAGTYTEKVNISPMRAFITLEGAGAD  149

Query  435   NTVITWSDGGDIIHSP-----------TLTVFASDFVGRYLTIMNT-----FGRSGK-GV  563
              TV+ W D  D    P           +  V A  F+ R +T  NT      G SGK  V
Sbjct  150   RTVVQWGDTADTPAGPRGRPLGTYGSASFAVNAQYFLARNITFKNTSPVPKAGASGKQAV  209

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALRVS D +A+ GC+    QDTL D  G+HYY +CYIEG +DFIFGNA SL+EGC +H+I
Sbjct  210   ALRVSADNAAFVGCKFLGAQDTLYDHTGRHYYKDCYIEGSIDFIFGNALSLYEGCHVHAI  269

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A   GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +YM   I P 
Sbjct  270   ARDYGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTYMDDIIIPR  329

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW +W DP R+ TV+YG+YKC GPGA  S RV WSR L+  EAKPF++   I+G EW+R
Sbjct  330   GWYNWGDPSRELTVFYGQYKCTGPGASYSGRVSWSRELTDEEAKPFISLSFIDGTEWVR  388



>ref|XP_009126386.1| PREDICTED: probable pectinesterase 53 [Brassica rapa]
Length=382

 Score =   285 bits (729),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 139/298 (47%), Positives = 189/298 (63%), Gaps = 16/298 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L +      GD+  IQDAIDS+P  N   V I V  G ++EKV +P  K F+T+ G+ A 
Sbjct  84    LTVHKNQNKGDFTNIQDAIDSLPLINLVRVVIKVHAGVFKEKVNIPPMKSFVTIEGEGAE  143

Query  435   NTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVA  566
              T++ W D               +S +  V +  FV + +T  NT      G  GK  VA
Sbjct  144   TTIVEWGDTAQTPDTKGNPMGTFNSASFAVNSPFFVAKNITFKNTTPVPLPGAVGKQAVA  203

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LRVS D +A++GC++   QDTL D +G+HYY +CYIEG VDFIFGNA SL+EGC +H+IA
Sbjct  204   LRVSADNAAFFGCKMLGAQDTLYDHSGRHYYKDCYIEGSVDFIFGNALSLYEGCHVHAIA  263

Query  747   VGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEG  926
                GA+TAQ R S  E+TGF+F+ CK+TGTG   LGR WGP+SRVV+  +YM + I P G
Sbjct  264   DKLGAVTAQGRGSVLEDTGFSFVNCKVTGTGVLYLGRAWGPFSRVVFAYTYMDNIILPRG  323

Query  927   WNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             W +W DP R+ TV+YG+YKC G GA+ + RV W++ L+  EAKPF++   I+G EW++
Sbjct  324   WYNWGDPSREMTVFYGQYKCTGEGANYAGRVAWAKELTDDEAKPFISLTFIDGSEWIK  381



>ref|XP_007204399.1| hypothetical protein PRUPE_ppa007112mg [Prunus persica]
 gb|EMJ05598.1| hypothetical protein PRUPE_ppa007112mg [Prunus persica]
Length=381

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 184/308 (60%), Gaps = 17/308 (6%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+  IQDAIDS+P  N   V I V  G Y EKV +P  K +
Sbjct  73    KNKLFPSYTLHVAKNRAAGDFTTIQDAIDSLPFINLLRVVIKVHAGVYTEKVNIPPLKSY  132

Query  408   ITLSGDDASNTVITWSDGGDIIHSP-----------TLTVFASDFVGRYLTIMNTF----  542
             IT+ G  A  T++ W D       P           T  V +  F+ R +T  NT     
Sbjct  133   ITIEGAGADKTIVQWGDTAQTPSGPKKQPMGTYNSATFAVNSPYFIARNITFKNTTPVPA  192

Query  543   -GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              G  GK  VA R+S D +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGN  SL
Sbjct  193   PGAIGKQAVAFRISADTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSL  252

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             FEGC +H+IA   GA+TAQ R S  E TGF+F+ CK+TG+G   LGR WGP+SRVV+  +
Sbjct  253   FEGCHVHAIAQNIGALTAQGRSSLLEETGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYT  312

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             YM + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   
Sbjct  313   YMDNIIMPKGWYNWGDPNREMTVFYGQYKCTGPGARFAGRVSWSRELTDEEAKPFISLTF  372

Query  1077  IEGQEWLR  1100
             I+G EW++
Sbjct  373   IDGSEWIK  380



>ref|XP_002964788.1| hypothetical protein SELMODRAFT_83442 [Selaginella moellendorffii]
 gb|EFJ33626.1| hypothetical protein SELMODRAFT_83442 [Selaginella moellendorffii]
Length=329

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/298 (46%), Positives = 185/298 (62%), Gaps = 15/298 (5%)
 Frame = +3

Query  255   LIIVDQSG------HGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
              ++VDQS        G +  IQ AID+VP  N   V I V  G Y+EK+ +P  KP+I L
Sbjct  31    FLVVDQSSLLSSQTAGVFRSIQAAIDAVPVGNQHWVIIQVGAGVYQEKITIPYMKPYILL  90

Query  417   SGDDASNTVITWSDGGDII---HSPTLTVFASDFVGRYLTIMNTFGRSGKG------VAL  569
              G     T I+WSD        +S T + FA +F+ +Y++  N   R   G      VA+
Sbjct  91    QGAGRDFTTISWSDSASTFGTANSATFSAFAPNFIAKYISFRNNAPRPPPGAFNRQAVAV  150

Query  570   RVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV  749
              V+GD +A+Y C     QDTL D  G+HY+ +CYIEG +DFIFG+A S+F+ CE+H+IA 
Sbjct  151   LVAGDMAAFYSCGFYGAQDTLFDYEGRHYFRDCYIEGSIDFIFGHAKSVFKACELHAIAD  210

Query  750   GGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGW  929
               G++TAQ R    EN+GF F+ C +TG+GT  LGR WG YSRVV++ +YM S +  EGW
Sbjct  211   SFGSVTAQNRGDPRENSGFIFIACTVTGSGTIFLGRAWGAYSRVVYLFTYMDSNVVSEGW  270

Query  930   NDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQ  1103
             NDW    RQ+TVYYG+YKC+GPGA+   RV WS  L+  EA+PF+    I+G +WLR+
Sbjct  271   NDWGVASRQQTVYYGQYKCFGPGANELGRVRWSHELTDEEARPFLQVNFIDGVQWLRE  328



>ref|NP_001044216.1| Os01g0743200 [Oryza sativa Japonica Group]
 dbj|BAB91933.1| pectin methyl esterase-like [Oryza sativa Japonica Group]
 dbj|BAF06130.1| Os01g0743200 [Oryza sativa Japonica Group]
 gb|EAY75779.1| hypothetical protein OsI_03695 [Oryza sativa Indica Group]
 gb|EAZ13496.1| hypothetical protein OsJ_03413 [Oryza sativa Japonica Group]
 dbj|BAG93545.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97491.1| unnamed protein product [Oryza sativa Japonica Group]
Length=384

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 183/299 (61%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L++      GD+  IQ A+DS+P  N   V I V  GTY EKV +   + FITL G  A 
Sbjct  85    LVVDKNPAFGDFTTIQAAVDSLPIINLVRVVIKVNAGTYTEKVNISPMRAFITLEGAGAD  144

Query  435   NTVITWSDGGD-----------IIHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GV  563
              T++ W D  D              S +  V A  F+ R +T  NT      G SGK  V
Sbjct  145   KTIVQWGDTADSPSGRAGRPLGTYSSASFAVNAQYFLARNITFKNTSPVPKPGASGKQAV  204

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALRVS D +A+ GCR    QDTL D +G+HYY  CYIEG VDFIFGNA SLFE C +H+I
Sbjct  205   ALRVSADNAAFVGCRFLGAQDTLYDHSGRHYYKECYIEGSVDFIFGNALSLFEDCHVHAI  264

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A   GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +YM   I P 
Sbjct  265   ARDYGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTYMDDIIIPR  324

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW +W DP R+ TV+YG+YKC GPGA  S RV WSR L+  EAKPF++   I+G EW+R
Sbjct  325   GWYNWGDPNRELTVFYGQYKCTGPGASFSGRVSWSRELTDEEAKPFISLTFIDGTEWVR  383



>ref|XP_009406173.1| PREDICTED: probable pectinesterase 53 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 192/310 (62%), Gaps = 17/310 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGH-GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVD  398
             G  L +   +  + VD++   GD+  IQ+A+DS+P  N   V I V  GTY EKV V   
Sbjct  67    GRALNKAFPSYTLTVDKNPSVGDFTTIQEAVDSLPLINLVRVVIKVNAGTYTEKVNVSPM  126

Query  399   KPFITLSGDDASNTVITWSDGGDII----------HSPTLTVFASDFVGRYLTIMNTF--  542
             + FIT+ G  A  TV+ W D  + +          +S T  V A  F+ R +T  NT   
Sbjct  127   RAFITIQGAGADKTVVQWGDTAETLGPKKQPIGTFNSATFAVNAPYFIARNITFKNTTPV  186

Query  543   ---GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAA  710
                G  GK  V+LR+SGD +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGNA 
Sbjct  187   PPPGAMGKQAVSLRISGDTAAFVGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNAL  246

Query  711   SLFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWV  890
             SL+EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WG +SRV++ 
Sbjct  247   SLYEGCHVHAIAQNYGALTAQNRMSLLEDTGFSFVNCKVTGSGALYLGRAWGTFSRVIFA  306

Query  891   SSYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
              +YM   I P GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++ 
Sbjct  307   YTYMDDIILPRGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVSWSRELTDEEAKPFISM  366

Query  1071  KMIEGQEWLR  1100
               I+G EW++
Sbjct  367   SFIDGSEWIK  376



>ref|XP_004251642.1| PREDICTED: probable pectinesterase 53 [Solanum lycopersicum]
Length=378

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 189/307 (62%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  LI+     HGD+  IQ+AIDS+P  N   V I +  G Y EKV +P  K F
Sbjct  71    KNKLFPSYTLIVDKNPSHGDFTSIQEAIDSLPFINLIRVVIKIHAGIYTEKVNIPPFKSF  130

Query  408   ITLSGDDASNTVITWSDGGDIIH----------SPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G+ A NT+I + D    I           S T  V +  F  + +T  NT      
Sbjct  131   ITIEGEGADNTIIQYGDTAQTIGPNGKPLGTFGSATFAVNSPYFQAKNITFKNTTPVPPP  190

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGN  S F
Sbjct  191   GAIGKQAVAFRISADTAAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSFF  250

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRV++  +Y
Sbjct  251   EGCHLHAIAQVTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVIFAYTY  310

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW++W DP R+ TV+YG+YKC GPGA  + RV W R L++ EAKPF++   I
Sbjct  311   MDNIIIPKGWHNWGDPLREMTVFYGQYKCSGPGASFAGRVSWCRELTEQEAKPFISLSFI  370

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  371   DGSEWIK  377



>ref|XP_004961453.1| PREDICTED: probable pectinesterase 53-like isoform X2 [Setaria 
italica]
Length=401

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/301 (48%), Positives = 192/301 (64%), Gaps = 17/301 (6%)
 Frame = +3

Query  249   AVLIIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGD  425
             A  ++VD++ G GD+  IQ A+DS+P  N   V I V  GTY EKV +   + F+T+ G 
Sbjct  100   ARTLVVDKTPGAGDFTSIQAAVDSLPLINLARVVIKVNAGTYTEKVNISPMRAFVTVEGA  159

Query  426   DASNTVITWSDGGDIIHS----------PTLTVFASDFVGRYLTIMNTF-----GRSGK-  557
              A  TV+ W D  D + S           T  V +  FV + +T  NT      G  GK 
Sbjct  160   GADKTVVQWGDTADTVGSWGRAMGTFGSATFAVNSMFFVAKNITFKNTAPMPKPGALGKQ  219

Query  558   GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIH  737
             GVALR+S D +A+ GC     QDTL D  G+HYY +CYIEG +DFIFGNA SL+EGC +H
Sbjct  220   GVALRISADNAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSIDFIFGNALSLYEGCHVH  279

Query  738   SIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQ  917
             +IA   GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +YM + I 
Sbjct  280   AIARNYGALTAQNRQSLLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIII  339

Query  918   PEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             P GW +W DP R+ TV+YG+YKC GPGA+ + RV+WSR L+  EAKPF++   I+G EWL
Sbjct  340   PRGWYNWGDPTREMTVFYGQYKCTGPGANYAGRVQWSRELTDEEAKPFISLDFIDGLEWL  399

Query  1098  R  1100
             +
Sbjct  400   K  400



>ref|XP_006451320.1| hypothetical protein CICLE_v10010616mg, partial [Citrus clementina]
 gb|ESR64560.1| hypothetical protein CICLE_v10010616mg, partial [Citrus clementina]
Length=359

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/298 (48%), Positives = 186/298 (62%), Gaps = 16/298 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L +      GD+ KIQDAIDS+P  N   V I V  G Y+EKV +P  K FIT+ G  A 
Sbjct  61    LTVAKNPAAGDFTKIQDAIDSLPFINLVRVVIKVHAGVYKEKVNIPPFKSFITIEGAGAD  120

Query  435   NTVITWSDG-------GDII---HSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVA  566
              T++ W D        G  I    S T  V A  F+ + +T  NT      G  GK  VA
Sbjct  121   KTIVQWGDTAQTRGPRGQPIGTWASATFAVNAPYFIAKNITFKNTTPVPAPGAVGKQAVA  180

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
              R+S D + ++GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLFEGC +H+IA
Sbjct  181   FRISADTATFWGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIA  240

Query  747   VGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEG  926
                GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  + M + I P+G
Sbjct  241   QYTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTDMDNIIIPKG  300

Query  927   WNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             W +W DP R+ TV+YG+YKC GPGA  + RV W+R L+  EAKPF++   I+G EW++
Sbjct  301   WYNWGDPNREMTVFYGQYKCKGPGASFAGRVSWARELTDEEAKPFISLSFIDGSEWIK  358



>ref|XP_002968924.1| hypothetical protein SELMODRAFT_65663, partial [Selaginella moellendorffii]
 ref|XP_002989971.1| hypothetical protein SELMODRAFT_45575, partial [Selaginella moellendorffii]
 gb|EFJ08984.1| hypothetical protein SELMODRAFT_45575, partial [Selaginella moellendorffii]
 gb|EFJ30040.1| hypothetical protein SELMODRAFT_65663, partial [Selaginella moellendorffii]
Length=292

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 191/294 (65%), Gaps = 15/294 (5%)
 Frame = +3

Query  258   IIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASN  437
             ++VDQ G+GD+  +Q+AID+VP  N+  + I V PG Y+EKV +   KP+ITL G  A  
Sbjct  1     VVVDQDGNGDHASVQEAIDAVPVNNTVPITIFVSPGVYQEKVKIVESKPYITLQGSGADL  60

Query  438   TVITWSD-----GGD-----IIHSPTLTVFASDFVGRYLTIMNTFGRSGKG---VALRVS  578
             T I W D     G D       H+ T+ V A  F  R +T  N+      G   VA +++
Sbjct  61    TTIVWDDYAGKLGVDGSHLGTFHTATVHVSAPYFSARGITFKNSAPVQPAGSQAVAFQIT  120

Query  579   GDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGG  758
             GD +A+Y C     QDTL D +G+HY+ +C+I+G VDFIFGN  SL++ CE++  A+G G
Sbjct  121   GDMAAFYECNFIGAQDTLYDHSGRHYFKSCFIQGSVDFIFGNGRSLYKDCELN--AIGSG  178

Query  759   AITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDW  938
             A+TAQ+R++A +NTGF+F+ C+I G G   LGR WGP+SRVV++  YM S I P GW+DW
Sbjct  179   ALTAQKRQNASDNTGFSFVNCRILGNGLVYLGRAWGPFSRVVFLYCYMDSVINPGGWDDW  238

Query  939   DDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
              D  R  TV+YGE+ C GPGA+  +RV WS  L++AEA+PF+ ++ IEG  WL+
Sbjct  239   GDSSRDMTVFYGEFNCTGPGANGMRRVPWSYVLTEAEAQPFLDERFIEGDAWLQ  292



>ref|XP_008242479.1| PREDICTED: probable pectinesterase 53 [Prunus mume]
Length=381

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 184/308 (60%), Gaps = 17/308 (6%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+  IQDAIDS+P  N   V I V  G Y EKV +P  K +
Sbjct  73    KNKLFPSYTLHVAKNRAAGDFTTIQDAIDSLPFINLLRVVIKVHAGVYTEKVNIPPLKSY  132

Query  408   ITLSGDDASNTVITWSDGGDIIHSP-----------TLTVFASDFVGRYLTIMNTF----  542
             IT+ G  A  T++ W D       P           T  V +  F+ + +T  NT     
Sbjct  133   ITIEGAGADKTIVQWGDTAQTPSGPKKQPMGTYNSATFAVNSPYFIAKNITFKNTTPVPA  192

Query  543   -GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              G  GK  VA R+S D +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGN  SL
Sbjct  193   PGAIGKQAVAFRISADTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSL  252

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             FEGC +H+IA   GA+TAQ R S  E TGF+F+ CK+TG+G   LGR WGP+SRVV+  +
Sbjct  253   FEGCHVHAIAQNIGALTAQGRSSLLEETGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYT  312

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             YM + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   
Sbjct  313   YMDNIIMPKGWYNWGDPNREMTVFYGQYKCTGPGARFAGRVSWSRELTDEEAKPFISLTF  372

Query  1077  IEGQEWLR  1100
             I+G EW++
Sbjct  373   IDGSEWIK  380



>ref|XP_004135808.1| PREDICTED: probable pectinesterase 53-like, partial [Cucumis 
sativus]
Length=393

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 186/307 (61%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+  IQDAIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  86    KNKLFPSFTLHVAKNPASGDFTSIQDAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSF  145

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T+I W D               +S T  V +  F+ + +T  NT      
Sbjct  146   ITIEGAGAEKTIIQWGDTAQTPGSNGQPMGTYNSATFAVNSPYFIAKNITFKNTTPVPAP  205

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D +A++GCR    QDTL D  G+HYY +CYIEG VDFIFGN  SLF
Sbjct  206   GAIGKQAVAFRISADTAAFFGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLF  265

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  266   EGCHVHAIAQYTGALTAQGRSSLLEDTGFSFVKCKVTGSGALYLGRAWGPFSRVVFAYTY  325

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP R+ TV+YG+YKC G GA  + RV WSR L+  EAKPF++   I
Sbjct  326   MDNIIIPKGWYNWGDPNREMTVFYGQYKCTGDGASFAGRVSWSRELTDEEAKPFISLTFI  385

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  386   DGSEWIK  392



>ref|XP_010049610.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase 53 [Eucalyptus 
grandis]
Length=383

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 189/308 (61%), Gaps = 16/308 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K + +  L +     +GD+  IQDAIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  76    KNKLSPSYTLTVDKNPAYGDFTSIQDAIDSLPFINLVRVVIKVHAGVYTEKVSIPQLKSF  135

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A+ T++ W D  D             S T  V +  F+ + +T  NT      
Sbjct  136   ITIEGAGAAKTIVQWGDRADTPGPKGQHMGTYGSATFGVNSPFFIAKNITFKNTTPVPKP  195

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D +A++GC     QDTL D  G+HYY +CYIEG VDFIFGN  SLF
Sbjct  196   GAVGKQAVAFRISADTAAFWGCSFLGAQDTLYDHFGRHYYKDCYIEGSVDFIFGNGLSLF  255

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             E C++H+IA   GA+TAQ R S  E+TGF+FL CK+TG+G   LGR WGP+SRVV+  ++
Sbjct  256   ESCQVHAIASXVGALTAQGRSSMLEDTGFSFLKCKVTGSGALYLGRAWGPFSRVVFAYTW  315

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M   I P+GW++W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   I
Sbjct  316   MDDIIIPKGWSNWGDPGREMTVFYGQYKCIGPGASFAGRVSWSRELTDEEAKPFLSLSFI  375

Query  1080  EGQEWLRQ  1103
             +G EW++ 
Sbjct  376   DGSEWIKM  383



>ref|XP_002961718.1| hypothetical protein SELMODRAFT_76693 [Selaginella moellendorffii]
 gb|EFJ36978.1| hypothetical protein SELMODRAFT_76693 [Selaginella moellendorffii]
Length=329

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/298 (46%), Positives = 184/298 (62%), Gaps = 15/298 (5%)
 Frame = +3

Query  255   LIIVDQSG------HGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
              ++VDQS        G +  IQ AID+VP  N   V I V  G Y+EK+ +P  KP+I L
Sbjct  31    FLVVDQSSLLSSQTTGVFRSIQAAIDAVPVGNQHWVIIQVGAGVYQEKITIPYMKPYILL  90

Query  417   SGDDASNTVITWSDGGDII---HSPTLTVFASDFVGRYLTIMNTFGRSGKG------VAL  569
              G     T I+WSD        +S T + FA +F+ +Y++  N   R   G      VA+
Sbjct  91    QGAGRDFTTISWSDTASTFGTANSATFSAFAPNFIAKYISFRNNAPRPPPGAFNRQAVAV  150

Query  570   RVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV  749
              V+GD +A+Y C     QDTL D  G+HY+ +CYIEG +DFIFG+A S+F+ CE+H+IA 
Sbjct  151   LVAGDMAAFYSCGFYGAQDTLFDYEGRHYFRDCYIEGSIDFIFGHAKSVFKACELHAIAD  210

Query  750   GGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGW  929
               G++TAQ R    EN+GF F+ C +TG+GT  LGR WG YSRVV++ +YM S +  EGW
Sbjct  211   SFGSVTAQNRGDPRENSGFIFIACTVTGSGTIFLGRAWGAYSRVVYLFTYMDSNVVSEGW  270

Query  930   NDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQ  1103
             NDW    RQ TVYYG+YKC+GPGA+   RV WS  L+  EA+PF+    I+G +WLR+
Sbjct  271   NDWGVASRQETVYYGQYKCFGPGANELGRVRWSHELTDEEARPFLQVNFIDGVQWLRE  328



>ref|XP_008450789.1| PREDICTED: probable pectinesterase 53 [Cucumis melo]
Length=387

 Score =   283 bits (724),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 186/307 (61%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+  IQDAIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  80    KNKLFPSFTLHVAKNPAAGDFTSIQDAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSF  139

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T+I W D               +S T  V +  F+ + +T  NT      
Sbjct  140   ITIEGAGAEKTIIQWGDTAQTPGSNGQPMGTYNSATFAVNSPYFIAKNITFKNTTPVPAP  199

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D +A++GCR    QDTL D  G+HYY +CYIEG VDFIFGN  SLF
Sbjct  200   GAIGKQAVAFRISADTAAFFGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLF  259

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  260   EGCHVHAIAQYTGALTAQGRSSLLEDTGFSFVKCKVTGSGALYLGRAWGPFSRVVFAYTY  319

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP R+ TV+YG+YKC G GA  + RV WSR L+  EAKPF++   I
Sbjct  320   MDNIIIPKGWYNWGDPNREMTVFYGQYKCTGGGASFAGRVSWSRELTDEEAKPFISLTFI  379

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  380   DGSEWIK  386



>gb|KGN66185.1| hypothetical protein Csa_1G575010 [Cucumis sativus]
Length=386

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 186/307 (61%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+  IQDAIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  79    KNKLFPSFTLHVAKNPASGDFTSIQDAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSF  138

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T+I W D               +S T  V +  F+ + +T  NT      
Sbjct  139   ITIEGAGAEKTIIQWGDTAQTPGSNGQPMGTYNSATFAVNSPYFIAKNITFKNTTPVPAP  198

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D +A++GCR    QDTL D  G+HYY +CYIEG VDFIFGN  SLF
Sbjct  199   GAIGKQAVAFRISADTAAFFGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLF  258

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  259   EGCHVHAIAQYTGALTAQGRSSLLEDTGFSFVKCKVTGSGALYLGRAWGPFSRVVFAYTY  318

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP R+ TV+YG+YKC G GA  + RV WSR L+  EAKPF++   I
Sbjct  319   MDNIIIPKGWYNWGDPNREMTVFYGQYKCTGDGASFAGRVSWSRELTDEEAKPFISLTFI  378

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  379   DGSEWIK  385



>ref|XP_004158420.1| PREDICTED: probable pectinesterase 53-like [Cucumis sativus]
Length=387

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 186/307 (61%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+  IQDAIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  80    KNKLFPSFTLHVAKNPASGDFTSIQDAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSF  139

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T+I W D               +S T  V +  F+ + +T  NT      
Sbjct  140   ITIEGAGAEKTIIQWGDTAQTPGSNGQPMGTYNSATFAVNSPYFIAKNITFKNTTPVPAP  199

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D +A++GCR    QDTL D  G+HYY +CYIEG VDFIFGN  SLF
Sbjct  200   GAIGKQAVAFRISADTAAFFGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLF  259

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  260   EGCHVHAIAQYTGALTAQGRSSLLEDTGFSFVKCKVTGSGALYLGRAWGPFSRVVFAYTY  319

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP R+ TV+YG+YKC G GA  + RV WSR L+  EAKPF++   I
Sbjct  320   MDNIIIPKGWYNWGDPNREMTVFYGQYKCTGDGASFAGRVSWSRELTDEEAKPFISLTFI  379

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  380   DGSEWIK  386



>ref|XP_008337605.1| PREDICTED: probable pectinesterase 53 [Malus domestica]
Length=382

 Score =   283 bits (723),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 185/308 (60%), Gaps = 17/308 (6%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      G + KIQ AIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  74    KNKLFPSFTLHVAKNPNAGHFTKIQAAIDSLPFINLVRVVIKVHAGVYXEKVNIPPLKSF  133

Query  408   ITLSGDDASNTVITWSDGGDI-----------IHSPTLTVFASDFVGRYLTIMNTF----  542
             IT+ G  A  T++ W D                +S T  V +  F+ + +T  NT     
Sbjct  134   ITIEGAGADKTIVQWGDTAQTPSGPKKQPMGTFNSATFAVNSPYFIAKNITFKNTXPVPK  193

Query  543   -GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              G  GK  VA R+S D +++ GCR    QDTL D  G+HYY +CYIEG VDFIFGN  SL
Sbjct  194   PGAIGKQAVAFRISADTASFXGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSL  253

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             FEGC +H+IA   GA+TAQ R S  E TGF+F+ CK+TG+G   LGR WGP+SRVV+  +
Sbjct  254   FEGCHVHAIAQNIGALTAQGRSSMLEETGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYT  313

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             YM + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+K EAKPF++   
Sbjct  314   YMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGPGARFAGRVSWSRELTKEEAKPFISLTF  373

Query  1077  IEGQEWLR  1100
             I+G EW++
Sbjct  374   IDGSEWIK  381



>ref|XP_002976448.1| hypothetical protein SELMODRAFT_104861 [Selaginella moellendorffii]
 gb|EFJ22708.1| hypothetical protein SELMODRAFT_104861 [Selaginella moellendorffii]
Length=362

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 192/301 (64%), Gaps = 14/301 (5%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             ++ V+ IVDQ G GD+  +QDAID+VP  N   V+I +  GT+ EKV++P  KP+ITL G
Sbjct  32    ASPVVFIVDQKGFGDFRTVQDAIDAVPDYNQVPVHIYINNGTFTEKVLIPHSKPYITLQG  91

Query  423   DDASNTVITWSD----GGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGV------ALR  572
                  T I W+D     G    S +++V A+DFV + L+ +NT    G GV      ALR
Sbjct  92    QGMDLTAIAWNDTANSSGRTYSSASVSVEAADFVAKNLSFLNTSPGPGVGVQGAQAVALR  151

Query  573   VSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVG  752
             VS DR+A+YGC    +QDTL D+ G+HY+  C+IEG +DFI G+  SL+E CE+HS+A  
Sbjct  152   VSSDRAAFYGCGFYGFQDTLFDDQGRHYFKECFIEGSIDFICGSGRSLYENCELHSVAKP  211

Query  753   G----GAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQP  920
                  G+ITAQRR    E + F+F+ C ITGTG  +LGR WGP+SRV++  + M S + P
Sbjct  212   SKKVSGSITAQRRLKWSEASAFSFVNCSITGTGNVLLGRAWGPFSRVIFAYTSMDSIVHP  271

Query  921   EGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
              GW+DW D  R  TV YGEY+C G G++R KR  WS SLS  +A P+++   I+G EW+ 
Sbjct  272   VGWDDWGDSGRTLTVVYGEYECSGLGSNRRKRANWSHSLSDWQAYPYLSPLFIDGDEWIP  331

Query  1101  Q  1103
             +
Sbjct  332   E  332



>ref|XP_011093645.1| PREDICTED: probable pectinesterase 53 isoform X2 [Sesamum indicum]
Length=386

 Score =   283 bits (723),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/289 (48%), Positives = 183/289 (63%), Gaps = 16/289 (6%)
 Frame = +3

Query  282   GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWSDG  461
             GD+  IQ A+DS+P  N   V I+V  G Y EKV +P  K FIT+ G  A +T++ W D 
Sbjct  97    GDFTSIQQALDSLPPLNLLRVVINVHAGVYTEKVRIPKLKSFITIEGGGAESTIVEWGDT  156

Query  462   GDI----------IHSPTLTVFASDFVGRYLTIMNT-----FGRSG-KGVALRVSGDRSA  593
                            S T  V A  F+ + +T  NT      G +G + VA R+SGD +A
Sbjct  157   AQTPGPKGRPLGTFASATFAVDAPYFIAKNITFKNTTPVPRAGETGTQAVAFRISGDTAA  216

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             + GC+    QDTL D +G+HYY +CYIEG VDFIFGN  SLFE CE+H++A   GA+TAQ
Sbjct  217   FVGCKFLGAQDTLYDHSGRHYYKDCYIEGSVDFIFGNGLSLFEECEVHAVAAVTGAVTAQ  276

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
              R S  ++TGF+F+ CK+TG+G   LGR WGP+SRVV+  +YM + I P+GW+DW DP R
Sbjct  277   GRSSMLDDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTYMDNIIIPKGWHDWGDPSR  336

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             Q TV+YG+YKC G GA  + RV WSR LS  EAKPF++   I+G EW+ 
Sbjct  337   QLTVFYGQYKCRGAGASFAGRVSWSRELSDEEAKPFISLSFIDGSEWIN  385



>gb|KDP33787.1| hypothetical protein JCGZ_07358 [Jatropha curcas]
Length=383

 Score =   282 bits (722),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 186/307 (61%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+  IQDAIDS+P  N   V I V  G Y+EKV +P  K F
Sbjct  76    KNKLFPSYTLTVDKNPAAGDFTSIQDAIDSLPFINLVRVVIKVHAGVYKEKVNIPPLKSF  135

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T++ W D                S T  V +  F+ + +T  NT      
Sbjct  136   ITIEGAGADKTIVEWGDTAQTPGAKGQPMGTYSSATFAVNSPYFIAKNITFKNTTPVPPP  195

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D +A+ GCR    QDTL D  G+HYY +CYIEG VDFIFGN  SLF
Sbjct  196   GAIGKQAVAFRISADTAAFLGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLF  255

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  256   EGCHVHAIAQYTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTY  315

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   I
Sbjct  316   MDNIIIPKGWYNWGDPTREMTVFYGQYKCTGPGARFAGRVSWSRELTDEEAKPFISLSYI  375

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  376   DGSEWIK  382



>ref|XP_008656475.1| PREDICTED: probable pectinesterase 53 isoform X2 [Zea mays]
Length=396

 Score =   283 bits (723),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 142/298 (48%), Positives = 188/298 (63%), Gaps = 16/298 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L++  + G GD+  IQ A+DS+P  N   V I V  GTY EKV +   + F+T+ G  A 
Sbjct  98    LVVDRRPGAGDFTSIQAAVDSLPLINLARVVIRVNAGTYTEKVNISPMRAFVTVEGAGAD  157

Query  435   NTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVA  566
              TV+ W D  D             S T  V +  FV + +T  NT      G  GK GVA
Sbjct  158   KTVVQWGDTADTAGSWGRPMGTFGSATFAVNSMFFVAKNITFKNTAPVPRPGALGKQGVA  217

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LR+S D +A+ GC     QDTL D  G+HYY +CYIEG VDFIFGNA SL+EGC +H+IA
Sbjct  218   LRISADNAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDFIFGNALSLYEGCHVHAIA  277

Query  747   VGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEG  926
                GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +YM + I P G
Sbjct  278   RNYGALTAQNRQSLLEDTGFSFVKCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIIIPRG  337

Query  927   WNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             W +W DP R+ TV+YG+YKC GPGA+ + RV+WSR L+  EAKPF++   I+G +WLR
Sbjct  338   WYNWGDPTREMTVFYGQYKCTGPGANYAGRVQWSRELTDEEAKPFISLDFIDGFQWLR  395



>ref|XP_008352338.1| PREDICTED: probable pectinesterase 53 [Malus domestica]
Length=382

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 185/308 (60%), Gaps = 17/308 (6%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      G + KIQ AIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  74    KNKLFPSFTLHVAKNPNAGHFTKIQAAIDSLPFINLVRVVIKVHAGVYXEKVNIPPLKSF  133

Query  408   ITLSGDDASNTVITWSDGGDI-----------IHSPTLTVFASDFVGRYLTIMNTF----  542
             IT+ G  A  T++ W D                +S T  V +  F+ + +T  NT     
Sbjct  134   ITIEGAGADKTIVQWGDTAQTPSGPKKQPMGTFNSATFAVNSPYFIAKNITFKNTSPXPK  193

Query  543   -GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              G  GK  VA R+S D +++ GCR    QDTL D  G+HYY +CYIEG VDFIFGN  SL
Sbjct  194   PGAIGKQAVAFRISADTASFLGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSL  253

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             FEGC +H+IA   GA+TAQ R S  E TGF+F+ CK+TG+G   LGR WGP+SRVV+  +
Sbjct  254   FEGCHVHAIAQNIGALTAQGRSSMLEETGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYT  313

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             YM + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+K EAKPF++   
Sbjct  314   YMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGPGARFAGRVSWSRELTKEEAKPFISLTF  373

Query  1077  IEGQEWLR  1100
             I+G EW++
Sbjct  374   IDGSEWIK  381



>ref|XP_007013011.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY30630.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=379

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/307 (47%), Positives = 186/307 (61%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+ KIQDAIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  72    KNKLFPSYTLTVNKNPAAGDFTKIQDAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSF  131

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T++ W D                S T  V +  F+ + +T  NT      
Sbjct  132   ITIEGAGADKTIVQWGDTAQTPGPRGQPLGTFGSATFAVNSPYFIAKNITFKNTTPVPPP  191

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D + + GCR    QDTL D  G+HYY +CYIEG VDFIFGNA SLF
Sbjct  192   GAVGKQAVAFRISADTATFLGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLF  251

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ C +TG+G   LGR WGP+SRVV+  +Y
Sbjct  252   EGCHVHAIARLTGALTAQGRGSILEDTGFSFVNCMVTGSGALYLGRAWGPFSRVVFAYTY  311

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP R+ TV+YG+YKC GPG++ + RV WSR L+  EAKPF++   I
Sbjct  312   MDNIIIPKGWYNWGDPNREMTVFYGQYKCTGPGSNFAGRVSWSRELTDEEAKPFISLGFI  371

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  372   DGSEWIK  378



>ref|XP_007152966.1| hypothetical protein PHAVU_004G175200g [Phaseolus vulgaris]
 gb|ESW24960.1| hypothetical protein PHAVU_004G175200g [Phaseolus vulgaris]
Length=381

 Score =   282 bits (722),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 142/309 (46%), Positives = 189/309 (61%), Gaps = 16/309 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
              VK K  ++  L +      GD+  IQ+AIDS+P  N   V I V  G Y EKV +P  K
Sbjct  72    AVKNKLVASYTLHVDKDPSVGDFTSIQEAIDSLPFINLVRVVIKVHAGVYTEKVNIPAFK  131

Query  402   PFITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF---  542
              +IT+ GD A  T++ WSD                S T  V +  F+ + +T  NT    
Sbjct  132   SYITIEGDGAEETIVKWSDTAQTPGSNGRPLGTYGSATFAVNSPYFIAKNITFQNTTPVP  191

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK  VALR+S D +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGN+ S
Sbjct  192   APGAIGKQAVALRISADTAAFVGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNSLS  251

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             LFEGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  
Sbjct  252   LFEGCHVHAIAQNTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAY  311

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             +YM + I P+GW +W DP R+ TV+YG+YKC G GA  + RV WSR L+  EA PF++  
Sbjct  312   TYMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGAGASFAGRVAWSRELTDEEAIPFLSLG  371

Query  1074  MIEGQEWLR  1100
              ++G EW++
Sbjct  372   FVDGTEWIQ  380



>ref|XP_010915072.1| PREDICTED: probable pectinesterase 53 isoform X1 [Elaeis guineensis]
Length=381

 Score =   282 bits (721),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 191/308 (62%), Gaps = 18/308 (6%)
 Frame = +3

Query  231   LKQTSTAVLIIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             L +   +  + VD++   GD+  IQDAIDS+P  N   V I V  GTY+EKV +   K F
Sbjct  73    LNKVIPSYTLTVDKNPSKGDFTSIQDAIDSLPFVNLVRVVIKVNAGTYKEKVNISPGKAF  132

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  TV+ W D  D            +S T  V A  F+ + +T  NT      
Sbjct  133   ITIEGAGADKTVVQWGDTADTPGPRGQPIGTFNSATFGVNAPYFIAKNITFKNTTPIPPP  192

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VALR+SGD +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLF
Sbjct  193   GAMGKQAVALRISGDTAAFLGCKFLGGQDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLF  252

Query  720   E-GCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             E GC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WG +SRVV+  +
Sbjct  253   EQGCHVHAIAQNYGAVTAQNRMSLLEDTGFSFVNCKVTGSGALYLGRAWGTFSRVVFAYT  312

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             YM   I P GW +W DP R+ TV+YG+YKC GPGA+   RV WSR L+  EAKPF++   
Sbjct  313   YMDDIIIPRGWYNWGDPSREMTVFYGQYKCSGPGANYVGRVSWSRELTDEEAKPFISLSF  372

Query  1077  IEGQEWLR  1100
             I+G EW++
Sbjct  373   IDGTEWVK  380



>ref|XP_002514210.1| Pectinesterase PPE8B precursor, putative [Ricinus communis]
 gb|EEF48164.1| Pectinesterase PPE8B precursor, putative [Ricinus communis]
Length=383

 Score =   282 bits (721),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 187/307 (61%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +     +GD+  IQDAIDS+P  N   V I V  G Y+EKV +P  K F
Sbjct  76    KNKLFPSYTLTVDKNPAYGDFTSIQDAIDSLPFINLVRVVIRVHAGVYKEKVSIPPLKSF  135

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T+I W D               +S T  V +  F+ + +T  NT      
Sbjct  136   ITVEGAGADKTIIQWGDTAQTPGAKGQPMGTYNSATFAVNSPYFIAKNITFKNTTPVPPP  195

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D + + GC+    QDTL D  G+HYY +CYIEG VDFIFGN  SLF
Sbjct  196   GAIGKQAVAFRISADTAVFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLF  255

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  ++TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  256   EGCHVHAIAQYTGALTAQGRSSILDDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTY  315

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   I
Sbjct  316   MDNIIIPKGWYNWGDPTREMTVFYGQYKCTGPGASFAGRVSWSRELTDEEAKPFISLSFI  375

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  376   DGSEWIK  382



>gb|EEC79546.1| hypothetical protein OsI_20666 [Oryza sativa Indica Group]
Length=398

 Score =   282 bits (722),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/301 (47%), Positives = 186/301 (62%), Gaps = 16/301 (5%)
 Frame = +3

Query  246   TAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGD  425
             T  L++      G++  IQ A+DS+P  N   V I V  GTY EKV +   + F+T+ G 
Sbjct  97    TRTLVVDKNPAAGNFTSIQAAVDSIPLINLARVVIKVNAGTYTEKVTISPLRAFVTIEGA  156

Query  426   DASNTVITWSDGGDII----------HSPTLTVFASDFVGRYLTIMNTF-----GRSGK-  557
              A  TV+ W D  D +           S T  V A  FV + +T  NT      G  GK 
Sbjct  157   GADKTVVQWGDTADTVGPLGRPFGTFASATFAVNAQFFVAKNITFKNTAPVPRPGALGKQ  216

Query  558   GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIH  737
             GVALR+S D +A+ GC     QDTL D  G+HYY +CYIEG VDFIFGNA SL+EGC +H
Sbjct  217   GVALRISADNAAFLGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDFIFGNALSLYEGCHVH  276

Query  738   SIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQ  917
             +IA   GA+TAQ R S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +YM + I 
Sbjct  277   AIARNYGALTAQNRMSILEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIII  336

Query  918   PEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             P GW +W DP R+ TV+YG+YKC GPG++ + RV WSR L+  EAKPF++   I+G EW+
Sbjct  337   PRGWYNWGDPTREMTVFYGQYKCTGPGSNYAGRVAWSRELTDQEAKPFISLSFIDGLEWV  396

Query  1098  R  1100
             +
Sbjct  397   K  397



>ref|NP_001056077.1| Os05g0521600 [Oryza sativa Japonica Group]
 gb|AAV59317.1| putative pectin methylesterase [Oryza sativa Japonica Group]
 dbj|BAF17991.1| Os05g0521600 [Oryza sativa Japonica Group]
 dbj|BAG88606.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64406.1| hypothetical protein OsJ_19250 [Oryza sativa Japonica Group]
Length=398

 Score =   282 bits (722),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/301 (47%), Positives = 186/301 (62%), Gaps = 16/301 (5%)
 Frame = +3

Query  246   TAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGD  425
             T  L++      G++  IQ A+DS+P  N   V I V  GTY EKV +   + F+T+ G 
Sbjct  97    TRTLVVDKNPAAGNFTSIQAAVDSIPLINLARVVIKVNAGTYTEKVTISPLRAFVTIEGA  156

Query  426   DASNTVITWSDGGDII----------HSPTLTVFASDFVGRYLTIMNTF-----GRSGK-  557
              A  TV+ W D  D +           S T  V A  FV + +T  NT      G  GK 
Sbjct  157   GADKTVVQWGDTADTVGPLGRPFGTFASATFAVNAQFFVAKNITFKNTAPVPRPGALGKQ  216

Query  558   GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIH  737
             GVALR+S D +A+ GC     QDTL D  G+HYY +CYIEG VDFIFGNA SL+EGC +H
Sbjct  217   GVALRISADNAAFLGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDFIFGNALSLYEGCHVH  276

Query  738   SIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQ  917
             +IA   GA+TAQ R S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +YM + I 
Sbjct  277   AIARNYGALTAQNRMSILEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIII  336

Query  918   PEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             P GW +W DP R+ TV+YG+YKC GPG++ + RV WSR L+  EAKPF++   I+G EW+
Sbjct  337   PRGWYNWGDPTREMTVFYGQYKCTGPGSNYAGRVAWSRELTDQEAKPFISLSFIDGLEWV  396

Query  1098  R  1100
             +
Sbjct  397   K  397



>ref|XP_008649911.1| PREDICTED: probable pectinesterase 53 [Zea mays]
 gb|AFW78823.1| hypothetical protein ZEAMMB73_511959 [Zea mays]
Length=410

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/298 (48%), Positives = 187/298 (63%), Gaps = 16/298 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L++    G G++  IQ A+DS+P  N   V I V  GTY EKV +   + F+T+ G  A 
Sbjct  112   LVVDKNPGAGNFTSIQAAVDSLPLINLARVVIRVNAGTYTEKVSISPMRAFVTVEGAGAD  171

Query  435   NTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVA  566
              TV+ W D  D             S T  V +  FV + +T  NT      G  GK GVA
Sbjct  172   KTVVQWGDTADTAGAWGRPMGTFGSATFAVNSMFFVAKNITFKNTAPVPRPGALGKQGVA  231

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LR+S D +A+ GC     QDTL D  G+HYY +CYIEG VDFIFGNA SL+EGC +H+IA
Sbjct  232   LRISADSAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDFIFGNALSLYEGCHVHAIA  291

Query  747   VGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEG  926
                GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +YM + I P G
Sbjct  292   RNYGALTAQSRQSLLEDTGFSFVSCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIIIPRG  351

Query  927   WNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             W +W DP R+ TV+YG+YKC GPGA+ + RV+WSR L+  EAKPF++   I+G EWLR
Sbjct  352   WYNWGDPTREMTVFYGQYKCTGPGANYAGRVQWSRELTDDEAKPFISLDFIDGFEWLR  409



>ref|XP_008657240.1| PREDICTED: probable pectinesterase 53 [Zea mays]
 gb|AFW85118.1| hypothetical protein ZEAMMB73_006796 [Zea mays]
Length=395

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 191/307 (62%), Gaps = 18/307 (6%)
 Frame = +3

Query  231   LKQTSTAVLIIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             L + S +  ++VD +   GD+  IQ A+DS+P  N   V I V PGTY EKV +   + F
Sbjct  87    LDRASPSYSLVVDANPAFGDFTTIQAAVDSLPDMNLVRVVIRVNPGTYTEKVSISAMRAF  146

Query  408   ITLSGDDASNTVITWSDGGD-----------IIHSPTLTVFASDFVGRYLTIMNTF----  542
             ITL G  A +T++ W D  D             +S +  V A  F+ R +T  NT     
Sbjct  147   ITLEGAGADSTIVQWGDTADSPTGAKGRPLGTFNSASFAVNAQYFLARNITFKNTSPVPR  206

Query  543   -GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              G +GK  VALRVS D +A+ GC     QDTL D +G+HYY  CYI+G VDFIFGNA SL
Sbjct  207   PGATGKQAVALRVSADNAAFVGCSFLGAQDTLYDHSGRHYYKECYIQGSVDFIFGNALSL  266

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             +E C +H+IA+  GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +
Sbjct  267   YEDCHVHAIALDYGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYT  326

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             YM   I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WS  L+  EA+PF++   
Sbjct  327   YMDDIIIPKGWYNWGDPNRELTVFYGQYKCTGPGATYAGRVAWSHELTDDEARPFVSLNF  386

Query  1077  IEGQEWL  1097
             I+G EW+
Sbjct  387   IDGNEWI  393



>ref|XP_009764658.1| PREDICTED: pectinesterase QRT1 [Nicotiana sylvestris]
Length=352

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/299 (47%), Positives = 190/299 (64%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+VDQ G GD I +Q A+D VP  NS  V I + PGTYREKV +P  KPFI+L GD   
Sbjct  53    VIVVDQKGKGDSITVQGAVDKVPFHNSRRVIIYIHPGTYREKVHIPASKPFISLVGDQNQ  112

Query  429   ASNTVITWSDGGD----------IIHSPTLTVFASDFVGRYLTIMNTF-----GRSGKGV  563
              + T+IT  D                + T+TV +  F    +TI NT      G   + V
Sbjct  113   TARTIITGHDKASDTDQFGSKLGTSRTATVTVESDYFCATGITIENTIVPEPEGVGMQAV  172

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR++GDR+  Y  RI   QDTLLD+AG HY+  CYI+G VDFI GNA SL++ C +HS+
Sbjct  173   ALRLTGDRAVLYRVRILGSQDTLLDDAGSHYFYQCYIQGSVDFICGNARSLYKNCTLHSV  232

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A G GAI AQ R S  ++TGF+F+ CKI+G+G   LGR WG YSRV++    +   I P+
Sbjct  233   AKGYGAIAAQHRNSVYQDTGFSFVNCKISGSGRVFLGRAWGEYSRVIYSKCDIDGIIDPK  292

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW DW+ P R++   +GEY+C G GA+R+ RV WS+SL+++EA+PF+  K I GQ+WLR
Sbjct  293   GWTDWNLPSRRQHAVFGEYECRGNGANRAGRVPWSKSLNESEAEPFLDVKFIGGQQWLR  351



>ref|XP_003530551.1| PREDICTED: probable pectinesterase 53-like isoform X1 [Glycine 
max]
 ref|XP_006584808.1| PREDICTED: probable pectinesterase 53-like isoform X2 [Glycine 
max]
 gb|KHN16649.1| Putative pectinesterase 53 [Glycine soja]
Length=375

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/302 (47%), Positives = 186/302 (62%), Gaps = 11/302 (4%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +  + G G +  IQ AIDS+P  N   V I V  G Y EKV +   K F
Sbjct  71    KNKLFPSHTLHVSKKHGKGGFSSIQAAIDSLPFINVVRVVIKVHAGVYTEKVNISPFKSF  130

Query  408   ITLSGDDASNTVITWSDGGD-----IIHSPTLTVFASDFVGRYLTIMNTF-----GRSGK  557
             +T+ G+ A  T++ W D           S T  V +  F+ + +T  NT      G  GK
Sbjct  131   VTIQGEGADKTIVQWGDTAQSQPLGTYGSATFAVNSPYFIAKNITFKNTAPIPAPGAVGK  190

Query  558   -GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEI  734
              GVALR+S D + + GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLFEGC +
Sbjct  191   QGVALRISADTAVFLGCKFLGAQDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLFEGCHV  250

Query  735   HSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAI  914
             H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +YM + I
Sbjct  251   HAIAQLTGALTAQGRNSLLEDTGFSFVHCKVTGSGALYLGRAWGPFSRVVFAYTYMDNII  310

Query  915   QPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEW  1094
              P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR LS  EAKPF++   I+G EW
Sbjct  311   IPKGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVSWSRELSDEEAKPFISLSYIDGSEW  370

Query  1095  LR  1100
             + 
Sbjct  371   IN  372



>ref|XP_004513038.1| PREDICTED: probable pectinesterase 53-like [Cicer arietinum]
Length=380

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/292 (47%), Positives = 183/292 (63%), Gaps = 22/292 (8%)
 Frame = +3

Query  282   GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWSDG  461
             GD+  IQ+AIDS+PS N   V I V  G Y EKV +P  K FIT+ GDDA  T++ W   
Sbjct  91    GDFTTIQEAIDSLPSINLVRVVIKVHAGVYMEKVNIPPLKSFITIEGDDADTTIVQW---  147

Query  462   GDIIHSP-------------TLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSGD  584
             GD   +P             T  V +  F+ + +T  NTF     G  GK  VA R+S D
Sbjct  148   GDTAQTPGPKGTPMGTHGSATFAVNSPYFIAKNITFQNTFPVPAPGAMGKQAVAFRISAD  207

Query  585   RSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAI  764
              +++ GC+    QDTL D  G+HYY +CYIEG VDFIFGNA S  +GC +H+IA   GA+
Sbjct  208   TASFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNALSFMKGCHVHAIARNAGAV  267

Query  765   TAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDD  944
             TAQ R +  E+TGF+F+ CK+TG+G   LGR WG YSRVV+  +YM + I P+GW +W D
Sbjct  268   TAQGRSNELEDTGFSFVNCKVTGSGALYLGRAWGRYSRVVFAYTYMDNIIIPKGWYNWGD  327

Query  945   PKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             P R+ TV+YG+YKC G GA+ + RV WSR L+  +AKPF++   I+G EW+ 
Sbjct  328   PNREMTVFYGQYKCRGDGANFAGRVSWSRELTDDQAKPFLSLSFIDGTEWIN  379



>ref|XP_009352561.1| PREDICTED: probable pectinesterase 53 [Pyrus x bretschneideri]
Length=382

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/308 (46%), Positives = 186/308 (60%), Gaps = 17/308 (6%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      G + KIQ AIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  74    KNKLFPSFTLHVAKNPNAGHFTKIQAAIDSLPFINFVRVVIKVHAGVYTEKVNIPPLKSF  133

Query  408   ITLSGDDASNTVITWSDGGDI-----------IHSPTLTVFASDFVGRYLTIMNTF----  542
             IT+ G  A  T++ W D                +S T  V +  F+ + +T  NT     
Sbjct  134   ITIEGAGADKTIVQWGDTAQTPSGPKKQPMGTFNSATFAVNSPYFIAKNITFKNTTPVPK  193

Query  543   -GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              G  GK  VA R+S D ++++GCR    QDTL D  G+HYY +CYIEG VDFIFGN  SL
Sbjct  194   PGAIGKQAVAFRISADTASFWGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSL  253

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             FEGC +H+IA   GA+TAQ R S  E TGF+F+ CK+TG+G   LGR WGP+SRVV+  +
Sbjct  254   FEGCHVHAIAQNIGALTAQGRSSMLEETGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYT  313

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             YM + I P+GW +W DP R+ TV+YG+Y+C GPGA  + RV WSR L++ EAKPF++   
Sbjct  314   YMDNIIIPKGWYNWGDPNREMTVFYGQYQCAGPGARFAGRVSWSRELTREEAKPFISLSF  373

Query  1077  IEGQEWLR  1100
             I+G EW++
Sbjct  374   IDGSEWIK  381



>ref|XP_008673062.1| PREDICTED: pectinesterase isoform X1 [Zea mays]
 gb|ACR36293.1| unknown [Zea mays]
Length=391

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/299 (47%), Positives = 185/299 (62%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L++      GD+  IQ A+DS+P+ N   V I V  GTY EKV V   + FITL G  A 
Sbjct  92    LVVDKDPALGDFTTIQAAVDSLPAINLVRVVIRVNAGTYTEKVTVSAMRAFITLEGAGAD  151

Query  435   NTVITWSDGGD-----------IIHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GV  563
              TV+ W D  D             +S +  V A  F+ R +T  NT      G +GK  V
Sbjct  152   KTVVQWGDTADSPTGPKGRPLGTFNSASFAVNAQYFLARNITFKNTSPVPKPGAAGKQAV  211

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALRVS D +A+ GCR    QDTL D +G+HYY +CYI+G VDFIFGNA SL+E C +H+I
Sbjct  212   ALRVSADNAAFVGCRFLGAQDTLYDHSGRHYYKDCYIQGSVDFIFGNALSLYEDCHVHAI  271

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A   GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  ++M   I P 
Sbjct  272   ARDYGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTHMDDIIVPN  331

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW +W DP R+ TV+YG+YKC GPGA  + RV WS  L+  EAKPF++   I+G EW+R
Sbjct  332   GWFNWGDPNRELTVFYGQYKCTGPGATYAGRVAWSHELTDDEAKPFISLSFIDGTEWVR  390



>ref|XP_003524409.1| PREDICTED: probable pectinesterase 53-like [Glycine max]
Length=375

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/293 (48%), Positives = 184/293 (63%), Gaps = 11/293 (4%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L +  + G G +  IQ AIDS+P  N   V I V  G Y EKV +   K FIT+ G+ A 
Sbjct  80    LHVSKKHGKGGFSSIQAAIDSLPFINVVRVVIKVHAGVYTEKVNISPFKSFITIQGEGAD  139

Query  435   NTVITWSDGGD-----IIHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSG  581
              T++ W D           S T  V ++ F+ + +T  NT      G  GK GVALR+S 
Sbjct  140   KTIVQWGDTAQSQPLGTYGSATFAVNSAYFIAKNITFKNTAPIPAPGAVGKQGVALRISA  199

Query  582   DRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGA  761
             D + + GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLFEGC +H+IA   GA
Sbjct  200   DTAVFQGCKFLGAQDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIAQLTGA  259

Query  762   ITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD  941
             +TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +YM + I P+GW +W 
Sbjct  260   LTAQGRSSLLEDTGFSFVHCKVTGSGALYLGRAWGPFSRVVFAYTYMDNIIIPKGWYNWG  319

Query  942   DPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   I+G EW+ 
Sbjct  320   DPNREMTVFYGQYKCTGPGASYAGRVSWSRELTDEEAKPFISLSYIDGSEWIN  372



>ref|XP_006353578.1| PREDICTED: probable pectinesterase 53-like [Solanum tuberosum]
Length=376

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 188/307 (61%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  LI+     HGD+  IQ+AIDS+P  N   V I +  G Y EKV +   K F
Sbjct  69    KNKLFPSYTLIVDKNPSHGDFTSIQEAIDSLPFINLIRVVIKIHAGIYTEKVNISPFKSF  128

Query  408   ITLSGDDASNTVITWSDGGDIIH----------SPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G+ A NT+I + D    I           S T  V +  F  + +T  NT      
Sbjct  129   ITIEGEGADNTIIQYGDTAQTIGPNGKPLGTFGSATFAVNSPYFQAKNITFKNTTPVPPP  188

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGN  S F
Sbjct  189   GAIGKQAVAFRISADTAAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSFF  248

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRV++  +Y
Sbjct  249   EGCHLHAIAQVTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVIFAYTY  308

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW++W DP R+ TV+YG+YKC GPGA  + RV W R L++ EAKPF++   I
Sbjct  309   MDNIIIPKGWHNWGDPLREMTVFYGQYKCSGPGASFAGRVSWCRELTEQEAKPFISLSFI  368

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  369   DGYEWIK  375



>gb|KHG28421.1| putative pectinesterase 53 -like protein [Gossypium arboreum]
Length=381

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/307 (46%), Positives = 184/307 (60%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+  IQDAIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  74    KNKLFPSYTLTVDKNPAKGDFTTIQDAIDSLPLVNLVRVVIKVHAGVYTEKVNIPPLKSF  133

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T++ W D                S T  V +  F+ + +T  NT      
Sbjct  134   ITIEGSGADETIVQWGDTAQTPGPRGQPLGTYASATFAVNSPYFIAKNITFKNTTPVPPP  193

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D + + GC+    QDTL D  G+HYY +CYIEG VDFIFGN  SLF
Sbjct  194   GAVGKQAVAFRISADTATFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLF  253

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  ++TGF+F+ CK+TG+G   LGR WGP+SRV++  +Y
Sbjct  254   EGCHVHAIATLTGAVTAQGRGSMLDDTGFSFVNCKVTGSGALYLGRAWGPFSRVIFAYTY  313

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++   I
Sbjct  314   MDNIIIPKGWYNWGDPSREMTVFYGQYKCTGPGASFAGRVSWSRELTDEEAKPFLSLSFI  373

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  374   DGSEWIK  380



>ref|XP_002440102.1| hypothetical protein SORBIDRAFT_09g026060 [Sorghum bicolor]
 gb|EES18532.1| hypothetical protein SORBIDRAFT_09g026060 [Sorghum bicolor]
Length=406

 Score =   281 bits (719),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/301 (47%), Positives = 187/301 (62%), Gaps = 16/301 (5%)
 Frame = +3

Query  246   TAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGD  425
             T  L++      G++  IQ A+DS+P  N   V I V  GTY EKV +   + F+T+ G 
Sbjct  105   TRTLVVDKNPAAGNFTSIQAAVDSLPLINLARVVIRVNAGTYTEKVNISPMRAFVTVEGA  164

Query  426   DASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-  557
              A  TV+ W D  D             S T  V +  FV + +T  NT      G  GK 
Sbjct  165   GADKTVVQWGDTADTAGSFGRPMGTFGSATFAVNSMFFVAKNITFKNTAPVPRPGALGKQ  224

Query  558   GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIH  737
             GVALR+S D +A+ GC     QDTL D  G+HYY +CYIEG VDFIFGNA SL+EGC +H
Sbjct  225   GVALRISADNAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDFIFGNALSLYEGCHVH  284

Query  738   SIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQ  917
             +IA   GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +YM + I 
Sbjct  285   AIARNYGALTAQNRQSLLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIII  344

Query  918   PEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             P GW +W DP R+ TV+YG+YKC GPGA+ + RV+WSR L+  EAKPF++   I+G EWL
Sbjct  345   PRGWYNWGDPTREMTVFYGQYKCTGPGANYAGRVQWSRELTDEEAKPFISLDFIDGFEWL  404

Query  1098  R  1100
             +
Sbjct  405   K  405



>ref|XP_002975044.1| hypothetical protein SELMODRAFT_102829 [Selaginella moellendorffii]
 gb|EFJ23829.1| hypothetical protein SELMODRAFT_102829 [Selaginella moellendorffii]
Length=318

 Score =   278 bits (710),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 193/296 (65%), Gaps = 15/296 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             +I+V + G G++  I +AIDS+P +N + V + +K G YREK+ +P  KPF+TL GD +S
Sbjct  20    VIVVARDGFGNFSSIAEAIDSIPEQNQQRVIVRIKAGVYREKIAIPKSKPFVTLQGDGSS  79

Query  435   NTVITWS------DGGDII---HSPTLTVFASDFVGRYLTIMN-----TFGRSGK-GVAL  569
              T+ITW+      +G +++   +S T+++ +  F+ + +T  N       G +GK  VAL
Sbjct  80    LTIITWNSTASDRNGTNLLKTYNSATISINSRFFIAKNITFQNEAIAHIHGETGKQAVAL  139

Query  570   RVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV  749
             R+S D +A+Y C     QDTL D  G+HY+  C+++G VDFIFG   SL++ C ++SIA 
Sbjct  140   RISADMAAFYDCNFHGGQDTLYDHKGRHYFKRCFVQGSVDFIFGYGRSLYKDCHLYSIAN  199

Query  750   GGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGW  929
               GAITAQ+R     N+GF+F+ C ITG+G   LGR WG  SRVV+  +YM + I P+GW
Sbjct  200   KTGAITAQKRTIRNMNSGFSFVNCSITGSGRIYLGRAWGDRSRVVYSYTYMDALIAPQGW  259

Query  930   NDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
              +W+ P+R RTV++ +Y+C GPGA  S+RV W+R+L+  EA+PF+    I G+ WL
Sbjct  260   QNWNHPERNRTVFFAQYECSGPGAKTSQRVAWARTLTFEEAQPFLGTDFIHGETWL  315



>ref|XP_010110876.1| putative pectinesterase 53 [Morus notabilis]
 gb|EXC28695.1| putative pectinesterase 53 [Morus notabilis]
Length=380

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/307 (46%), Positives = 185/307 (60%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +      GD+  IQDAIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  73    KNKLFPSFTLTVSKNPATGDFTSIQDAIDSLPFINLVRVAIKVHAGVYTEKVNIPPFKSF  132

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T++ W D                S T  V +  F+ + +T  NT      
Sbjct  133   ITIEGAGADKTIVQWGDTAQTPGPRGQPLGTYASATFAVNSPYFIAKNITFKNTTPVPAP  192

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D + + GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLF
Sbjct  193   GAIGKQAVAFRISADTATFLGCKFLGAQDTLYDHYGRHYYKDCYIEGSVDFIFGNALSLF  252

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H++A   GA+TAQ R+S  E+TGF+F+ CK+TG+G   LGR WGP+S VV+  +Y
Sbjct  253   EGCHVHAVAQLTGALTAQGRKSIMEDTGFSFVNCKVTGSGALYLGRAWGPFSTVVFAYTY  312

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW +W DP R+ TV+YG+YKC GPGA+ + RV WSR L+  E KPF++   I
Sbjct  313   MDNIIIPKGWYNWGDPSREMTVFYGQYKCTGPGANFAGRVAWSRELTNEEVKPFISLSFI  372

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  373   DGSEWIK  379



>ref|XP_002979836.1| hypothetical protein SELMODRAFT_55472, partial [Selaginella moellendorffii]
 gb|EFJ19238.1| hypothetical protein SELMODRAFT_55472, partial [Selaginella moellendorffii]
Length=292

 Score =   276 bits (707),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 137/292 (47%), Positives = 186/292 (64%), Gaps = 14/292 (5%)
 Frame = +3

Query  264   VDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTV  443
             VDQ G GD+  +QDAID+VP  N   V+I +  GT+ EKV++P  KP+ITL G     T 
Sbjct  1     VDQKGFGDFRTVQDAIDAVPDYNQVPVHIYINNGTFTEKVLIPHSKPYITLQGQGMDLTA  60

Query  444   ITWSD----GGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGV------ALRVSGDRSA  593
             I W+D     G    S +++V A+DFV + L+ +NT    G GV      ALRVS DR+A
Sbjct  61    IAWNDTANSSGRTYKSASVSVEATDFVAKNLSFLNTSPGPGVGVQGAQAVALRVSSDRAA  120

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGG----GA  761
             +YGC    +QDTL D+ G+HY+  C+IEG +DFI G+  SL+E CE+HS+A       G+
Sbjct  121   FYGCGFYGFQDTLFDDQGRHYFKECFIEGSIDFICGSGRSLYENCELHSVANPSKKVSGS  180

Query  762   ITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD  941
             ITAQRR    E + F+F+ C ITGTG  +LGR WGP+SRV++  + M S + P GW+DW 
Sbjct  181   ITAQRRLKWSEASAFSFVNCSITGTGNVLLGRAWGPFSRVIFAYTSMDSIVHPVGWDDWG  240

Query  942   DPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             D  R  TV YGEY+C G G++R KR  WS SLS  +A P+++   I+G EW+
Sbjct  241   DSGRTLTVVYGEYECSGLGSNRRKRANWSHSLSDWQAYPYLSPLFIDGDEWI  292



>ref|XP_009591684.1| PREDICTED: probable pectinesterase 53 [Nicotiana tomentosiformis]
Length=380

 Score =   280 bits (715),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 183/307 (60%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +     HGD+  IQDAIDS+P  N   V I +  G Y EKV +P  K F
Sbjct  73    KNKIFPSFTLTVDKNPSHGDFTSIQDAIDSLPFVNLIRVVIKIHAGVYTEKVNIPPFKSF  132

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNT-----F  542
             IT+ G  A  T+I W D                S T  V +  F  + +T  NT      
Sbjct  133   ITIEGAGADKTIIQWGDTAQTPGPNGKPLGTFGSATFAVNSPYFQAKNITFKNTTPVPAA  192

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGN  S F
Sbjct  193   GAIGKQAVAFRISADTAAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSFF  252

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +Y
Sbjct  253   EGCHLHAIAPVTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTY  312

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW++W DP R+ TV++G+YKC GPGA  + RV W R L+  EAKPF++   I
Sbjct  313   MDNIIIPKGWHNWGDPLREMTVFFGQYKCSGPGASFAGRVSWCRELTDQEAKPFISLSFI  372

Query  1080  EGQEWLR  1100
             +G EW+ 
Sbjct  373   DGSEWIN  379



>ref|XP_003630703.1| Pectinesterase [Medicago truncatula]
 gb|AET05179.1| pectinesterase [Medicago truncatula]
Length=381

 Score =   279 bits (714),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 186/309 (60%), Gaps = 18/309 (6%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +   S  G +  IQ AIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  70    KNKLFPSYTLNVYKHSSKGGFSSIQAAIDSLPFINLVRVVIKVHAGVYTEKVSIPALKSF  129

Query  408   ITLSGDDASNTVITWSDGGDIIH------------SPTLTVFASDFVGRYLTIMNTF---  542
             IT+ G  A  T++ W D     +            S T  V +  F+ + +T  NT    
Sbjct  130   ITIQGAGADKTIVQWGDTALTPNPGAKGQTLGTYGSATFAVNSPYFIAKNITFKNTAPIP  189

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK GVALR+S D + + GC+    QDTL D  G+HYY +CYIEG VDFIFGNA S
Sbjct  190   KPGAVGKQGVALRISADTAMFLGCKFLGAQDTLYDHIGRHYYKDCYIEGSVDFIFGNALS  249

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             LFEGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  
Sbjct  250   LFEGCHVHAIAQNIGALTAQGRNSLLEDTGFSFVHCKVTGSGALYLGRAWGPFSRVVFAY  309

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             +YM + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++  
Sbjct  310   TYMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVAWSRELTDEEAKPFISLN  369

Query  1074  MIEGQEWLR  1100
              ++G EW+ 
Sbjct  370   YVDGSEWIN  378



>ref|XP_003566023.2| PREDICTED: probable pectinesterase 53 [Brachypodium distachyon]
Length=334

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/301 (48%), Positives = 190/301 (63%), Gaps = 20/301 (7%)
 Frame = +3

Query  258   IIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGD-DA  431
             ++VD+S G G++  IQ A+DS+P  N   V I V PGTY EKV +   + F+T+ G   A
Sbjct  33    LVVDKSPGAGNFTSIQAAVDSLPLINLARVVIRVNPGTYTEKVNISPMRGFVTVEGAAGA  92

Query  432   SNTVITWSDGGDI------------IHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-  557
               TV+ W D  +               S T  V A  FV + +T  NT      G  GK 
Sbjct  93    EKTVVQWGDTAETAGPWGRRSPLGTFASATFAVNAQFFVAKNITFKNTAPVPRPGALGKQ  152

Query  558   GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIH  737
             GVALR+S D +A+ GC     QDTL D  G+HYY +CYIEG VDFIFGNA SL+EGC +H
Sbjct  153   GVALRISADNAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDFIFGNALSLYEGCHVH  212

Query  738   SIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQ  917
             +I+   GA+TAQ R S  ++TGF+FL C++TG+G   LGR WG +SRVV+  +YM + I 
Sbjct  213   AISPRYGALTAQGRTSLLDDTGFSFLNCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIII  272

Query  918   PEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             P GW +W DP R+ TV+YG+YKC GPGA+ + RV+WSR L+  EAKPF++   I+G EWL
Sbjct  273   PRGWYNWGDPTREMTVFYGQYKCTGPGANYAGRVDWSRELTDEEAKPFISLSFIDGLEWL  332

Query  1098  R  1100
             R
Sbjct  333   R  333



>ref|XP_009602719.1| PREDICTED: pectinesterase QRT1 [Nicotiana tomentosiformis]
Length=352

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/299 (47%), Positives = 190/299 (64%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+VDQ G GD I +Q A+D VP  NS  V I + PGTYREKV +P  KPFI+L GD   
Sbjct  53    VIVVDQKGEGDSITVQGAVDKVPFHNSRRVIIYIHPGTYREKVHIPASKPFISLVGDQNQ  112

Query  429   ASNTVITWSDGGD----------IIHSPTLTVFASDFVGRYLTIMNTF-----GRSGKGV  563
              + T+IT  +                + T+TV +  F    +TI NT      G   + V
Sbjct  113   TARTIITGHEKASDTDQFGSKLGTSRTATVTVESDYFCATGITIENTIVPEPEGVGMQAV  172

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR++GDR+  Y  RI   QDTLLD+AG HY+  CYI+G VDFI GNA SL++ C +HS+
Sbjct  173   ALRLTGDRAVLYRVRILGSQDTLLDDAGSHYFYQCYIQGSVDFICGNARSLYKNCTLHSV  232

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A G GAI AQ R S  +++GF+F+ CKI+G+G   LGR WG YSRV++    +   I P+
Sbjct  233   AKGYGAIAAQHRNSVYQDSGFSFVNCKISGSGRVFLGRAWGEYSRVIYSKCDIDGIIDPK  292

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW DW+ P R++   +GEY+C G GA+R+ RV WS+SL+++EA+PF+  K I GQ+WLR
Sbjct  293   GWTDWNLPSRRQHAVFGEYQCRGNGANRAGRVPWSKSLNESEAEPFLDVKFIGGQQWLR  351



>gb|KHN26987.1| Putative pectinesterase 53 [Glycine soja]
Length=361

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/289 (48%), Positives = 178/289 (62%), Gaps = 3/289 (1%)
 Frame = +3

Query  234   KQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFIT  413
             K   +  L +  + G G +  IQ AIDS+P  N   V I V  G Y EKV +   K FIT
Sbjct  73    KLFPSHTLHVSKKHGKGGFSSIQAAIDSLPFINVVRVVIKVHAGVYTEKVNISPFKSFIT  132

Query  414   LSGDDASNTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKGVALRVSGDRSA  593
             + G+ A  T++ W   GD   S  L  + S        I        +GVALR+S D + 
Sbjct  133   IQGEGADKTIVQW---GDTAQSQPLGTYGSATFANTAPIPAPGAVGKQGVALRISADTAV  189

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             + GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLFEGC +H+IA   GA+TAQ
Sbjct  190   FLGCKFLGAQDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIAQLTGALTAQ  249

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
              R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  +YM + I P+GW +W DP R
Sbjct  250   GRSSLLEDTGFSFVHCKVTGSGALYLGRAWGPFSRVVFAYTYMDNIIIPKGWYNWGDPNR  309

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             + TV+YG+YKC GPGA  + RV WSR LS  EAKPF++   I+G EW+ 
Sbjct  310   EMTVFYGQYKCTGPGASYAGRVSWSRELSDEEAKPFISLSYIDGSEWIN  358



>emb|CDY44939.1| BnaA02g04440D [Brassica napus]
Length=478

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/298 (47%), Positives = 191/298 (64%), Gaps = 16/298 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L +      GD+  IQDAIDS+P  N   V I V  G ++EKV +P  K F+T+ G+ A 
Sbjct  84    LTVHKNQNKGDFTNIQDAIDSLPLINLVRVVIKVHAGVFKEKVNIPPMKSFVTIEGEGAE  143

Query  435   NTVITW--------SDGGDI--IHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVA  566
              T++ W        + G  +   +S +  V +  FV + +T  NT      G  GK  VA
Sbjct  144   TTIVEWGGTAQTPDTKGNPMGTFNSASFAVNSPFFVAKNITFKNTTPVPLPGAVGKQAVA  203

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LRVS D +A++GC++   QDTL D +G+HYY +CYIEG VDFIFGNA SL+EGC +H+IA
Sbjct  204   LRVSADNAAFFGCKMLGAQDTLYDHSGRHYYKDCYIEGSVDFIFGNALSLYEGCHVHAIA  263

Query  747   VGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEG  926
                GA+TAQ R S  E+TGF+F+ CK+TGTG   LGR WGP+SRVV+  +YM + I P G
Sbjct  264   DKLGAVTAQGRGSVLEDTGFSFVNCKVTGTGVLYLGRAWGPFSRVVFAYTYMDNIILPRG  323

Query  927   WNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             W +W DP R+ TV+YG+YKC G GA+ + RV W++ L+  EAKPF++   I+G EW++
Sbjct  324   WYNWGDPSREMTVFYGQYKCTGEGANYAGRVAWAKELTDDEAKPFISLTFIDGSEWIK  381



>ref|XP_003529058.2| PREDICTED: probable pectinesterase 53-like [Glycine max]
Length=381

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 189/310 (61%), Gaps = 22/310 (7%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K  ++  L +      GD+  IQ+AIDS+P  N   V I V  G Y EKV +P  K +
Sbjct  74    KNKLVASYTLHVDKNPNAGDFTSIQEAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSY  133

Query  408   ITLSGDDASNTVITWSDGGDIIHSP-------------TLTVFASDFVGRYLTIMNTF--  542
             IT+ G DA  T++ W   GD   +P             T  V +  F+ + +T  NT   
Sbjct  134   ITIEGADADKTIVKW---GDTAQTPGSNGRPLGTYGSATFAVNSPYFLAKNITFQNTTPV  190

Query  543   ---GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAA  710
                G  GK  VALR+S D +A+ GC+    QDTL D  G+H+Y +CYIEG VDFIFGN+ 
Sbjct  191   PAPGAVGKQAVALRISADTAAFVGCKFLGAQDTLYDHLGRHFYKDCYIEGSVDFIFGNSL  250

Query  711   SLFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWV  890
             SLFEGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+ 
Sbjct  251   SLFEGCHVHAIAQNTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFA  310

Query  891   SSYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
              +YM + I P+GW +W DP R+ TV+YG+YKC G GA  + RV WSR L+  EA PF++ 
Sbjct  311   YTYMENIIIPKGWYNWGDPNREMTVFYGQYKCTGLGASFAGRVPWSRELTDEEATPFLSL  370

Query  1071  KMIEGQEWLR  1100
               ++G EW++
Sbjct  371   SFVDGTEWIK  380



>ref|XP_006646312.1| PREDICTED: probable pectinesterase 53-like, partial [Oryza brachyantha]
Length=366

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 190/308 (62%), Gaps = 18/308 (6%)
 Frame = +3

Query  231   LKQTSTAVLIIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             L +   +  ++VD++   GD+  IQ A+DS+P  N   V I V  GTY EKV +   + F
Sbjct  58    LARAFPSYTLVVDRNPAFGDFTTIQAAVDSLPVINLVRVVIKVNAGTYTEKVNISPMRAF  117

Query  408   ITLSGDDASNTVITWSDGGD-----------IIHSPTLTVFASDFVGRYLTIMNTF----  542
             ITL G  A  T++ W D  D             +S +  V A  F+ R +T  NT     
Sbjct  118   ITLEGAGADKTIVQWGDSADSPSGRAGRPLGTYNSASFAVNAHYFLARNITFKNTSPVPK  177

Query  543   -GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              G SGK  VALRVS D +A+ GC+    QDTL D +G+HYY +CYIEG VDFIFGNA SL
Sbjct  178   PGASGKQAVALRVSADNAAFVGCKFLGAQDTLYDHSGRHYYKDCYIEGSVDFIFGNALSL  237

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             +E C +H+IA   GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR  G +SRVV+  +
Sbjct  238   YEDCHVHAIARDYGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGRARGTFSRVVFAYT  297

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             YM   I P GW +W DP R+ TV+YG+YKC GPGA  S RV WSR L+  EAKPF++   
Sbjct  298   YMDDIIVPRGWYNWGDPNREMTVFYGQYKCTGPGASFSGRVSWSRELTDDEAKPFISLSF  357

Query  1077  IEGQEWLR  1100
             I+G EW+R
Sbjct  358   IDGTEWIR  365



>ref|XP_002974192.1| hypothetical protein SELMODRAFT_101090 [Selaginella moellendorffii]
 gb|EFJ24414.1| hypothetical protein SELMODRAFT_101090 [Selaginella moellendorffii]
Length=318

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 193/296 (65%), Gaps = 15/296 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             +I+V + G G++  I +AIDS+P +N + V + +K G YREK+ +P  KPF+TL GD +S
Sbjct  20    VIVVARDGLGNFSSIAEAIDSIPEQNQQRVIVWIKAGVYREKIAIPKSKPFVTLQGDGSS  79

Query  435   NTVITWS------DGGDII---HSPTLTVFASDFVGRYLTIMN-----TFGRSGK-GVAL  569
              T+ITW+      +G +++   +S T+++ +  F+ + +T  N       G +GK  VAL
Sbjct  80    LTIITWNSTASDRNGTNLLKTYNSATISINSRFFIAKNITFQNEAIAHIHGETGKQAVAL  139

Query  570   RVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV  749
             R+S D +A+Y C     QDTL D  G+HY+  C+++G VDFIFG   SL++ C ++SIA 
Sbjct  140   RISADMAAFYDCNFHGGQDTLYDHKGRHYFKRCFVQGSVDFIFGYGRSLYKDCHLYSIAN  199

Query  750   GGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGW  929
               GAITAQ+R     N+GF+F+ C ITG+G   LGR WG  SRVV+  +YM + I P+GW
Sbjct  200   KTGAITAQKRTIRNMNSGFSFVNCSITGSGRIYLGRAWGDRSRVVYSYTYMDALIAPQGW  259

Query  930   NDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
              +W+ P+R RTV++ +Y+C GPGA  S+RV W+R+L+  EA+PF+    I G+ WL
Sbjct  260   QNWNHPERNRTVFFAQYECSGPGAKTSQRVAWARTLTFEEAQPFLDTDFIHGETWL  315



>ref|XP_008656474.1| PREDICTED: probable pectinesterase 53 isoform X1 [Zea mays]
Length=397

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/299 (47%), Positives = 188/299 (63%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L++  + G GD+  IQ A+DS+P  N   V I V  GTY EKV +   + F+T+ G  A 
Sbjct  98    LVVDRRPGAGDFTSIQAAVDSLPLINLARVVIRVNAGTYTEKVNISPMRAFVTVEGAGAD  157

Query  435   NTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTI-MNTF-----GRSGK-GV  563
              TV+ W D  D             S T  V +  FV + +T   NT      G  GK GV
Sbjct  158   KTVVQWGDTADTAGSWGRPMGTFGSATFAVNSMFFVAKNITFKQNTAPVPRPGALGKQGV  217

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR+S D +A+ GC     QDTL D  G+HYY +CYIEG VDFIFGNA SL+EGC +H+I
Sbjct  218   ALRISADNAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDFIFGNALSLYEGCHVHAI  277

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A   GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +YM + I P 
Sbjct  278   ARNYGALTAQNRQSLLEDTGFSFVKCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIIIPR  337

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW +W DP R+ TV+YG+YKC GPGA+ + RV+WSR L+  EAKPF++   I+G +WLR
Sbjct  338   GWYNWGDPTREMTVFYGQYKCTGPGANYAGRVQWSRELTDEEAKPFISLDFIDGFQWLR  396



>gb|AFK39158.1| unknown [Medicago truncatula]
Length=381

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 185/309 (60%), Gaps = 18/309 (6%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +   S  G +  IQ AIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  70    KNKLFPSYTLNVYKHSSKGGFSSIQAAIDSLPFINLVRVVIKVHAGVYTEKVSIPALKSF  129

Query  408   ITLSGDDASNTVITWSDGGDIIH------------SPTLTVFASDFVGRYLTIMNTF---  542
             IT+ G  A  T++ W D     +            S T  V +  F+ + +T  NT    
Sbjct  130   ITIQGAGADKTIVQWGDTALTPNPGAKGQTLGTYGSATFAVNSPYFIAKNITFKNTAPIP  189

Query  543   --GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G  GK GVALR+S D + + GC+    QDTL D  G HYY +CYIEG VDFIFGNA S
Sbjct  190   KPGAVGKQGVALRISADTAMFLGCKFLGAQDTLYDHIGGHYYKDCYIEGSVDFIFGNALS  249

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             LFEGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+  
Sbjct  250   LFEGCHVHAIAQNIGALTAQGRNSLLEDTGFSFVHCKVTGSGALYLGRAWGPFSRVVFAY  309

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             +YM + I P+GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF++  
Sbjct  310   TYMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVAWSRELTDEEAKPFISLN  369

Query  1074  MIEGQEWLR  1100
              ++G EW+ 
Sbjct  370   YVDGSEWIN  378



>ref|XP_001774315.1| predicted protein [Physcomitrella patens]
 gb|EDQ60817.1| predicted protein [Physcomitrella patens]
Length=286

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 184/287 (64%), Gaps = 12/287 (4%)
 Frame = +3

Query  270   QSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVIT  449
             +SG GD+ KIQ AID+VP  N +   I +K G YREK++VP  K  I         T++ 
Sbjct  1     KSGKGDFRKIQQAIDAVPVGNKKRFVIQIKNGVYREKLLVPKTKANIHFKCS-GRRTILV  59

Query  450   WSD----GGDIIHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSGDRSAWY  599
             W D     G    S +  V + +F+    T +N+      G  GK  VALRV GD++A+Y
Sbjct  60    WGDTAEMAGGTSKSASTAVESDNFLATDCTFVNSAPAPPGGAVGKQAVALRVQGDKAAFY  119

Query  600   GCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV-GGGAITAQR  776
              C     QDTL  + G+ YY NCYI+G +D+IFGNA +LF  C I+SIA    G+ITAQ+
Sbjct  120   RCYFYGAQDTLYAKEGRQYYRNCYIQGSIDWIFGNARALFHKCHINSIAFKNSGSITAQK  179

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             RES +E TGF+F+GCKITG+GT  LGR WG +SRVV++  YM + I P GW DW+DP R 
Sbjct  180   RESNKEATGFSFVGCKITGSGTIYLGRAWGTHSRVVFIRCYMQNMILPIGWQDWNDPARH  239

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             +TVYYGEY C GPGA+R  R +WSR+L+K EA+PF T K I G+ WL
Sbjct  240   KTVYYGEYLCSGPGANRKGRAKWSRALTKKEAEPFSTVKFINGKNWL  286



>gb|EYU30697.1| hypothetical protein MIMGU_mgv1a024695mg [Erythranthe guttata]
Length=353

 Score =   277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/287 (48%), Positives = 183/287 (64%), Gaps = 7/287 (2%)
 Frame = +3

Query  258   IIVDQSGH-GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             + VD++   GD+  IQDAIDS+P  N   V I +  G Y EKV +P  K FIT+ G  A 
Sbjct  65    LTVDRNPQLGDFTSIQDAIDSLPLVNLVRVVIKIHAGVYTEKVTIPTMKSFITIEGASAE  124

Query  435   NTVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSGDRSAW  596
              TV+ +        S T  V +  F+ R +T  NT      G  GK  VA R+S D +A+
Sbjct  125   KTVVQFGIPLGTYGSATFAVNSPYFIARNITFKNTTPVPPPGAVGKQAVAFRISADTAAF  184

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
              GC+    QDTL D  G+HYY +CYIEG VDFIFGN  SLFE C++H+IA   GA+TAQ 
Sbjct  185   VGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLFENCQVHAIAPIIGAVTAQA  244

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             R S  +++GF+F+ CK+TG+G   LGR WGP+SRVV+  +YM + I P+GW +W DP R+
Sbjct  245   RSSILDDSGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTYMDNIIIPKGWYNWGDPSRE  304

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
              TV+YG+YKC G GA+ + RV WSR L+  EAKPF++   I+G EW+
Sbjct  305   MTVFYGQYKCTGAGANYAGRVSWSRELTDQEAKPFISLTFIDGSEWI  351



>ref|XP_007160279.1| hypothetical protein PHAVU_002G308000g [Phaseolus vulgaris]
 gb|ESW32273.1| hypothetical protein PHAVU_002G308000g [Phaseolus vulgaris]
Length=376

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/302 (47%), Positives = 185/302 (61%), Gaps = 11/302 (4%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +  +   G +  IQ AIDS+P  N   V I V  G Y EKV +P  K F
Sbjct  72    KNKLFPSHTLHVSKKPSKGGFSSIQAAIDSLPFINVVRVVIKVHAGVYTEKVNIPPLKSF  131

Query  408   ITLSGDDASNTVITWSDGGD-----IIHSPTLTVFASDFVGRYLTIMNTF-----GRSGK  557
             IT+ G  A NT++ W D           S T  V +  F+ + +T  NT      G  GK
Sbjct  132   ITIQGAGADNTIVQWGDTAQSQPLGTYGSATFAVNSPFFIAKNITFKNTAPIPAPGAVGK  191

Query  558   -GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEI  734
               VALR+S D + + GC+    QDTL D+ G+HYY +CYIEG VDFIFGNA SLFEGC +
Sbjct  192   QAVALRISADNAIFLGCKFLGAQDTLYDQLGRHYYKDCYIEGSVDFIFGNALSLFEGCHV  251

Query  735   HSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAI  914
             H+IA   GA+TAQ R S  ++TGF+F+ CK+TG+G   LGR WGP+SRVV+  +YM + I
Sbjct  252   HAIAQVTGALTAQGRSSLLQDTGFSFVHCKVTGSGALYLGRAWGPFSRVVFAYTYMDNII  311

Query  915   QPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEW  1094
              P+GW +W DP R+ TV+YG+YKC G GA  + RV WSR L+  EAKPF++   I+G EW
Sbjct  312   IPKGWYNWGDPNREMTVFYGQYKCTGAGASYAGRVSWSRELTDEEAKPFISLSYIDGSEW  371

Query  1095  LR  1100
             + 
Sbjct  372   IN  373



>gb|EMT24197.1| Pectinesterase QRT1 [Aegilops tauschii]
Length=364

 Score =   277 bits (708),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 186/297 (63%), Gaps = 16/297 (5%)
 Frame = +3

Query  258   IIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASN  437
             I+V Q G G    +Q A+D VP+ N+  V I V+PG YREKV VP+ KPF++L G     
Sbjct  67    IVVSQDGTGHSRTVQGAVDMVPAGNTRRVKILVRPGVYREKVTVPITKPFVSLIGMGTGR  126

Query  438   TVITW-SDGGDI---------IHSPTLTVFASDFVGRYLTIMNTFGRSGKG------VAL  569
             TVITW +   DI          +S +  + A  F   ++T  N+   +  G      VAL
Sbjct  127   TVITWNARASDIDATGHQVGTFYSASFAIEADYFCASHITFENSAPAAPPGAVGMQAVAL  186

Query  570   RVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV  749
             R+SGD++  Y CRI   QDTL D  G+HY  NC I+G +DFIFGNA SL++GC +H++A 
Sbjct  187   RLSGDKTMLYRCRILGTQDTLFDNIGRHYLYNCDIQGSIDFIFGNARSLYQGCALHAVAT  246

Query  750   GGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGW  929
               GAI A +R SA + +GF+F+GC++TG+G   LGR WG Y+RVV+    +   + P+GW
Sbjct  247   SYGAIAASQRSSASDESGFSFVGCRLTGSGMLYLGRAWGRYARVVYAFCDLGGIVVPQGW  306

Query  930   NDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             +DW D  R +TV +GEYKC GPGA   +RV WSR+L+  EA+PF+ +  I G++WLR
Sbjct  307   SDWGDRARTKTVMFGEYKCKGPGASSRQRVPWSRALTYEEARPFLGRDFINGEQWLR  363



>ref|XP_011093643.1| PREDICTED: probable pectinesterase 53 isoform X1 [Sesamum indicum]
Length=388

 Score =   277 bits (709),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 139/291 (48%), Positives = 183/291 (63%), Gaps = 18/291 (6%)
 Frame = +3

Query  282   GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWSDG  461
             GD+  IQ A+DS+P  N   V I+V  G Y EKV +P  K FIT+ G  A +T++ W D 
Sbjct  97    GDFTSIQQALDSLPPLNLLRVVINVHAGVYTEKVRIPKLKSFITIEGGGAESTIVEWGDT  156

Query  462   GDI----------IHSPTLTVFASDFVGRYLTIMNT-----FGRSG-KGVALRVSGDRSA  593
                            S T  V A  F+ + +T  NT      G +G + VA R+SGD +A
Sbjct  157   AQTPGPKGRPLGTFASATFAVDAPYFIAKNITFKNTTPVPRAGETGTQAVAFRISGDTAA  216

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFE--GCEIHSIAVGGGAIT  767
             + GC+    QDTL D +G+HYY +CYIEG VDFIFGN  SLFE   CE+H++A   GA+T
Sbjct  217   FVGCKFLGAQDTLYDHSGRHYYKDCYIEGSVDFIFGNGLSLFELQECEVHAVAAVTGAVT  276

Query  768   AQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDP  947
             AQ R S  ++TGF+F+ CK+TG+G   LGR WGP+SRVV+  +YM + I P+GW+DW DP
Sbjct  277   AQGRSSMLDDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTYMDNIIIPKGWHDWGDP  336

Query  948   KRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
              RQ TV+YG+YKC G GA  + RV WSR LS  EAKPF++   I+G EW+ 
Sbjct  337   SRQLTVFYGQYKCRGAGASFAGRVSWSRELSDEEAKPFISLSFIDGSEWIN  387



>ref|XP_010679844.1| PREDICTED: probable pectinesterase 53 [Beta vulgaris subsp. vulgaris]
Length=385

 Score =   277 bits (709),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 137/288 (48%), Positives = 179/288 (62%), Gaps = 16/288 (6%)
 Frame = +3

Query  288   YIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWSDGGD  467
             Y  +Q+AI+S+P  N   V IS+ PGTYREKV VPV   +I L G  A  T+I W D  D
Sbjct  96    YASVQEAINSLPISNLCRVVISIGPGTYREKVEVPVTMAYIKLKGAGAEKTIIEWDDTAD  155

Query  468   II----------HSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSGDRSAWY  599
              +          +S T  V +  F+ + +T  NT      G  GK  VALR+S D++A+ 
Sbjct  156   RLGQSGQPLGTKNSATFAVNSPYFIAKNITFKNTAPSPASGAQGKQAVALRISADKAAFI  215

Query  600   GCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRR  779
             GC+    QDTL D  G+HY+  CYIEG VDF+FGN  SL++ C +H+++   GA+TAQ+R
Sbjct  216   GCKFIGEQDTLYDHIGRHYFRECYIEGSVDFVFGNGLSLYDNCHLHAVSNNYGALTAQKR  275

Query  780   ESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQR  959
             ES  E TGF+FL C ITG+G   LGR WG +SRVV+  +YM   I P GW DW D  R  
Sbjct  276   ESFLEETGFSFLNCTITGSGALYLGRAWGTFSRVVFAYTYMDKIIAPGGWYDWGDKNRDT  335

Query  960   TVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQ  1103
             TV+YG+YKC GPGAD   RV WSR L+  EA+PF++   I+G EWL+ 
Sbjct  336   TVFYGQYKCSGPGADHGVRVSWSRELTTQEAQPFISYDFIDGDEWLKN  383



>gb|KHN40374.1| Putative pectinesterase 53 [Glycine soja]
Length=326

 Score =   275 bits (704),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 188/310 (61%), Gaps = 22/310 (7%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K  ++  L +    G GD+  IQ+AIDS+P  N   V I V  G Y EKV +P  K +
Sbjct  19    KNKLVASYTLHVDKDPGAGDFTSIQEAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSY  78

Query  408   ITLSGDDASNTVITWSDGGDIIHSP-------------TLTVFASDFVGRYLTIMNTF--  542
             IT+ G     T++ W   GD   +P             T  V +  F+ + +T  NT   
Sbjct  79    ITIEGAGTDKTIVKW---GDTAQTPGPNGRPLGTYGSATFAVNSPYFLAKNITFQNTTPV  135

Query  543   ---GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAA  710
                G  GK  VALR+S D +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGN+ 
Sbjct  136   PAPGAVGKQAVALRISADTAAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNSL  195

Query  711   SLFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWV  890
             SLFEGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+ 
Sbjct  196   SLFEGCHVHAIAQNTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFA  255

Query  891   SSYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
              ++M + I P+GW +W DP R+ TV+YG+YKC G GA  + RV WSR L+  EA PF++ 
Sbjct  256   YTFMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGLGASFAGRVPWSRELTDEEAAPFLSL  315

Query  1071  KMIEGQEWLR  1100
               I+G EW++
Sbjct  316   SFIDGTEWIK  325



>emb|CDP03246.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   276 bits (705),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/307 (45%), Positives = 184/307 (60%), Gaps = 16/307 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K   +  L +     +GD+  IQ AIDS+P+ N   V I V  G Y EKV +P  K +
Sbjct  30    KNKLFPSYTLTVDKNPNYGDFTTIQQAIDSLPTVNLVRVLIKVHAGVYTEKVTIPQLKSY  89

Query  408   ITLSGDDASNTVITWSDGGDI----------IHSPTLTVFASDFVGRYLTIMNTF-----  542
             IT+ G  A  T++ W D                S T  V +  F+ + +T  NT      
Sbjct  90    ITVEGAGADKTIVQWGDTAQTPGAKGQPLGTFASATFAVNSPYFIAKNITFKNTTPVPPP  149

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VA R+S D + + GCR    QDTL D  G+HYY +CYIEG VDFIFGN  SLF
Sbjct  150   GAIGKQAVAFRISADTAVFVGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLF  209

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC + +IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRV++  +Y
Sbjct  210   EGCHVRAIAQLTGAVTAQGRSSLLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVIFAYTY  269

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P+GW++W DP R+ TV+YG+YKC G GA  + RV WSR L+  EAKPF++   I
Sbjct  270   MDNIIIPKGWHNWGDPSREMTVFYGQYKCSGAGASFAGRVSWSRELTDEEAKPFISLAFI  329

Query  1080  EGQEWLR  1100
             +G EW++
Sbjct  330   DGSEWIK  336



>ref|XP_011078244.1| PREDICTED: probable pectinesterase 53 [Sesamum indicum]
Length=380

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/291 (47%), Positives = 180/291 (62%), Gaps = 16/291 (5%)
 Frame = +3

Query  276   GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWS  455
              +GD+  IQDAIDS+P  N   V I V  G Y EKV +P  K FIT+ G  A  T++ W 
Sbjct  89    AYGDFTSIQDAIDSLPMVNLVRVVIKVHAGVYTEKVTIPQLKSFITIEGAGADKTIVQWG  148

Query  456   DGGDIIH----------SPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSGDR  587
             D                S T  V +  F+ + +T  NT      G  GK  VA R+S D 
Sbjct  149   DTAQTAGPKGQPLGTYGSATFAVNSPYFIAKNITFKNTTPVPPPGAVGKQAVAFRISADT  208

Query  588   SAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAIT  767
             +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGNA SLFE C +H+IA   GA+T
Sbjct  209   AAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLFENCHVHAIAPIIGAVT  268

Query  768   AQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDP  947
             AQ R S  ++TGF+F+ CK+TG+G   LGR WGP+SRVV+  +YM + I P+GW +W DP
Sbjct  269   AQGRSSILDDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFAYTYMDNIIIPKGWYNWGDP  328

Query  948   KRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
              R+ TV+YG+YKC G GA  + RV WSR L+  EAKPF++   I+G EW++
Sbjct  329   SREMTVFYGQYKCTGAGASFAGRVSWSRELTDEEAKPFISLTFIDGSEWIK  379



>ref|XP_009602721.1| PREDICTED: pectinesterase QRT1-like [Nicotiana tomentosiformis]
Length=360

 Score =   276 bits (706),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 138/303 (46%), Positives = 201/303 (66%), Gaps = 21/303 (7%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I VDQ+G+GD + +Q A+D VP  NS+ V I ++PGTYREKV +P  KPFI+  GD+  
Sbjct  57    VIAVDQNGNGDSVTVQGAVDIVPIHNSQRVKIFIRPGTYREKVFIPASKPFISFIGDENQ  116

Query  429   ASNTVITWSDG-------GDII---HSPTLTVFASDFVGRYLTIMNTFG-----RSGKGV  563
             A   +IT +         G+++   ++ T+ V +  F    +TI NT          + V
Sbjct  117   ARKIIITGNSKASDKDKYGNVLGTYNTATVAVESDYFSATGITIENTVVALPQYNDMQAV  176

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR++G+R+  Y  RI   QDTLLDE+G HY+  CYI+G VDFI GNA SL++GC+++S+
Sbjct  177   ALRLAGERAMLYKVRILGSQDTLLDESGSHYFYKCYIQGSVDFICGNARSLYQGCDLYSV  236

Query  744   A---VG-GGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSA  911
             A   +G  GAI A +R SA+E++GF+F+ CKI+G+G+ +LGR WG YSR+++ + Y  + 
Sbjct  237   AEDNIGISGAIAAHQRNSADEDSGFSFVDCKISGSGSILLGRAWGEYSRIIYSNCYFDAL  296

Query  912   IQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQE  1091
             I PEGW DW+   R +   +GEYKC G GA+R  RVEWS+SL+K +A+PF+  K I G++
Sbjct  297   ITPEGWFDWNQLSRHKHAVFGEYKCKGRGANRKGRVEWSKSLNKTQAQPFLNTKFIGGEQ  356

Query  1092  WLR  1100
             WLR
Sbjct  357   WLR  359



>ref|XP_009402793.1| PREDICTED: probable pectinesterase 53 [Musa acuminata subsp. 
malaccensis]
Length=379

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 139/302 (46%), Positives = 185/302 (61%), Gaps = 16/302 (5%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             S+  L +      GD+  IQ A+DS+P  N   V I V  GTY EKV +   + F+T+ G
Sbjct  77    SSRALTVDKNPSAGDFTTIQAAVDSLPLINLVRVVIKVNAGTYTEKVRISPMRAFVTIQG  136

Query  423   DDASNTVITWSDGGDII----------HSPTLTVFASDFVGRYLTIMNTF-----GRSGK  557
               A  TV+ W D  + +          +S T  V A  F+ + +T  NT      G  GK
Sbjct  137   AGAGKTVVQWGDTAETLGPTGQPIGTFNSATFAVNAPYFMAKNITFKNTTPVPPPGAMGK  196

Query  558   -GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEI  734
               VALRVS D + + GC I   QDTL D  G+HYY +CYIEG VDFIFGNA SL+EGC +
Sbjct  197   QAVALRVSADAATFVGCNILGAQDTLYDHFGRHYYKDCYIEGSVDFIFGNALSLYEGCRV  256

Query  735   HSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAI  914
             H++A   GA+TAQ R +  E+TGF+F+ CK+TG+G   LGR WG +SRV++  +YM + I
Sbjct  257   HAVARNYGAVTAQNRMNLLEDTGFSFVRCKVTGSGALYLGRAWGTFSRVIFAYTYMDAII  316

Query  915   QPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEW  1094
              P GW +W DP R+ TV+YG+YKC GPGA  + RV WSR L+  EAKPF+T   I+G EW
Sbjct  317   VPRGWYNWGDPNREMTVFYGQYKCSGPGASYAGRVSWSRELTDEEAKPFITLSFIDGSEW  376

Query  1095  LR  1100
             ++
Sbjct  377   VK  378



>ref|XP_002962216.1| hypothetical protein SELMODRAFT_76951 [Selaginella moellendorffii]
 gb|EFJ37476.1| hypothetical protein SELMODRAFT_76951 [Selaginella moellendorffii]
Length=369

 Score =   276 bits (706),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 192/299 (64%), Gaps = 18/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             +++    G GDY  +Q A++S+P  N E + I + PG YREKV VP+ KP+ITL G  A 
Sbjct  69    IVVSKTIGEGDYTTVQAALNSIPDYNGERIVIHINPGYYREKVTVPITKPYITLQGSGAW  128

Query  435   NTVITWSD-------GGDII---HSPTLTVFASDFVGRYLTIMNTF----GRSGK-GVAL  569
              T+I W+D       GG  +    S T+ ++AS F+ + +T  N+     G  GK  VAL
Sbjct  129   LTIIDWNDTASSPGPGGQPLGTFESATVGIYASFFIAKNITFKNSAVFFPGAPGKQAVAL  188

Query  570   RVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA-  746
             R+SGD +A+YGC     QDTL D +G+HY+  CYIEG +DFIFG+  S +    +H+ A 
Sbjct  189   RISGDTAAFYGCHFLGSQDTLYDHSGRHYFRECYIEGSIDFIFGDGHSYYYKSHLHAAAE  248

Query  747   -VGG-GAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQP  920
               GG GA+ AQ+R +  E TGF+F+ C++TG+GT  LGR WG +SRVV+  +YM + + P
Sbjct  249   NCGGIGALAAQKRTNQSERTGFSFVNCRVTGSGTIFLGRAWGDFSRVVYAFTYMDNIVVP  308

Query  921   EGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             EGW++W DP ++ TV++G+YKC GPGA+ + RV WS  L+  +A+PF+    I+G +WL
Sbjct  309   EGWDNWGDPNKEHTVFFGQYKCSGPGANHAGRVAWSHELTPGQAQPFLDPSFIDGSQWL  367



>emb|CDY06568.1| BnaC02g12920D [Brassica napus]
Length=378

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 187/299 (63%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+V+++G GD + +Q A+D VP  NS+ V I + PG YREKV VP+ KP+I+  GD+  
Sbjct  79    VIVVEKNGRGDSVTVQGAVDMVPDSNSQRVKIYILPGIYREKVNVPITKPYISFIGDEKY  138

Query  429   ASNTVITWSD--------GGDI--IHSPTLTVFASDFVGRYLTIMNTF-----GRSGKGV  563
                TVITWSD        G +I    + T+TV +  F    +TI NT       +  +  
Sbjct  139   VGKTVITWSDKASDRYSNGSEIGTYRTATVTVDSDFFCATAITIQNTVVAVPGDQGNQAA  198

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR+ GD++  Y  RI   QDTL DE+G HY+  CYIEG VDFIFGNA SL+  C I S 
Sbjct  199   ALRIKGDKAMLYSVRILGSQDTLDDESGSHYFLKCYIEGNVDFIFGNAKSLYRNCYISSN  258

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A   G+I A  R+   E+TGF+F+ C I+GTG   LGR WG Y+R+V+ + Y++  I P 
Sbjct  259   AKRFGSIAAHHRDKENEDTGFSFVNCTISGTGNVTLGRAWGNYARIVYSNCYIADVITPA  318

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW+DW DP R   V +GEY C G GADR+ RV WS+SL++ EAKPF+  + I G +WL+
Sbjct  319   GWDDWSDPARDSEVLFGEYNCTGKGADRTGRVPWSKSLTQDEAKPFLGMEFISGDQWLK  377



>ref|XP_010064980.1| PREDICTED: pectinesterase QRT1 [Eucalyptus grandis]
Length=365

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/299 (47%), Positives = 189/299 (63%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+VD++G GD I +Q A+D VP  NS+ V I + PGTYREKV VP  KP+I+  GD+  
Sbjct  66    VILVDKNGRGDSITVQGAVDMVPENNSQRVKILILPGTYREKVHVPSSKPYISFIGDEDQ  125

Query  429   ASNTVITW--------SDGGDI--IHSPTLTVFASDFVGRYLTIMNTF-----GRSGKGV  563
             +S T I+W        +DG ++    S ++TV +  F    +T  NT      G   + V
Sbjct  126   SSKTTISWHDKASDKQTDGCELGTYRSASVTVESDFFCATGITFENTVVAVPGGYGMQAV  185

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALRVSGD++ +Y  R+   QDTLLD+ G HY+  CYI+G VDFIFG + SL+E C IHS 
Sbjct  186   ALRVSGDKAMFYRVRVLGTQDTLLDDTGSHYFYQCYIQGSVDFIFGRSTSLYEECVIHST  245

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A   GAI A  R+S  +++GF+F+ C I GTG   LGR WG YSRVV+   Y+ + I P 
Sbjct  246   ATNFGAIAAHHRDSPSDDSGFSFVNCVINGTGNIYLGRAWGDYSRVVYSYCYLDNIITPP  305

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW+DW+ P RQ+T  +GEY+C G GAD   RV WS++ S  EA+ F+ KK I+G  WLR
Sbjct  306   GWSDWNHPYRQKTAVFGEYQCSGRGADTRGRVPWSKTFSHEEARGFLDKKFIQGDRWLR  364



>ref|XP_003516527.2| PREDICTED: probable pectinesterase 53-like [Glycine max]
Length=379

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 188/310 (61%), Gaps = 22/310 (7%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K  ++  L +    G GD+  IQ+AIDS+P  N   V I V  G Y EKV +P  K +
Sbjct  72    KNKLVASYTLHVDKDPGAGDFTSIQEAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSY  131

Query  408   ITLSGDDASNTVITWSDGGDIIHSP-------------TLTVFASDFVGRYLTIMNTF--  542
             IT+ G     T++ W   GD   +P             T  V +  F+ + +T  NT   
Sbjct  132   ITIEGAGTDKTIVKW---GDTAQTPGPNGRPLGTYGSATFAVNSPYFLAKNITFQNTTPV  188

Query  543   ---GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAA  710
                G  GK  VALR+S D +A+ GC+    QDTL D  G+HYY +CYIEG VDFIFGN+ 
Sbjct  189   PAPGAVGKQAVALRISADTAAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNSL  248

Query  711   SLFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWV  890
             SLFEGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+ 
Sbjct  249   SLFEGCHVHAIAQNTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFA  308

Query  891   SSYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
              ++M + I P+GW +W DP R+ TV+YG+YKC G GA  + RV WSR L+  EA PF++ 
Sbjct  309   YTFMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGLGASFAGRVPWSRELTDEEAAPFLSL  368

Query  1071  KMIEGQEWLR  1100
               I+G EW++
Sbjct  369   SFIDGTEWIK  378



>gb|KCW70485.1| hypothetical protein EUGRSUZ_F03696, partial [Eucalyptus grandis]
Length=363

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/299 (47%), Positives = 189/299 (63%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+VD++G GD I +Q A+D VP  NS+ V I + PGTYREKV VP  KP+I+  GD+  
Sbjct  64    VILVDKNGRGDSITVQGAVDMVPENNSQRVKILILPGTYREKVHVPSSKPYISFIGDEDQ  123

Query  429   ASNTVITW--------SDGGDI--IHSPTLTVFASDFVGRYLTIMNTF-----GRSGKGV  563
             +S T I+W        +DG ++    S ++TV +  F    +T  NT      G   + V
Sbjct  124   SSKTTISWHDKASDKQTDGCELGTYRSASVTVESDFFCATGITFENTVVAVPGGYGMQAV  183

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALRVSGD++ +Y  R+   QDTLLD+ G HY+  CYI+G VDFIFG + SL+E C IHS 
Sbjct  184   ALRVSGDKAMFYRVRVLGTQDTLLDDTGSHYFYQCYIQGSVDFIFGRSTSLYEECVIHST  243

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A   GAI A  R+S  +++GF+F+ C I GTG   LGR WG YSRVV+   Y+ + I P 
Sbjct  244   ATNFGAIAAHHRDSPSDDSGFSFVNCVINGTGNIYLGRAWGDYSRVVYSYCYLDNIITPP  303

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW+DW+ P RQ+T  +GEY+C G GAD   RV WS++ S  EA+ F+ KK I+G  WLR
Sbjct  304   GWSDWNHPYRQKTAVFGEYQCSGRGADTRGRVPWSKTFSHEEARGFLDKKFIQGDRWLR  362



>ref|XP_002965130.1| hypothetical protein SELMODRAFT_83276 [Selaginella moellendorffii]
 gb|EFJ33968.1| hypothetical protein SELMODRAFT_83276 [Selaginella moellendorffii]
Length=369

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 192/299 (64%), Gaps = 18/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             +++    G GDY  +Q A++S+P  N E + I + PG YREKV VP+ KP+ITL G  A 
Sbjct  69    IVVSKTIGEGDYTTVQAALNSIPDYNGERIVIQINPGYYREKVTVPITKPYITLQGCGAW  128

Query  435   NTVITWSD-------GGDII---HSPTLTVFASDFVGRYLTIMNTF----GRSGK-GVAL  569
              T+I W+D       GG  +    S T+ ++AS F+ + +T  N+     G  GK  VAL
Sbjct  129   LTIIDWNDTASSPGPGGQPLGTFESATVGIYASFFIAKNITFKNSAVFFPGAPGKQAVAL  188

Query  570   RVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA-  746
             R+SGD +A+YGC     QDTL D +G+HY+  CYIEG +DFIFG+  S +    +H+ A 
Sbjct  189   RISGDTAAFYGCHFLGSQDTLYDHSGRHYFRECYIEGSIDFIFGDGHSYYYKSHLHAAAE  248

Query  747   -VGG-GAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQP  920
               GG GA+ AQ+R +  E TGF+F+ C++TG+GT  LGR WG +SRVV+  +YM + + P
Sbjct  249   NCGGIGALAAQKRTNQSERTGFSFVNCRVTGSGTIFLGRAWGDFSRVVYAFTYMDNIVVP  308

Query  921   EGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             EGW++W DP ++ TV++G+YKC GPGA+ + RV WS  L+  +A+PF+    I+G +WL
Sbjct  309   EGWDNWGDPNKEHTVFFGQYKCSGPGANHAGRVAWSHELTPGQAQPFLDPSFIDGSQWL  367



>ref|XP_008653334.1| PREDICTED: pectinesterase QRT1 isoform X1 [Zea mays]
 tpg|DAA63553.1| TPA: hypothetical protein ZEAMMB73_008946 [Zea mays]
Length=366

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 187/297 (63%), Gaps = 16/297 (5%)
 Frame = +3

Query  258   IIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASN  437
             I+V Q G G    +Q A+D VP+ NS  V I V+PG YREKV VP+ KPF++L G  +  
Sbjct  69    IVVAQDGTGHSRTVQGAVDMVPAGNSRRVKILVRPGVYREKVTVPITKPFVSLIGMGSGR  128

Query  438   TVITW-SDGGDI---------IHSPTLTVFASDFVGRYLTIMNTFGRSGKG------VAL  569
             TVITW +   D+          +S ++ V A  F   ++T  N+   +  G      VAL
Sbjct  129   TVITWNARASDMDRSGHQVGTFYSASVAVEADYFCASHITFENSAPAAPPGAVGQQAVAL  188

Query  570   RVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV  749
             R+SGD++  Y CRI   QDTL D  G+H+  NC I+G +DFIFGNA SL++GC +H++A 
Sbjct  189   RLSGDKTMLYRCRILGTQDTLFDNIGRHFLYNCDIQGSIDFIFGNARSLYQGCTLHAVAT  248

Query  750   GGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGW  929
               GAI A +R SAEE++GF+F+GC++TG+G   LGR WG Y+RVV+    +   + P+GW
Sbjct  249   SYGAIAASQRSSAEEDSGFSFVGCRLTGSGMLYLGRAWGRYARVVYSYCDLGGIVVPQGW  308

Query  930   NDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             +DW D  R +TV +GEY C GPGA    RV WSRSL+  EA+PF+    I G++WLR
Sbjct  309   SDWGDQSRTKTVLFGEYSCKGPGASTRNRVPWSRSLTYDEARPFLGPSFINGEQWLR  365



>gb|KHN14256.1| Putative pectinesterase 53 [Glycine soja]
Length=375

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/310 (45%), Positives = 188/310 (61%), Gaps = 22/310 (7%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K K  ++  L +      GD+  IQ+AIDS+P  N   V I V  G Y EKV +P  K +
Sbjct  68    KNKLVASYTLHVDKNPNAGDFTSIQEAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSY  127

Query  408   ITLSGDDASNTVITWSDGGDIIHSP-------------TLTVFASDFVGRYLTIMNTF--  542
             IT+ G  A  T++ W   GD   +P             T  V +  F+ + +T  NT   
Sbjct  128   ITIEGAGADKTIVKW---GDTAQTPGSNGRPLGTYGSATFAVNSPYFLAKNITFQNTTPV  184

Query  543   ---GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAA  710
                G  GK  VALR+S D +A+ GC+    QDTL D  G+H+Y +CYIEG VDFIFGN+ 
Sbjct  185   PAPGAVGKQAVALRISADTAAFVGCKFLGAQDTLYDHLGRHFYKDCYIEGSVDFIFGNSL  244

Query  711   SLFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWV  890
             SLFEGC +H+IA   GA+TAQ R S  E+TGF+F+ CK+TG+G   LGR WGP+SRVV+ 
Sbjct  245   SLFEGCHVHAIAQNTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGRAWGPFSRVVFA  304

Query  891   SSYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
              +YM + I P+GW +W DP R+ TV+YG+YKC G GA  + RV WSR L+  EA PF++ 
Sbjct  305   YTYMENIIIPKGWYNWGDPNREMTVFYGQYKCTGLGASFAGRVPWSRELTDEEATPFLSL  364

Query  1071  KMIEGQEWLR  1100
               ++G EW++
Sbjct  365   SFVDGTEWIK  374



>ref|XP_001752210.1| predicted protein [Physcomitrella patens]
 gb|EDQ82943.1| predicted protein [Physcomitrella patens]
Length=386

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 189/301 (63%), Gaps = 14/301 (5%)
 Frame = +3

Query  243   STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSG  422
             S    I V + G+ D+  +Q+AID++P  N+  V IS++ G YREKV +P +KPF+ L G
Sbjct  85    SNTNYISVGKQGNVDFNTVQEAIDAIPENNAVWVEISIRAGVYREKVFIPSNKPFVILQG  144

Query  423   DDASNTVITWSDGGD---IIHSPTLTVFASDFVGRYLTIMNTFGRS------GKGVALRV  575
             +  S T I            +S T+TV++S+F+ R +   N    +      G+ VA+ +
Sbjct  145   EGRSTTTIAHRQSASQSGTANSATVTVYSSNFIARGIGFQNDAPLAEPGQVDGQAVAVLL  204

Query  576   SGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGG  755
               D++A+Y C     QDTL D +G+HY+  CY EG +D I GN  S+F+ CEIH IA   
Sbjct  205   VTDKAAFYSCGFYGGQDTLFDFSGRHYFKECYFEGNIDIISGNGQSVFKNCEIHEIATQA  264

Query  756   ---GAITAQRRESAEENTGFTFLGCKITG--TGTTVLGRPWGPYSRVVWVSSYMSSAIQP  920
                G++TAQ+R S +ENTGF F+ C ITG  TG   LGR WGPYSRVV++ +YM   I P
Sbjct  265   YISGSLTAQKRSSPDENTGFVFINCLITGIGTGQVFLGRAWGPYSRVVYIYTYMDDVILP  324

Query  921   EGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             EGW DW +P R+RTVYYG+Y+C GPG+D S+RV+WS  LS  EA+ F+    I+GQ WL+
Sbjct  325   EGWQDWSNPSRERTVYYGQYQCSGPGSDASQRVKWSHELSDGEAQNFLQLSWIDGQAWLQ  384

Query  1101  Q  1103
             +
Sbjct  385   E  385



>emb|CDY20756.1| BnaA02g08960D [Brassica napus]
Length=378

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 186/299 (62%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+V+++G GD + +Q A+D VP  NS+ V I + PG YREKV VP+ KP+I+  G    
Sbjct  79    VIVVEKNGRGDSVTVQGAVDMVPDSNSQRVKIYILPGIYREKVNVPITKPYISFIGSQKY  138

Query  429   ASNTVITWSD--------GGDI--IHSPTLTVFASDFVGRYLTIMNTF-----GRSGKGV  563
                TVI+WSD        G +I    + T+TV +  F    +TI NT       +  +  
Sbjct  139   VGKTVISWSDKASDRYSNGSEIGTYRTATVTVDSDFFCATAITIQNTVVAVPGDQGNQAA  198

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR+ GD++  Y  RI   QDTL DE+G HY+  CYIEG VDFIFGNA SL+  C I S 
Sbjct  199   ALRIKGDKAMLYSVRILGSQDTLDDESGSHYFLKCYIEGNVDFIFGNAKSLYRDCYIRSN  258

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A   G+I A  R+   E+TGF+F+ C I+GTG   LGR WG Y+R+V+ +SY++  I P 
Sbjct  259   AKRFGSIAAHHRDRENEDTGFSFVNCTISGTGNVTLGRAWGNYARIVYSNSYIADVITPA  318

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW+DW DP R   V +GEY C G GADR+ RV WS+SL++ EAKPF+  + I G +WLR
Sbjct  319   GWDDWSDPARDSEVLFGEYNCTGKGADRTGRVPWSKSLTQDEAKPFLGMEFISGDQWLR  377



>ref|XP_010271483.1| PREDICTED: probable pectinesterase 53 [Nelumbo nucifera]
Length=395

 Score =   275 bits (704),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/307 (45%), Positives = 188/307 (61%), Gaps = 20/307 (7%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKP  404
             KLK   T   I VD+    GD++ +Q A+DS+P  N   V I +  G YREKV +P  K 
Sbjct  91    KLKPCLT---ITVDKDPKKGDFVTVQKAVDSLPIVNQCRVLIKIHAGIYREKVDIPATKA  147

Query  405   FITLSGDDASNTVITWSDGGD----------IIHSPTLTVFASDFVGRYLTIMNTF----  542
             F+TL G  A  T++ W D  D             S T  + +  FV + +T  NT     
Sbjct  148   FVTLEGAGADRTILQWGDTADRMGSDRRPLGTFASATFAINSPYFVAKNITFKNTAPLPP  207

Query  543   -GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              G  GK  VALR+SGD +A++ C     QDTL D  G+HY+ +CYI+G VDFIFG+  SL
Sbjct  208   SGALGKQAVALRISGDTAAFFSCNFIGAQDTLYDHIGRHYFKDCYIQGSVDFIFGDGLSL  267

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             +EGC +H+I    GA+TAQ+R++  E TGF+F+ C++TG+G   LGR WG +SRVV+  +
Sbjct  268   YEGCHLHAITNSYGALTAQKRDNMLEETGFSFVNCRVTGSGALYLGRAWGSFSRVVFAYT  327

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             YM   I P+GW +W D  R+ TV+YG+YKC GPGAD   RV WSR L++ EAKPF++   
Sbjct  328   YMDKIITPKGWYNWGDKNRELTVFYGQYKCSGPGADFGGRVSWSRELTQQEAKPFISLSF  387

Query  1077  IEGQEWL  1097
             I+G EWL
Sbjct  388   IDGYEWL  394



>ref|XP_001785334.1| predicted protein [Physcomitrella patens]
 gb|EDQ49846.1| predicted protein [Physcomitrella patens]
Length=305

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/293 (46%), Positives = 188/293 (64%), Gaps = 14/293 (5%)
 Frame = +3

Query  252   VLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDA  431
             + I+VD+SG GD+ KIQDA+DS+P  N++ V I +  G Y EK+ VP D  +   SG   
Sbjct  14    LYIVVDKSGKGDFTKIQDAVDSIPKGNNKRVTIHIMNGYYSEKINVPHDNVYFKCSG---  70

Query  432   SNTVITWSDGGDIIHSPTLT----VFASDFVGRYLTIMNTF-----GRSGK-GVALRVSG  581
               T++ W D  +   S +L+    V   +F+    T +NT      G  GK  VA R+ G
Sbjct  71    KRTILAWGDTAEKAGSTSLSASTAVTGDNFLATDCTFVNTAPAPPGGAVGKQAVAFRIQG  130

Query  582   DRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV-GGG  758
             D+ A+Y C     QDTL  + G+HY+  C+I G +DFIFG+  ++F  C+I SIA    G
Sbjct  131   DKGAFYRCFFYGAQDTLYSKEGRHYFRECHIIGSIDFIFGDGTAMFHKCKIKSIAFQNSG  190

Query  759   AITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDW  938
             +I+AQ+RESAE  +GF+F+GC I+G+GT  LGR WG +SR V++  YM+  I P GW DW
Sbjct  191   SISAQKRESAESPSGFSFVGCHISGSGTIYLGRAWGSHSRTVFIRCYMADMILPIGWQDW  250

Query  939   DDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             +DP RQ+TV+YGEY C GPG+ RS R +WSR L+K EA+PFMT+K + G +WL
Sbjct  251   NDPARQKTVFYGEYLCSGPGSIRSGRAKWSRELTKKEAEPFMTRKFVNGDKWL  303



>ref|XP_010505218.1| PREDICTED: probable pectinesterase 15 [Camelina sativa]
Length=397

 Score =   275 bits (703),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 198/319 (62%), Gaps = 17/319 (5%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q  T++++IVD  G G++  +Q AID+VP  +     I V  G+YREKV V  +K  I L
Sbjct  72    QYKTSLVLIVDLHGCGNFSNVQSAIDAVPDLSPSKTLIIVNSGSYREKVTVNENKTNIVL  131

Query  417   SGDDASNTVITWSD----GGDIIHSPTLTVFASDFVGRYLTIMNTFGR------SGKGVA  566
              G    NT I W+D     G    S +  VFA++F    ++  N           G+ VA
Sbjct  132   QGRGYQNTSIEWNDTAKSAGSTADSFSFVVFAANFTAYNISFKNIAPEPDPGEADGQAVA  191

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LR+ GD++A+YGC     QDTLLD++G+H++ +C+I+G +DFIFGN  SL++ C+I+SIA
Sbjct  192   LRIEGDQAAFYGCGFYGAQDTLLDDSGRHFFKDCFIQGSIDFIFGNGRSLYQDCKINSIA  251

Query  747   VGG------GAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSS  908
              G       G+ITAQ R+S +E +GF+F+ CKI G G  +LGR WG Y+ VV+ ++YMS 
Sbjct  252   KGNASAGVTGSITAQGRQSKDEESGFSFVNCKIDGIGEVLLGRAWGAYATVVFSNTYMSG  311

Query  909   AIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQ  1088
              I PEGWNDW DP +Q+TV +GE+KCYGPGA+  +RV + + L+++EA  F+    I G 
Sbjct  312   IITPEGWNDWGDPAKQKTVTFGEHKCYGPGANYKERVSFGKQLTESEASSFIDLSFINGD  371

Query  1089  EWLRQAPTNFKRMSSCKDM  1145
             +WL         ++S KD+
Sbjct  372   QWLNDHTNKLSDLTS-KDI  389



>gb|KDP46694.1| hypothetical protein JCGZ_06482 [Jatropha curcas]
Length=374

 Score =   274 bits (700),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 134/292 (46%), Positives = 180/292 (62%), Gaps = 16/292 (5%)
 Frame = +3

Query  270   QSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVIT  449
             +S  G ++ +Q AIDS+P  N+  V IS+  GTYREKV +P    +ITL GD    T+I 
Sbjct  81    KSKSGGFVTVQKAIDSIPIVNNCRVVISISAGTYREKVEIPASMAYITLEGDGTGKTIIE  140

Query  450   WSDGGDIIH----------SPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSG  581
             W D  D +           S T  + +  F+ + +T  N       G  GK  VALR+S 
Sbjct  141   WDDTADKMGQGGHRLGTYGSATFAINSPYFIAKNITFKNKAPSPPSGALGKQAVALRISA  200

Query  582   DRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGA  761
             D +A+ GC     QDTL D  G+HY+ +CYIEG VDFIFGN  SL+E C +H+I    GA
Sbjct  201   DTAAFIGCNFIGAQDTLYDHIGRHYFKDCYIEGSVDFIFGNGLSLYENCHLHAITNSFGA  260

Query  762   ITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWD  941
             +TAQ+R+S  + TGF+F+ CK+TG+G   LGR WG +SRVV+  +YM   I P GW +W 
Sbjct  261   LTAQKRDSMLQETGFSFVNCKVTGSGALYLGRAWGSFSRVVFAYTYMDKIITPRGWYNWG  320

Query  942   DPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             D  R+ TV+YG+YKC GPGAD   RV WSR L++ EAKPF++   I+G +WL
Sbjct  321   DKNREMTVFYGQYKCSGPGADFGGRVSWSRELTEEEAKPFISIGFIDGHQWL  372



>ref|XP_002458469.1| hypothetical protein SORBIDRAFT_03g034250 [Sorghum bicolor]
 gb|EES03589.1| hypothetical protein SORBIDRAFT_03g034250 [Sorghum bicolor]
Length=402

 Score =   275 bits (703),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 185/307 (60%), Gaps = 25/307 (8%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L++      GD+  IQ AIDS+P  N   V I V  GTY EKV +   + FITL G  A 
Sbjct  95    LVVDKNPAFGDFTTIQAAIDSLPVINLVRVVIRVNAGTYTEKVSISAMRAFITLEGAGAD  154

Query  435   NTVITWSDGGD-----------IIHSPTLTVFASDFVGRYLTI--------MNTF-----  542
             +T++ W D  D             +S T  V A  F+ R +T          NT      
Sbjct  155   STIVQWGDTADSPTGPKGRPLGTFNSATFAVNAQYFLARNITFKLWHWAAGQNTSPVPKP  214

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G +GK  VALRVS D +A+ GC+    QDTL D +G+HYY  CYIEG VDFIFGNA SL+
Sbjct  215   GATGKQAVALRVSADNAAFVGCKFLGAQDTLYDHSGRHYYKECYIEGSVDFIFGNALSLY  274

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             E C +H+IA   GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +Y
Sbjct  275   EDCHVHAIARDYGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTY  334

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M + I P GW +W DP R+ TV+YG+YKC GPGA  + RV WS  L+  EAKPF++   I
Sbjct  335   MDNIIIPNGWYNWGDPNRELTVFYGQYKCTGPGASYAGRVAWSHELTDDEAKPFISLSFI  394

Query  1080  EGQEWLR  1100
             +G EW+R
Sbjct  395   DGTEWIR  401



>gb|EYU27429.1| hypothetical protein MIMGU_mgv1a008712mg [Erythranthe guttata]
Length=365

 Score =   273 bits (699),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 194/300 (65%), Gaps = 19/300 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+VD+ G GD + +Q A+D VP  N + V I + PG YREKV +P +KP+I+L GD+  
Sbjct  66    VIVVDKYGRGDSLTVQGAVDLVPENNRQRVKIHLLPGLYREKVHIPANKPYISLIGDENQ  125

Query  429   ASNTVITWSD-------GGDII---HSPTLTVFASDFVGRYLTIMNTF-----GRSG-KG  560
             AS TVITW D       GG  I   +S T+TV +  F    +T  NT      G +G + 
Sbjct  126   ASATVITWHDKAADILPGGGFIGTWNSATVTVESDFFCASSITFQNTVKALTGGVNGYQA  185

Query  561   VALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHS  740
             VA+R+SG+++ +Y  R    QDTLLDE G HY+  C+I+G  DF+FGNA SL++ C I S
Sbjct  186   VAMRISGEKAVFYKARFLGSQDTLLDEIGSHYFYQCFIQGSTDFVFGNAKSLYQECAI-S  244

Query  741   IAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQP  920
             +   G AI A  R SA+E TGF+F+ C ++GTG   LGR WG YSRV++  +     ++P
Sbjct  245   LVDEGFAIAAHHRNSADEETGFSFVNCTVSGTGYIYLGRAWGNYSRVIYSYTEFDVNVRP  304

Query  921   EGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             +GW DW+ P RQ TV +GEY+C G GADRS+R +WS++L+ +EA+PF+    I G++WLR
Sbjct  305   QGWEDWNIPSRQNTVLFGEYECRGRGADRSRRAQWSKALNYSEARPFLDTAFITGEQWLR  364



>ref|XP_009599854.1| PREDICTED: probable pectinesterase 53 [Nicotiana tomentosiformis]
Length=372

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 177/289 (61%), Gaps = 16/289 (6%)
 Frame = +3

Query  279   HGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWSD  458
             HGD+  +Q AIDS+P  NS  V ISV PG YREK+ +P    +ITL G  +  T I W D
Sbjct  81    HGDFTTVQKAIDSIPIVNSCRVVISVSPGIYREKIEIPATMAYITLEGAGSRKTTIKWDD  140

Query  459   GGDIIH----------SPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSGDRS  590
               D +           S T  V +  F+ + +T  N       G  GK  VALR+S D +
Sbjct  141   TADRLGKDGQPMGTYGSATFAVNSPYFIAKNITFKNVAPPPPSGALGKQAVALRISADTA  200

Query  591   AWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITA  770
             A+  C+    QDTL D  G+HY+ NCYI+G VDFIFG+  SL+E C +H+     GA+TA
Sbjct  201   AFINCKFIGAQDTLYDHRGRHYFKNCYIQGSVDFIFGDGLSLYENCHLHAKTKSYGALTA  260

Query  771   QRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPK  950
             Q+RES  E TGF+F+ CK+TG+G   LGR WG +SRVV+  +YM   I  +GW DW D  
Sbjct  261   QKRESMLEETGFSFVNCKVTGSGALYLGRAWGTFSRVVFAYTYMDKIITSKGWYDWGDKN  320

Query  951   RQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             R  TV+YG++KC GPGA+   RV+WSR L++ EAKPF++   I+G EWL
Sbjct  321   RHMTVFYGQFKCSGPGANHGGRVKWSRELTEQEAKPFVSLSFIDGHEWL  369



>ref|XP_009126995.1| PREDICTED: pectinesterase QRT1-like [Brassica rapa]
Length=378

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 185/299 (62%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+V+++G GD + +Q A+D VP  NSE V I + PG YREKV VP+ KP+I+  G    
Sbjct  79    VIVVEKNGRGDSVTVQGAVDMVPDSNSERVKIYILPGIYREKVNVPITKPYISFIGSQKY  138

Query  429   ASNTVITWSD--------GGDI--IHSPTLTVFASDFVGRYLTIMNTF-----GRSGKGV  563
                TVI+WSD        G +I    + T+TV +  F    +TI NT       +  +  
Sbjct  139   VGKTVISWSDKASDRYSNGSEIGTYRTATVTVDSDFFCATAITIQNTVVAVPGDQGNQAA  198

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR+ GD++  Y  RI   QDTL DE+G HY+  CYIEG VDFIFGNA SL+  C I S 
Sbjct  199   ALRIKGDKAMLYSVRILGSQDTLDDESGSHYFLKCYIEGNVDFIFGNAKSLYRDCYIRSN  258

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A   G+I A  R+   E+TGF+F+ C I+GTG   LGR WG Y+R+++ + Y++  I P 
Sbjct  259   AKRFGSIAAHHRDRENEDTGFSFVNCTISGTGNVTLGRAWGNYARIIYSNCYIADVITPA  318

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW+DW DP R   V +GEY C G GADR+ RV WS+SL++ EAKPF+  + I G +WLR
Sbjct  319   GWDDWSDPARDSEVLFGEYNCTGKGADRTGRVPWSKSLTQDEAKPFLGMEFISGDQWLR  377



>ref|XP_011095807.1| PREDICTED: pectinesterase QRT1-like [Sesamum indicum]
Length=357

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 190/300 (63%), Gaps = 19/300 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+VD +G GD + +Q A+D VP  N+E V I V PG YREKV VP +KP+I+  GD   
Sbjct  58    VIVVDVNGRGDSVTVQGAVDMVPENNAERVKIHVLPGVYREKVHVPANKPYISFIGDQDQ  117

Query  429   ASNTVITWSD--------GGDI--IHSPTLTVFASDFVGRYLTIMNTFGRSGKGV-----  563
             AS TVITW D        GG I    S ++TV +  F    +T  NT   +G GV     
Sbjct  118   ASATVITWHDKASDQAPTGGFIGTWKSASVTVESDYFCASGITFENTVVAAGGGVDGYQA  177

Query  564   -ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHS  740
              ALR+SG+++ +Y  R    QDTLLDE+G HY+ +C I+G VDFIFGNA SL++ CEI S
Sbjct  178   VALRISGEKAVFYKVRFLGSQDTLLDESGSHYFFHCLIQGSVDFIFGNARSLYQECEI-S  236

Query  741   IAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQP  920
             +   G A+ AQ R S  E+TGF+F+ C ++GTG   LGR WG YSR+++        ++P
Sbjct  237   VVGDGFAVAAQHRNSVAEDTGFSFVNCTVSGTGNVYLGRAWGNYSRIIYSYCEFDIDVRP  296

Query  921   EGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             EGW DW  P RQ TV +GEY+C G GADR++R  WSR+L+ +EA+PF     I G++WLR
Sbjct  297   EGWEDWRIPSRQNTVVFGEYECRGRGADRTRRAPWSRALNCSEARPFFDTTFIRGEQWLR  356



>ref|XP_006654665.1| PREDICTED: probable pectinesterase 53-like [Oryza brachyantha]
Length=395

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/301 (46%), Positives = 184/301 (61%), Gaps = 16/301 (5%)
 Frame = +3

Query  246   TAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGD  425
             T  L++      G++  IQ A+DS+P  N   V I V  GTY EKV +   + F+T+ G 
Sbjct  94    TRTLVVDKNPAAGNFTSIQAAVDSLPLINLARVVIKVNAGTYTEKVTISPLRAFVTIEGA  153

Query  426   DASNTVITWSDGGDII----------HSPTLTVFASDFVGRYLTIMNTF-----GRSGK-  557
              A  TV+ W D  D +           S T  V A  FV + ++  NT      G  GK 
Sbjct  154   GADKTVVQWGDTADTVGPFGRPFGTFASATFAVNAQYFVAKNISFKNTAPVPRPGALGKQ  213

Query  558   GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIH  737
             GVALR+S D +A+ GC     QDTL D  G+HYY +CYIEG VDFIFGNA SL+EGC +H
Sbjct  214   GVALRISADNAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDFIFGNALSLYEGCHVH  273

Query  738   SIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQ  917
             +IA   GA+TAQ R S  E+TGF+F+ C++TG+G   LG   G +SRV++  +YM + I 
Sbjct  274   AIARNYGALTAQNRMSILEDTGFSFVNCRVTGSGALYLGXXXGTFSRVIFAYTYMDNIII  333

Query  918   PEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             P GW +W DP R+ TV+YG+YKC GPGA+ + RV WSR L+  EAKPF++   I+G EW+
Sbjct  334   PRGWYNWGDPTREMTVFYGQYKCTGPGANYAGRVAWSRELTDQEAKPFISLSFIDGLEWV  393

Query  1098  R  1100
             +
Sbjct  394   K  394



>ref|XP_004244060.1| PREDICTED: pectinesterase QRT1-like [Solanum lycopersicum]
Length=357

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 190/303 (63%), Gaps = 21/303 (7%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             +I+VD  G+GD + +Q AID VP  NS+ + I V PG YREKV +P  KPF++L GD+  
Sbjct  54    IIVVDSRGYGDSVTVQGAIDMVPEFNSQRIKILVLPGVYREKVFIPSSKPFVSLIGDENH  113

Query  429   ASNTVITWSD--------GGDI--IHSPTLTVFASDFVGRYLTIMNTFG-----RSGKGV  563
                T+IT +         G +I  + + T+TV +  F    +T  NT          +GV
Sbjct  114   PRRTIITGNSKACDKDQYGNEIGTVATATVTVESDYFCATGITFENTVAAMRQENDKQGV  173

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR++GD++  Y  RI   QDTL D+ G HY+  CYI+G VDFI GNA SLF+ CE+HSI
Sbjct  174   ALRLAGDKAMLYKVRILGSQDTLYDDKGSHYFFKCYIQGTVDFICGNARSLFQSCELHSI  233

Query  744   A---VG-GGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSA  911
             A   VG  GAI A  RES  ++TGF+F+ CK+TG+G+  LGR WG YSR+++   Y  + 
Sbjct  234   APDNVGISGAIAAHERESPYDDTGFSFVNCKVTGSGSVFLGRAWGEYSRIIYSKCYFDAI  293

Query  912   IQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQE  1091
             I P+GW+DWD P RQ   ++GEY C G GA+R+ RV WS   ++ +A+PFM +  I G E
Sbjct  294   IHPQGWSDWDVPSRQEHAFFGEYSCKGIGANRAGRVPWSNDFTQHQAQPFMKRDFIGGDE  353

Query  1092  WLR  1100
             WLR
Sbjct  354   WLR  356



>ref|XP_010936490.1| PREDICTED: pectinesterase QRT1-like [Elaeis guineensis]
Length=371

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 196/309 (63%), Gaps = 16/309 (5%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
             G  L   + + +++V + G GD   +Q A++ VP  N E V I + PG YREKV++P+ K
Sbjct  62    GNNLIDRAHSRVMLVSKDGSGDSRTVQGAVNIVPDGNKERVKIFISPGVYREKVIIPITK  121

Query  402   PFITLSGDDASNTVITW----SDGGD------IIHSPTLTVFASDFVGRYLTIMNTFGRS  551
             P+I+   + +S TVI+W    SD G         +S ++ V +  F  + +T  NT   +
Sbjct  122   PYISFIANGSSETVISWHSKASDRGPNGRTVGTFYSASVAVESDYFCAKGITFENTAQGA  181

Query  552   GKG------VALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAAS  713
               G      VALR+SGD++  Y CRI   QDTL D  G+HY+  CY++G +DFIFGNA S
Sbjct  182   VPGAIGMQAVALRLSGDKAMLYRCRILGSQDTLFDHMGRHYFLECYVQGSIDFIFGNARS  241

Query  714   LFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVS  893
             L++GC +H++A+  GA+ A +R S ++++GF+FL C++ G+G   LGR WG Y+RVV+  
Sbjct  242   LYQGCRLHAVAMSYGAVAASQRNSPKDDSGFSFLDCRLDGSGILYLGRAWGRYARVVYSY  301

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
               +   I PEGW+DW DP R RTV++GE+ C G GA+  KRV+W+RSL+  EA+PF+ + 
Sbjct  302   CQLEGIIIPEGWSDWGDPSRTRTVWFGEFNCSGKGANLRKRVQWARSLNYDEARPFLDQN  361

Query  1074  MIEGQEWLR  1100
              I+G +WLR
Sbjct  362   YIDGNQWLR  370



>ref|XP_010675900.1| PREDICTED: pectinesterase QRT1 [Beta vulgaris subsp. vulgaris]
Length=361

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/311 (45%), Positives = 197/311 (63%), Gaps = 19/311 (6%)
 Frame = +3

Query  225   VKLKQT-STAVLIIVDQSGH-GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVD  398
             +K KQ  + + +I+VD+SG  GD + +Q A+D VP  NS+ + I + PG YRE+V VP  
Sbjct  50    IKGKQNWNNSGIIVVDKSGKTGDSVTVQGAVDLVPYGNSQRIRILILPGIYRERVTVPSS  109

Query  399   KPFITLSG--DDASNTVITW--------SDGGDI--IHSPTLTVFASDFVGRYLTIMNTF  542
             KP+I+  G  + ASNTVITW        S+G ++    S T+T+++  F    +T  NT 
Sbjct  110   KPYISFIGTENQASNTVITWNNKASDKNSNGVELGTFGSATITIYSDYFCASQITFENTV  169

Query  543   -----GRSGKGVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNA  707
                  G   + VALRV+ +R+ +Y   +   QDTLLDE G HY+ +C I+G VDFIFGNA
Sbjct  170   VAIPGGLGMQAVALRVAAERAMFYKVNVLGSQDTLLDETGSHYFYHCLIQGSVDFIFGNA  229

Query  708   ASLFEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVW  887
              SL++   + SIA   GAI A  R S +ENTGF+FL C I+G+G   LGR WGPYSR V+
Sbjct  230   RSLYQNSVLRSIANRSGAIAAHHRNSPDENTGFSFLNCTISGSGMIYLGRAWGPYSRAVY  289

Query  888   VSSYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMT  1067
                 M   I PEGW+DW DP+RQ+T  +GE++C G GA+ ++RV W++S    +A+PF+ 
Sbjct  290   SYCNMGDVIAPEGWSDWGDPERQKTTVFGEFQCIGTGANTTRRVPWAKSFRIDDARPFLD  349

Query  1068  KKMIEGQEWLR  1100
              + I+G +WLR
Sbjct  350   MEFIDGNKWLR  360



>ref|NP_001167796.1| pectinesterase precursor [Zea mays]
 gb|ACN26093.1| unknown [Zea mays]
 tpg|DAA57696.1| TPA: pectinesterase [Zea mays]
Length=399

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 185/307 (60%), Gaps = 25/307 (8%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             L++      GD+  IQ A+DS+P+ N   V I V  GTY EKV V   + FITL G  A 
Sbjct  92    LVVDKDPALGDFTTIQAAVDSLPAINLVRVVIRVNAGTYTEKVTVSAMRAFITLEGAGAD  151

Query  435   NTVITWSDGGD-----------IIHSPTLTVFASDFVGRYLTI--------MNTF-----  542
              TV+ W D  D             +S +  V A  F+ R +T          NT      
Sbjct  152   KTVVQWGDTADSPTGPKGRPLGTFNSASFAVNAQYFLARNITFKFWRWRAGQNTSPVPKP  211

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G +GK  VALRVS D +A+ GCR    QDTL D +G+HYY +CYI+G VDFIFGNA SL+
Sbjct  212   GAAGKQAVALRVSADNAAFVGCRFLGAQDTLYDHSGRHYYKDCYIQGSVDFIFGNALSLY  271

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             E C +H+IA   GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  ++
Sbjct  272   EDCHVHAIARDYGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTH  331

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M   I P GW +W DP R+ TV+YG+YKC GPGA  + RV WS  L+  EAKPF++   I
Sbjct  332   MDDIIVPNGWFNWGDPNRELTVFYGQYKCTGPGATYAGRVAWSHELTDDEAKPFISLSFI  391

Query  1080  EGQEWLR  1100
             +G EW+R
Sbjct  392   DGTEWVR  398



>ref|XP_010037120.1| PREDICTED: probable pectinesterase 15 [Eucalyptus grandis]
Length=402

 Score =   273 bits (698),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 191/309 (62%), Gaps = 16/309 (5%)
 Frame = +3

Query  252   VLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDA  431
             +++ VD  G  ++  +Q A+D+VP  +     I +  GTYREKVVV   K  I L G   
Sbjct  93    LVLTVDLKGCANFSSVQRAVDAVPDFSPSRTLILLDSGTYREKVVVNASKTNIILEGQGY  152

Query  432   SNTVITWSDG----GDIIHSPTLTVFASDFVGRYLTIMNTFGRS------GKGVALRVSG  581
              NT I W+D     G  I+SP++ VFA +F    ++  NT          G+ VALR++G
Sbjct  153   LNTAIAWNDTANSTGGTIYSPSVAVFADNFTAYNISFQNTAPSPSPGDVGGQAVALRIAG  212

Query  582   DRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVG---  752
             D +A++GC     QDTL D+AG+HY+ +C+IEG +DFIFGNA SL+EGC I+SIA     
Sbjct  213   DEAAFFGCGFYGAQDTLHDDAGRHYFGDCFIEGSIDFIFGNARSLYEGCTINSIAKDVTA  272

Query  753   --GGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEG  926
                GAITAQ R+S  E+TGF+F+ C+I G+G   LGR WG Y+ VV+  +YMS  + PEG
Sbjct  273   GISGAITAQGRDSGSEHTGFSFVNCRIGGSGRVWLGRAWGAYATVVFSKTYMSDIVDPEG  332

Query  927   WNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL-RQ  1103
             WNDW DP R  TV++GEY C GPGA+ + RVE+ R L  +EA  F+    I+G +WL  +
Sbjct  333   WNDWRDPSRDETVFFGEYDCRGPGANYTTRVEYGRLLKPSEASLFLDISYIDGHDWLPER  392

Query  1104  APTNFKRMS  1130
              P+   R S
Sbjct  393   HPSFLARTS  401



>ref|XP_009411137.1| PREDICTED: pectinesterase QRT1 [Musa acuminata subsp. malaccensis]
Length=343

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/298 (45%), Positives = 188/298 (63%), Gaps = 16/298 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             +I+V + G GD   +Q A+D +P  N E V I + PG YREKV+VP  KPF++  G+ +S
Sbjct  45    VILVSKDGTGDSRTVQGAVDMIPDGNKERVKILINPGVYREKVIVPKTKPFVSFIGNQSS  104

Query  435   NTVIT--------WSDGGDI--IHSPTLTVFASDFVGRYLTIMNTF-----GRSG-KGVA  566
              TVI+        +S+G ++    S T+ V +  F    +T  NT      G  G + VA
Sbjct  105   ETVISFHLRASDRYSNGQNVGTFDSATVAVESDYFCANGITFENTAPAAQPGEEGMQAVA  164

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LR++GD++  Y CRI   QDTL D  G+HY+  CYI+G +DFIFG+A SL++ C +H++A
Sbjct  165   LRLTGDKAMIYRCRILGSQDTLFDHYGRHYFYECYIQGSIDFIFGSARSLYQACTLHAVA  224

Query  747   VGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEG  926
                GA+ A +R S  +N+GF+FL C++ GTG   LGR WG Y+RVV+    +   I PEG
Sbjct  225   ESYGAVAASQRNSPMDNSGFSFLECRLNGTGLLYLGRAWGRYARVVYSYCQLEGIILPEG  284

Query  927   WNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             WNDW DP R+ TVY+G++ C G GA+   RV W+RSL+  EAKPFM +  I+G+ WLR
Sbjct  285   WNDWGDPSRKSTVYFGQFNCKGDGANLQGRVSWARSLTYLEAKPFMDRGYIDGELWLR  342



>ref|XP_006340937.1| PREDICTED: probable pectinesterase 53-like [Solanum tuberosum]
Length=355

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/288 (46%), Positives = 174/288 (60%), Gaps = 16/288 (6%)
 Frame = +3

Query  282   GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWSDG  461
             GD+  +Q AIDS+P  NS  V ISV PGTYREK+ +P    +ITL G  +  T I W D 
Sbjct  65    GDFTTVQKAIDSIPIVNSCRVVISVSPGTYREKIEIPATMAYITLEGAGSHKTTIKWDDT  124

Query  462   GD----------IIHSPTLTVFASDFVGRYLTIMNTFGRSGKG------VALRVSGDRSA  593
              D             S T  V +  F+ + +T  N       G      VALR+S D +A
Sbjct  125   ADRTGKSGQPMGTYGSATFAVNSPYFIAKNITFKNVAPPPPSGALRKQAVALRISADTAA  184

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +  C+    QDTL D  G+HY+ NCYI+G VDFIFG+  SL+E C + +     GA+TAQ
Sbjct  185   FINCKFIGAQDTLYDHRGRHYFKNCYIQGSVDFIFGDGLSLYENCHLRAKTKSYGALTAQ  244

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             +RES  E TGF+FL CK+TG+G   LGR WG +SRVV+  +YM   I  +GW DW D  R
Sbjct  245   KRESLLEETGFSFLNCKVTGSGALYLGRAWGTFSRVVFAYTYMDKIITSKGWYDWGDKNR  304

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
               TV+YG++KC GPGAD  +RV+WSR L++ EAKPF++   I+G EWL
Sbjct  305   HMTVFYGQFKCSGPGADHGERVKWSRELTEQEAKPFISLSFIDGHEWL  352



>ref|XP_010936491.1| PREDICTED: pectinesterase QRT1-like [Elaeis guineensis]
Length=369

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/298 (43%), Positives = 191/298 (64%), Gaps = 16/298 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             +I+V + G GD   +Q A++ +P  N E V I + PG YREKV++P+ KP+I+     +S
Sbjct  71    VILVSKDGSGDSRTVQGAVNMIPDGNKERVKIFISPGVYREKVIIPMRKPYISFIATGSS  130

Query  435   NTVITW----SDGGD------IIHSPTLTVFASDFVGRYLTIMNTFGRSGKG------VA  566
              TVI+W    SD G         +S ++ V +  F  + +T  NT   +G G      VA
Sbjct  131   QTVISWHSRASDRGPNGQTVGTFYSASVAVESDYFCAKGITFENTAQGAGPGAIGMQAVA  190

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LR+SGD++  Y CRI   QDTL D  G+HY+  CY++G +DFIFGNA SL++GC +H++A
Sbjct  191   LRLSGDKAMLYRCRILGSQDTLFDHMGRHYFLECYVQGSIDFIFGNARSLYQGCRLHAVA  250

Query  747   VGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEG  926
             +  GA+ A +R S ++++GF+FL C++ G+G   LGR WG Y+RVV+    +   I PEG
Sbjct  251   MSYGAVAASQRNSPKDDSGFSFLDCRLDGSGILYLGRAWGRYARVVYSYCQLEGIIIPEG  310

Query  927   WNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             W+DW DP R RT ++GE+ C G GA+  +RV+W+RSL+  EA+PF+ +  I+G +WLR
Sbjct  311   WSDWGDPSRTRTAWFGEFNCSGKGANLRERVQWARSLNYNEARPFLDQNYIDGDQWLR  368



>ref|XP_010316821.1| PREDICTED: probable pectinesterase 53 [Solanum lycopersicum]
Length=362

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/288 (47%), Positives = 176/288 (61%), Gaps = 16/288 (6%)
 Frame = +3

Query  282   GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWSDG  461
             GD+  +Q AIDS+P  NS  V ISV PGTYREK+ +P    +ITL G  +  T I W D 
Sbjct  72    GDFTTVQKAIDSIPIVNSCRVVISVSPGTYREKIEIPATMAYITLEGAASHKTTIKWDDT  131

Query  462   GD----------IIHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSGDRSA  593
              D             S T  V +  F+ + +T  N       G  GK  VALR+S D +A
Sbjct  132   ADRTGKSGQPMGTYGSATFAVNSPYFIAKNITFKNVAPPPPSGALGKQAVALRISADTAA  191

Query  594   WYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQ  773
             +  C+    QDTL D  G+HY+ NCYI+G VDFIFG+  SL+E C + +     GA+TAQ
Sbjct  192   FINCKFIGAQDTLYDHRGRHYFKNCYIQGSVDFIFGDGLSLYENCHLRAKTKSYGALTAQ  251

Query  774   RRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKR  953
             +RES  E TGF+FL CK+TG+G   LGR WG +SRVV+  +YM   I  +GW DW D  R
Sbjct  252   KRESLLEETGFSFLNCKVTGSGALYLGRAWGTFSRVVFAYTYMDKIITSKGWYDWGDKNR  311

Query  954   QRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
               TV++G++KC GPGAD  +RV+WSR L++ EAKPF++   I+G EWL
Sbjct  312   HMTVFFGQFKCSGPGADHGERVKWSRELTEQEAKPFISLSFIDGHEWL  359



>ref|XP_007145123.1| hypothetical protein PHAVU_007G212000g [Phaseolus vulgaris]
 gb|ESW17117.1| hypothetical protein PHAVU_007G212000g [Phaseolus vulgaris]
Length=370

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/307 (45%), Positives = 190/307 (62%), Gaps = 16/307 (5%)
 Frame = +3

Query  225   VKLKQT-STAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDK  401
             +KL+Q  S  V+I V Q G  D+  I +A++S+P +N+  V +S+ PG YREKV++P   
Sbjct  61    LKLRQAESNKVIITVSQDGSADFKTISEALNSIPPRNTMRVIVSISPGVYREKVMIPRTM  120

Query  402   PFITLSGDDASNTVITWSDGGD----------IIHSPTLTVFASDFVGRYLTIMNT----  539
             PFITLSG+  +   IT +D               HS T+ V AS FV   +   N+    
Sbjct  121   PFITLSGEAGNPPTITGNDTASASKRNGTPLGTFHSATVAVDASYFVAINIKFENSAPHE  180

Query  540   FGRSG-KGVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              GR G +GVALR+SG ++A+Y C     QDTL D  G H++ NC I+G VDFIFG A SL
Sbjct  181   IGRRGEQGVALRISGTKAAFYNCSFNGAQDTLYDHKGLHFFHNCSIQGSVDFIFGYARSL  240

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             ++ C ++S      +ITAQ+R ++  ++GF+F  C +TG+G   LGR WG YSRVV+  +
Sbjct  241   YQNCYLNSTTKKVASITAQKRTNSSLDSGFSFQNCTVTGSGKVYLGRAWGDYSRVVFSYT  300

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             YM + + P+GW+DW D KR   VYYGEY C GPGA+ + RV W+R L+  EAKPF+  + 
Sbjct  301   YMDNLVLPKGWSDWGDQKRDSRVYYGEYMCSGPGANMAGRVPWARVLTDEEAKPFIGTQF  360

Query  1077  IEGQEWL  1097
             IEG  WL
Sbjct  361   IEGDTWL  367



>ref|XP_003631899.2| PREDICTED: probable pectinesterase 53 [Vitis vinifera]
 emb|CBI17409.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 189/306 (62%), Gaps = 18/306 (6%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             KLK   T + +  DQS  G +  +Q A+DS+P  N   V IS+  G YREKVV+P  K +
Sbjct  58    KLKPCLT-IKVDKDQS-LGHFASVQKAVDSLPVNNPCRVVISIGAGIYREKVVIPAIKAY  115

Query  408   ITLSGDDASNTVITWSDGGDIIH----------SPTLTVFASDFVGRYLTIMNTF-----  542
             ++L G  A  T+I W+D  D++           S T  V +  F+ + +T  N       
Sbjct  116   VSLEGAGADKTIIEWNDTADLVGQTGRPLGTFGSATFAVNSPYFIAKNITFQNKAPPPPS  175

Query  543   GRSGK-GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLF  719
             G  GK  VALR+S D +A+ GC+    QDTL D  G+HY+ +CYI+G VDFIFGN  SL+
Sbjct  176   GALGKQAVALRISADTAAFIGCKFIGAQDTLYDHMGRHYFRDCYIQGSVDFIFGNGLSLY  235

Query  720   EGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSY  899
             EGC +H+I    GA+TAQ+R+   E TGF+F+ CK+TG+G   LGR WG +SRVV+  ++
Sbjct  236   EGCHLHAITNSVGALTAQKRDGLLEETGFSFVHCKVTGSGALYLGRAWGTFSRVVFAFTF  295

Query  900   MSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMI  1079
             M   I P GW  W +  R+ TV+YG+Y+C GPGAD  +RV WSR L++ EAKPF++   +
Sbjct  296   MDKIINPSGWYAWGNKSREMTVFYGQYQCSGPGADFGRRVSWSRELTQQEAKPFISIGFV  355

Query  1080  EGQEWL  1097
             +G EWL
Sbjct  356   DGYEWL  361



>ref|XP_010516895.1| PREDICTED: probable pectinesterase 15 [Camelina sativa]
Length=406

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/319 (42%), Positives = 196/319 (61%), Gaps = 17/319 (5%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q  T++++IVD  G G++  +Q AID+VP  +     I V  G+YREKV+V  +K  I L
Sbjct  81    QYKTSLVLIVDLHGCGNFSNVQSAIDAVPDLSPSKTLIIVNSGSYREKVMVNENKTNIVL  140

Query  417   SGDDASNTVITWSD----GGDIIHSPTLTVFASDFVGRYLTIMNTFGR------SGKGVA  566
              G    NT I W+D     G    S +  VFA++F    ++  N           G+ VA
Sbjct  141   QGRGYQNTSIEWNDTAKSAGSTADSFSFVVFAANFTAYNISFKNNAPEPDPGEADGQAVA  200

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LR+ GD++A+YGC     QDTLLD+ G+H++ +C+I+G +DFIFGN  SL++ C I+SIA
Sbjct  201   LRIEGDQAAFYGCGFYGAQDTLLDDKGRHFFKDCFIQGSIDFIFGNGRSLYQDCTINSIA  260

Query  747   VGG------GAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSS  908
              G       G+ITAQ R+S +E +GF+F+ CKI G+G  +LGR WG Y+ VV+ ++YMS 
Sbjct  261   KGNASAGVTGSITAQGRQSKDEESGFSFVNCKIDGSGEVLLGRAWGAYATVVFSNTYMSG  320

Query  909   AIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQ  1088
              I P+GWNDW DP +Q+T  +GE+KCYGPGA+  +RV + + L+ +EA  F+    I G 
Sbjct  321   IITPQGWNDWGDPAKQKTATFGEHKCYGPGANYKERVSFGKQLTDSEASSFIDLSFINGD  380

Query  1089  EWLRQAPTNFKRMSSCKDM  1145
             +WL         ++S KD+
Sbjct  381   QWLNDHTNKLSDLTS-KDI  398



>gb|EYU24077.1| hypothetical protein MIMGU_mgv1a008262mg [Erythranthe guttata]
Length=379

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/298 (45%), Positives = 182/298 (61%), Gaps = 17/298 (6%)
 Frame = +3

Query  255   LIIVDQSGH-GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDA  431
              I V+Q+   GD+  ++ AI+S+P  N   V ISV PGTYREK+ +P    ++TL G  A
Sbjct  79    FIKVNQNPKLGDFTTVKKAINSIPLFNPCRVVISVSPGTYREKIEIPASMAYVTLEGSGA  138

Query  432   SNTVITWSDGGDIIH----------SPTLTVFASDFVGRYLTIMN-----TFGRSGK-GV  563
             + T+I W D  D I           S T  V A  F+ R +T  N       G  GK  V
Sbjct  139   AKTIIRWDDTADRIGPNGAALGTYGSATFAVNAPFFLARNITFKNKSPAPLAGAIGKQAV  198

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR+S D +A+  C+    QDTL D  G+HY+ NC+I+G VDFIFG+  SL++ C +H+ 
Sbjct  199   ALRISADMAAFINCKFVGAQDTLYDHKGRHYFKNCHIQGSVDFIFGDGLSLYDSCHLHAK  258

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
                 GA+TAQ+RES  + TGF+F+ CK+TG G   LGR WG +SRVV+  +YM   I P 
Sbjct  259   TNNYGALTAQKRESMLDETGFSFVNCKVTGNGALYLGRAWGSFSRVVFAFTYMDKIITPR  318

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             GW DW D +R  TV+YG++KC GPGA+   RV W+R L+K EA+PF++   I+G EWL
Sbjct  319   GWYDWGDKQRHMTVFYGQFKCSGPGANYGGRVSWARELTKQEAQPFVSLSFIDGHEWL  376



>ref|XP_009802490.1| PREDICTED: probable pectinesterase 53 [Nicotiana sylvestris]
Length=372

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/289 (45%), Positives = 177/289 (61%), Gaps = 16/289 (6%)
 Frame = +3

Query  279   HGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWSD  458
             HGD+  +Q+AIDS+P  NS  V ISV PG YREK+ +P    +ITL G  +  T I W D
Sbjct  81    HGDFTTVQEAIDSIPIANSCRVVISVSPGIYREKIEIPATMAYITLEGASSRKTTIKWDD  140

Query  459   GGDIIH----------SPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSGDRS  590
               D +           S T  V +  F+ + +T  N       G  GK  VALR+S D +
Sbjct  141   TADRVGKDGQPMGTYGSATFAVNSPYFIAKNITFKNVAPPPPSGALGKQAVALRISADTA  200

Query  591   AWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITA  770
             A+  C+    QDTL D  G+HY+ NCYI+G VDFIFG+  SL+E C +++     GA+TA
Sbjct  201   AFINCKFIGAQDTLYDHRGRHYFKNCYIQGSVDFIFGDGLSLYENCHLNAKTKSYGALTA  260

Query  771   QRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPK  950
             Q+RES  E TGF+F+ CK+TG+G   LGR WG +SRV++  +YM   I  +GW DW D  
Sbjct  261   QKRESMLEETGFSFVNCKVTGSGALYLGRAWGTFSRVIFAYTYMDKIITSKGWYDWGDKN  320

Query  951   RQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             R  TV+YG++KC GPGA+   RV+WSR L++ EA PF++   I+G EWL
Sbjct  321   RHMTVFYGQFKCSGPGANHGGRVKWSRELTEQEANPFVSLSFIDGHEWL  369



>ref|XP_008355312.1| PREDICTED: pectinesterase QRT1-like [Malus domestica]
Length=361

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 192/308 (62%), Gaps = 17/308 (6%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPF  407
             K ++ + + +I+VD++G GD + +Q A+D VP +N+E + I + PG YREKV+VP+ KP+
Sbjct  53    KEERVNXSRIIVVDKNGGGDSLTVQGAVDMVPEQNTERIKIYILPGIYREKVLVPISKPY  112

Query  408   ITLSGD--DASNTVITWSDGGD----------IIHSPTLTVFASDFVGRYLTIMNTF---  542
             I+  G+  + S TVITW++                + ++ + A  F    +T  NT    
Sbjct  113   ISFIGNQXNTSETVITWNNKASDKDGTGCELGTYRTASVAIEADYFCATGITFENTVVAV  172

Query  543   --GRSGKGVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
               G   + VALRV+GD++ +Y  R+   QDTLLDE G HY+ +C+I+G VDFIFG + SL
Sbjct  173   PGGYGMQAVALRVAGDKAMFYRVRVLGTQDTLLDETGSHYFYHCHIQGNVDFIFGRSRSL  232

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
             ++ C I S A   GAI A  R+S  E+TGF+F+ CKI GTG   LGR WG YSR V+   
Sbjct  233   YQECVIQSTAENSGAIAAHHRDSPYEDTGFSFVNCKIIGTGYIYLGRAWGNYSRAVYSYC  292

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKM  1076
             +    I P GW+DW+ P RQ+TV +GEYKC G GA+RS RV W +S S  E +PF+  K 
Sbjct  293   HFDDIITPPGWSDWNYPSRQKTVDFGEYKCRGRGAERSGRVPWLKSFSLEEIRPFLDTKF  352

Query  1077  IEGQEWLR  1100
             I G++WLR
Sbjct  353   ISGEQWLR  360



>gb|EYU27253.1| hypothetical protein MIMGU_mgv1a022744mg, partial [Erythranthe 
guttata]
Length=301

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 184/298 (62%), Gaps = 17/298 (6%)
 Frame = +3

Query  249   AVLIIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGD  425
             +++IIVD++ G G++  IQ AIDS+P  N E V I V  G Y EKV +P  K +I + G 
Sbjct  3     SIIIIVDKNPGSGNFTSIQGAIDSLPLVNQERVLIDVHAGIYTEKVTIPSTKAYIKIQGA  62

Query  426   DASNTVITWSDGG-----DIIHSPTLTVFASDFVGRYLTIMNTFGR---------SGKGV  563
              A NTV+ W D           S T  V A  FV + +T  +T  +         + K V
Sbjct  63    GAENTVVQWGDTARSQPLGTYGSATFGVDAPYFVAKNITFKHTSFKIKIQRYHFATDKRV  122

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR+SGD SA+ GC+    QDTL D  G+HYY +CYIEG VDFIFG+  S F+GCE+H+I
Sbjct  123   ALRISGDASAFAGCKFLGAQDTLYDHKGRHYYEDCYIEGSVDFIFGDGRSYFKGCELHAI  182

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A G  A+ AQ R ++ ENTGF+ + CK+TG+    LGR W P+S  V+  +YM + + PE
Sbjct  183   ATG--AVAAQNRSASSENTGFSLVNCKVTGSDIVYLGRAWAPFSTTVFAYTYMENNVNPE  240

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
             GW DW+DP RQ TV +GEY+C GPG++ + RV+WS+ L+  EA  F +   I+  EWL
Sbjct  241   GWFDWNDPSRQSTVTFGEYQCSGPGSNTAGRVKWSKILTDEEAGRFTSLDFIDASEWL  298



>ref|XP_002531506.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF30860.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=367

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/298 (45%), Positives = 184/298 (62%), Gaps = 16/298 (5%)
 Frame = +3

Query  261   IVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNT  440
             +  +S  GD++ ++ A++S+P  N+  V IS+  GTYREK+ +P    +ITL G  A  T
Sbjct  70    VNKKSKSGDFVTLKKALNSIPVINNCRVIISIGAGTYREKIEIPGSMSYITLEGAGAGKT  129

Query  441   VITWSD-------GGDIIH---SPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALR  572
              I W D       GG ++    S T  + +  F+ + +T  N       G  GK  VALR
Sbjct  130   TIEWDDTADKQGQGGHLLGTYGSATFAINSPYFIAKNITFKNKAPSPPSGALGKQAVALR  189

Query  573   VSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVG  752
             +S D +A+ GC+    QDTL D  G+HY+  CYIEG VDFIFGN  SL++ C +H+I   
Sbjct  190   ISADTAAFIGCKFIGAQDTLYDHIGRHYFKECYIEGSVDFIFGNGLSLYDDCHLHAITNS  249

Query  753   GGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWN  932
              GA+TAQ+RES  E TGF+F+ CK+TG+G   LGR WG +SRVV+  +YM   I P GW 
Sbjct  250   FGALTAQKRESMLEETGFSFVNCKVTGSGALYLGRAWGTFSRVVFAYTYMDKIITPTGWY  309

Query  933   DWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQA  1106
             DW D  R+ TV+YG+YKC GPGA    RV WSR L++ EAKPF++   I+GQ+WL  +
Sbjct  310   DWGDKNREMTVFYGQYKCSGPGAQFGGRVSWSRELTEQEAKPFVSIDFIDGQDWLLHS  367



>ref|XP_001766064.1| predicted protein [Physcomitrella patens]
 gb|EDQ69123.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/284 (47%), Positives = 180/284 (63%), Gaps = 6/284 (2%)
 Frame = +3

Query  258   IIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASN  437
             IIVD+ G G + K+QDAIDS+   N + + I ++ GTY EK  +P  KPFITL G   + 
Sbjct  13    IIVDKQGKGHFRKVQDAIDSIKEGNKKRITIIIRAGTYVEKCRIPKTKPFITLLGS-GTK  71

Query  438   TVITWSDGGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGK-GVALRVSGDRSAWYGCRIK  614
             TV+ WSD          T  ++ F           G  GK  VALR+ GD+ A+Y CR  
Sbjct  72    TVLVWSDTAG---KAGGTALSASFAVESEAPAPPGGSVGKQAVALRIQGDKGAFYRCRFF  128

Query  615   SYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV-GGGAITAQRRESAE  791
               QDTL D+ G+HY+ NC+I+G +D+IFGNA S++  C I SIA    G+ITAQ+R S  
Sbjct  129   GAQDTLYDKQGRHYFRNCFIQGSIDWIFGNAQSMYHCCTIKSIAKRNSGSITAQKRSSKN  188

Query  792   ENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRTVYY  971
               TGF+F+ CKI GTG+  LGR WG +SRVV++  +M+  I P GW DW+DP RQ+TV+Y
Sbjct  189   SPTGFSFVRCKIFGTGSIYLGRAWGTHSRVVFIKCHMAKMILPIGWQDWNDPARQKTVFY  248

Query  972   GEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLRQ  1103
              EY C GPGA+R  RV+WS+ LS  +A PF + + I+G +WL +
Sbjct  249   AEYSCTGPGANREGRVKWSKLLSAKQAAPFYSYRFIDGHKWLNK  292



>ref|XP_010509442.1| PREDICTED: probable pectinesterase 15 [Camelina sativa]
Length=397

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/319 (42%), Positives = 196/319 (61%), Gaps = 17/319 (5%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q  T++++IVD  G G++  +Q AID+VP  +     I V  G+YREKV V  +K  + L
Sbjct  72    QYQTSLVLIVDLHGCGNFSNVQSAIDAVPDLSPSKTLIIVNSGSYREKVTVNENKTNLVL  131

Query  417   SGDDASNTVITWSD----GGDIIHSPTLTVFASDFVGRYLTIMNTFGR------SGKGVA  566
              G    NT I W+D     G    S +  VFA++F    ++  N           G+ VA
Sbjct  132   QGRGYQNTSIEWNDTAKSAGSTADSFSFVVFAANFTAYNISFKNIAPEPDPGEADGQAVA  191

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LR+ GD++A+YGC     QDTLLD++G+H++ +C+I+G +DFIFGN  SL++ C I+SIA
Sbjct  192   LRIEGDQAAFYGCGFYGAQDTLLDDSGRHFFKDCFIQGSIDFIFGNGRSLYQDCTINSIA  251

Query  747   VGG------GAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSS  908
              G       G+ITAQ R+S +E +GF+F+ CKI G+G  +LGR WG Y+ VV+ ++YMS 
Sbjct  252   KGNASAGVTGSITAQGRQSKDEESGFSFVNCKIDGSGEVLLGRAWGAYATVVFSNTYMSG  311

Query  909   AIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQ  1088
              I  EGWNDW DP +Q+TV +GE+KCYGPGA+  +RV + + L+ +EA  F+    I G 
Sbjct  312   IITREGWNDWGDPAKQKTVTFGEHKCYGPGANYKERVSFGKQLTDSEASSFIDLSFINGD  371

Query  1089  EWLRQAPTNFKRMSSCKDM  1145
             +WL         ++S KD+
Sbjct  372   QWLNDHTNKLSDLTS-KDI  389



>ref|XP_010270248.1| PREDICTED: pectinesterase QRT1 [Nelumbo nucifera]
Length=358

 Score =   268 bits (686),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 187/297 (63%), Gaps = 15/297 (5%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDAS  434
             +I+V + G GD + +Q A+D VP  N+  V I + PG YREKV+VP  KP+++  G +A+
Sbjct  61    VIVVSKDGTGDSLTVQGAVDLVPLHNTLRVKILILPGIYREKVIVPASKPYVSFIGTEAN  120

Query  435   NTVITWS--------DGGDI--IHSPTLTVFASDFVGRYLTIMNTF-----GRSGKGVAL  569
              TVI+W+        +G +I   ++ T+++ +  F    +T  NT      G   + VAL
Sbjct  121   RTVISWNTKASDKDNNGQEIGTYNTATVSIESDYFCATKITFENTEVAVPGGVGMQAVAL  180

Query  570   RVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAV  749
             R+SGD+S  Y  R+   QDTLLD+ G HY+  CYI+G +DFIFGNA SL+E C ++S A 
Sbjct  181   RLSGDKSFLYKTRMLGSQDTLLDDTGTHYFYKCYIQGSIDFIFGNARSLYEECTLYSTAR  240

Query  750   GGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGW  929
             G GAI A  RESA ENTGF+F+ CK+ G+G   LGR WG Y+R ++    M   I P GW
Sbjct  241   GPGAIAASHRESAMENTGFSFVQCKVKGSGNIYLGRAWGRYARTLYYHCDMEGIITPIGW  300

Query  930   NDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             +DW DP R+ TV +GEY+C G GA+  +R  WS+S +  EAKPF+ K  IEG +W R
Sbjct  301   HDWGDPSRRWTVSFGEYQCRGKGANLGRRAPWSKSFTYEEAKPFLDKTYIEGDQWFR  357



>ref|XP_002879623.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55882.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=404

 Score =   270 bits (689),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 135/318 (42%), Positives = 195/318 (61%), Gaps = 17/318 (5%)
 Frame = +3

Query  237   QTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITL  416
             Q  T++++ VD  G G++  +Q AID+VP  +     I V  G YREKV V  +K  + +
Sbjct  81    QYKTSLVLTVDLHGCGNFSNVQSAIDAVPDLSPSKTLIIVNSGCYREKVTVNENKTNLVI  140

Query  417   SGDDASNTVITWSD----GGDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKG------VA  566
              G    NT I W+D     G+   S +  VFA++F    ++  N       G      V+
Sbjct  141   QGRGYQNTSIEWNDTAKSAGNTAESFSFVVFAANFTAYNISFKNNAPEPDPGEADAQAVS  200

Query  567   LRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIA  746
             LR+ GD++A+YGC     QDTLLD+ G+H++ +C+I+G +DFIFGN  SL++ C I+SIA
Sbjct  201   LRIEGDQAAFYGCGFYGAQDTLLDDKGRHFFKDCFIQGSIDFIFGNGRSLYKDCTINSIA  260

Query  747   VGG-----GAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSA  911
              G      G+ITAQ R+S +E TGF+F+ CKI G+G  +LGR WG Y+ VV+  +YMS  
Sbjct  261   KGNTSGVTGSITAQGRQSEDEQTGFSFVNCKIAGSGEILLGRAWGAYATVVFSDTYMSGI  320

Query  912   IQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQE  1091
             I PEGWN+W DP +++TV +GE+KCYGPGAD  +RV + + L+ +EA  F+    I+G E
Sbjct  321   ISPEGWNNWGDPDKEKTVTFGEHKCYGPGADYKERVLFGKQLTDSEASSFIDISFIDGDE  380

Query  1092  WLRQAPTNFKRMSSCKDM  1145
             WLR   TN     + KD+
Sbjct  381   WLRH--TNIVSEFTSKDI  396



>gb|EYU27258.1| hypothetical protein MIMGU_mgv1a025960mg, partial [Erythranthe 
guttata]
Length=304

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/302 (45%), Positives = 186/302 (62%), Gaps = 14/302 (5%)
 Frame = +3

Query  228   KLKQTSTAVLIIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKP  404
             K+  T+ +++I VD++ G G++  IQ AIDS+P  N E V I V  G Y EKV +P  K 
Sbjct  2     KVIMTAPSIIITVDKNPGSGNFTSIQGAIDSLPLVNQERVLIDVHAGIYTEKVTIPSTKA  61

Query  405   FITLSGDDASNTVITWSDGG-----DIIHSPTLTVFASDFVGRYLTIMNTF-----GRSG  554
             +I + G  A NTV+ W D           S T  V A  FV + +T  NT      G  G
Sbjct  62    YIKIQGAGAENTVVQWGDTARSQPLGTYGSATFGVDAPYFVAKNITFKNTAPIPPPGADG  121

Query  555   -KGVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCE  731
              +GVALR+SGD SA+ GC+    QDTL D  G+HYY +CYIEG VDFIFG+  S ++GCE
Sbjct  122   MQGVALRISGDASAFAGCKFLGAQDTLYDHRGRHYYEDCYIEGSVDFIFGDGRSYYKGCE  181

Query  732   IHSIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSA  911
             +H+IA G  A+ AQ R ++ ENTGF+ + C++TG+    L R W P+S  ++  +YM + 
Sbjct  182   LHAIATG--AVAAQNRSASSENTGFSIVNCRVTGSDIVYLARAWAPFSTTIFAYTYMENN  239

Query  912   IQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQE  1091
             + PEGW DW DP RQ TV +GEY+C GPG++ + RV+WS+ L+  EA  F +   I+  E
Sbjct  240   VNPEGWFDWGDPSRQSTVTFGEYQCSGPGSNTAGRVKWSKILTDEEAGRFTSLDFIDASE  299

Query  1092  WL  1097
             WL
Sbjct  300   WL  301



>ref|XP_009406172.1| PREDICTED: probable pectinesterase 53 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/337 (43%), Positives = 192/337 (57%), Gaps = 44/337 (13%)
 Frame = +3

Query  222   GVKLKQTSTAVLIIVDQSGH-GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVD  398
             G  L +   +  + VD++   GD+  IQ+A+DS+P  N   V I V  GTY EKV V   
Sbjct  67    GRALNKAFPSYTLTVDKNPSVGDFTTIQEAVDSLPLINLVRVVIKVNAGTYTEKVNVSPM  126

Query  399   KPFITLSGDDASNTVITWSDGGDII----------HSPTLTVFASDFVGRYLTI------  530
             + FIT+ G  A  TV+ W D  + +          +S T  V A  F+ R +T       
Sbjct  127   RAFITIQGAGADKTVVQWGDTAETLGPKKQPIGTFNSATFAVNAPYFIARNITFKVCVSC  186

Query  531   ---------------------MNTF-----GRSGK-GVALRVSGDRSAWYGCRIKSYQDT  629
                                   NT      G  GK  V+LR+SGD +A+ GC+    QDT
Sbjct  187   SIRMEFVWRPDPVLLLALLGFQNTTPVPPPGAMGKQAVSLRISGDTAAFVGCKFLGAQDT  246

Query  630   LLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQRRESAEENTGFT  809
             L D  G+HYY +CYIEG VDFIFGNA SL+EGC +H+IA   GA+TAQ R S  E+TGF+
Sbjct  247   LYDHVGRHYYKDCYIEGSVDFIFGNALSLYEGCHVHAIAQNYGALTAQNRMSLLEDTGFS  306

Query  810   FLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCY  989
             F+ CK+TG+G   LGR WG +SRV++  +YM   I P GW +W DP R+ TV+YG+YKC 
Sbjct  307   FVNCKVTGSGALYLGRAWGTFSRVIFAYTYMDDIILPRGWYNWGDPNREMTVFYGQYKCT  366

Query  990   GPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GPGA  + RV WSR L+  EAKPF++   I+G EW++
Sbjct  367   GPGASYAGRVSWSRELTDEEAKPFISMSFIDGSEWIK  403



>ref|XP_006452563.1| hypothetical protein CICLE_v10010593mg [Citrus clementina]
 gb|ESR65803.1| hypothetical protein CICLE_v10010593mg [Citrus clementina]
 gb|KDO59079.1| hypothetical protein CISIN_1g043630mg [Citrus sinensis]
Length=359

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/299 (45%), Positives = 188/299 (63%), Gaps = 17/299 (6%)
 Frame = +3

Query  255   LIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDD--  428
             LIIVD++G G    +Q A+D VP  NSE V I + PG YREKV VP +KP+I+  G +  
Sbjct  60    LIIVDKNGGGHSSTVQGAVDLVPENNSERVKIYILPGVYREKVTVPQNKPYISFIGHEQR  119

Query  429   ASNTVITW--------SDGGDI--IHSPTLTVFASDFVGRYLTIMNTF-----GRSGKGV  563
             AS TVI+W        S+G ++    S +++VFA  F    +T  NT      G   + V
Sbjct  120   ASETVISWHNKASDKDSNGIELGTYKSASVSVFADFFCATGITFANTVVAVPGGIGMQAV  179

Query  564   ALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSI  743
             ALR++GD++  Y  ++   QDTLLD+ G HY+  C+I+G +DFIFG A SL++ C + SI
Sbjct  180   ALRLAGDKAMLYKVKVLGTQDTLLDDTGSHYFYQCHIQGSIDFIFGRARSLYQDCVLQSI  239

Query  744   AVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPE  923
             A   GAI A  R+  ++++GF+F+ C I GTG   LGR WG YSR+++  SY+   I P 
Sbjct  240   AEKSGAIAAHHRDIPDDSSGFSFVNCVINGTGKIYLGRAWGNYSRIIYSYSYLEDIIYPT  299

Query  924   GWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             GW+DW+ P R RTV +GEY+C G GADRS R  W +SLS  E +PF+    I+G+EWLR
Sbjct  300   GWSDWNMPYRDRTVVFGEYQCSGKGADRSHRPSWLKSLSYEEVQPFLNVTFIDGKEWLR  358



>ref|XP_002459865.1| hypothetical protein SORBIDRAFT_02g012560 [Sorghum bicolor]
 gb|EER96386.1| hypothetical protein SORBIDRAFT_02g012560 [Sorghum bicolor]
Length=428

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 190/308 (62%), Gaps = 19/308 (6%)
 Frame = +3

Query  228   KLKQTSTAVLII-VDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKP  404
             K+     A L++ VD  G G+Y ++Q A+D+VP   +    I+V  G Y EKVVV  +K 
Sbjct  90    KMASLHNATLVLTVDHKGCGNYTRLQKAVDAVPDYAAARTLIAVDAGVYAEKVVVWSNKT  149

Query  405   FITLSGDDASNTVITWSD----GGDIIHSPTLTVFASDFVGRYLTIMNTF------GRSG  554
              +TL G    NT I W+D     G   +S T+ V A++FV   +++ NT       G  G
Sbjct  150   GVTLQGRGNLNTTIVWNDTANSSGGTFYSATVAVLAANFVAYNVSVQNTAAPADPGGSGG  209

Query  555   KGVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEI  734
             + VALRV+GD++A+Y C   S QDTLLDE G+H +  CY+EG +DFIFGNA SL+ GC I
Sbjct  210   QAVALRVAGDQAAFYWCGFYSSQDTLLDEQGRHLFRGCYVEGSIDFIFGNARSLYLGCTI  269

Query  735   HSIA---VGG---GAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSS  896
              S+A    GG   G++TA  R S  E TGF F+GC + GTG   LGR WGPY+ VV+  +
Sbjct  270   SSVANAAAGGTVTGSVTAHGRASPAEKTGFAFVGCTVVGTGQVWLGRAWGPYATVVFART  329

Query  897   YMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGAD--RSKRVEWSRSLSKAEAKPFMTK  1070
             Y+S+ + P  WNDW+DP RQ++V++GEY C GPGA     +RV ++R L + +A PFM  
Sbjct  330   YLSAVVAPGAWNDWNDPARQQSVFFGEYDCTGPGASGGTVQRVAYARQLDQRQAAPFMDV  389

Query  1071  KMIEGQEW  1094
               I+G +W
Sbjct  390   SYIDGNQW  397



>ref|NP_001131435.1| uncharacterized protein LOC100192767 precursor [Zea mays]
 ref|XP_008660811.1| PREDICTED: putative pectinesterase 11 [Zea mays]
 gb|ACF79840.1| unknown [Zea mays]
Length=332

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/295 (46%), Positives = 191/295 (65%), Gaps = 14/295 (5%)
 Frame = +3

Query  252   VLIIVDQSGHGDYIKIQDAIDSVPSKNSE-----LVYISVKPGTYREKVVVPVDKPFITL  416
              ++ VD +G GDY  IQ+AID++P+  +      +V I+V PG Y EKVVV  +K  ++L
Sbjct  38    TVLTVDMTGKGDYRTIQEAIDAIPAAANNSTSAAIVTINVNPGIYTEKVVV--NKAGVSL  95

Query  417   SGDDASNTVITWSDGGDIIHSPTLTVF--ASDFVGRYLTIMNTFGR--SGKGVALRVSGD  584
              G  A++T++TWS   +  H     ++  A+DFV + LT  NT G   +G  VA +V  D
Sbjct  96    VGRSATSTIVTWSGPWNQNHQSEFALYVQATDFVAKGLTFQNTLGSKDNGPAVAAKVDAD  155

Query  585   RSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAI  764
             ++A+Y CR  SYQDTLLD  G+HYY  CYIEG  DFIFG   + FE C +HS +   GA 
Sbjct  156   KAAFYDCRFLSYQDTLLDATGRHYYRGCYIEGATDFIFGTGKAFFESCHLHSTSDAKGAF  215

Query  765   TAQRRESAEENTGFTFLGCKITGTG--TTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDW  938
             TAQRR +  EN GF+F  C+ TGTG  T +LGRPWGPY+RVV+    MS+ + PEGWN+W
Sbjct  216   TAQRRSTESENAGFSFFRCESTGTGVATAILGRPWGPYARVVFALCNMSNTVAPEGWNNW  275

Query  939   DDPKRQRTVYYGEYKCYGPGADRSKRVEWSR-SLSKAEAKPFMTKKMIEGQEWLR  1100
             D+   ++T ++G+++CYG G+    RV W+  +LS  EA PF+T   ++GQ+WLR
Sbjct  276   DNTANEKTAFFGQFQCYGQGSGTQGRVTWAHNNLSPNEAAPFLTNAWVDGQDWLR  330



>ref|XP_003559976.2| PREDICTED: pectinesterase QRT1-like [Brachypodium distachyon]
Length=387

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 185/295 (63%), Gaps = 18/295 (6%)
 Frame = +3

Query  264   VDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTV  443
             +D +GH     +Q A+D VP+ N+  V I ++PG YREKV VP+ KPF++L G     TV
Sbjct  94    LDGTGHSR--TVQGAVDMVPAGNARRVKILIRPGVYREKVTVPITKPFVSLIGMGTGRTV  151

Query  444   ITW-SDGGDI---------IHSPTLTVFASDFVGRYLTIMNTFGRSGKG------VALRV  575
             ITW S   D+          +S ++ V A  F   +LT  N+   +  G      VALR+
Sbjct  152   ITWNSRASDMDTTGHQVGTFYSASVAVEADYFCASHLTFENSAPAAPPGAVGQQAVALRL  211

Query  576   SGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGG  755
             SGD++  Y CRI   QDTL D  G+HY  +C I+G +DFIFGNA SL++GC +H++A   
Sbjct  212   SGDKTMLYRCRILGAQDTLFDNIGRHYLYDCDIQGSIDFIFGNARSLYQGCRLHAVATSY  271

Query  756   GAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWND  935
             GAI A +R SA E +GF+F+GC++TG+G   LGR WG Y+RVV+    +S  + P+GW+D
Sbjct  272   GAIAASQRSSATEESGFSFVGCRLTGSGMLYLGRAWGKYARVVYSLCDLSGIVVPQGWSD  331

Query  936   WDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             W D  R +TV +GEY C GPGA   +RV WSR+L+  EA PF+ +  I G++WLR
Sbjct  332   WGDRARTKTVLFGEYNCKGPGASSRERVPWSRALTYQEALPFLGRDFINGEQWLR  386



>ref|XP_002988891.1| hypothetical protein SELMODRAFT_128677 [Selaginella moellendorffii]
 gb|EFJ10153.1| hypothetical protein SELMODRAFT_128677 [Selaginella moellendorffii]
Length=321

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 180/310 (58%), Gaps = 19/310 (6%)
 Frame = +3

Query  231   LKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFI  410
              KQ + +  +IVDQ GHG++  IQ A+DS+P  N + VY+ +  G YREKV++P +KPFI
Sbjct  11    FKQMAISKYLIVDQYGHGNFKTIQAAVDSIPLDNKQWVYVQINAGLYREKVIIPYNKPFI  70

Query  411   TLSGDDASNTVITWSDGGD---IIHSPTLTVFASDFVGR---------YLTIMNTFGRSG  554
                G     T I W+D         S T T +A  F+ +          L + N      
Sbjct  71    IFQGAGRDKTTIEWNDAASRSGTADSATFTAWAPSFIAKGISFKASTWLLCLCNGSPAPP  130

Query  555   KGVALR------VSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASL  716
              G   R       + D  A+Y C     QDTL D  G+HY+ +CYIEG +D IFG+A S+
Sbjct  131   PGAENRQAVAALAAADMQAFYSCGFYGAQDTLFDYQGRHYFRDCYIEGSIDVIFGHAQSI  190

Query  717   FEGCEIHSIAVGGGAITAQRRESAEENTGFTFLGCKITGT-GTTVLGRPWGPYSRVVWVS  893
             F  CE+HSIA   G++ A  R +  +++GF F+ C ITG+ G   LGR WG YSR+V+++
Sbjct  191   FRECELHSIAESYGSLAAHNRWNPSDSSGFVFVDCTITGSKGQVFLGRAWGAYSRIVYIN  250

Query  894   SYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKK  1073
             + M + I PEGW DW +P+RQRTV++G+YKC GPGA  S RV WS  L+  EA+PFM   
Sbjct  251   TRMDNVIIPEGWYDWGEPQRQRTVFFGQYKCSGPGAGESGRVSWSHELNDYEARPFMQIN  310

Query  1074  MIEGQEWLRQ  1103
              I G EWL +
Sbjct  311   FINGHEWLSE  320



>ref|XP_009386766.1| PREDICTED: putative pectinesterase 14 [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 194/309 (63%), Gaps = 19/309 (6%)
 Frame = +3

Query  225   VKLKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKP  404
             + L+Q +T +L  VDQ G  ++  +Q AID+VP  +     I +  G YREK+ V  +K 
Sbjct  104   LALEQNATLILT-VDQKGCANFSSVQRAIDAVPDYSPSRTLIILDSGVYREKLFVWANKT  162

Query  405   FITLSGDDASNTVITWSDG----GDIIHSPTLTVFASDFVGRYLTIMNTFGRSGKG----  560
              IT+ G    NT I W+D     G  I+S ++++F+ +F+   ++  NT   +  G    
Sbjct  163   NITMQGQGFLNTSIAWNDTANSTGGTIYSASVSIFSFNFIAYNISFQNTAPPASPGDVGA  222

Query  561   --VALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEI  734
               VALR++GD++A YGC     QDTLLDE G+HY+  C+IEG +DFIFGNA SL+E C I
Sbjct  223   QAVALRIAGDQAALYGCGFYGAQDTLLDERGRHYFRECFIEGSIDFIFGNARSLYEACTI  282

Query  735   HSIA------VGG--GAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWV  890
             +SIA      VGG  G ITA  R SA E TGF+F+ C I GTG   LGR W PY+ VV+ 
Sbjct  283   NSIAKQATSDVGGVTGCITAHGRSSATEKTGFSFVNCSIGGTGKVWLGRAWWPYATVVFS  342

Query  891   SSYMSSAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTK  1070
              +YM+S I PEGWNDW+DP R ++VY+GEY+C GPGA+ + R  +++ L + +A  FM  
Sbjct  343   RTYMASIIAPEGWNDWNDPSRDQSVYFGEYECMGPGANYTLRTSYAKQLDQCQAASFMDI  402

Query  1071  KMIEGQEWL  1097
               +EG++W+
Sbjct  403   SYVEGKDWV  411



>gb|KHG12413.1| putative pectinesterase 15 -like protein [Gossypium arboreum]
Length=407

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 191/305 (63%), Gaps = 15/305 (5%)
 Frame = +3

Query  231   LKQTSTAVLIIVDQSGHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFI  410
             + Q   ++++ VD  G G++   Q AID+VP  +     I +  GTYREKVVV   K  +
Sbjct  102   IYQYKVSLVLTVDLEGCGNFSNAQKAIDAVPDSSPSKTLIIIYSGTYREKVVVHASKSNL  161

Query  411   TLSGDDASNTVITWSDG----GDIIHSPTLTVFASDFVGRYLTIMNTF-----GRSGK-G  560
              + G+   NTVI W+D     G  ++S ++ +FAS+F    ++  NT      G +GK  
Sbjct  162   IIQGEGFLNTVIEWNDTANSTGGTVYSSSVAIFASNFTAYNISFKNTAPEPIPGETGKQA  221

Query  561   VALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHS  740
             VALR++GD++A+Y C     QDTLLD+ G+HY+  C+I+G +DFIFGNA SL++GC IHS
Sbjct  222   VALRIAGDQAAFYNCGFYGAQDTLLDDRGRHYFKGCFIQGSIDFIFGNARSLYQGCVIHS  281

Query  741   IAVGG-----GAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMS  905
             IA  G     G++TA  R+S  E TGF+F+ C + GTG+  LGR WG Y+ VV+  SYMS
Sbjct  282   IAKEGTSGVSGSVTAHARQSLNEQTGFSFVNCIVRGTGSVWLGRAWGAYATVVFSRSYMS  341

Query  906   SAIQPEGWNDWDDPKRQRTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEG  1085
               + P GWNDW DP R +TV++GEY+C GPGA+ + R  + + L + EA  +M    I+G
Sbjct  342   DVVAPVGWNDWRDPSRDQTVFFGEYECLGPGANYTFRASYGKQLMEYEAAHYMNISYIDG  401

Query  1086  QEWLR  1100
              +WL+
Sbjct  402   DQWLQ  406



>ref|XP_004961452.1| PREDICTED: probable pectinesterase 53-like isoform X1 [Setaria 
italica]
Length=434

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/334 (43%), Positives = 193/334 (58%), Gaps = 50/334 (15%)
 Frame = +3

Query  249   AVLIIVDQS-GHGDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGD  425
             A  ++VD++ G GD+  IQ A+DS+P  N   V I V  GTY EKV +   + F+T+ G 
Sbjct  100   ARTLVVDKTPGAGDFTSIQAAVDSLPLINLARVVIKVNAGTYTEKVNISPMRAFVTVEGA  159

Query  426   DASNTVITWSDGGDIIHS----------PTLTVFASDFVGRYLTIMNTF-----GRSGK-  557
              A  TV+ W D  D + S           T  V +  FV + +T  NT      G  GK 
Sbjct  160   GADKTVVQWGDTADTVGSWGRAMGTFGSATFAVNSMFFVAKNITFKNTAPMPKPGALGKQ  219

Query  558   GVALRVSGDRSAWYGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIH  737
             GVALR+S D +A+ GC     QDTL D  G+HYY +CYIEG +DFIFGNA SL+EGC +H
Sbjct  220   GVALRISADNAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSIDFIFGNALSLYEGCHVH  279

Query  738   SIAVGGGAITAQRRESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQ  917
             +IA   GA+TAQ R+S  E+TGF+F+ C++TG+G   LGR WG +SRVV+  +YM + I 
Sbjct  280   AIARNYGALTAQNRQSLLEDTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIII  339

Query  918   PEGWNDWDDPKRQ---------------------------------RTVYYGEYKCYGPG  998
             P GW +W DP R+                                 RTV+YG+YKC GPG
Sbjct  340   PRGWYNWGDPTREMSVPSFFFIGPSPSCSRVVPDADAGWLCSLECFRTVFYGQYKCTGPG  399

Query  999   ADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWLR  1100
             A+ + RV+WSR L+  EAKPF++   I+G EWL+
Sbjct  400   ANYAGRVQWSRELTDEEAKPFISLDFIDGLEWLK  433



>ref|XP_002310842.1| hypothetical protein POPTR_0007s13780g [Populus trichocarpa]
 gb|EEE91292.1| hypothetical protein POPTR_0007s13780g [Populus trichocarpa]
Length=339

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/287 (46%), Positives = 175/287 (61%), Gaps = 15/287 (5%)
 Frame = +3

Query  282   GDYIKIQDAIDSVPSKNSELVYISVKPGTYREKVVVPVDKPFITLSGDDASNTVITWSDG  461
             G +  +Q AI+S+P  N+  V IS+  GTYREKV +P    +ITL G  A  T+I W D 
Sbjct  50    GAFPTVQKAINSLPVINNCRVVISISAGTYREKVEIPATMAYITLRGAGADRTIIEWDDT  109

Query  462   GDIIH---------SPTLTVFASDFVGRYLTIMNTF-----GRSGK-GVALRVSGDRSAW  596
              D +          S T  V +  F+ + +T  N       G  GK  VALR+S D +A+
Sbjct  110   ADRMENGRPLGTFGSATFAVNSPYFIAKDITFKNKAPLPPSGALGKQAVALRISADTAAF  169

Query  597   YGCRIKSYQDTLLDEAGKHYYSNCYIEGGVDFIFGNAASLFEGCEIHSIAVGGGAITAQR  776
               C+    QDTL D  G+HY+  CYIEG VDFIFGN  SL+E C +H++    GA+TAQ+
Sbjct  170   ISCKFIGAQDTLYDHIGRHYFKKCYIEGSVDFIFGNGLSLYEDCHLHAVTTSFGALTAQK  229

Query  777   RESAEENTGFTFLGCKITGTGTTVLGRPWGPYSRVVWVSSYMSSAIQPEGWNDWDDPKRQ  956
             R+S  E TGF+F+ CK+TG+G   LGR WG +SRVV+  ++M   I P GW DW D  RQ
Sbjct  230   RQSFLEETGFSFVSCKVTGSGALFLGRAWGNFSRVVFAYTFMDKIITPRGWYDWGDKSRQ  289

Query  957   RTVYYGEYKCYGPGADRSKRVEWSRSLSKAEAKPFMTKKMIEGQEWL  1097
              TV++G+YKC GPGAD   RV WSR L+  +AKPF++   I+G EWL
Sbjct  290   MTVFFGQYKCSGPGADFGGRVAWSRELTDQQAKPFISIGFIDGHEWL  336



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3626085783502