BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c94763_g1_i1 len=414 path=[1:0-413]

Length=414
                                                                      Score     E

ref|XP_006348848.1|  PREDICTED: uncharacterized protein LOC102594004    196   7e-58   
ref|XP_010323758.1|  PREDICTED: protein trichome birefringence-li...    193   1e-56   
ref|XP_004243820.1|  PREDICTED: protein trichome birefringence-li...    193   2e-56   
ref|XP_009354322.1|  PREDICTED: protein trichome birefringence-li...    189   4e-56   
ref|XP_009593638.1|  PREDICTED: protein trichome birefringence-li...    187   2e-54   
ref|XP_008342804.1|  PREDICTED: protein trichome birefringence-li...    186   4e-54   
ref|XP_009786368.1|  PREDICTED: protein trichome birefringence-li...    183   6e-53   
ref|XP_010277751.1|  PREDICTED: protein trichome birefringence-li...    181   7e-52   
ref|XP_002326021.2|  hypothetical protein POPTR_0019s11970g             181   9e-52   Populus trichocarpa [western balsam poplar]
ref|XP_004140241.1|  PREDICTED: uncharacterized protein LOC101217736    179   2e-51   
ref|XP_008449392.1|  PREDICTED: protein trichome birefringence-li...    179   4e-51   
ref|XP_006469127.1|  PREDICTED: protein YLS7-like                       177   1e-50   
gb|KDO63330.1|  hypothetical protein CISIN_1g043893mg                   177   2e-50   
ref|XP_011002530.1|  PREDICTED: protein trichome birefringence-li...    176   3e-50   
ref|XP_006446764.1|  hypothetical protein CICLE_v10017800mg             174   1e-49   
ref|XP_007214171.1|  hypothetical protein PRUPE_ppa019033mg             174   2e-49   
ref|XP_007048657.1|  Trichome birefringence-like 6, putative isof...    175   6e-49   
emb|CBI21995.3|  unnamed protein product                                171   1e-48   
ref|XP_008244482.1|  PREDICTED: protein trichome birefringence-li...    171   2e-48   
ref|XP_002276891.2|  PREDICTED: protein trichome birefringence-li...    172   7e-48   Vitis vinifera
gb|KHG08135.1|  putative U95                                            168   1e-46   
gb|KDP31784.1|  hypothetical protein JCGZ_12245                         166   2e-46   
ref|XP_010052546.1|  PREDICTED: protein trichome birefringence-li...    164   2e-45   
ref|XP_002276383.1|  PREDICTED: protein trichome birefringence-li...    163   2e-45   Vitis vinifera
ref|XP_010914510.1|  PREDICTED: protein trichome birefringence-li...    161   2e-44   
ref|XP_009395765.1|  PREDICTED: protein trichome birefringence-li...    162   4e-44   
ref|XP_006852457.1|  hypothetical protein AMTR_s00021p00115070          160   7e-44   
ref|XP_009386636.1|  PREDICTED: protein trichome birefringence-li...    158   4e-43   
ref|XP_010099371.1|  hypothetical protein L484_004797                   157   5e-43   
ref|XP_010913162.1|  PREDICTED: protein trichome birefringence-li...    158   9e-43   
ref|XP_009386635.1|  PREDICTED: protein trichome birefringence-li...    158   1e-42   
ref|XP_008778408.1|  PREDICTED: protein trichome birefringence-li...    156   5e-42   
ref|XP_008810174.1|  PREDICTED: protein trichome birefringence-li...    148   2e-39   
gb|ACF87806.1|  unknown                                                 144   3e-39   Zea mays [maize]
ref|XP_010681621.1|  PREDICTED: protein PMR5-like                       145   1e-38   
ref|NP_001142167.1|  putative DUF231 domain containing family pro...    146   1e-38   Zea mays [maize]
ref|XP_002455950.1|  hypothetical protein SORBIDRAFT_03g027810          146   1e-38   Sorghum bicolor [broomcorn]
ref|XP_010689872.1|  PREDICTED: protein trichome birefringence-li...    145   2e-38   
ref|XP_010681620.1|  PREDICTED: protein trichome birefringence-li...    142   2e-38   
ref|XP_004969160.1|  PREDICTED: uncharacterized protein LOC101763686    145   3e-38   
ref|NP_001056472.1|  Os05g0587700                                       140   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007048659.1|  Trichome birefringence-like 6, putative            143   2e-37   
ref|XP_010681619.1|  PREDICTED: protein trichome birefringence-li...    142   4e-37   
gb|EMS64161.1|  hypothetical protein TRIUR3_16646                       142   5e-37   
ref|XP_010665978.1|  PREDICTED: protein trichome birefringence-li...    141   6e-37   
gb|EAZ12682.1|  hypothetical protein OsJ_02598                          140   1e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EAY74956.1|  hypothetical protein OsI_02852                          140   3e-36   Oryza sativa Indica Group [Indian rice]
ref|NP_001043565.1|  Os01g0614300                                       139   3e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010665987.1|  PREDICTED: protein trichome birefringence-li...    138   4e-36   
ref|XP_010665991.1|  PREDICTED: protein trichome birefringence-li...    138   6e-36   
ref|XP_010665981.1|  PREDICTED: protein trichome birefringence-like     137   2e-35   
ref|XP_003566882.1|  PREDICTED: protein trichome birefringence-li...    137   3e-35   
ref|XP_010665979.1|  PREDICTED: protein trichome birefringence-li...    136   3e-35   
ref|XP_002525121.1|  conserved hypothetical protein                     129   5e-35   Ricinus communis
ref|XP_006646096.1|  PREDICTED: protein YLS7-like                       136   5e-35   
ref|XP_008654642.1|  PREDICTED: putative DUF231 domain containing...    133   8e-34   
ref|XP_010689873.1|  PREDICTED: protein trichome birefringence-li...    132   1e-33   
ref|XP_002454638.1|  hypothetical protein SORBIDRAFT_04g034670          132   6e-33   Sorghum bicolor [broomcorn]
ref|XP_008679266.1|  PREDICTED: protein trichome birefringence-li...    132   7e-33   
gb|AFW73695.1|  putative DUF231 domain containing family protein        132   1e-32   
ref|XP_008646340.1|  PREDICTED: protein trichome birefringence          132   1e-32   
ref|XP_010665989.1|  PREDICTED: protein trichome birefringence-li...    129   2e-32   
ref|XP_006655646.1|  PREDICTED: protein YLS7-like                       129   2e-32   
ref|XP_010932482.1|  PREDICTED: protein trichome birefringence-li...    130   3e-32   
ref|XP_006649087.1|  PREDICTED: protein YLS7-like                       129   6e-32   
ref|XP_003560946.2|  PREDICTED: protein trichome birefringence-li...    130   7e-32   
gb|EMT28733.1|  hypothetical protein F775_16151                         127   7e-32   
ref|XP_010665988.1|  PREDICTED: protein trichome birefringence-li...    126   1e-31   
ref|XP_004954083.1|  PREDICTED: cell wall protein AWA1-like             129   1e-31   
ref|XP_008791924.1|  PREDICTED: protein trichome birefringence-li...    129   1e-31   
ref|XP_003573026.1|  PREDICTED: protein trichome birefringence          128   2e-31   
ref|XP_010665993.1|  PREDICTED: protein trichome birefringence-li...    125   4e-31   
ref|XP_010689869.1|  PREDICTED: protein trichome birefringence-li...    125   4e-31   
dbj|BAK01401.1|  predicted protein                                      127   5e-31   
ref|XP_004964924.1|  PREDICTED: fibroin heavy chain-like                127   8e-31   
ref|XP_006656749.1|  PREDICTED: mucin-19-like                           127   8e-31   
ref|XP_010917266.1|  PREDICTED: protein trichome birefringence          126   1e-30   
gb|KFK38572.1|  hypothetical protein AALP_AA3G130900                    124   1e-30   
gb|AFW85381.1|  putative DUF231 domain containing family protein        126   1e-30   
ref|XP_006849537.1|  hypothetical protein AMTR_s00024p00162030          125   1e-30   
gb|EAZ36212.1|  hypothetical protein OsJ_20530                          126   1e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87710.1|  hypothetical protein OsI_09124                          125   2e-30   Oryza sativa Indica Group [Indian rice]
dbj|BAD16880.1|  hypothetical protein                                   125   2e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD35858.1|  lustrin A-like                                         126   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002436669.1|  hypothetical protein SORBIDRAFT_10g006800          126   2e-30   Sorghum bicolor [broomcorn]
gb|EMT28814.1|  hypothetical protein F775_14799                         125   2e-30   
gb|EYU44003.1|  hypothetical protein MIMGU_mgv1a017776mg                119   3e-30   
ref|XP_008789200.1|  PREDICTED: protein trichome birefringence          124   4e-30   
ref|NP_001057100.1|  Os06g0207500                                       124   6e-30   Oryza sativa Japonica Group [Japonica rice]
gb|KHG17263.1|  Alanine--tRNA ligase                                    121   8e-30   
ref|XP_002882764.1|  predicted protein                                  122   1e-29   
ref|XP_006407376.1|  hypothetical protein EUTSA_v10020451mg             122   1e-29   
emb|CDY72094.1|  BnaCnng75930D                                          121   2e-29   
ref|NP_001141610.1|  uncharacterized protein LOC100273728               120   2e-29   Zea mays [maize]
gb|AAM67355.1|  unknown                                                 119   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EMS48369.1|  hypothetical protein TRIUR3_11824                       120   3e-29   
ref|XP_007142667.1|  hypothetical protein PHAVU_007G006500g             120   3e-29   
ref|XP_010452610.1|  PREDICTED: protein trichome birefringence          121   4e-29   
ref|XP_010491248.1|  PREDICTED: protein trichome birefringence-like     121   4e-29   
emb|CDX81015.1|  BnaC03g02690D                                          120   4e-29   
emb|CDY08459.1|  BnaA05g26950D                                          120   5e-29   
ref|XP_010520026.1|  PREDICTED: protein trichome birefringence-like     121   5e-29   
ref|XP_009146094.1|  PREDICTED: protein trichome birefringence-li...    117   5e-29   
ref|XP_006299462.1|  hypothetical protein CARUB_v10015627mg             119   7e-29   
ref|NP_187813.1|  protein TRICHOME BIREFRINGENCE-LIKE 1                 120   7e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28553.1|  unknown                                                 120   7e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287297.1|  hypothetical protein CARUB_v10000490mg             120   7e-29   
ref|XP_003625280.1|  hypothetical protein MTR_7g093450                  120   8e-29   
ref|XP_004497358.1|  PREDICTED: uncharacterized protein LOC101512304    119   1e-28   
ref|XP_010682517.1|  PREDICTED: protein trichome birefringence-li...    119   1e-28   
gb|KHN37297.1|  hypothetical protein glysoja_013512                     119   1e-28   
gb|EYU44005.1|  hypothetical protein MIMGU_mgv1a026273mg                118   1e-28   
emb|CDY55774.1|  BnaA03g55480D                                          118   2e-28   
ref|NP_568173.2|  protein TRICHOME BIREFRINGENCE                        119   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|ADI48429.1|  trichome birefringence                                  119   2e-28   
gb|KHN27090.1|  hypothetical protein glysoja_032858                     115   2e-28   
emb|CDX70077.1|  BnaA10g24260D                                          118   3e-28   
emb|CDX98947.1|  BnaC09g48880D                                          118   3e-28   
ref|XP_009146650.1|  PREDICTED: protein trichome birefringence-li...    117   3e-28   
ref|XP_009130955.1|  PREDICTED: protein trichome birefringence-like     118   3e-28   
gb|ABK22287.1|  unknown                                                 117   3e-28   Picea sitchensis
ref|XP_010265940.1|  PREDICTED: protein trichome birefringence-like     118   3e-28   
gb|ABK25068.1|  unknown                                                 117   4e-28   Picea sitchensis
gb|KHG20627.1|  CAS1 domain-containing 1                                117   4e-28   
ref|XP_006399144.1|  hypothetical protein EUTSA_v10012993mg             118   4e-28   
ref|XP_009391441.1|  PREDICTED: protein trichome birefringence-like     119   4e-28   
ref|XP_009120981.1|  PREDICTED: protein trichome birefringence-li...    117   4e-28   
ref|XP_009122281.1|  PREDICTED: protein trichome birefringence          118   4e-28   
ref|XP_010557950.1|  PREDICTED: protein trichome birefringence-like     118   4e-28   
ref|XP_002871228.1|  hypothetical protein ARALYDRAFT_487481             118   4e-28   
ref|XP_009133414.1|  PREDICTED: protein trichome birefringence-li...    116   5e-28   
ref|XP_003555633.2|  PREDICTED: protein YLS7-like                       117   5e-28   
gb|KDO70900.1|  hypothetical protein CISIN_1g037533mg                   115   6e-28   
gb|KFK25082.1|  hypothetical protein AALP_AA8G063700                    117   6e-28   
ref|XP_010672635.1|  PREDICTED: protein trichome birefringence-li...    117   6e-28   
ref|XP_010498482.1|  PREDICTED: protein trichome birefringence-li...    117   6e-28   
ref|XP_010257492.1|  PREDICTED: protein trichome birefringence          117   6e-28   
ref|XP_006590231.1|  PREDICTED: protein YLS7-like                       116   7e-28   
gb|KHG04354.1|  CAS1 domain-containing 1                                117   9e-28   
ref|XP_010486896.1|  PREDICTED: protein trichome birefringence-li...    116   9e-28   
ref|XP_009125778.1|  PREDICTED: protein trichome birefringence-like     116   1e-27   
emb|CDY24925.1|  BnaC03g22470D                                          115   1e-27   
gb|KHG00171.1|  U3 small nucleolar RNA-associated 6                     111   1e-27   
ref|XP_010464957.1|  PREDICTED: protein trichome birefringence-li...    116   2e-27   
ref|XP_008340353.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    115   2e-27   
ref|XP_010026659.1|  PREDICTED: protein trichome birefringence-li...    115   2e-27   
ref|XP_003520540.1|  PREDICTED: protein YLS7-like                       116   2e-27   
ref|XP_007011182.1|  Uncharacterized protein isoform 1                  116   2e-27   
ref|XP_009414351.1|  PREDICTED: protein trichome birefringence-li...    117   2e-27   
ref|XP_003535115.1|  PREDICTED: protein YLS7-like                       116   2e-27   
emb|CDY05000.1|  BnaAnng01820D                                          115   2e-27   
ref|XP_010227191.1|  PREDICTED: protein trichome birefringence-li...    116   3e-27   
ref|XP_008229144.1|  PREDICTED: protein trichome birefringence-li...    116   3e-27   
gb|KCW88140.1|  hypothetical protein EUGRSUZ_A00530                     114   3e-27   
gb|ABK92679.1|  unknown                                                 111   3e-27   Populus trichocarpa [western balsam poplar]
gb|KCW59798.1|  hypothetical protein EUGRSUZ_H02546                     112   3e-27   
gb|KDP32509.1|  hypothetical protein JCGZ_14712                         111   3e-27   
ref|XP_008444354.1|  PREDICTED: protein trichome birefringence-li...    115   3e-27   
ref|XP_007207689.1|  hypothetical protein PRUPE_ppa023743mg             115   4e-27   
ref|XP_002308359.2|  hypothetical protein POPTR_0006s20840g             115   4e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009376704.1|  PREDICTED: protein trichome birefringence-li...    115   4e-27   
gb|EMS61403.1|  hypothetical protein TRIUR3_19587                       116   4e-27   
ref|XP_006429897.1|  hypothetical protein CICLE_v10011263mg             115   5e-27   
ref|XP_006492844.1|  PREDICTED: protein YLS7-like                       115   5e-27   
ref|XP_004143065.1|  PREDICTED: uncharacterized protein LOC101210768    114   5e-27   
ref|XP_008352647.1|  PREDICTED: protein trichome birefringence-li...    113   5e-27   
ref|XP_010536111.1|  PREDICTED: protein ESKIMO 1-like isoform X2        113   5e-27   
gb|EEE64866.1|  hypothetical protein OsJ_19723                          115   5e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011078818.1|  PREDICTED: protein trichome birefringence-like     115   6e-27   
ref|XP_010536034.1|  PREDICTED: protein ESKIMO 1-like isoform X1        113   6e-27   
ref|XP_011005287.1|  PREDICTED: protein trichome birefringence-like     115   6e-27   
ref|XP_010268038.1|  PREDICTED: protein trichome birefringence-li...    113   6e-27   
ref|XP_009392183.1|  PREDICTED: protein trichome birefringence-li...    115   8e-27   
ref|XP_008363352.1|  PREDICTED: protein trichome birefringence-li...    112   8e-27   
gb|KDO61978.1|  hypothetical protein CISIN_1g023751mg                   111   8e-27   
ref|XP_004296154.1|  PREDICTED: uncharacterized protein LOC101303316    114   8e-27   
ref|XP_007157368.1|  hypothetical protein PHAVU_002G064300g             114   9e-27   
ref|XP_011075105.1|  PREDICTED: protein trichome birefringence-like     114   9e-27   
ref|XP_003553434.1|  PREDICTED: protein YLS7-like                       114   9e-27   
ref|XP_007044711.1|  Uncharacterized protein TCM_010432                 115   9e-27   
ref|XP_008221854.1|  PREDICTED: protein trichome birefringence-li...    114   1e-26   
ref|XP_004493599.1|  PREDICTED: uncharacterized protein LOC101511851    114   1e-26   
ref|XP_009375160.1|  PREDICTED: protein trichome birefringence-like     112   1e-26   
ref|XP_004249290.1|  PREDICTED: protein trichome birefringence-like     114   1e-26   
ref|XP_007221982.1|  hypothetical protein PRUPE_ppa002834mg             114   1e-26   
ref|XP_008804141.1|  PREDICTED: protein trichome birefringence-li...    112   1e-26   
ref|XP_009417662.1|  PREDICTED: protein trichome birefringence-like     114   1e-26   
ref|XP_008361466.1|  PREDICTED: protein trichome birefringence-li...    114   1e-26   
ref|XP_006351352.1|  PREDICTED: uncharacterized protein LOC102598...    114   2e-26   
gb|EPS68903.1|  hypothetical protein M569_05864                         112   2e-26   
ref|XP_006351351.1|  PREDICTED: uncharacterized protein LOC102598...    114   2e-26   
ref|XP_010554669.1|  PREDICTED: protein ESKIMO 1-like                   112   2e-26   
ref|XP_006453211.1|  hypothetical protein CICLE_v10008256mg             112   2e-26   
ref|XP_002323329.2|  hypothetical protein POPTR_0016s05930g             113   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011100832.1|  PREDICTED: protein trichome birefringence-li...    112   2e-26   
ref|XP_008352661.1|  PREDICTED: protein trichome birefringence-li...    113   2e-26   
ref|XP_008363351.1|  PREDICTED: protein trichome birefringence-li...    113   2e-26   
ref|XP_006474304.1|  PREDICTED: protein YLS7-like                       112   3e-26   
ref|XP_004252117.1|  PREDICTED: protein trichome birefringence-li...    111   3e-26   
gb|EYU39954.1|  hypothetical protein MIMGU_mgv1a008556mg                111   3e-26   
ref|XP_008812175.1|  PREDICTED: protein trichome birefringence-li...    113   3e-26   
ref|XP_006358947.1|  PREDICTED: uncharacterized protein LOC102605235    111   3e-26   
gb|KHN00372.1|  hypothetical protein glysoja_000040                     112   3e-26   
ref|XP_009604045.1|  PREDICTED: protein trichome birefringence-like     113   3e-26   
ref|XP_002282459.1|  PREDICTED: protein trichome birefringence-li...    110   3e-26   Vitis vinifera
gb|EYU26676.1|  hypothetical protein MIMGU_mgv1a006839mg                111   3e-26   
ref|XP_007029023.1|  Emb:CAB82953.1, putative                           113   4e-26   
ref|XP_009783309.1|  PREDICTED: protein trichome birefringence-like     113   4e-26   
ref|XP_010032111.1|  PREDICTED: protein trichome birefringence-li...    111   4e-26   
ref|XP_002311231.2|  hypothetical protein POPTR_0008s06990g             111   4e-26   Populus trichocarpa [western balsam poplar]
emb|CDP10159.1|  unnamed protein product                                112   4e-26   
ref|XP_009592544.1|  PREDICTED: protein trichome birefringence-li...    111   4e-26   
gb|EYU46810.1|  hypothetical protein MIMGU_mgv1a005200mg                111   4e-26   
ref|XP_009592552.1|  PREDICTED: protein trichome birefringence-li...    111   4e-26   
gb|KCW88139.1|  hypothetical protein EUGRSUZ_A00530                     111   5e-26   
ref|XP_008360191.1|  PREDICTED: protein trichome birefringence-li...    112   5e-26   
ref|XP_003541536.1|  PREDICTED: protein YLS7-like                       111   5e-26   
ref|XP_009364158.1|  PREDICTED: protein trichome birefringence-li...    112   5e-26   
ref|XP_010259297.1|  PREDICTED: protein trichome birefringence-li...    111   5e-26   
ref|XP_002448144.1|  hypothetical protein SORBIDRAFT_06g022030          113   5e-26   Sorghum bicolor [broomcorn]
ref|XP_009757308.1|  PREDICTED: protein trichome birefringence-like     112   6e-26   
ref|XP_004296155.1|  PREDICTED: uncharacterized protein LOC101303602    113   6e-26   
ref|XP_010913702.1|  PREDICTED: protein trichome birefringence-li...    110   7e-26   
emb|CDP13190.1|  unnamed protein product                                112   8e-26   
gb|AES91931.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    110   8e-26   
ref|XP_009795769.1|  PREDICTED: protein trichome birefringence-li...    110   8e-26   
gb|KDP24643.1|  hypothetical protein JCGZ_25559                         112   9e-26   
emb|CCI55362.1|  PH01B035L11.7                                          112   9e-26   
gb|KDP44745.1|  hypothetical protein JCGZ_01245                         109   1e-25   
ref|XP_006362212.1|  PREDICTED: uncharacterized protein LOC102599885    112   1e-25   
ref|XP_002311402.2|  hypothetical protein POPTR_0008s10790g             109   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006355406.1|  PREDICTED: uncharacterized protein LOC102580314    110   1e-25   
ref|XP_006575204.1|  PREDICTED: protein YLS7-like                       111   1e-25   
gb|KDO82333.1|  hypothetical protein CISIN_1g007771mg                   111   1e-25   
ref|XP_002297655.2|  hypothetical protein POPTR_0001s04810g             110   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_004489803.1|  PREDICTED: uncharacterized protein LOC101513224    110   1e-25   
ref|XP_011037956.1|  PREDICTED: protein trichome birefringence-like     110   1e-25   
ref|XP_002528302.1|  conserved hypothetical protein                     110   1e-25   Ricinus communis
ref|XP_008351025.1|  PREDICTED: protein trichome birefringence-li...    107   1e-25   
emb|CAH67561.1|  OSIGBa0101P20.4                                        111   1e-25   Oryza sativa [red rice]
ref|XP_011020489.1|  PREDICTED: protein trichome birefringence-li...    110   1e-25   
gb|KDP26622.1|  hypothetical protein JCGZ_17780                         111   1e-25   
ref|XP_007162340.1|  hypothetical protein PHAVU_001G143600g             111   1e-25   
ref|NP_001053267.1|  Os04g0508000                                       111   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006349533.1|  PREDICTED: uncharacterized protein LOC102582870    109   2e-25   
ref|XP_010921030.1|  PREDICTED: protein trichome birefringence-li...    109   2e-25   
ref|XP_004249070.1|  PREDICTED: protein trichome birefringence-li...    109   2e-25   
ref|XP_010429700.1|  PREDICTED: protein trichome birefringence-li...    108   2e-25   
gb|KHN14559.1|  hypothetical protein glysoja_027168                     110   2e-25   
ref|XP_010644139.1|  PREDICTED: protein trichome birefringence-li...    109   2e-25   
ref|XP_003517720.1|  PREDICTED: protein YLS7-like                       110   2e-25   
ref|XP_003613189.1|  hypothetical protein MTR_5g033800                  109   2e-25   
emb|CAN66611.1|  hypothetical protein VITISV_017558                     108   2e-25   Vitis vinifera
ref|XP_002534536.1|  conserved hypothetical protein                     110   2e-25   Ricinus communis
ref|XP_004294131.1|  PREDICTED: uncharacterized protein LOC101303...    108   2e-25   
ref|XP_003616659.1|  hypothetical protein MTR_5g082880                  110   2e-25   
ref|XP_008365523.1|  PREDICTED: protein trichome birefringence-li...    107   2e-25   
gb|KHN17657.1|  hypothetical protein glysoja_005854                     109   2e-25   
ref|XP_010534605.1|  PREDICTED: protein ESKIMO 1-like                   109   2e-25   
ref|XP_008229347.1|  PREDICTED: protein trichome birefringence-like     111   2e-25   
ref|XP_002316834.2|  hypothetical protein POPTR_0011s07550g             106   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010472706.1|  PREDICTED: protein trichome birefringence-li...    108   2e-25   
ref|XP_010417475.1|  PREDICTED: protein trichome birefringence-li...    108   2e-25   
ref|XP_010267992.1|  PREDICTED: protein trichome birefringence-li...    109   2e-25   
ref|XP_008663376.1|  PREDICTED: protein trichome birefringence-li...    111   2e-25   
emb|CBI30004.3|  unnamed protein product                                108   2e-25   
ref|XP_003550638.1|  PREDICTED: protein YLS7-like                       109   2e-25   
gb|KHN22642.1|  hypothetical protein glysoja_027530                     109   3e-25   
ref|XP_002271893.1|  PREDICTED: protein trichome birefringence-li...    108   3e-25   Vitis vinifera
ref|XP_009794597.1|  PREDICTED: protein trichome birefringence-li...    108   3e-25   
ref|XP_008789128.1|  PREDICTED: protein trichome birefringence-li...    108   3e-25   
ref|XP_003519825.1|  PREDICTED: protein YLS7-like                       109   3e-25   
ref|XP_009345074.1|  PREDICTED: protein ESKIMO 1-like                   109   3e-25   
gb|KDO86990.1|  hypothetical protein CISIN_1g009237mg                   108   3e-25   
ref|XP_002534436.1|  conserved hypothetical protein                     110   3e-25   Ricinus communis
ref|XP_006854129.1|  hypothetical protein AMTR_s00048p00162020          109   3e-25   
ref|XP_002316205.2|  hypothetical protein POPTR_0010s19490g             108   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008389689.1|  PREDICTED: protein trichome birefringence-li...    110   3e-25   
ref|XP_008374103.1|  PREDICTED: protein ESKIMO 1                        108   3e-25   
ref|XP_010671195.1|  PREDICTED: protein trichome birefringence-li...    108   3e-25   
ref|XP_002525401.1|  conserved hypothetical protein                     110   4e-25   
ref|XP_010676820.1|  PREDICTED: protein trichome birefringence-li...    108   4e-25   
emb|CDY07619.1|  BnaA03g18920D                                          110   4e-25   
ref|XP_003610012.1|  hypothetical protein MTR_4g126950                  108   4e-25   
ref|XP_006301170.1|  hypothetical protein CARUB_v10021567mg             108   4e-25   
gb|KDO71838.1|  hypothetical protein CISIN_1g045325mg                   108   4e-25   
gb|EPS74217.1|  hypothetical protein M569_00536                         107   4e-25   
ref|XP_004249181.1|  PREDICTED: protein trichome birefringence          110   4e-25   
ref|XP_004228795.2|  PREDICTED: protein trichome birefringence-like     107   4e-25   
ref|XP_002301513.2|  hypothetical protein POPTR_0002s19680g             108   4e-25   
gb|EPS65088.1|  hypothetical protein M569_09686                         109   4e-25   
ref|XP_006419433.1|  hypothetical protein CICLE_v10006676mg             108   4e-25   
emb|CBW30214.1|  Conserved hypothetical protein                         108   4e-25   
ref|XP_006366946.1|  PREDICTED: uncharacterized protein LOC102588894    108   4e-25   
gb|KDP44302.1|  hypothetical protein JCGZ_19169                         108   4e-25   
ref|XP_006488998.1|  PREDICTED: protein YLS7-like                       108   5e-25   
gb|EAZ01954.1|  hypothetical protein OsI_23985                          108   5e-25   
ref|XP_007134783.1|  hypothetical protein PHAVU_010G075700g             108   5e-25   
ref|XP_008374091.1|  PREDICTED: protein ESKIMO 1-like                   108   5e-25   
ref|XP_002316204.1|  hypothetical protein POPTR_0010s19480g             107   5e-25   
emb|CDY46514.1|  BnaC06g15710D                                          108   5e-25   
gb|KFK34842.1|  hypothetical protein AALP_AA5G200300                    108   5e-25   
gb|KHG14015.1|  CAS1 domain-containing 1                                108   5e-25   
gb|AES97753.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    108   5e-25   
emb|CDO98793.1|  unnamed protein product                                108   6e-25   
gb|KEH16599.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    108   6e-25   
ref|XP_009611858.1|  PREDICTED: protein trichome birefringence-like     109   6e-25   
gb|EMT17911.1|  hypothetical protein F775_21346                         106   6e-25   
emb|CBI22044.3|  unnamed protein product                                110   6e-25   
ref|XP_008649021.1|  PREDICTED: protein trichome birefringence-li...    108   6e-25   
ref|XP_010037693.1|  PREDICTED: protein trichome birefringence-li...    107   6e-25   
emb|CDX67630.1|  BnaA07g16700D                                          107   6e-25   
ref|XP_011039468.1|  PREDICTED: protein trichome birefringence-like     109   6e-25   
emb|CDP06464.1|  unnamed protein product                                107   6e-25   
ref|XP_002323595.1|  hypothetical protein POPTR_0016s12660g             107   6e-25   
ref|XP_011042254.1|  PREDICTED: protein trichome birefringence-li...    108   6e-25   
ref|XP_007153754.1|  hypothetical protein PHAVU_003G062400g             108   6e-25   
ref|XP_006846293.1|  hypothetical protein AMTR_s00012p00251740          107   6e-25   
ref|XP_009587467.1|  PREDICTED: protein trichome birefringence-like     108   6e-25   
ref|NP_030560.1|  trichome birefringence-like 28 protein                107   7e-25   
ref|XP_010044971.1|  PREDICTED: protein trichome birefringence-li...    108   7e-25   
gb|EYU28435.1|  hypothetical protein MIMGU_mgv1a003426mg                109   7e-25   
ref|XP_009378730.1|  PREDICTED: protein trichome birefringence-li...    108   7e-25   
ref|XP_002527690.1|  conserved hypothetical protein                     108   7e-25   
gb|KDP35862.1|  hypothetical protein JCGZ_10642                         108   7e-25   
ref|XP_010508898.1|  PREDICTED: protein trichome birefringence-li...    107   8e-25   
ref|XP_010058223.1|  PREDICTED: protein trichome birefringence          109   8e-25   
ref|XP_003609734.1|  hypothetical protein MTR_4g121560                  107   8e-25   
ref|XP_007200128.1|  hypothetical protein PRUPE_ppa017879mg             109   8e-25   
ref|XP_008245906.1|  PREDICTED: protein trichome birefringence-li...    106   8e-25   
ref|XP_011035916.1|  PREDICTED: protein ESKIMO 1-like isoform X1        107   9e-25   
ref|XP_010940155.1|  PREDICTED: protein trichome birefringence-li...    109   9e-25   
ref|XP_008382075.1|  PREDICTED: protein trichome birefringence-li...    107   9e-25   
ref|XP_009103977.1|  PREDICTED: protein ESKIMO 1                        108   9e-25   
ref|XP_002873001.1|  hypothetical protein ARALYDRAFT_486912             107   9e-25   
ref|XP_004229072.1|  PREDICTED: protein trichome birefringence-li...    107   9e-25   
ref|XP_006492340.1|  PREDICTED: protein YLS7-like                       108   9e-25   
ref|XP_003625972.1|  hypothetical protein MTR_7g109550                  107   9e-25   
ref|XP_009783488.1|  PREDICTED: protein trichome birefringence-li...    108   1e-24   
ref|XP_002876345.1|  hypothetical protein ARALYDRAFT_907033             107   1e-24   
ref|XP_004164982.1|  PREDICTED: uncharacterized LOC101220002            107   1e-24   
ref|XP_006349183.1|  PREDICTED: uncharacterized protein LOC102598625    108   1e-24   
ref|XP_009795954.1|  PREDICTED: protein trichome birefringence-li...    108   1e-24   
gb|KDP24428.1|  hypothetical protein JCGZ_24992                         106   1e-24   
ref|XP_008454494.1|  PREDICTED: protein trichome birefringence-li...    108   1e-24   
ref|XP_008225213.1|  PREDICTED: protein trichome birefringence-li...    106   1e-24   
ref|XP_002532108.1|  conserved hypothetical protein                     107   1e-24   
ref|XP_008450807.1|  PREDICTED: protein trichome birefringence-li...    107   1e-24   
ref|XP_010265394.1|  PREDICTED: protein trichome birefringence-li...    107   1e-24   
ref|XP_010504475.1|  PREDICTED: protein ESKIMO 1 isoform X1             107   1e-24   
ref|XP_004502134.1|  PREDICTED: uncharacterized protein LOC101510392    107   1e-24   
ref|XP_010273481.1|  PREDICTED: protein trichome birefringence-li...    106   1e-24   
ref|XP_002280022.1|  PREDICTED: protein trichome birefringence          108   1e-24   
ref|XP_010505739.1|  PREDICTED: protein trichome birefringence-li...    107   1e-24   
ref|XP_004229386.1|  PREDICTED: protein trichome birefringence-li...    108   1e-24   
ref|XP_008791066.1|  PREDICTED: protein trichome birefringence-li...    107   1e-24   
ref|XP_007219006.1|  hypothetical protein PRUPE_ppa004236mg             107   1e-24   
gb|KHN19484.1|  hypothetical protein glysoja_026099                     105   1e-24   
ref|XP_010516197.1|  PREDICTED: protein ESKIMO 1-like                   107   1e-24   
ref|XP_011035919.1|  PREDICTED: protein ESKIMO 1-like isoform X2        107   1e-24   
ref|XP_009623098.1|  PREDICTED: protein trichome birefringence-li...    106   1e-24   
ref|XP_011035918.1|  PREDICTED: protein ESKIMO 1-like isoform X1        107   1e-24   
ref|XP_010427403.1|  PREDICTED: protein ESKIMO 1-like                   107   1e-24   
gb|KCW50459.1|  hypothetical protein EUGRSUZ_J00196                     107   2e-24   
ref|XP_006357865.1|  PREDICTED: uncharacterized protein LOC102596807    108   2e-24   
ref|NP_177992.1|  trichome birefringence-like 42                        106   2e-24   
ref|XP_009591829.1|  PREDICTED: protein trichome birefringence-li...    108   2e-24   
ref|XP_010251171.1|  PREDICTED: protein trichome birefringence-li...    108   2e-24   
ref|XP_004150389.1|  PREDICTED: uncharacterized protein LOC101212427    107   2e-24   
ref|XP_010937874.1|  PREDICTED: protein trichome birefringence-li...    106   2e-24   
ref|XP_009604954.1|  PREDICTED: protein trichome birefringence-li...    107   2e-24   
ref|XP_009393972.1|  PREDICTED: protein trichome birefringence-li...    107   2e-24   
ref|XP_011048808.1|  PREDICTED: protein ESKIMO 1-like isoform X2        106   2e-24   
ref|XP_010670899.1|  PREDICTED: protein trichome birefringence-li...    106   2e-24   
ref|XP_007204980.1|  hypothetical protein PRUPE_ppa003027mg             108   2e-24   
ref|XP_010544965.1|  PREDICTED: protein trichome birefringence-li...    107   2e-24   
gb|EYU17992.1|  hypothetical protein MIMGU_mgv1a025478mg                107   2e-24   
ref|XP_011048734.1|  PREDICTED: protein ESKIMO 1-like isoform X1        107   2e-24   
ref|XP_010937873.1|  PREDICTED: protein trichome birefringence-li...    106   2e-24   
ref|XP_009378728.1|  PREDICTED: protein trichome birefringence-li...    106   2e-24   
ref|XP_010535816.1|  PREDICTED: protein trichome birefringence-li...    107   2e-24   
ref|XP_010031198.1|  PREDICTED: protein ESKIMO 1                        107   2e-24   
ref|XP_011085127.1|  PREDICTED: protein ESKIMO 1                        106   2e-24   
ref|XP_006657213.1|  PREDICTED: protein YLS7-like                       106   2e-24   
ref|XP_004137306.1|  PREDICTED: uncharacterized protein LOC101210661    106   2e-24   
ref|XP_008443032.1|  PREDICTED: protein trichome birefringence          108   2e-24   
ref|XP_011004745.1|  PREDICTED: protein trichome birefringence-li...    106   2e-24   
ref|XP_004152223.1|  PREDICTED: uncharacterized protein LOC101220002    107   2e-24   
ref|XP_009394684.1|  PREDICTED: protein trichome birefringence-li...    106   2e-24   
ref|XP_010509796.1|  PREDICTED: protein trichome birefringence-li...    105   2e-24   
ref|XP_011095068.1|  PREDICTED: protein trichome birefringence-li...    106   2e-24   
ref|XP_008369267.1|  PREDICTED: protein ESKIMO 1-like                   107   2e-24   
gb|KDP44746.1|  hypothetical protein JCGZ_01246                         105   2e-24   
ref|XP_004149051.1|  PREDICTED: uncharacterized protein LOC101203509    105   2e-24   
gb|KDP21076.1|  hypothetical protein JCGZ_21547                         105   2e-24   
ref|XP_004161492.1|  PREDICTED: uncharacterized protein LOC101228487    107   3e-24   
ref|XP_004136561.1|  PREDICTED: uncharacterized protein LOC101220024    107   3e-24   
gb|EMS46414.1|  hypothetical protein TRIUR3_18542                       105   3e-24   
ref|NP_568093.1|  protein trichome birefringence-like 35                106   3e-24   
ref|XP_010505740.1|  PREDICTED: protein trichome birefringence-li...    106   3e-24   
gb|AAM61008.1|  unknown                                                 106   3e-24   
gb|KFK24668.1|  hypothetical protein AALP_AA8G009500                    106   3e-24   
ref|XP_010671194.1|  PREDICTED: protein trichome birefringence-li...    106   3e-24   
ref|XP_007153710.1|  hypothetical protein PHAVU_003G058400g             105   3e-24   
ref|XP_002311232.2|  hypothetical protein POPTR_0008s07000g             106   3e-24   
ref|XP_010413780.1|  PREDICTED: protein trichome birefringence-li...    105   3e-24   
ref|XP_009619687.1|  PREDICTED: protein trichome birefringence-li...    105   3e-24   
ref|XP_010469399.1|  PREDICTED: protein trichome birefringence-li...    105   3e-24   
gb|EPS65057.1|  hypothetical protein M569_09721                         105   3e-24   
emb|CAB82278.1|  putative protein                                       106   3e-24   
ref|XP_010088792.1|  hypothetical protein L484_018353                   105   3e-24   
ref|NP_001190201.1|  protein trichome birefringence-like 35             106   3e-24   
dbj|BAJ94312.1|  predicted protein                                      106   3e-24   
ref|XP_010687461.1|  PREDICTED: protein trichome birefringence-li...    106   3e-24   
ref|XP_004308558.1|  PREDICTED: uncharacterized protein LOC101311052    105   3e-24   
ref|XP_004507926.1|  PREDICTED: uncharacterized protein LOC101489...    105   3e-24   
ref|XP_002887755.1|  hypothetical protein ARALYDRAFT_316771             105   3e-24   
ref|XP_007145701.1|  hypothetical protein PHAVU_007G261000g             107   4e-24   
ref|XP_006852469.1|  hypothetical protein AMTR_s00021p00123440          105   4e-24   
ref|XP_006843604.1|  hypothetical protein AMTR_s00007p00137180          105   4e-24   
gb|AGV54877.1|  hypothetical protein                                    105   4e-24   
ref|XP_009591603.1|  PREDICTED: protein trichome birefringence-li...    105   4e-24   
ref|XP_006483906.1|  PREDICTED: protein YLS7-like                       107   4e-24   
ref|XP_007211438.1|  hypothetical protein PRUPE_ppa007187mg             105   4e-24   
ref|XP_008781112.1|  PREDICTED: protein trichome birefringence-li...    107   4e-24   
ref|XP_004500278.1|  PREDICTED: uncharacterized protein LOC101504380    105   4e-24   
gb|EMT02462.1|  hypothetical protein F775_07079                         105   4e-24   
ref|XP_011045285.1|  PREDICTED: protein trichome birefringence-li...    107   4e-24   
ref|XP_006403037.1|  hypothetical protein EUTSA_v10005901mg             106   4e-24   
ref|XP_006438320.1|  hypothetical protein CICLE_v10031033mg             107   4e-24   
ref|NP_191158.1|  protein ESKIMO 1                                      106   4e-24   
ref|XP_010101390.1|  hypothetical protein L484_020405                   105   4e-24   
ref|XP_009335197.1|  PREDICTED: protein trichome birefringence-li...    105   4e-24   
ref|XP_006649908.1|  PREDICTED: protein YLS7-like                       105   4e-24   
ref|XP_008781812.1|  PREDICTED: protein trichome birefringence-li...    106   4e-24   
ref|XP_008345228.1|  PREDICTED: protein trichome birefringence-li...    104   4e-24   
ref|XP_008451714.1|  PREDICTED: protein trichome birefringence-li...    105   5e-24   
ref|XP_008369108.1|  PREDICTED: protein trichome birefringence-li...    105   5e-24   
ref|XP_008231948.1|  PREDICTED: protein trichome birefringence-li...    105   5e-24   
ref|XP_006444503.1|  hypothetical protein CICLE_v100200871mg            103   5e-24   
emb|CDX84181.1|  BnaC04g09430D                                          105   5e-24   
ref|XP_007154672.1|  hypothetical protein PHAVU_003G138100g             105   5e-24   
ref|XP_009376740.1|  PREDICTED: protein trichome birefringence-li...    104   5e-24   
ref|XP_010999799.1|  PREDICTED: protein trichome birefringence-li...    105   5e-24   
emb|CDY37673.1|  BnaA04g19950D                                          100   5e-24   
emb|CDY40499.1|  BnaC09g14570D                                          105   5e-24   
gb|EMT09233.1|  hypothetical protein F775_52456                         107   5e-24   
ref|XP_009591602.1|  PREDICTED: protein trichome birefringence-li...    105   5e-24   
ref|XP_006287739.1|  hypothetical protein CARUB_v10000949mg             105   5e-24   
ref|XP_010253783.1|  PREDICTED: protein trichome birefringence-li...    105   5e-24   
emb|CBI20116.3|  unnamed protein product                                104   5e-24   
ref|XP_006828125.1|  hypothetical protein AMTR_s00023p00040670          105   5e-24   
emb|CBI15933.3|  unnamed protein product                                104   5e-24   
ref|XP_008233772.1|  PREDICTED: protein ESKIMO 1-like                   106   6e-24   
ref|XP_006290951.1|  hypothetical protein CARUB_v10017067mg             105   6e-24   
ref|XP_006485831.1|  PREDICTED: protein YLS7-like                       105   6e-24   
ref|XP_007008936.1|  Uncharacterized protein TCM_042483                 105   6e-24   
ref|XP_004984854.1|  PREDICTED: uncharacterized protein LOC101772...    104   6e-24   
ref|XP_007217300.1|  hypothetical protein PRUPE_ppa018693mg             104   6e-24   
gb|KDO48340.1|  hypothetical protein CISIN_1g015036mg                   105   6e-24   
gb|KDO68937.1|  hypothetical protein CISIN_1g047865mg                   104   6e-24   
ref|XP_009776954.1|  PREDICTED: protein trichome birefringence-li...    105   6e-24   
ref|XP_010920201.1|  PREDICTED: protein trichome birefringence-li...    105   6e-24   
ref|XP_009338153.1|  PREDICTED: protein trichome birefringence-li...    105   6e-24   
ref|XP_006451733.1|  hypothetical protein CICLE_v10008349mg             105   6e-24   
gb|KFK36903.1|  hypothetical protein AALP_AA4G187800                    104   6e-24   
ref|XP_006398600.1|  hypothetical protein EUTSA_v10013544mg             105   6e-24   
ref|XP_009348559.1|  PREDICTED: protein trichome birefringence-li...    105   6e-24   
ref|XP_002283640.1|  PREDICTED: protein trichome birefringence-li...    104   7e-24   
emb|CDP06045.1|  unnamed protein product                                104   7e-24   
ref|XP_004298485.1|  PREDICTED: uncharacterized protein LOC101297725    106   7e-24   
emb|CDY69617.1|  BnaA09g53160D                                          106   8e-24   
ref|XP_010108265.1|  hypothetical protein L484_018686                   104   8e-24   
ref|XP_008226367.1|  PREDICTED: protein trichome birefringence-li...    104   8e-24   
ref|XP_006841061.1|  hypothetical protein AMTR_s00085p00172090          105   8e-24   
emb|CDP05987.1|  unnamed protein product                                104   8e-24   
dbj|BAK05297.1|  predicted protein                                      104   8e-24   
ref|XP_003561735.1|  PREDICTED: protein PMR5                            104   8e-24   
ref|XP_006444502.1|  hypothetical protein CICLE_v100200871mg            104   8e-24   
ref|XP_010676766.1|  PREDICTED: protein trichome birefringence-li...    104   8e-24   
ref|XP_011006720.1|  PREDICTED: protein trichome birefringence-li...    104   8e-24   
ref|XP_011077543.1|  PREDICTED: protein trichome birefringence-li...    104   8e-24   
ref|XP_002515280.1|  conserved hypothetical protein                     106   9e-24   
ref|XP_004293928.1|  PREDICTED: uncharacterized protein LOC101315214    103   9e-24   
ref|XP_011084898.1|  PREDICTED: protein ESKIMO 1-like                   104   9e-24   
ref|XP_010111373.1|  hypothetical protein L484_028030                   106   9e-24   
gb|KDP44749.1|  hypothetical protein JCGZ_01249                         105   9e-24   
ref|XP_010675287.1|  PREDICTED: protein trichome birefringence-li...    104   9e-24   
ref|XP_007134784.1|  hypothetical protein PHAVU_010G075800g             104   9e-24   
ref|XP_009356126.1|  PREDICTED: protein trichome birefringence-li...    104   9e-24   
ref|XP_010271679.1|  PREDICTED: protein trichome birefringence-li...    104   9e-24   
ref|XP_008464204.1|  PREDICTED: protein trichome birefringence-li...    104   9e-24   
ref|XP_006435758.1|  hypothetical protein CICLE_v10033614mg             104   9e-24   
ref|XP_010517431.1|  PREDICTED: protein trichome birefringence-li...    104   9e-24   
ref|XP_004301795.1|  PREDICTED: uncharacterized protein LOC101300923    105   9e-24   
ref|XP_002308095.2|  hypothetical protein POPTR_0006s07090g             105   9e-24   
ref|XP_002298909.1|  hypothetical protein POPTR_0001s38580g             104   9e-24   
ref|XP_002277229.1|  PREDICTED: protein PMR5                            104   1e-23   
emb|CDY54603.1|  BnaA05g28590D                                          105   1e-23   
ref|XP_006486529.1|  PREDICTED: protein YLS7-like                       104   1e-23   



>ref|XP_006348848.1| PREDICTED: uncharacterized protein LOC102594004 [Solanum tuberosum]
Length=429

 Score =   196 bits (499),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +F+YK +L DE+++ESAF++AM+TW  WID N++ T+TTVFFRSISPEH+G++ CYN+T+
Sbjct  262  LFEYKGQLVDELKLESAFEVAMRTWANWIDQNVNLTKTTVFFRSISPEHKGQNGCYNKTQ  321

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI D+S +T F E L KIV+RT+SKM+ PVRYLNITKLSQ+R DAHP+ YA+K G+++I+
Sbjct  322  PITDMSYVTHFSESLTKIVDRTLSKMRVPVRYLNITKLSQHRVDAHPSAYAKKKGQELIK  381

Query  54   KKLNPEETYSDCSHWCLP  1
            +KL P ++ SDCSHWCLP
Sbjct  382  RKLKPPQSISDCSHWCLP  399



>ref|XP_010323758.1| PREDICTED: protein trichome birefringence-like 42 isoform X2 
[Solanum lycopersicum]
Length=436

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +F+YK +L +E+++ESAF++AM+TW  WID N++ T+TTVFFRSISPEH+ ++ CYN+T+
Sbjct  258  LFEYKGRLVNELKLESAFEVAMRTWANWIDQNVNLTKTTVFFRSISPEHKSQNGCYNKTQ  317

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI D+S +T F E L KIV+RT+SKM+ PVRYLNITKLSQ+R DAHP++YA+K G+++I+
Sbjct  318  PITDLSYVTDFSETLTKIVDRTLSKMRVPVRYLNITKLSQHRVDAHPSVYAKKKGQELIK  377

Query  54   KKLNPEETYSDCSHWCLP  1
            +KL P ++ SDCSHWCLP
Sbjct  378  RKLKPPQSISDCSHWCLP  395



>ref|XP_004243820.1| PREDICTED: protein trichome birefringence-like 42 isoform X1 
[Solanum lycopersicum]
Length=440

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +F+YK +L +E+++ESAF++AM+TW  WID N++ T+TTVFFRSISPEH+ ++ CYN+T+
Sbjct  262  LFEYKGRLVNELKLESAFEVAMRTWANWIDQNVNLTKTTVFFRSISPEHKSQNGCYNKTQ  321

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI D+S +T F E L KIV+RT+SKM+ PVRYLNITKLSQ+R DAHP++YA+K G+++I+
Sbjct  322  PITDLSYVTDFSETLTKIVDRTLSKMRVPVRYLNITKLSQHRVDAHPSVYAKKKGQELIK  381

Query  54   KKLNPEETYSDCSHWCLP  1
            +KL P ++ SDCSHWCLP
Sbjct  382  RKLKPPQSISDCSHWCLP  399



>ref|XP_009354322.1| PREDICTED: protein trichome birefringence-like 1 [Pyrus x bretschneideri]
Length=331

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +FQY+ K  + M IESAF +AM TW +W+D N+D T+T VFFRSISPEH+G+HWCYN+T+
Sbjct  169  LFQYEGKTVENMDIESAFDMAMNTWARWVDQNVDATKTRVFFRSISPEHKGKHWCYNKTQ  228

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI D S  T FP  + K+VERT+ +MKTPV YLNITKLSQ+R+DAHP +YA K  KQ++ 
Sbjct  229  PIEDDSYETTFPGKIIKVVERTMQRMKTPVTYLNITKLSQHRRDAHPAVYATKKWKQLLA  288

Query  54   KKLNPEETYSDCSHWCLP  1
             +    ETY+DCSHWCLP
Sbjct  289  LQNRKLETYADCSHWCLP  306



>ref|XP_009593638.1| PREDICTED: protein trichome birefringence-like 28 [Nicotiana 
tomentosiformis]
Length=442

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKP  232
            F+YK  L +E+++ESAF++AM+TW  WID N++ T+TTVFFRSISPEH+ ++ CYN+T+P
Sbjct  276  FEYKGLLVNELKLESAFEVAMRTWADWIDQNVNLTKTTVFFRSISPEHKAQNGCYNKTQP  335

Query  231  IIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEK  52
            I D S +T F E L  IVERT+SKM+  VRYLNITKLS++R DAHP++YA+K GK+++++
Sbjct  336  ITDKSHVTHFSESLTAIVERTLSKMRISVRYLNITKLSEHRVDAHPSVYAKKKGKELVKR  395

Query  51   KLNPEETYSDCSHWCLP  1
            K+ P E+++DCSHWCLP
Sbjct  396  KVKPPESFADCSHWCLP  412



>ref|XP_008342804.1| PREDICTED: protein trichome birefringence-like 42 [Malus domestica]
 ref|XP_008368633.1| PREDICTED: protein trichome birefringence-like 42 [Malus domestica]
Length=422

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +FQY+ K  + M IESAF +AM TW +W+D N+D T+T VFFRSISPEH+G+HWCYNET+
Sbjct  260  LFQYEGKTXENMEIESAFDMAMNTWARWVDQNVDATKTRVFFRSISPEHKGKHWCYNETQ  319

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI   S  T FP  + K++ERT+ +MKTPV YLNITKLSQ+R+DAHP +YA K  KQ++ 
Sbjct  320  PIEXDSYETTFPGKIIKVIERTMQRMKTPVTYLNITKLSQHRRDAHPAVYATKEWKQLLA  379

Query  54   KKLNPEETYSDCSHWCLP  1
             +    ETY+DCSHWCLP
Sbjct  380  LQNRKPETYADCSHWCLP  397



>ref|XP_009786368.1| PREDICTED: protein trichome birefringence-like 28 [Nicotiana 
sylvestris]
Length=402

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKP  232
            F+Y+ +L +E+++ESAF++AM+TW  WID N++  +TTVFFRSISPEH+ ++ CYN+T+ 
Sbjct  236  FEYEGRLVNELKLESAFEVAMRTWADWIDQNVNLNKTTVFFRSISPEHKAQNGCYNKTQL  295

Query  231  IIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEK  52
            I D S  T F E L +IVERT+S+M+ PVRYLNIT+LS++R DAHP++YA+K GK+++++
Sbjct  296  ITDKSHATHFSESLTEIVERTLSQMRIPVRYLNITELSEHRVDAHPSVYAKKKGKELVKR  355

Query  51   KLNPEETYSDCSHWCLP  1
            KL P E+++DCSHWCLP
Sbjct  356  KLKPPESFADCSHWCLP  372



>ref|XP_010277751.1| PREDICTED: protein trichome birefringence-like 36 [Nelumbo nucifera]
Length=442

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = -1

Query  408  QYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPI  229
            +YK+K+  ++ +E  F+ A++TW +WI+DN+DPT+TTVFFRSISPEH+GR WCYN+T+PI
Sbjct  284  EYKKKMLKDLDVEIKFETALKTWSQWIEDNVDPTKTTVFFRSISPEHKGRQWCYNQTQPI  343

Query  228  IDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKK  49
            +D S  T FP  +  IVE+T+ +M+TPV+YLNIT+LSQYR+DAHPT+Y  K G  + E++
Sbjct  344  MDESYTTSFPRQVVAIVEKTIREMRTPVKYLNITRLSQYRRDAHPTVYTAKQGVLLTEEQ  403

Query  48   LNPEETYSDCSHWCLP  1
                + Y+DCSHWCLP
Sbjct  404  RMKPQLYADCSHWCLP  419



>ref|XP_002326021.2| hypothetical protein POPTR_0019s11970g, partial [Populus trichocarpa]
 gb|EEF00403.2| hypothetical protein POPTR_0019s11970g, partial [Populus trichocarpa]
Length=426

 Score =   181 bits (458),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +FQYK KL +EM IESA +  M+TW +WID ++D ++TTVFFRSISP+HQG+ WCYN T+
Sbjct  263  LFQYKGKLVEEMEIESALRKGMRTWARWIDHHVDASKTTVFFRSISPQHQGKQWCYNITQ  322

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            P +D S ++ FP+P+++I+E T+  M  PVRYLNITKLS YR+DAHP +YARK  K +  
Sbjct  323  PNMDESYVSAFPKPMKEIIEITIRSMMIPVRYLNITKLSGYRRDAHPALYARKQEKLLKT  382

Query  54   KKLNPEETYSDCSHWCLP  1
            ++   EE++ DCSHWCLP
Sbjct  383  EQQLQEESHPDCSHWCLP  400



>ref|XP_004140241.1| PREDICTED: uncharacterized protein LOC101217736 [Cucumis sativus]
 ref|XP_004165199.1| PREDICTED: uncharacterized LOC101217736 [Cucumis sativus]
 gb|KGN47947.1| hypothetical protein Csa_6G419440 [Cucumis sativus]
Length=419

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKP  232
            F +  K+   M++E A + AM+TW  WID N+D  +T VFFRSISPEH+G+ WCYNET+P
Sbjct  264  FHHDGKMIATMKMELALEAAMKTWSNWIDQNVDTNKTAVFFRSISPEHKGKQWCYNETEP  323

Query  231  IIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEK  52
              D S   +FPE L ++ ERT+ +MKTPV+YLNITKLSQYR+DAHP+IYA+K GK  +  
Sbjct  324  FFDESYQKIFPESLTEVFERTMKRMKTPVKYLNITKLSQYRRDAHPSIYAKKQGKLWVAT  383

Query  51   KLNPEETYSDCSHWCLP  1
            K   EE  +DCSHWCLP
Sbjct  384  KQRKEEIIADCSHWCLP  400



>ref|XP_008449392.1| PREDICTED: protein trichome birefringence-like 42 [Cucumis melo]
Length=419

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKP  232
            F+Y  K+   M +E A + AM+TW  WID N+D  +T VFFRSISPEH+G+ WCYNET+P
Sbjct  264  FRYDGKMIKTMEMELALEAAMKTWSNWIDQNVDTNKTAVFFRSISPEHKGKQWCYNETEP  323

Query  231  IIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEK  52
              D S   +FPE L ++ ERT+ +MKTPV+YLNITKLSQYR+DAHP+IYA+K GK  +  
Sbjct  324  FSDESYQKIFPESLTEVFERTMKRMKTPVKYLNITKLSQYRRDAHPSIYAKKQGKLWVAM  383

Query  51   KLNPEETYSDCSHWCLP  1
                EE  +DCSHWCLP
Sbjct  384  NQRKEEIIADCSHWCLP  400



>ref|XP_006469127.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=409

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +F++  KL + + ++ AF++AM+TW  WID+N+D T+T VFFRSISPEH+G  WCYN T+
Sbjct  239  LFEHDGKLMENLNVDEAFEIAMETWAHWIDENVDATKTMVFFRSISPEHKGEQWCYNTTE  298

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI D S +  FP+ + +IV+RT+  M TPV+YLNITKLSQYR DAHPTIY +K  + +I 
Sbjct  299  PITDESYVAKFPKSMVEIVKRTIGGMSTPVKYLNITKLSQYRVDAHPTIYTKKR-EFLIA  357

Query  54   KKLNPEETYSDCSHWCLP  1
            K+   +ETY+DCSHWCLP
Sbjct  358  KQQMQQETYADCSHWCLP  375



>gb|KDO63330.1| hypothetical protein CISIN_1g043893mg [Citrus sinensis]
Length=419

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +F++  KL + + ++ AF++AM+TW  WID+N+D T+T VFFRSISPEH+G  WCYN T+
Sbjct  249  LFEHDGKLMENLNVDEAFEIAMETWAHWIDENVDATKTMVFFRSISPEHKGEQWCYNTTE  308

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI D S +  FP+ + +IV+RT+  M TPV+YLNITKLSQYR DAHPTIY +K  + +I 
Sbjct  309  PITDESYVAKFPKSMVEIVKRTIGGMSTPVKYLNITKLSQYRVDAHPTIYTKKR-EFLIA  367

Query  54   KKLNPEETYSDCSHWCLP  1
            K+   +ETY+DCSHWCLP
Sbjct  368  KQQMQQETYADCSHWCLP  385



>ref|XP_011002530.1| PREDICTED: protein trichome birefringence-like 42 [Populus euphratica]
 ref|XP_011002531.1| PREDICTED: protein trichome birefringence-like 42 [Populus euphratica]
Length=441

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +FQYK KL  EM I+SA +  M+TW +WID ++D T+TTVFFRSISP+HQG+ WCYN T+
Sbjct  279  LFQYKGKLV-EMEIDSALRKGMRTWARWIDHHVDATKTTVFFRSISPQHQGKQWCYNITQ  337

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            P +D S ++ FP+P+++I+E+T+  M  PVRYLNITKLS+YR+DAHP +YARK  K +  
Sbjct  338  PNMDESYVSAFPKPMKEIIEKTIRGMMLPVRYLNITKLSEYRRDAHPALYARKQEKLLKT  397

Query  54   KKLNPEETYSDCSHWCLP  1
             +   EE++ DCSHWCLP
Sbjct  398  VQQLQEESHPDCSHWCLP  415



>ref|XP_006446764.1| hypothetical protein CICLE_v10017800mg, partial [Citrus clementina]
 gb|ESR60004.1| hypothetical protein CICLE_v10017800mg, partial [Citrus clementina]
Length=399

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 105/138 (76%), Gaps = 1/138 (1%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +F++  KL + + ++ AF++AM+TW  WID+N+D T+T VFFRSISPEH+G  WCYN T+
Sbjct  249  LFEHDGKLMENLNVDEAFEIAMETWAHWIDENVDATKTIVFFRSISPEHKGEQWCYNTTE  308

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI D S +  FP+ + +IV+RT+  M TPV+YLNITKLSQYR DAHPTIY +K  + +I 
Sbjct  309  PITDESYVAKFPKSMVEIVKRTIRGMSTPVKYLNITKLSQYRVDAHPTIYTKKR-EFLIA  367

Query  54   KKLNPEETYSDCSHWCLP  1
            K+    ETY+DCSHWCLP
Sbjct  368  KQQMQLETYADCSHWCLP  385



>ref|XP_007214171.1| hypothetical protein PRUPE_ppa019033mg [Prunus persica]
 gb|EMJ15370.1| hypothetical protein PRUPE_ppa019033mg [Prunus persica]
Length=419

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +FQ   K  + M IESAF+ AM TW  WID N+D T+T VFFRSISPEH+G+ WCYN+TK
Sbjct  258  LFQNGGKTVENMEIESAFEKAMNTWASWIDQNVDVTKTRVFFRSISPEHKGKLWCYNKTK  317

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI D S  T FP  + + +ERT+ +MKTPV YLNITKLSQYR+DAHP IY  K  KQ+  
Sbjct  318  PITDDSYETTFPRKIIEAIERTIQRMKTPVTYLNITKLSQYRRDAHPMIYKTKQWKQLAM  377

Query  54   KKLNPEETYSDCSHWCLP  1
            ++  PE + +DCSHWCLP
Sbjct  378  QQRRPESS-ADCSHWCLP  394



>ref|XP_007048657.1| Trichome birefringence-like 6, putative isoform 1 [Theobroma 
cacao]
 gb|EOX92814.1| Trichome birefringence-like 6, putative isoform 1 [Theobroma 
cacao]
Length=517

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKP  232
            FQYK K+ D+M+IE+AFK+AM+TW +WID N+D  +T V+FRS+SP H G+ WCY  TKP
Sbjct  356  FQYKRKVFDDMKIETAFKVAMKTWARWIDKNVDTNKTKVYFRSMSPPHFGKDWCYKATKP  415

Query  231  IIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEK  52
            I+D S    F + L++IVE+T+  M+TPV+YLNITKLS+YR DAH +IY  K GK ++  
Sbjct  416  IMDESYQLTFGKSLKEIVEKTLEGMRTPVKYLNITKLSEYRTDAHSSIYGTKQGKLLVAT  475

Query  51   KLNPEETYSDCSHWCLP  1
            K  P    +DCSHWCLP
Sbjct  476  KQKPPAMVADCSHWCLP  492



>emb|CBI21995.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 105/138 (76%), Gaps = 5/138 (4%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +FQYK KL +EM  ESAF + ++TW +W+D  +D T+TTVFFRS+SP+H G+H+CYN+++
Sbjct  216  LFQYKGKLVEEMERESAFGMGLRTWARWVDRYVDRTKTTVFFRSLSPQHSGQHYCYNQSQ  275

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI+D   +  FP  + +IVE  + +M+TPVRYLNITKLSQYRKDAHP+IY+ K  K +I 
Sbjct  276  PILDEFLLPPFPNSMARIVEGRIRRMRTPVRYLNITKLSQYRKDAHPSIYSSKREKLMIN  335

Query  54   KKLNPEETYSDCSHWCLP  1
            +K +P     DCSHWCLP
Sbjct  336  QKQSP-----DCSHWCLP  348



>ref|XP_008244482.1| PREDICTED: protein trichome birefringence-like 42 [Prunus mume]
Length=419

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +F+ + K  + M IESAF+ A+ TW +WID N+D T+T VFFRSISPEH+G+ WCYN+T+
Sbjct  258  LFRNEGKTVENMEIESAFEKAINTWARWIDQNVDVTKTRVFFRSISPEHKGKLWCYNKTQ  317

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI D S  T FP  + + VERT+ +MKTPV YLNITKLSQYR+DAHP IY  K  KQ+  
Sbjct  318  PITDDSYETTFPRKIIEAVERTIQRMKTPVTYLNITKLSQYRRDAHPMIYNTKQWKQLAM  377

Query  54   KKLNPEETYSDCSHWCLP  1
            ++  PE + +DCSHWCLP
Sbjct  378  QQRQPESS-ADCSHWCLP  394



>ref|XP_002276891.2| PREDICTED: protein trichome birefringence-like 42 [Vitis vinifera]
Length=532

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 105/138 (76%), Gaps = 5/138 (4%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +FQYK KL +EM  ESAF + ++TW +W+D  +D T+TTVFFRS+SP+H G+H+CYN+++
Sbjct  374  LFQYKGKLVEEMERESAFGMGLRTWARWVDRYVDRTKTTVFFRSLSPQHSGQHYCYNQSQ  433

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI+D   +  FP  + +IVE  + +M+TPVRYLNITKLSQYRKDAHP+IY+ K  K +I 
Sbjct  434  PILDEFLLPPFPNSMARIVEGRIRRMRTPVRYLNITKLSQYRKDAHPSIYSSKREKLMIN  493

Query  54   KKLNPEETYSDCSHWCLP  1
            +K +P     DCSHWCLP
Sbjct  494  QKQSP-----DCSHWCLP  506



>gb|KHG08135.1| putative U95 [Gossypium arboreum]
Length=514

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKP  232
            F YK K+  +M+IE+AFK+AM+TW +W++ N+D ++TTV+FR +SP H G++WCY  T+P
Sbjct  348  FGYKRKVFADMKIETAFKVAMKTWARWVEKNVDTSKTTVYFRGMSPPHFGKNWCYKSTRP  407

Query  231  IIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEK  52
            I+D S    F + L++IVE+T+  M+TPV+YLNIT+LSQYR DAH +IYA K GK ++ +
Sbjct  408  IMDESYKLTFGKSLKEIVEQTLQAMRTPVKYLNITRLSQYRVDAHSSIYATKQGKFLVLR  467

Query  51   KLNPEETYSDCSHWCLP  1
            K  P     DCSHWCLP
Sbjct  468  KQKPPAMVVDCSHWCLP  484



>gb|KDP31784.1| hypothetical protein JCGZ_12245 [Jatropha curcas]
Length=413

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 102/138 (74%), Gaps = 6/138 (4%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +FQY  KL ++M +ESAFK+A+ TW  WID N++ T+TTVFFRSISPEH+   WC N T+
Sbjct  255  LFQYDGKLVEQMELESAFKMAIGTWANWIDQNVNMTKTTVFFRSISPEHKEGVWCQNRTQ  314

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI+D S +  FP+P+++I+E T+  MKTPVRYLNITKLS+YR+DAHP IYA    +Q + 
Sbjct  315  PIMDESYVYQFPKPIKEILETTIRGMKTPVRYLNITKLSEYRRDAHPAIYALTAEEQQLP  374

Query  54   KKLNPEETYSDCSHWCLP  1
                   ++ DCSHWCLP
Sbjct  375  G------SHPDCSHWCLP  386



>ref|XP_010052546.1| PREDICTED: protein trichome birefringence-like 36 [Eucalyptus 
grandis]
 gb|KCW89620.1| hypothetical protein EUGRSUZ_A01903 [Eucalyptus grandis]
Length=428

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -1

Query  408  QYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPI  229
            QY+++L   M  E A ++AM+TW  WID N++ TET V+FRSISPEH+G+ WC+NET+PI
Sbjct  263  QYRQELYQNMETEIALEIAMKTWAAWIDKNVNVTETKVYFRSISPEHKGKQWCHNETQPI  322

Query  228  IDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKK  49
            +D S    F   +++I ERT+ + + PV YLNITKLS+YR+DAHPT+Y  + GK +  ++
Sbjct  323  MDNSDRKTFLHTIKEITERTIERTRFPVTYLNITKLSEYRRDAHPTVYTSRGGKLLTAEE  382

Query  48   LNPEETYSDCSHWCLP  1
                E ++DCSHWCLP
Sbjct  383  KRHPEVHADCSHWCLP  398



>ref|XP_002276383.1| PREDICTED: protein trichome birefringence-like 42 [Vitis vinifera]
 emb|CBI21962.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 99/138 (72%), Gaps = 6/138 (4%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +FQY+ KL +EM IESA  +AM+TW +WI   +D  +T VFFRSISP H G+  CYNET+
Sbjct  258  LFQYRGKLVEEMEIESALDIAMKTWARWIRRKLDRNKTRVFFRSISPSHTGKQ-CYNETQ  316

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI+D S    FP+ L +I+E T+  MK PVRYLNIT LSQYR+DAHP+IY+RK  ++   
Sbjct  317  PILDESDAASFPKSLTEIIEGTIKAMKNPVRYLNITNLSQYRRDAHPSIYSRKEEERQQR  376

Query  54   KKLNPEETYSDCSHWCLP  1
            K+ +P     DCSHWCLP
Sbjct  377  KEFHP-----DCSHWCLP  389



>ref|XP_010914510.1| PREDICTED: protein trichome birefringence-like 40 [Elaeis guineensis]
Length=418

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = -1

Query  399  EKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH--QGRHWCYNETKPII  226
            ++L ++M  + AF++ ++TW +W+D N+DP++TTVFFRSISPEH  +  HWCYN+T PI 
Sbjct  262  DQLVEDMERDKAFEMGLRTWARWVDRNVDPSKTTVFFRSISPEHKRENLHWCYNQTHPIT  321

Query  225  DVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKL  46
            + + +  FP  +   VE+T++KM+TPVRYLNIT+LS+YR+DAH  +Y  + GK +  ++ 
Sbjct  322  NETYVQWFPRSMIATVEKTLTKMRTPVRYLNITRLSEYRRDAHAAVYTMRRGKLLTPEQR  381

Query  45   NPEETYSDCSHWCLP  1
            +  +TY+DCSHWCLP
Sbjct  382  DQPQTYADCSHWCLP  396



>ref|XP_009395765.1| PREDICTED: protein trichome birefringence-like 42 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 97/139 (70%), Gaps = 2/139 (1%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH--QGRHWCYNET  238
            F+ +E+LT+ M    AF  A++TW +W+D ++DP +TTVFFRS+SPEH  +  HWCYNET
Sbjct  362  FERREQLTEAMEANEAFNRALRTWARWVDGSVDPAKTTVFFRSVSPEHKRENLHWCYNET  421

Query  237  KPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
             PI     + +FP  + ++VERT+ KM+TPV YLNIT+LS+YR+DAH  +Y  K GK + 
Sbjct  422  HPITHQRYVQLFPRSMVELVERTIRKMRTPVTYLNITRLSEYRRDAHTAVYTSKQGKLLT  481

Query  57   EKKLNPEETYSDCSHWCLP  1
              +      Y+DCSHWCLP
Sbjct  482  AGQRQEPARYADCSHWCLP  500



>ref|XP_006852457.1| hypothetical protein AMTR_s00021p00115070 [Amborella trichopoda]
 gb|ERN13924.1| hypothetical protein AMTR_s00021p00115070 [Amborella trichopoda]
Length=435

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKP  232
            F+ + +L +++  E A+++AM+TW +W++ N+DP+ TTVFFRSISPEH+G+ WCYN+T+P
Sbjct  276  FEKEGQLMEDLETEIAYEMAMRTWAQWVEKNVDPSVTTVFFRSISPEHKGKQWCYNQTQP  335

Query  231  IIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEK  52
            I+D S +  FP  ++ + E+ V++M   VRYLNIT LSQYR DAH +++  + GK +  +
Sbjct  336  IMDDSYIVNFPHVIKNVTEKIVAEMDGVVRYLNITHLSQYRIDAHTSVFTERGGKLLTLE  395

Query  51   KLNPEETYSDCSHWCLP  1
            +    ET++DCSHWCLP
Sbjct  396  QQKQPETFADCSHWCLP  412



>ref|XP_009386636.1| PREDICTED: protein trichome birefringence-like 42 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=442

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH--QGRHWCYNET  238
            F+  E L ++M  E AF+ A++TW +W+D N+DP  T VFFRSISPEH  +  HWCYN+T
Sbjct  280  FECSEGLMEDMEAEEAFQRALRTWAQWVDRNVDPARTAVFFRSISPEHKRENLHWCYNQT  339

Query  237  KPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
             PI + + +  FP  +  + E T+ KM+TPV YLNIT+LS+YR+DAH +IY  + GK + 
Sbjct  340  HPITNDTYLQQFPRSMVSLAETTIGKMRTPVTYLNITRLSEYRRDAHTSIYTSRQGKLLT  399

Query  57   EKKLNPEETYSDCSHWCLP  1
             ++      Y+DCSHWCLP
Sbjct  400  AEQRKEPARYADCSHWCLP  418



>ref|XP_010099371.1| hypothetical protein L484_004797 [Morus notabilis]
 gb|EXB78096.1| hypothetical protein L484_004797 [Morus notabilis]
Length=426

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 95/137 (69%), Gaps = 0/137 (0%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKP  232
            FQYK K  ++M  E A ++AM+TW +WI+  ++P +T VFFRSISP H+G  WCYN TKP
Sbjct  266  FQYKGKRMEKMEAEEALEVAMKTWARWIEKIVNPAKTRVFFRSISPSHKGNQWCYNVTKP  325

Query  231  IIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEK  52
              D S +  F + +  IVERTV +MKTPV YLNITKLS+YR+DAHP+IY    GK ++  
Sbjct  326  NTDNSYVKPFAKQMMNIVERTVREMKTPVTYLNITKLSEYRRDAHPSIYRTMQGKNLVAT  385

Query  51   KLNPEETYSDCSHWCLP  1
                 +  +DC+HWC+P
Sbjct  386  HQKEPQNLADCNHWCVP  402



>ref|XP_010913162.1| PREDICTED: protein trichome birefringence-like 42 [Elaeis guineensis]
Length=501

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKP  232
            F+++ +L +EM +  AF  A++TW +W+D ++D T+TTVFFRS+SPEH+  +WCYN+T+P
Sbjct  343  FEFRGQLMEEMGVIEAFNKALRTWARWVDRHVDSTKTTVFFRSVSPEHKRDNWCYNQTRP  402

Query  231  IIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEK  52
            I   + +  FP  +   VER + KM TPVRYLNIT+LS+YR+DAH T+Y  + G  +  +
Sbjct  403  ITTETYVQRFPRNMISSVERAIQKMTTPVRYLNITRLSEYRRDAHTTVYTSRQGILLTAE  462

Query  51   KLNPEETYSDCSHWCLP  1
            +    E Y+DCSHWCLP
Sbjct  463  QRKQPEIYADCSHWCLP  479



>ref|XP_009386635.1| PREDICTED: protein trichome birefringence-like 42 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=545

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH--QGRHWCYNET  238
            F+  E L ++M  E AF+ A++TW +W+D N+DP  T VFFRSISPEH  +  HWCYN+T
Sbjct  383  FECSEGLMEDMEAEEAFQRALRTWAQWVDRNVDPARTAVFFRSISPEHKRENLHWCYNQT  442

Query  237  KPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
             PI + + +  FP  +  + E T+ KM+TPV YLNIT+LS+YR+DAH +IY  + GK + 
Sbjct  443  HPITNDTYLQQFPRSMVSLAETTIGKMRTPVTYLNITRLSEYRRDAHTSIYTSRQGKLLT  502

Query  57   EKKLNPEETYSDCSHWCLP  1
             ++      Y+DCSHWCLP
Sbjct  503  AEQRKEPARYADCSHWCLP  521



>ref|XP_008778408.1| PREDICTED: protein trichome birefringence-like 42 [Phoenix dactylifera]
Length=510

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 95/137 (69%), Gaps = 0/137 (0%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKP  232
            F+   +L +EM +  AF  A+ TW +W D ++D T+TTVFFR ISPEH+  +WCYN+T P
Sbjct  352  FECGGQLVEEMGVIEAFNKALGTWARWADRHVDSTKTTVFFRGISPEHKRENWCYNQTTP  411

Query  231  IIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEK  52
            +   + +  FP  +  +VERTV KM+TPVRYLNIT+LS+YR+DAH  +Y  + GK +  +
Sbjct  412  MTTETYVQRFPGKMISLVERTVEKMRTPVRYLNITRLSEYRRDAHTAVYTSRQGKLLTAE  471

Query  51   KLNPEETYSDCSHWCLP  1
            +    E Y+DCSHWCLP
Sbjct  472  QRKQPERYADCSHWCLP  488



>ref|XP_008810174.1| PREDICTED: protein trichome birefringence-like 40 [Phoenix dactylifera]
Length=481

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 100/139 (72%), Gaps = 3/139 (2%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH--QGRHWCYNET  238
            ++ +  L +++  + AF++ ++TW +W+D ++DPT+TTVFFRSISPEH  +  HWCYN+T
Sbjct  322  YEQRGALVEDIDSDKAFEMGLRTWARWVDRHVDPTKTTVFFRSISPEHKTENLHWCYNQT  381

Query  237  KPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
             PI + + +  FP  +   VE+T+++M TPVRYLNIT+LS++R+DAH T Y  + GK + 
Sbjct  382  HPITNETYVQWFPRSMIATVEKTLTEMTTPVRYLNITRLSEHRRDAH-TAYTTRRGKLLT  440

Query  57   EKKLNPEETYSDCSHWCLP  1
             ++     TY+DCSHWCLP
Sbjct  441  PEQRKRPRTYADCSHWCLP  459



>gb|ACF87806.1| unknown [Zea mays]
 gb|AFW83243.1| putative DUF231 domain containing family protein [Zea mays]
Length=257

 Score =   144 bits (362),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = -1

Query  390  TDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIIDVSGM  211
            T +M  E AF  A++TW +WID NIDP+ T VFFRS+SPEH+  +WCYN+T PI   +  
Sbjct  106  TVQMAGEEAFDGALRTWARWIDYNIDPSRTRVFFRSVSPEHKSVNWCYNQTAPISRGNIA  165

Query  210  TMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA-RKNGKQIIEKKLNPEE  34
              FP+ L  I+E+ + +MKTP+ Y+NIT+LS+ R DAHP+IY     GK + +++     
Sbjct  166  PWFPQSLIDIIEKNIKRMKTPIVYMNITRLSELRIDAHPSIYTITHEGKPLSKEQRQQPL  225

Query  33   TYSDCSHWCLP  1
            TYSDCSHWCLP
Sbjct  226  TYSDCSHWCLP  236



>ref|XP_010681621.1| PREDICTED: protein PMR5-like [Beta vulgaris subsp. vulgaris]
Length=426

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 97/142 (68%), Gaps = 5/142 (4%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGR---HWCYN  244
            +F YK +LT+EM IE A++ AM+TW  W+++N++P +TTVFFRSIS EH+ R    WCYN
Sbjct  262  LFSYKGELTEEMPIELAYERAMKTWATWLENNVNPQKTTVFFRSISAEHKSRQYDQWCYN  321

Query  243  ETKPIIDVSGMTMFPEPLRKIVERTVSKMKTP-VRYLNITKLSQYRKDAHPTIYARKNGK  67
             TKP+   S ++++P  L  ++E  V  M  P V YLN+TKLS+YR DAHP++Y   N K
Sbjct  322  ITKPMKSESYVSVYPNSLVDVIESLVKVMNKPKVNYLNVTKLSEYRIDAHPSVYRSMNWK  381

Query  66   QIIEKKLNPEETYSDCSHWCLP  1
             I + K      Y+DCSHWCLP
Sbjct  382  NITQ-KFEDVLGYADCSHWCLP  402



>ref|NP_001142167.1| putative DUF231 domain containing family protein [Zea mays]
 gb|ACF85175.1| unknown [Zea mays]
 gb|AFW83242.1| putative DUF231 domain containing family protein [Zea mays]
Length=460

 Score =   146 bits (368),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 67/131 (51%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = -1

Query  390  TDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIIDVSGM  211
            T +M  E AF  A++TW +WID NIDP+ T VFFRS+SPEH+  +WCYN+T PI   +  
Sbjct  309  TVQMAGEEAFDGALRTWARWIDYNIDPSRTRVFFRSVSPEHKSVNWCYNQTAPISRGNIA  368

Query  210  TMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA-RKNGKQIIEKKLNPEE  34
              FP+ L  I+E+ + +MKTP+ Y+NIT+LS+ R DAHP+IY     GK + +++     
Sbjct  369  PWFPQSLIDIIEKNIKRMKTPIVYMNITRLSELRIDAHPSIYTITHEGKPLSKEQRQQPL  428

Query  33   TYSDCSHWCLP  1
            TYSDCSHWCLP
Sbjct  429  TYSDCSHWCLP  439



>ref|XP_002455950.1| hypothetical protein SORBIDRAFT_03g027810 [Sorghum bicolor]
 gb|EES01070.1| hypothetical protein SORBIDRAFT_03g027810 [Sorghum bicolor]
Length=483

 Score =   146 bits (369),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 68/131 (52%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIIDVSG--M  211
            +M  E AF  A++TW +W+D NIDP+ T VFFRS+SPEH+  +WCYN+T PI   +G   
Sbjct  332  QMAGEEAFDGALRTWARWVDYNIDPSRTRVFFRSVSPEHKSVNWCYNQTAPISKGNGNIA  391

Query  210  TMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA-RKNGKQIIEKKLNPEE  34
              FP+ L  IVE+ + KMKTP+ Y+NIT+LS+ R DAHP+IY   + GK + +++     
Sbjct  392  PSFPKSLMTIVEKNIKKMKTPIIYMNITRLSELRIDAHPSIYTITREGKPLSKEQQQQPL  451

Query  33   TYSDCSHWCLP  1
            TYSDCSHWCLP
Sbjct  452  TYSDCSHWCLP  462



>ref|XP_010689872.1| PREDICTED: protein trichome birefringence-like 40 [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 93/139 (67%), Gaps = 2/139 (1%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ-GRHWCYNETK  235
            FQYK +L ++M+I+ A+   M+TW KWI DN+DP +T VFFRSIS  H  G+ WCYN T+
Sbjct  308  FQYKGQLLEKMKIQLAYDRGMRTWEKWIKDNVDPKKTIVFFRSISANHNVGKRWCYNSTQ  367

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKM-KTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
            PI+D S    FP+ +  I+ER +  M K+ V+YLNITKLSQYR DAHP++Y     K   
Sbjct  368  PIMDDSYQNPFPKLMVYIIERLIEGMSKSNVKYLNITKLSQYRNDAHPSVYGNGKWKIYT  427

Query  57   EKKLNPEETYSDCSHWCLP  1
             K      + +DCSHWCLP
Sbjct  428  TKYKRFLPSNADCSHWCLP  446



>ref|XP_010681620.1| PREDICTED: protein trichome birefringence-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=307

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 97/142 (68%), Gaps = 5/142 (4%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGR---HWCYN  244
            +FQY E L +EM IE A+K  M+TW KWI +N+DP +TTVFFRSIS EH  R    WCYN
Sbjct  146  LFQYGEDLKEEMPIEKAYKRGMRTWAKWIKNNVDPKKTTVFFRSISAEHTQRKYDQWCYN  205

Query  243  ETKPIIDVSGMTMFPEPLRKIVERTVSKM-KTPVRYLNITKLSQYRKDAHPTIYARKNGK  67
             T+P +D S ++++P+     +E  + KM K  V+YLNITKL++YR DAHP+++   + K
Sbjct  206  VTQP-MDRSYLSVYPKSFVDTIEGLIKKMSKLQVKYLNITKLTEYRIDAHPSVFRSSDWK  264

Query  66   QIIEKKLNPEETYSDCSHWCLP  1
             + +K  +    Y+DCSHWCLP
Sbjct  265  ILTKKFEDNISGYADCSHWCLP  286



>ref|XP_004969160.1| PREDICTED: uncharacterized protein LOC101763686 [Setaria italica]
Length=469

 Score =   145 bits (365),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 66/129 (51%), Positives = 88/129 (68%), Gaps = 1/129 (1%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIIDVSGMTM  205
            EM  E AF +A++ W KW+D +IDP+ T VFFRS+SPEH+  +WCYN+T PI   +    
Sbjct  316  EMEGEEAFNIALRAWAKWVDHSIDPSRTRVFFRSVSPEHKSVNWCYNQTFPISAGTVAPG  375

Query  204  FPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA-RKNGKQIIEKKLNPEETY  28
            FP+ L  IVER +  M+TPV YLNIT LS+ R DAHP++Y   + GK +  ++     TY
Sbjct  376  FPKSLVTIVERNIKSMRTPVTYLNITHLSELRIDAHPSVYTITREGKPLTTEQQRQPLTY  435

Query  27   SDCSHWCLP  1
            +DCSHWCLP
Sbjct  436  ADCSHWCLP  444



>ref|NP_001056472.1| Os05g0587700 [Oryza sativa Japonica Group]
 gb|AAT44163.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18386.1| Os05g0587700 [Oryza sativa Japonica Group]
Length=284

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 88/129 (68%), Gaps = 1/129 (1%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIIDVSG-MT  208
            EM  E AF  A++TW +W+D N+D  +T VFFRSISPEH+ ++WCYNET P+      + 
Sbjct  137  EMGAEEAFNRALRTWTRWLDRNVDSHKTMVFFRSISPEHKNKNWCYNETAPMARAEEYVE  196

Query  207  MFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNPEETY  28
             FP  +  IVER V + +T V YL+IT+LS+ R+DAHP+++  + GK +  ++     +Y
Sbjct  197  AFPRGMVSIVERNVRRARTAVGYLDITRLSELRRDAHPSVFTVRGGKLLTPEQRRQPGSY  256

Query  27   SDCSHWCLP  1
            +DCSHWCLP
Sbjct  257  ADCSHWCLP  265



>ref|XP_007048659.1| Trichome birefringence-like 6, putative [Theobroma cacao]
 gb|EOX92816.1| Trichome birefringence-like 6, putative [Theobroma cacao]
Length=514

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 95/139 (68%), Gaps = 12/139 (9%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKP  232
            F YK+KL  +M++E AFKLAMQTW  WI  N+D ++TTVFFR +SP H GR+ CY  T+P
Sbjct  358  FLYKKKLYTDMKLERAFKLAMQTWAGWIQKNVDTSKTTVFFRGMSPAHSGRNKCYRATQP  417

Query  231  IIDVSGMTM-FPEPLRK-IVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
            I D     + + E L K IVERT+  M+TPV+YLNITKL++YRKDAH +IY +       
Sbjct  418  IEDDQPFKLKYSESLIKGIVERTIQGMRTPVKYLNITKLTEYRKDAHSSIYWK-------  470

Query  57   EKKLNPEETYSDCSHWCLP  1
            +K+  P     DCSHWCLP
Sbjct  471  QKQFRPGP---DCSHWCLP  486



>ref|XP_010681619.1| PREDICTED: protein trichome birefringence-like 40 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=439

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 97/142 (68%), Gaps = 5/142 (4%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGR---HWCYN  244
            +FQY E L +EM IE A+K  M+TW KWI +N+DP +TTVFFRSIS EH  R    WCYN
Sbjct  278  LFQYGEDLKEEMPIEKAYKRGMRTWAKWIKNNVDPKKTTVFFRSISAEHTQRKYDQWCYN  337

Query  243  ETKPIIDVSGMTMFPEPLRKIVERTVSKM-KTPVRYLNITKLSQYRKDAHPTIYARKNGK  67
             T+P +D S ++++P+     +E  + KM K  V+YLNITKL++YR DAHP+++   + K
Sbjct  338  VTQP-MDRSYLSVYPKSFVDTIEGLIKKMSKLQVKYLNITKLTEYRIDAHPSVFRSSDWK  396

Query  66   QIIEKKLNPEETYSDCSHWCLP  1
             + +K  +    Y+DCSHWCLP
Sbjct  397  ILTKKFEDNISGYADCSHWCLP  418



>gb|EMS64161.1| hypothetical protein TRIUR3_16646 [Triticum urartu]
Length=506

 Score =   142 bits (358),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 63/130 (48%), Positives = 91/130 (70%), Gaps = 2/130 (2%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPI-IDVSGMT  208
            +M  E AF  A++TW +W+D N+D T T VFFRS+SPEH+G +WCYN+T PI  D + + 
Sbjct  353  KMEGEEAFSRALRTWARWVDHNVDQTRTRVFFRSVSPEHKGANWCYNQTSPIAADEAIVP  412

Query  207  MFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA-RKNGKQIIEKKLNPEET  31
             FP+ +  IVE ++  M+TP  YLNIT+LS+ R DAHP++Y+  ++GK +  ++      
Sbjct  413  WFPKSMVSIVEGSIRSMRTPAAYLNITRLSELRIDAHPSVYSINRDGKPLTLEQRKQPVA  472

Query  30   YSDCSHWCLP  1
            Y+DCSHWCLP
Sbjct  473  YADCSHWCLP  482



>ref|XP_010665978.1| PREDICTED: protein trichome birefringence-like 36 [Beta vulgaris 
subsp. vulgaris]
Length=433

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 99/142 (70%), Gaps = 4/142 (3%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGR-HWCYNET  238
            +F+Y+ KL +EM+IE A++ AM TW  W+++N+DP +TT+FFRS+S  HQ    WCYN T
Sbjct  273  MFEYEGKLMEEMQIELAYERAMTTWETWMNENVDPNKTTIFFRSLSAVHQNSADWCYNVT  332

Query  237  KPIIDVSGMT--MFPEPLRKIVERTVSKMKT-PVRYLNITKLSQYRKDAHPTIYARKNGK  67
            KPIID S  T     + L + ++R +  M T  V+YLNI+KLSQYR+DAHP++Y     K
Sbjct  333  KPIIDESYNTPPQKSDLLVETIKRLIDGMSTLQVKYLNISKLSQYRRDAHPSVYRSSQWK  392

Query  66   QIIEKKLNPEETYSDCSHWCLP  1
            ++I+K  +    Y+DCSHWCLP
Sbjct  393  ELIKKFEDNLGGYADCSHWCLP  414



>gb|EAZ12682.1| hypothetical protein OsJ_02598 [Oryza sativa Japonica Group]
Length=413

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIIDVSGMT-  208
            EM  E AF  A+ TW  W+D N+D   T VFFRSISPEH+  +WCYN+T PI D + +  
Sbjct  262  EMGGEEAFNQALGTWASWVDQNVDSARTRVFFRSISPEHKSENWCYNQTSPITDETKIVP  321

Query  207  MFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA-RKNGKQIIEKKLNPEET  31
             FP  L  IVER +   +TPV YLNIT+LS+ R DAHP++Y   + GK +  ++      
Sbjct  322  WFPRGLVSIVERNIRSTRTPVTYLNITRLSELRVDAHPSVYTITREGKPLSTEQRQQPLV  381

Query  30   YSDCSHWCLP  1
            Y+DCSHWCLP
Sbjct  382  YADCSHWCLP  391



>gb|EAY74956.1| hypothetical protein OsI_02852 [Oryza sativa Indica Group]
Length=473

 Score =   140 bits (352),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 65/130 (50%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIIDVSGMT-  208
            EM  E AF  A+ TW  W+D N+D   T VFFRSISPEH+  +WCYN+T PI D + +  
Sbjct  322  EMGGEEAFNQALGTWASWVDQNVDSARTRVFFRSISPEHKSENWCYNQTSPITDETKIVP  381

Query  207  MFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA-RKNGKQIIEKKLNPEET  31
             FP  L  IVER +   +TPV YLNIT+LS+ R DAHP++Y   + GK +  ++      
Sbjct  382  WFPRSLVSIVERNIRSTRTPVTYLNITRLSELRVDAHPSVYTITREGKPLSTEQRQQPLV  441

Query  30   YSDCSHWCLP  1
            Y+DCSHWCLP
Sbjct  442  YADCSHWCLP  451



>ref|NP_001043565.1| Os01g0614300 [Oryza sativa Japonica Group]
 dbj|BAD61231.1| leaf senescence related protein-like [Oryza sativa Japonica Group]
 dbj|BAF05479.1| Os01g0614300 [Oryza sativa Japonica Group]
 dbj|BAG97290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   139 bits (351),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 65/130 (50%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIIDVSGMT-  208
            EM  E AF  A+ TW  W+D N+D   T VFFRSISPEH+  +WCYN+T PI D + +  
Sbjct  328  EMGGEEAFNQALGTWASWVDQNVDSARTRVFFRSISPEHKSENWCYNQTSPITDETKIVP  387

Query  207  MFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA-RKNGKQIIEKKLNPEET  31
             FP  L  IVER +   +TPV YLNIT+LS+ R DAHP++Y   + GK +  ++      
Sbjct  388  WFPRGLVSIVERNIRSTRTPVTYLNITRLSELRVDAHPSVYTITREGKPLSTEQRQQPLV  447

Query  30   YSDCSHWCLP  1
            Y+DCSHWCLP
Sbjct  448  YADCSHWCLP  457



>ref|XP_010665987.1| PREDICTED: protein trichome birefringence-like 36 [Beta vulgaris 
subsp. vulgaris]
Length=416

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGR---HWCYN  244
            + +Y+ KL ++M +E A++  M+TW  WI+ N+DP +T+VFFRSIS EH+ R    WCYN
Sbjct  249  LLEYEGKLIEDMPLEVAYERGMRTWRTWIEKNVDPKKTSVFFRSISTEHKTRSHDQWCYN  308

Query  243  ETKPIIDVSGMTMFPEPLRKIVERTVSKM-KTPVRYLNITKLSQYRKDAHPTIYARKNGK  67
            +T+PI D S  + +P+P    +ER + +M K  VRYLNI+KLS YR DAHP++Y  ++ K
Sbjct  309  KTQPIKDESYKSYYPKPFVDTIERLIKEMSKLKVRYLNISKLSGYRIDAHPSMYRFQDWK  368

Query  66   QIIEKKLNPEETYSDCSHWCLP  1
             + +   +   +Y+DCSHWCLP
Sbjct  369  NLTKLYEDNLPSYADCSHWCLP  390



>ref|XP_010665991.1| PREDICTED: protein trichome birefringence-like 3 [Beta vulgaris 
subsp. vulgaris]
Length=405

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGR---HWCYN  244
            +F+Y+ KL D+M +E A++  M+TW  WI++N+DP   TVFFRSIS EH+ +    WCYN
Sbjct  242  LFEYEGKLIDDMPVELAYERGMRTWATWIENNVDPDIATVFFRSISAEHKTKTSERWCYN  301

Query  243  ETKPIIDVSGMTMFPEPLRKIVERTVSKM-KTPVRYLNITKLSQYRKDAHPTIYARKNGK  67
            +TK ++D S  + +P  L +I+E  ++   K+ V+YLNITKLS+YR +AHP+IY  K+ K
Sbjct  302  KTKLVVDDSYASDYPNYLVEIIESLINGFSKSQVKYLNITKLSKYRIEAHPSIYRYKDWK  361

Query  66   QIIEKKLNPEETYSDCSHWCLP  1
             + +K  +    + DCSHWCLP
Sbjct  362  ILTQKNEDILSLHPDCSHWCLP  383



>ref|XP_010665981.1| PREDICTED: protein trichome birefringence-like [Beta vulgaris 
subsp. vulgaris]
Length=480

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 91/142 (64%), Gaps = 4/142 (3%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH---QGRHWCYN  244
            + +YK KL ++M +   +   M TW  W+  N+DP +TTVFFRSIS EH   Q   WCY 
Sbjct  314  LVEYKGKLIEDMPLHQVYTRGMNTWANWVKKNVDPQKTTVFFRSISAEHKSPQYNQWCYT  373

Query  243  ETKPIIDVSGMTMFPEPLRKIVERTVSKMKTP-VRYLNITKLSQYRKDAHPTIYARKNGK  67
            +T+P++D    + +P  L +++ER V  M  P V+YLN+TKLSQYR DAHP+IY  K+ K
Sbjct  374  KTQPLVDEPYKSSYPNILIRVIERIVRGMTNPQVKYLNVTKLSQYRIDAHPSIYRNKDWK  433

Query  66   QIIEKKLNPEETYSDCSHWCLP  1
              ++   +   +Y+DC HWCLP
Sbjct  434  IRVQINKHNLSSYTDCGHWCLP  455



>ref|XP_003566882.1| PREDICTED: protein trichome birefringence-like 3 [Brachypodium 
distachyon]
Length=466

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 87/129 (67%), Gaps = 1/129 (1%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIIDVSGMTM  205
            +M  E AF  A++TW +W+D N+DPT T VFFRS+SPEH+  +WCY++T PI + + +  
Sbjct  310  KMDGEEAFNRALRTWARWVDHNVDPTRTRVFFRSVSPEHKSSNWCYSQTSPITNGTVVPW  369

Query  204  FPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIY-ARKNGKQIIEKKLNPEETY  28
            FP+ L  IVE  +  M T V YLNIT LS+ R DAHP++Y   + GK +  ++ +    Y
Sbjct  370  FPKSLISIVETNIQSMSTHVTYLNITHLSELRIDAHPSVYTTNREGKPLTMEQRHQPIIY  429

Query  27   SDCSHWCLP  1
            +DCSHWCLP
Sbjct  430  ADCSHWCLP  438



>ref|XP_010665979.1| PREDICTED: protein trichome birefringence-like 42 [Beta vulgaris 
subsp. vulgaris]
Length=466

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            + Q+  KL + M +  A++L M+TW KWI +N+DP +T VFFRSIS +H GR  CYN T+
Sbjct  303  LLQHNGKLMEGMPVAYAYELGMKTWAKWIKENVDPMKTNVFFRSISAQHNGRTGCYNVTQ  362

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKM-KTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
            P++D S +  +P+ +  ++E  ++ M K  V+YLNITKLS+YR DAHP++Y      +I 
Sbjct  363  PLMDESYINHYPKSMVNVIESLITGMSKIKVKYLNITKLSEYRIDAHPSVYRSSWKWKIY  422

Query  57   EKK---LNPEETYSDCSHWCLP  1
              K   L P  +Y+DCSHWCLP
Sbjct  423  TSKYQRLIP--SYADCSHWCLP  442



>ref|XP_002525121.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37248.1| conserved hypothetical protein [Ricinus communis]
Length=135

 Score =   129 bits (324),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = -1

Query  297  VFFRSISPEHQGRHWCYNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLS  118
            VFFRSISP+ +G  WCYN T+PI+D      FP P+++IVER +  MKTPVRYLNITKL 
Sbjct  10   VFFRSISPKRKGEMWCYNRTQPIMDEYYAYAFPMPVQEIVERIIGGMKTPVRYLNITKLL  69

Query  117  QYRKDAHPTIYARKNGKQIIE--KKLNPEETYSDCSHWCLP  1
            +YR+DAHP IYARK  K +I   ++L P E++ DCSHWCLP
Sbjct  70   EYRRDAHPAIYARKQQKLLIAELQQLQP-ESHIDCSHWCLP  109



>ref|XP_006646096.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=489

 Score =   136 bits (343),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIID-VSGMT  208
            EM  E AF  A++TW +W+D ++D   T VFFRS+SPEH+  +WCYN+T P+ D  + + 
Sbjct  338  EMGGEEAFNRALRTWARWVDQSVDTARTRVFFRSVSPEHKSENWCYNQTSPVADGTTVVP  397

Query  207  MFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA-RKNGKQIIEKKLNPEET  31
             FP+ L  IVER +  M+T V YLNIT+LS+ R DAHP++Y   + G+ +  ++      
Sbjct  398  WFPKSLVSIVERNIRSMRTTVAYLNITRLSELRIDAHPSVYTITREGRPLSVQQRQQPLV  457

Query  30   YSDCSHWCLP  1
            Y+DCSHWCLP
Sbjct  458  YADCSHWCLP  467



>ref|XP_008654642.1| PREDICTED: putative DUF231 domain containing family protein isoform 
X1 [Zea mays]
Length=484

 Score =   133 bits (334),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 67/155 (43%), Positives = 91/155 (59%), Gaps = 25/155 (16%)
 Frame = -1

Query  390  TDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ------------------  265
            T +M  E AF  A++TW +WID NIDP+ T VFFRS+SPEH+                  
Sbjct  309  TVQMAGEEAFDGALRTWARWIDYNIDPSRTRVFFRSVSPEHKRSISRTTNIQSNYISQLT  368

Query  264  ------GRHWCYNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKD  103
                    +WCYN+T PI   +    FP+ L  I+E+ + +MKTP+ Y+NIT+LS+ R D
Sbjct  369  TFLLSCSVNWCYNQTAPISRGNIAPWFPQSLIDIIEKNIKRMKTPIVYMNITRLSELRID  428

Query  102  AHPTIYA-RKNGKQIIEKKLNPEETYSDCSHWCLP  1
            AHP+IY     GK + +++     TYSDCSHWCLP
Sbjct  429  AHPSIYTITHEGKPLSKEQRQQPLTYSDCSHWCLP  463



>ref|XP_010689873.1| PREDICTED: protein trichome birefringence-like 43 [Beta vulgaris 
subsp. vulgaris]
Length=479

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 90/141 (64%), Gaps = 3/141 (2%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHW---CYN  244
            +++YK KL  +M +  A+K AM TW KWI+  +D T+T +FFRS+S EH+   +   C  
Sbjct  314  MYEYKGKLIKDMPLHIAYKRAMNTWAKWIEKKVDSTKTALFFRSVSAEHKAPQYNQACQY  373

Query  243  ETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQ  64
            +TKPI+D S   +FP+ L   +E  +  MK+ V+YLNITKLS YR DAHP+IY   + K 
Sbjct  374  KTKPIMDESYRNLFPKKLIPTIESVIKGMKSQVKYLNITKLSGYRIDAHPSIYRYNDWKI  433

Query  63   IIEKKLNPEETYSDCSHWCLP  1
              +K +     Y+DC HWCLP
Sbjct  434  RAKKDIRTLTAYADCGHWCLP  454



>ref|XP_002454638.1| hypothetical protein SORBIDRAFT_04g034670 [Sorghum bicolor]
 gb|EES07614.1| hypothetical protein SORBIDRAFT_04g034670 [Sorghum bicolor]
Length=733

 Score =   132 bits (333),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 59/143 (41%), Positives = 91/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  +++  E+ +  AF+ A+ TW KW+D N++P +TTVFFR  S  H  G  W     C
Sbjct  571  YQEGDRVYSELDVHDAFRRALNTWAKWVDSNVNPKKTTVFFRGYSASHFSGGQWNSGGSC  630

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI++   +T +P  +  I+E  +  MKTPV YLNIT+++ YRK+AHP++Y +   
Sbjct  631  DKETEPIMNDQYLTPYPTKM-SILEEVLHGMKTPVVYLNITRMTDYRKEAHPSVYRK---  686

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++ E++    E Y DCSHWCLP
Sbjct  687  QKLTEEERKSPELYQDCSHWCLP  709



>ref|XP_008679266.1| PREDICTED: protein trichome birefringence-like 1 [Zea mays]
 gb|AFW64296.1| putative DUF231 domain containing family protein [Zea mays]
Length=731

 Score =   132 bits (332),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 60/143 (42%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q   ++  E+ +  AF+ A+ TW KW+D N++P +TTVFFR  S  H  G  W     C
Sbjct  569  YQEGNRVYSELDVHDAFRRALNTWAKWVDSNVNPKKTTVFFRGYSASHFSGGQWNSGGSC  628

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI D   +T +P  +  I+E  +  MKTPV YLNIT+++ YRK+AHP++Y +   
Sbjct  629  DRETEPITDDQYLTPYPTKM-SILEEVLRGMKTPVVYLNITRMTDYRKEAHPSVYRK---  684

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++ E++    E Y DCSHWCLP
Sbjct  685  QKLTEEERKSPELYQDCSHWCLP  707



>gb|AFW73695.1| putative DUF231 domain containing family protein, partial [Zea 
mays]
Length=706

 Score =   132 bits (331),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/143 (42%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q   ++  E+ +  AF+ A+ TW KW+D +++P +TTVFFR  S  H  G  W     C
Sbjct  546  YQEGNRVYSELDVHDAFRRALNTWAKWVDSSVNPKKTTVFFRGYSASHFSGGQWNSGGSC  605

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET PI D   +T +PE +  I+E  + +MKTPV YLNIT+++ YRK+AHP+ Y +   
Sbjct  606  DKETDPITDGQYLTPYPEKM-SILEEVLREMKTPVVYLNITRMTDYRKEAHPSAYRK---  661

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++ E++    E Y DCSHWCLP
Sbjct  662  QELTEEERQSPELYQDCSHWCLP  684



>ref|XP_008646340.1| PREDICTED: protein trichome birefringence [Zea mays]
Length=710

 Score =   132 bits (331),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/143 (42%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q   ++  E+ +  AF+ A+ TW KW+D +++P +TTVFFR  S  H  G  W     C
Sbjct  546  YQEGNRVYSELDVHDAFRRALNTWAKWVDSSVNPKKTTVFFRGYSASHFSGGQWNSGGSC  605

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET PI D   +T +PE +  I+E  + +MKTPV YLNIT+++ YRK+AHP+ Y +   
Sbjct  606  DKETDPITDGQYLTPYPEKM-SILEEVLREMKTPVVYLNITRMTDYRKEAHPSAYRK---  661

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++ E++    E Y DCSHWCLP
Sbjct  662  QELTEEERQSPELYQDCSHWCLP  684



>ref|XP_010665989.1| PREDICTED: protein trichome birefringence-like 40 [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 91/143 (64%), Gaps = 7/143 (5%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGR---HWCYN  244
            +FQYK KL +EM  + A+K  M+TW  WI  N+DP +T VFFRS+SP H  +    WCYN
Sbjct  276  LFQYKGKLIEEMPRDLAYKRGMRTWASWIKKNVDPKQTNVFFRSLSPTHSSQKYDQWCYN  335

Query  243  ETKPIIDVSGMTMFPEPLRKIVERTVSKM-KTPVRYLNITKLSQYRKDAHPTIYARKNGK  67
             T P ++ S ++ FP+    ++E  +  M K  VRYLNIT+LSQ+R DAHP+IY  +   
Sbjct  336  VTLPKMEESYISSFPKTFVVVIETLIKGMSKFGVRYLNITELSQFRIDAHPSIYTME--L  393

Query  66   QIIEKKLNPEET-YSDCSHWCLP  1
              + K+ N +   + DCSHWCLP
Sbjct  394  NTLTKQYNDDHLRHVDCSHWCLP  416



>ref|XP_006655646.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=448

 Score =   129 bits (323),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 57/129 (44%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIIDVSG-MT  208
            EM  E A   A++TW +W+D ++D  +T VFFRSISPEH+  +WCYNET P+      + 
Sbjct  296  EMGAEEALNRALRTWTRWLDRSVDSDKTMVFFRSISPEHKNTNWCYNETAPMATAEEYVE  355

Query  207  MFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNPEETY  28
             FP  +   VER + + +T V  LNIT+LS+ R+DAHP+++  + GK +  ++     +Y
Sbjct  356  AFPRGMVSAVERNLRRARTAVACLNITRLSELRRDAHPSVFTARGGKVLTAEQRRQPGSY  415

Query  27   SDCSHWCLP  1
            +DCSHWCLP
Sbjct  416  ADCSHWCLP  424



>ref|XP_010932482.1| PREDICTED: protein trichome birefringence-like 1 [Elaeis guineensis]
Length=677

 Score =   130 bits (327),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 61/143 (43%), Positives = 90/143 (63%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + +  E+ +  AF  A+ TW KW+D N++P +T VFFR  S  H  G  W     C
Sbjct  516  YQEGDHVYSELNVVEAFHKALTTWAKWVDTNVNPKKTLVFFRGYSASHFSGGQWNSGGQC  575

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            +NET+PI +   +  +P P  +++E  + +MKTPV YLNIT+++ YRKDAHP+IY ++N 
Sbjct  576  HNETEPIKNEKYLYPYP-PKMQVLETVIKEMKTPVSYLNITRMTDYRKDAHPSIYRKQN-  633

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++    E Y DCSHWCLP
Sbjct  634  --LTEEERKSPEMYQDCSHWCLP  654



>ref|XP_006649087.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=696

 Score =   129 bits (325),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 57/143 (40%), Positives = 92/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q   ++  E+ ++ AF+ A+QTW KW+D +++P +TTVFFR  S  H  G  W     C
Sbjct  535  YQEGNRVYSELNVDDAFQKALQTWAKWVDSSVNPKKTTVFFRGYSASHFSGGQWNSGGSC  594

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   +T +P  +  ++E  +  MKTPV YLNIT+++ YRK+AHP++Y +   
Sbjct  595  DKETEPITNEKYLTPYPRKM-SVLEDVLHGMKTPVVYLNITRMTDYRKEAHPSVYRK---  650

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++ E+++   + Y DCSHWCLP
Sbjct  651  QKLTEEEMKSPQIYQDCSHWCLP  673



>ref|XP_003560946.2| PREDICTED: protein trichome birefringence-like 1 [Brachypodium 
distachyon]
Length=829

 Score =   130 bits (326),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 63/143 (44%), Positives = 88/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TW KWID N++P +TTV FR  S  H  G  W     C
Sbjct  667  YQEGNHIYSELNVVDAFRKALVTWSKWIDANVNPKKTTVMFRGYSASHFSGGQWNSGGSC  726

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   ++ +P P   I+E  + KMKTPV YLNIT+L+ YRKDAHP+IY +++ 
Sbjct  727  DKETEPIKNEQYLSTYP-PKMSILEDVIHKMKTPVVYLNITRLTDYRKDAHPSIYRKQH-  784

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++    E Y DCSHWCLP
Sbjct  785  --LTEEERRSPERYQDCSHWCLP  805



>gb|EMT28733.1| hypothetical protein F775_16151 [Aegilops tauschii]
Length=433

 Score =   127 bits (319),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 62/143 (43%), Positives = 90/143 (63%), Gaps = 15/143 (10%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRH-------------WCYN  244
            +M  E AF  A++TW +W+D N+D T T VFFRS+SPEH+G +             WCYN
Sbjct  267  KMEGEEAFSRALRTWARWVDHNVDQTRTRVFFRSVSPEHKGHYQLTEPPNTQCSANWCYN  326

Query  243  ETKPI-IDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA-RKNG  70
            +T PI  D + +  FP+ +  IVE ++  M+T   YLNIT+LS+ R DAHP++Y+  ++G
Sbjct  327  QTAPIAADEAIVPWFPKSMVSIVEGSIRSMRTRAAYLNITRLSELRIDAHPSVYSINRDG  386

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K +  ++      Y+DCSHWCLP
Sbjct  387  KPLTLEQRQQPIIYADCSHWCLP  409



>ref|XP_010665988.1| PREDICTED: protein trichome birefringence-like 40 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 91/143 (64%), Gaps = 7/143 (5%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGR---HWCYN  244
            +F+YK  L+ E+  E A+K  M+TW  W+  N+DP +TTVFFRSISP H  R    WCYN
Sbjct  230  LFEYKGNLSVELPREVAYKRGMRTWLSWLKKNVDPNKTTVFFRSISPTHTARKYDQWCYN  289

Query  243  ETKPIIDVSGMTMFPEPLRKIVERTVSKMKT-PVRYLNITKLSQYRKDAHPTIYARKNGK  67
            ET+P    S      + L  ++ER +  +KT  V+YLNITKLS+YR DAHP+IY  ++  
Sbjct  290  ETRPKKYDSYELGSAKSLVGVIERLIKGIKTLQVKYLNITKLSEYRIDAHPSIYTTESNS  349

Query  66   QIIEKKLNPEET-YSDCSHWCLP  1
              + KKL    + + DCSHWCLP
Sbjct  350  --LTKKLEDNRSGFLDCSHWCLP  370



>ref|XP_004954083.1| PREDICTED: cell wall protein AWA1-like [Setaria italica]
Length=736

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/143 (41%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q   ++  E+ +  A++ A+ TW KW+D N++P +TTVFFR  S  H  G  W     C
Sbjct  574  YQEGNRVYSELDVHDAYRRALNTWAKWVDSNVNPKKTTVFFRGYSASHFSGGQWNSGGSC  633

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   +T +P  +  I+E  +  MKTPV YLNIT+++ YRK+AHP++Y +   
Sbjct  634  DKETEPITNEQYLTPYPTKM-SILEEVLHGMKTPVVYLNITRMTDYRKEAHPSVYRK---  689

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++ E++    E Y DCSHWCLP
Sbjct  690  QKLSEEERKSPELYQDCSHWCLP  712



>ref|XP_008791924.1| PREDICTED: protein trichome birefringence-like 1 [Phoenix dactylifera]
Length=780

 Score =   129 bits (323),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/143 (41%), Positives = 90/143 (63%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + +  E+ +  AF  A+ TW KW+D  ++P +T VFFR  S  H  G  W     C
Sbjct  619  YQEGDHVYSELNVVEAFHKALNTWAKWVDAYVNPKKTLVFFRGYSASHFSGGQWNSGGQC  678

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             NET+PI + + ++ +P P  +++E+ +  MKTPV YLN+T+++ YRKDAHP+IY ++N 
Sbjct  679  DNETEPIKNKNYLSAYP-PKMRVLEKVIKGMKTPVSYLNVTRMTDYRKDAHPSIYRKQN-  736

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++    E Y DCSHWCLP
Sbjct  737  --LTEEERRSPERYQDCSHWCLP  757



>ref|XP_003573026.1| PREDICTED: protein trichome birefringence [Brachypodium distachyon]
Length=753

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/143 (41%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ ++ A++ A+ TW KW+D N++P  TTVFFR  S  H  G  W     C
Sbjct  591  YQEGNHVYSELNVDDAYRRALNTWAKWVDANVNPRRTTVFFRGYSASHFSGGQWNSGGSC  650

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ETKPI +   +  +P+ +  I+E  + +MKTPV Y+NIT+++ YRK+AHP++Y R   
Sbjct  651  DKETKPIRNEHYLVPYPQKM-SILEEVLHEMKTPVVYMNITRMTDYRKEAHPSVYRR---  706

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++ E++    E Y DCSHWCLP
Sbjct  707  QKLSEEERKSPELYQDCSHWCLP  729



>ref|XP_010665993.1| PREDICTED: protein trichome birefringence-like 42 [Beta vulgaris 
subsp. vulgaris]
Length=455

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 87/139 (63%), Gaps = 1/139 (1%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            + QY  KL + M +E A+KL M+TW KWI+ N+DP +TTVFFRSIS  H  +   Y+  +
Sbjct  301  LLQYDGKLLEWMPVEQAYKLGMKTWAKWINKNVDPKKTTVFFRSISENHNKKGGFYDMVQ  360

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKM-KTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
            P +D +    FP+ L  ++E  + KM K  V+YLNITKLS+YR DAH ++Y+    +   
Sbjct  361  PTMDETYTNHFPQSLVNVIESLIHKMNKIEVKYLNITKLSEYRIDAHSSVYSSSTWEINT  420

Query  57   EKKLNPEETYSDCSHWCLP  1
             K      ++ DCS+WCLP
Sbjct  421  TKYQRLVPSFVDCSNWCLP  439



>ref|XP_010689869.1| PREDICTED: protein trichome birefringence-like 36 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=435

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 88/140 (63%), Gaps = 3/140 (2%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETK  235
            +FQYK +L +EM +E A++ AM+TW  WI+ ++D   T + FRSIS  H  + WCYN T 
Sbjct  273  LFQYKGQLMEEMPMELAYERAMKTWATWIEKSVDSKRTKLLFRSISAVH-NKQWCYNSTH  331

Query  234  PIIDVSGMTMFPEPLRKIVERTVS-KMKT-PVRYLNITKLSQYRKDAHPTIYARKNGKQI  61
            PI+  S     P+ L  I+E+ ++ K K+  V YLNITKLS YR DAHP+ Y  K  +  
Sbjct  332  PIVAESYEDSLPKSLTSIIEKIINDKSKSHAVTYLNITKLSHYRIDAHPSAYKSKKWEIY  391

Query  60   IEKKLNPEETYSDCSHWCLP  1
             +K  N   +Y DCSHWCLP
Sbjct  392  TKKYKNSLMSYVDCSHWCLP  411



>dbj|BAK01401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=753

 Score =   127 bits (319),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 60/143 (42%), Positives = 90/143 (63%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  +++  E+ +  A++ A+ TW KW+D NI+P +TTVFFR  S  H  G  W     C
Sbjct  591  YQEGDQVYSELNVHDAYRRALNTWAKWVDSNINPKKTTVFFRGYSASHFSGGQWNSGGSC  650

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   +  +P+ +  I+E  +  MKTPV YLNIT+L+ YRK+ HP++Y RK+ 
Sbjct  651  DKETEPITNQQYLMPYPQKM-SILEEVLHGMKTPVAYLNITRLTDYRKEGHPSVY-RKH-  707

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             ++ E++    E Y DCSHWCLP
Sbjct  708  -KLSEEERKSPELYQDCSHWCLP  729



>ref|XP_004964924.1| PREDICTED: fibroin heavy chain-like [Setaria italica]
Length=907

 Score =   127 bits (319),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 63/143 (44%), Positives = 88/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF  A+ TW KWID N++P +TTV FR  S  H  G  W     C
Sbjct  745  YQEGNHVYSELNVVDAFHKALLTWSKWIDANVNPKKTTVLFRGYSASHFSGGQWNSGGSC  804

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              E++PI +   ++ +P P   I+E  + KMKTPV YLNIT+++ YRKDAHP+IY ++N 
Sbjct  805  DKESEPITNEQYLSTYP-PKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHPSIYRKQNL  863

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++ +PE  Y DCSHWCLP
Sbjct  864  TD--EERRSPER-YQDCSHWCLP  883



>ref|XP_006656749.1| PREDICTED: mucin-19-like [Oryza brachyantha]
Length=802

 Score =   127 bits (318),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 62/143 (43%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF  A+ TW +WID N++P +TTV FR  S  H  G  W     C
Sbjct  640  YQEGNHVYSELNVVDAFHKALVTWSRWIDANVNPKKTTVLFRGYSASHFSGGQWNSGGSC  699

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   ++ +P P   I+E  + KMKTPV YLNIT+++ YRKDAHP+IY ++N 
Sbjct  700  DKETEPIRNEQYLSTYP-PKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHPSIYRKRN-  757

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++    E Y DCSHWCLP
Sbjct  758  --LTEEERRSPERYQDCSHWCLP  778



>ref|XP_010917266.1| PREDICTED: protein trichome birefringence [Elaeis guineensis]
Length=678

 Score =   126 bits (316),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 60/143 (42%), Positives = 88/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + +  E+ +  AF  A+ TW KW+D N++P +T VFFR  S  H  G  W     C
Sbjct  517  YQEGDHVYGELNVVEAFHKALNTWAKWVDTNVNPKKTLVFFRGYSASHFSGGQWNSGGQC  576

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   ++ +P P   ++E+ +  MKTPV YLNIT+++ YRKDAHP+IY ++N 
Sbjct  577  DKETEPIKNKKYLSTYP-PKMLVLEKVIKGMKTPVSYLNITRMTDYRKDAHPSIYRKQN-  634

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++    E Y DCSHWCLP
Sbjct  635  --LTEEERRSPERYQDCSHWCLP  655



>gb|KFK38572.1| hypothetical protein AALP_AA3G130900 [Arabis alpina]
Length=530

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 93/143 (65%), Gaps = 8/143 (6%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++  + AF+ A+ TW +WID N++P ++ VFFR ++P H  G  W     C
Sbjct  357  YQEGSNVYPKLDADEAFRKALTTWSRWIDKNVNPKKSLVFFRGLAPSHFSGGQWNAGGAC  416

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + +I+ER +  MKTPV Y+NIT+L+ YRKDAHP+IY ++  
Sbjct  417  DDETEPIKNETYLTPYPSKM-EILERVLRGMKTPVTYINITRLTDYRKDAHPSIYRKRKQ  475

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K  +E+  +P   Y DCSHWCLP
Sbjct  476  KLSVEESKSP-LLYQDCSHWCLP  497



>gb|AFW85381.1| putative DUF231 domain containing family protein [Zea mays]
Length=865

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 62/143 (43%), Positives = 88/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF  A+ TW KWID N++P +T V FR  S  H  G  W     C
Sbjct  703  YQEGNHVYNELNVMDAFHKALLTWSKWIDANVNPRKTLVLFRGYSASHFSGGQWNSGGGC  762

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              E+KPI +   ++ +P P   I+E  + KMKTPV YLNIT+++ YRKDAHP+IY ++N 
Sbjct  763  DKESKPITNDQYLSTYP-PKMSILEDVIHKMKTPVVYLNITRMADYRKDAHPSIYRKQNL  821

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++ +PE  + DCSHWCLP
Sbjct  822  TD--EERRSPER-FQDCSHWCLP  841



>ref|XP_006849537.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda]
 gb|ERN11118.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda]
Length=718

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 92/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  A++ A++TW KW+D N++P +T VFFR  S  H  G  W     C
Sbjct  560  YQEGNHVYGELNVVDAYRKALKTWAKWVDINVNPKKTQVFFRGYSASHFSGGQWNSGGQC  619

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI     +TM+P P  +++E  + +MKTPV YLNIT+++ YRKDAHP++Y +KN 
Sbjct  620  HKETEPIYKEKYLTMYP-PKMRVLESVMREMKTPVFYLNITRMTDYRKDAHPSVYRKKN-  677

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++ +PE  + DCSHWCLP
Sbjct  678  -LTPEERTSPER-FQDCSHWCLP  698



>gb|EAZ36212.1| hypothetical protein OsJ_20530 [Oryza sativa Japonica Group]
Length=847

 Score =   126 bits (316),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF  A+ TW +WID N++P +TTV FR  S  H  G  W     C
Sbjct  685  YQEGNHVYSELNVVDAFHKALVTWSRWIDANVNPKKTTVLFRGYSASHFSGGQWNSGGSC  744

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   ++ +P P   I+E  + KMKTPV YLNIT+++ YRKDAHP+IY ++N 
Sbjct  745  DKETEPIRNEQYLSTYP-PKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHPSIYRKRN-  802

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E +    E Y DCSHWCLP
Sbjct  803  --LTEDERRSPERYQDCSHWCLP  823



>gb|EAY87710.1| hypothetical protein OsI_09124 [Oryza sativa Indica Group]
Length=700

 Score =   125 bits (315),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/143 (41%), Positives = 91/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q   ++  E+ ++ AF+ A+ TW KW+D +++P +TTVFFR  S  H  G  W     C
Sbjct  538  YQEGNRVYSELNVDDAFQKALITWAKWVDSSVNPKKTTVFFRGYSSSHFSGGQWNSGGSC  597

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   +T +P  +  I+E  +S MKTPV YLNIT+++ YRK+AHP++Y +   
Sbjct  598  DKETEPITNEKFLTPYPRKM-SILEDVLSGMKTPVVYLNITRMTDYRKEAHPSVYRK---  653

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++ E++    + Y DCSHWCLP
Sbjct  654  QKLTEEEKKSPQIYQDCSHWCLP  676



>dbj|BAD16880.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD17136.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ24784.1| hypothetical protein OsJ_08560 [Oryza sativa Japonica Group]
 dbj|BAH01510.1| unnamed protein product [Oryza sativa Japonica Group]
Length=700

 Score =   125 bits (315),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/143 (41%), Positives = 91/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q   ++  E+ ++ AF+ A+ TW KW+D +++P +TTVFFR  S  H  G  W     C
Sbjct  538  YQEGNRVYSELNVDDAFQKALITWAKWVDSSVNPKKTTVFFRGYSSSHFSGGQWNSGGSC  597

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   +T +P  +  I+E  +S MKTPV YLNIT+++ YRK+AHP++Y +   
Sbjct  598  DKETEPITNEKFLTPYPRKM-SILEDVLSGMKTPVVYLNITRMTDYRKEAHPSVYRK---  653

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++ E++    + Y DCSHWCLP
Sbjct  654  QKLTEEEKKSPQIYQDCSHWCLP  676



>dbj|BAD35858.1| lustrin A-like [Oryza sativa Japonica Group]
 dbj|BAD35885.1| lustrin A-like [Oryza sativa Japonica Group]
 gb|EAZ00091.1| hypothetical protein OsI_22096 [Oryza sativa Indica Group]
Length=847

 Score =   126 bits (316),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF  A+ TW +WID N++P +TTV FR  S  H  G  W     C
Sbjct  685  YQEGNHVYSELNVVDAFHKALVTWSRWIDANVNPKKTTVLFRGYSASHFSGGQWNSGGSC  744

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   ++ +P P   I+E  + KMKTPV YLNIT+++ YRKDAHP+IY ++N 
Sbjct  745  DKETEPIRNEQYLSTYP-PKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHPSIYRKRN-  802

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E +    E Y DCSHWCLP
Sbjct  803  --LTEDERRSPERYQDCSHWCLP  823



>ref|XP_002436669.1| hypothetical protein SORBIDRAFT_10g006800 [Sorghum bicolor]
 gb|EER88036.1| hypothetical protein SORBIDRAFT_10g006800 [Sorghum bicolor]
Length=869

 Score =   126 bits (316),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 62/143 (43%), Positives = 88/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF  A+ TW KWID N++P +T V FR  S  H  G  W     C
Sbjct  707  YQEGNHVYNELNVMDAFHKALLTWSKWIDANVNPRKTAVLFRGYSASHFSGGQWNSGGSC  766

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              E++PI +   ++ +P P   I+E  + KMKTPV YLNIT+++ YRKDAHP+IY ++N 
Sbjct  767  DKESEPITNEQYLSTYP-PKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHPSIYRKQNL  825

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++ +PE  Y DCSHWCLP
Sbjct  826  TD--EERRSPER-YQDCSHWCLP  845



>gb|EMT28814.1| hypothetical protein F775_14799 [Aegilops tauschii]
Length=705

 Score =   125 bits (314),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 62/143 (43%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF  A+ TW +WID N++P +TTV FR  S  H  G  W     C
Sbjct  543  YQEGSHIYSELNVVDAFHKALITWSRWIDGNVNPKKTTVMFRGYSASHFSGGQWNSGGSC  602

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   ++ +P P   I+E  + KM+TPV YLNIT+L+ YRKDAHP+IY +++ 
Sbjct  603  DKETEPIKNEQYLSTYP-PKMSILEDVIHKMRTPVVYLNITRLTDYRKDAHPSIYRKQHL  661

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             +  E++ +PE  Y DCSHWCLP
Sbjct  662  SE--EERRSPER-YQDCSHWCLP  681



>gb|EYU44003.1| hypothetical protein MIMGU_mgv1a017776mg, partial [Erythranthe 
guttata]
Length=207

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 90/148 (61%), Gaps = 24/148 (16%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            FQ  + + +++ +  A+K A++TW +W+D+NID ++T+VFFR  S  H +G  W     C
Sbjct  46   FQEGDHVYNKLAVADAYKKALKTWAQWVDENIDSSKTSVFFRGYSASHFKGGQWNSGGSC  105

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR---  79
              ETKPI + + ++ +P  +R + E  + KMKTPV YLNITK++ YRKD HP+I+ R   
Sbjct  106  DGETKPITNETQLSPYPWMMRAL-ESVLMKMKTPVFYLNITKMTDYRKDGHPSIFRRSSS  164

Query  78   --KNGKQIIEKKLNPEETYSDCSHWCLP  1
              KNG             + DCSHWCLP
Sbjct  165  NIKNG------------VFQDCSHWCLP  180



>ref|XP_008789200.1| PREDICTED: protein trichome birefringence [Phoenix dactylifera]
Length=670

 Score =   124 bits (311),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 60/143 (42%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF  A+ TW KW+D N++P +T VFFR  S  H  G  W     C
Sbjct  509  YQEGNHVYSELNVVEAFHKALTTWAKWVDTNVNPKKTLVFFRGYSASHFSGGQWNSGGQC  568

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   ++ +P P   ++E  +  MKTPV YLNIT+++ YRKDAHP+IY ++N 
Sbjct  569  DQETEPIKNEKYLSPYP-PKMHVLETVIKGMKTPVSYLNITRMTDYRKDAHPSIYRKQN-  626

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++    E Y DCSHWCLP
Sbjct  627  --LTEEERRSPERYQDCSHWCLP  647



>ref|NP_001057100.1| Os06g0207500 [Oryza sativa Japonica Group]
 dbj|BAF19014.1| Os06g0207500, partial [Oryza sativa Japonica Group]
Length=720

 Score =   124 bits (310),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF  A+ TW +WID N++P +TTV FR  S  H  G  W     C
Sbjct  558  YQEGNHVYSELNVVDAFHKALVTWSRWIDANVNPKKTTVLFRGYSASHFSGGQWNSGGSC  617

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   ++ +P P   I+E  + KMKTPV YLNIT+++ YRKDAHP+IY ++N 
Sbjct  618  DKETEPIRNEQYLSTYP-PKMSILEDVIHKMKTPVVYLNITRMTDYRKDAHPSIYRKRN-  675

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E +    E Y DCSHWCLP
Sbjct  676  --LTEDERRSPERYQDCSHWCLP  696



>gb|KHG17263.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=425

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 93/147 (63%), Gaps = 11/147 (7%)
 Frame = -1

Query  408  QYKEKLTDEMRIES--AFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ-GRHW-----  253
             +++ +TD + I+   A++ A+++W KW+++N+DP +T+VFF S++P H+    W     
Sbjct  263  SFEDGVTDYVDIDQNVAYESALKSWAKWVEENVDPNQTSVFFISMAPSHKMSSAWNNTNG  322

Query  252  --CYNETKPIIDVSGMTMFPE-PLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA  82
              C NET PI++ S   +     L  IVE  V  MK P+++LNIT+LS+YRKDAH +IYA
Sbjct  323  IMCLNETTPIVNTSTFDVGTNRQLSAIVENVVRSMKIPLQFLNITRLSEYRKDAHTSIYA  382

Query  81   RKNGKQIIEKKLNPEETYSDCSHWCLP  1
               GK + +++      Y+DC HWCLP
Sbjct  383  APGGKLLTQEQKADPAKYADCVHWCLP  409



>ref|XP_002882764.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 95/149 (64%), Gaps = 22/149 (15%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF+ A+ TWG+W+D N++P ++ VFFR  SP H  G  W     C
Sbjct  386  YQEGSNVHPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFSGGQWNAGGAC  445

Query  249  YNETKPIIDVSGMTMFPEPLR-KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKN  73
             +ET+PI + + +T  P  L+ +I+ER +S MKTPV YLNIT+L+ YRKDAHP+IY +  
Sbjct  446  DDETEPIKNETYLT--PYMLKMEILERVLSGMKTPVTYLNITRLTDYRKDAHPSIYRK--  501

Query  72   GKQIIEKKLNPEET-----YSDCSHWCLP  1
                  +KL+ EE+     Y DCSHWCLP
Sbjct  502  ------QKLSAEESKSPLLYQDCSHWCLP  524



>ref|XP_006407376.1| hypothetical protein EUTSA_v10020451mg [Eutrema salsugineum]
 gb|ESQ48829.1| hypothetical protein EUTSA_v10020451mg [Eutrema salsugineum]
Length=548

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 92/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF+ A+ TWG+W+D N+   +T VFFR  SP H  G  W     C
Sbjct  376  YQEGNNVYPKLDVDEAFQKALTTWGQWVDKNVKQKKTLVFFRGYSPSHFSGGQWNAGGAC  435

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P P  +I+ER +  MKTPV YLNIT+L+ YRKDAHP+IY ++  
Sbjct  436  DDETEPIKNETYLTPYP-PKMEILERVIKGMKTPVTYLNITRLTDYRKDAHPSIYRKQ--  492

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K  +E+  +P   Y DCSHWCLP
Sbjct  493  KLSLEESESP-LLYQDCSHWCLP  514



>emb|CDY72094.1| BnaCnng75930D [Brassica napus]
Length=535

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 92/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF+ A+ TWG+W+D+N++P ++ VFFR  SP H  G  W     C
Sbjct  365  YQEGSNVHPKLDVDEAFRKALTTWGQWVDENVNPKKSLVFFRGYSPSHFSGGQWNAGGAC  424

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  +  I+ER +  MK+PV YLNIT+L+ YRKDAHP++Y RK+ 
Sbjct  425  DDETEPIKNETYLTPYPSKML-ILERVLKGMKSPVTYLNITRLTDYRKDAHPSVY-RKHK  482

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E+K      Y DCSHWCLP
Sbjct  483  LSAKERK--SPLLYQDCSHWCLP  503



>ref|NP_001141610.1| uncharacterized protein LOC100273728 [Zea mays]
 gb|ACF86715.1| unknown [Zea mays]
Length=353

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF  A+ TW KWID N++P +T V FR  S  H  G  W     C
Sbjct  191  YQEGNHVYNELNVMDAFHKALLTWSKWIDANVNPRKTLVLFRGYSASHFSGGQWNSGGGC  250

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              E+KPI +   ++ +P P   I+E  + KMKTPV YLNIT+++ YRKDAHP+IY ++N 
Sbjct  251  DKESKPITNDQYLSTYP-PKMSILEDVIHKMKTPVVYLNITRMADYRKDAHPSIYRKQN-  308

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + +++    E + DCSHWCLP
Sbjct  309  --LTDEERRSPERFQDCSHWCLP  329



>gb|AAM67355.1| unknown [Arabidopsis thaliana]
Length=329

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 90/143 (63%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  163  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPAKSLVFFRGYSASHFSGGQWNSGGAC  222

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++E+ +  MKTPV YLNIT+L+ YRKD HP++Y +++ 
Sbjct  223  DSETEPIKNDTYLTPYPSKM-KVLEKVLRGMKTPVTYLNITRLTDYRKDGHPSVYRKQS-  280

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + EK+      Y DCSHWCLP
Sbjct  281  --LSEKEKKSPLLYQDCSHWCLP  301



>gb|EMS48369.1| hypothetical protein TRIUR3_11824 [Triticum urartu]
Length=426

 Score =   120 bits (300),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 57/143 (40%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q   ++  E+ +  AF+ A+ TW KW+D NI+P +TTV FR  S  H  G  W     C
Sbjct  264  YQEGNQVYSELNVHDAFRRALNTWAKWVDSNINPKKTTVLFRGYSSSHFSGGQWNSGGSC  323

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   +  +P+ +  I+E  +  MKTPV YLNIT+++ YRK+ HP++Y +   
Sbjct  324  DKETEPITNEKFLMPYPQKM-SILEEVLHGMKTPVAYLNITRMTDYRKEGHPSVYRK---  379

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++ E++    E Y DCSHWCLP
Sbjct  380  QKLSEEERKSPELYQDCSHWCLP  402



>ref|XP_007142667.1| hypothetical protein PHAVU_007G006500g [Phaseolus vulgaris]
 gb|ESW14661.1| hypothetical protein PHAVU_007G006500g [Phaseolus vulgaris]
Length=528

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-------QGRHW  253
            +Q   ++  +M +E AF+ AMQTW +W+D ++D  +TTVFFR  SP H        G H 
Sbjct  363  YQEGNRIHGQMSVEEAFQKAMQTWSRWVDTSVDRKKTTVFFRGYSPSHFRDGEWDSGGH-  421

Query  252  CYNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKN  73
            C NET+P+ + S  T  P P+   VE  + KMKTPV YLNITK++  R DAHP+ + R+N
Sbjct  422  CDNETEPMKNESEFTERP-PMMDSVEAALKKMKTPVFYLNITKMTDLRVDAHPSWFRREN  480

Query  72   GKQIIEKKLNPEETYSDCSHWCLP  1
              +  +K ++   T+ DCSHWCLP
Sbjct  481  MNEETKKIMH---THQDCSHWCLP  501



>ref|XP_010452610.1| PREDICTED: protein trichome birefringence [Camelina sativa]
Length=621

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++PT++ VFFR  S  H  G  W     C
Sbjct  455  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPTKSLVFFRGYSASHFSGGQWNSGGAC  514

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ETKPI + + +T +P  + K++E+ +  MKTPV YLNIT+L+ YRKD HP++Y +   
Sbjct  515  DSETKPIKNDTYLTPYPSKM-KVLEKVLRGMKTPVTYLNITRLTDYRKDGHPSVYRKHT-  572

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + EK+      Y DCSHWCLP
Sbjct  573  --LTEKEKKTPLLYQDCSHWCLP  593



>ref|XP_010491248.1| PREDICTED: protein trichome birefringence-like [Camelina sativa]
Length=616

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++PT++ VFFR  S  H  G  W     C
Sbjct  450  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPTKSLVFFRGYSASHFSGGQWNSGGAC  509

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ETKPI + + +T +P  + K++E+ +  MKTPV YLNIT+L+ YRKD HP++Y +   
Sbjct  510  DSETKPIKNDTYLTPYPSKM-KVLEKVLRGMKTPVTYLNITRLTDYRKDGHPSVYRKHT-  567

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + EK+      Y DCSHWCLP
Sbjct  568  --LTEKEKKTPLLYQDCSHWCLP  588



>emb|CDX81015.1| BnaC03g02690D [Brassica napus]
Length=519

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 91/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  353  YQEGSNVYHELAVHEAFRKALTTWGRWVEKNVNPNKSLVFFRGYSASHFSGGQWNSGGAC  412

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P+ + K++ER +  M+TPV YLNIT+L+ YRKD HP++Y +++ 
Sbjct  413  DSETEPIKNETYLTPYPDKM-KVLERVLKGMRTPVTYLNITRLTDYRKDGHPSVYRKQS-  470

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + +K+      Y DCSHWCLP
Sbjct  471  --LSDKEKKTPLLYQDCSHWCLP  491



>emb|CDY08459.1| BnaA05g26950D [Brassica napus]
Length=580

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 90/143 (63%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AFK A+ TWG+W+D N++P ++ VFFR  SP H  G  W     C
Sbjct  378  YQEGSNVHPKLDVDEAFKKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFSGGQWNAGGAC  437

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  +  I+E  +  MKTPV YLNIT+L+ YRKDAHP++Y RK+ 
Sbjct  438  DDETEPIKNETYLTPYPSKML-ILETVLKGMKTPVTYLNITRLTDYRKDAHPSVY-RKHK  495

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E+K      Y DCSHWCLP
Sbjct  496  LSAKERK--SPLLYQDCSHWCLP  516



>ref|XP_010520026.1| PREDICTED: protein trichome birefringence-like [Tarenaya hassleriana]
Length=649

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 89/148 (60%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TW +W+D N++P ++ V FR  S  H  G  W     C
Sbjct  483  YQEGSHVYGELNVLEAFRKALTTWSRWVDKNVNPDKSLVLFRGYSASHFSGGQWNSGGAC  542

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P P  +++ER +  MKTPV YLNIT+L+ YRKD HP+IY ++N 
Sbjct  543  DSETEPIKNETYLTPYP-PKMQVLERVIKGMKTPVTYLNITRLTDYRKDGHPSIYRKQN-  600

Query  69   KQIIEKKLNPEE-----TYSDCSHWCLP  1
                   L+PEE      Y DCSHWCLP
Sbjct  601  -------LSPEERRSPLRYQDCSHWCLP  621



>ref|XP_009146094.1| PREDICTED: protein trichome birefringence-like 1 [Brassica rapa]
Length=256

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 91/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            FQ +  +  ++ ++ AF+ A+ TWG+W+D  ++P ++ VFFR  S  H  G  W     C
Sbjct  85   FQERSTVYPKLNVDEAFRKALTTWGRWVDKYVNPKKSLVFFRGFSLSHFSGGRWNAGGAC  144

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +  +P  + +I+ER +  MKTPV YLNIT+L+ YRKDAHP++Y ++  
Sbjct  145  DDETEPIKNEAYLMPYPSKM-EILERVLRGMKTPVTYLNITRLTDYRKDAHPSVYRKQ--  201

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K   E+  +P   Y DCSHWCLP
Sbjct  202  KFTAEESKSP-LLYQDCSHWCLP  223



>ref|XP_006299462.1| hypothetical protein CARUB_v10015627mg [Capsella rubella]
 gb|EOA32360.1| hypothetical protein CARUB_v10015627mg [Capsella rubella]
Length=546

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 93/149 (62%), Gaps = 22/149 (15%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    L  ++ ++ AF+ A+ TWG+W+D N++P ++ VFFR  SP H  G  W     C
Sbjct  379  YQEGRNLYPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFSGGQWNAGGAC  438

Query  249  YNETKPIIDVSGMTMFPEPLR-KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKN  73
             +ET+PI + + +T  P  L+ +I+ER +  MK PV YLNIT+L+ YRKDAHP+IY +  
Sbjct  439  DDETEPIKNETYLT--PYMLKMQILERVLRGMKAPVTYLNITRLTDYRKDAHPSIYRK--  494

Query  72   GKQIIEKKLNPEET-----YSDCSHWCLP  1
                  +KL+ EE+     Y DCSHWCLP
Sbjct  495  ------QKLSAEESKSPLLYQDCSHWCLP  517



>ref|NP_187813.1| protein TRICHOME BIREFRINGENCE-LIKE 1 [Arabidopsis thaliana]
 sp|Q9LHL6.1|TBL1_ARATH RecName: Full=Protein trichome birefringence-like 1 [Arabidopsis 
thaliana]
 gb|AAG51057.1|AC069473_19 unknown protein; 38990-36982 [Arabidopsis thaliana]
 dbj|BAB03118.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE65935.1| unknown [Arabidopsis thaliana]
 gb|AEE75143.1| uncharacterized protein AT3G12060 [Arabidopsis thaliana]
Length=556

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 94/149 (63%), Gaps = 22/149 (15%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF+ A+ TWG+W+D N++P ++ VFFR  SP H  G  W     C
Sbjct  383  YQEGSTVHPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFSGGQWNAGGAC  442

Query  249  YNETKPIIDVSGMTMFPEPLR-KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKN  73
             +ET+PI + + +T  P  L+ +I+ER +  MKTPV YLNIT+L+ YRKDAHP+IY +  
Sbjct  443  DDETEPIKNETYLT--PYMLKMEILERVLRGMKTPVTYLNITRLTDYRKDAHPSIYRK--  498

Query  72   GKQIIEKKLNPEET-----YSDCSHWCLP  1
                  +KL+ EE+     Y DCSHWCLP
Sbjct  499  ------QKLSAEESKSPLLYQDCSHWCLP  521



>gb|ABK28553.1| unknown [Arabidopsis thaliana]
Length=557

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 94/149 (63%), Gaps = 22/149 (15%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF+ A+ TWG+W+D N++P ++ VFFR  SP H  G  W     C
Sbjct  383  YQEGSTVHPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFSGGQWNAGGAC  442

Query  249  YNETKPIIDVSGMTMFPEPLR-KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKN  73
             +ET+PI + + +T  P  L+ +I+ER +  MKTPV YLNIT+L+ YRKDAHP+IY +  
Sbjct  443  DDETEPIKNETYLT--PYMLKMEILERVLRGMKTPVTYLNITRLTDYRKDAHPSIYRK--  498

Query  72   GKQIIEKKLNPEET-----YSDCSHWCLP  1
                  +KL+ EE+     Y DCSHWCLP
Sbjct  499  ------QKLSAEESKSPLLYQDCSHWCLP  521



>ref|XP_006287297.1| hypothetical protein CARUB_v10000490mg [Capsella rubella]
 gb|EOA20195.1| hypothetical protein CARUB_v10000490mg [Capsella rubella]
Length=613

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 90/143 (63%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++PT++ VFFR  S  H  G  W     C
Sbjct  447  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPTKSLVFFRGYSASHFSGGQWNSGGAC  506

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++E+ +  MKTPV YLNIT+L+ YRKD HP++Y + + 
Sbjct  507  DSETEPIKNDTYLTPYPSKM-KVLEKVLRGMKTPVTYLNITRLTDYRKDGHPSVYRKHS-  564

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + EK+      Y DCSHWCLP
Sbjct  565  --LTEKEKKTPLLYQDCSHWCLP  585



>ref|XP_003625280.1| hypothetical protein MTR_7g093450 [Medicago truncatula]
 gb|AES81498.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=601

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 89/148 (60%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + DE+ +  AF+ A+ TWG+W+D N++PT++ V FR  S  H  G  W     C
Sbjct  435  YQEGSHVYDELNVLEAFRRAITTWGRWVDANVNPTKSIVLFRGYSASHFSGGQWNSGGQC  494

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET PI +   +T +P P  +++E+ +  MK PV YLNIT+++ +RKD HP+IY ++N 
Sbjct  495  DHETAPIDNEKYLTEYP-PKMRVLEKVLKNMKNPVSYLNITRMTDFRKDGHPSIYRKQN-  552

Query  69   KQIIEKKLNPEE-----TYSDCSHWCLP  1
                   L+PEE      + DCSHWCLP
Sbjct  553  -------LSPEERKSPLRFQDCSHWCLP  573



>ref|XP_004497358.1| PREDICTED: uncharacterized protein LOC101512304 [Cicer arietinum]
Length=517

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 88/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ +E AF  A+ TW  W+D NI+P +T VFFR  SP H +G  W     C
Sbjct  352  YQEGNHIHGQLNVEEAFSKALFTWSHWVDTNINPKKTIVFFRGYSPSHFRGGEWFSGGQC  411

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             NET+P+ + S ++  P P+ K +E  + +MKTPV YLNITK++ +R DAHP++Y   N 
Sbjct  412  ENETEPMKNESDLSENP-PMMKTIESVIERMKTPVFYLNITKMTDFRLDAHPSMYRNMNM  470

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             +  +K +    T+ DCSHWCLP
Sbjct  471  SEENKKYM---LTHQDCSHWCLP  490



>ref|XP_010682517.1| PREDICTED: protein trichome birefringence-like 2 [Beta vulgaris 
subsp. vulgaris]
Length=512

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 91/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + +   ++   A++ A+ TWG+W+D +ID  +T VFFR  S  H +G  W     C
Sbjct  348  YQEGDHVHPRLKALKAYRKALATWGRWVDRHIDYKKTLVFFRGYSGTHFRGGQWNSGGQC  407

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ETKPI + + +  +P  +R + E+ + KMKTPV YLNI++L+ YRKDAHP+IY RK+ 
Sbjct  408  HKETKPIFNETYLAKYPSKMRAL-EQVLGKMKTPVMYLNISRLTNYRKDAHPSIY-RKSY  465

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +   EK+L   E   DCSHWCLP
Sbjct  466  E--TEKELIEAEQSQDCSHWCLP  486



>gb|KHN37297.1| hypothetical protein glysoja_013512 [Glycine soja]
Length=526

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 89/143 (62%), Gaps = 11/143 (8%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  +M +E AF  A+ TW +WID NIDP +TTVFFR  SP H +G  W     C
Sbjct  362  YQEGNHIYGQMNVEEAFHKALLTWAQWIDSNIDPKKTTVFFRGYSPSHFRGGEWNSGGKC  421

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             NET+P+   S +   PE +   ++  + KMKTPV YLNITK++ +R+DAHP+++  +N 
Sbjct  422  DNETEPLESESDLET-PE-MMMTIDSVIKKMKTPVFYLNITKMTYFRRDAHPSLFRNENM  479

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             +  ++ +    T+ DCSHWCLP
Sbjct  480  TEETKRHM---LTHQDCSHWCLP  499



>gb|EYU44005.1| hypothetical protein MIMGU_mgv1a026273mg [Erythranthe guttata]
Length=456

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 91/143 (64%), Gaps = 14/143 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            FQ    + +++ +  A+K A++TW +W+D+NID ++T+VFFR  S  H +G  W     C
Sbjct  295  FQEGNHVYNKLAVADAYKKALKTWAQWVDENIDSSKTSVFFRGYSASHFKGGQWNSGGSC  354

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ETKPI + + ++ +P  +R + E  + KMKTPV YLNITK++ YRKD HP+I+ R + 
Sbjct  355  DGETKPITNETQLSPYPWMMRAL-ESVLMKMKTPVFYLNITKMTDYRKDGHPSIFRRSSS  413

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
               I+ ++     + DCSHWCLP
Sbjct  414  N--IKNRV-----FQDCSHWCLP  429



>emb|CDY55774.1| BnaA03g55480D [Brassica napus]
Length=519

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 91/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  353  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPDKSLVFFRGYSASHFSGGQWNSGGAC  412

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P+ + K++ER +  M+TPV YLNIT+L+ YRKD HP++Y +++ 
Sbjct  413  DSETEPIKNETYLTPYPDKM-KVLERVLKGMRTPVTYLNITRLTDYRKDGHPSVYRKQS-  470

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + +K+      Y DCSHWCLP
Sbjct  471  --LSDKEKKTPLLYQDCSHWCLP  491



>ref|NP_568173.2| protein TRICHOME BIREFRINGENCE [Arabidopsis thaliana]
 sp|Q9FG35.1|TBR_ARATH RecName: Full=Protein trichome birefringence [Arabidopsis thaliana]
 dbj|BAB09804.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF01304.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91052.1| uncharacterized protein AT5G06700 [Arabidopsis thaliana]
Length=608

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 90/143 (63%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  442  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPAKSLVFFRGYSASHFSGGQWNSGGAC  501

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++E+ +  MKTPV YLNIT+L+ YRKD HP++Y +++ 
Sbjct  502  DSETEPIKNDTYLTPYPSKM-KVLEKVLRGMKTPVTYLNITRLTDYRKDGHPSVYRKQS-  559

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + EK+      Y DCSHWCLP
Sbjct  560  --LSEKEKKSPLLYQDCSHWCLP  580



>gb|ADI48429.1| trichome birefringence [Arabidopsis thaliana]
Length=608

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 90/143 (63%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  442  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPAKSLVFFRGYSASHFSGGQWNSGGAC  501

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++E+ +  MKTPV YLNIT+L+ YRKD HP++Y +++ 
Sbjct  502  DSETEPIKNDTYLTPYPSKM-KVLEKVLRGMKTPVTYLNITRLTDYRKDGHPSVYRKQS-  559

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + EK+      Y DCSHWCLP
Sbjct  560  --LSEKEKKSPLLYQDCSHWCLP  580



>gb|KHN27090.1| hypothetical protein glysoja_032858 [Glycine soja]
Length=295

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 90/143 (63%), Gaps = 11/143 (8%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + +  +M +E AF  A+ TW +WID N+DP +TTVFFR  SP H +G  W     C
Sbjct  131  YQEGDHIYGQMNVEEAFHKALLTWAQWIDSNVDPKKTTVFFRGYSPSHFRGGEWNSGGKC  190

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             NET+P+   S +   PE +   ++  + KMKTPV YLNITK++ +R+DAHP+++  +N 
Sbjct  191  DNETEPMESESDLET-PE-MMMTIDSVIKKMKTPVFYLNITKMTYFRRDAHPSLFRNENM  248

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             +  ++ +    ++ DCSHWCLP
Sbjct  249  TEETKRYM---LSHQDCSHWCLP  268



>emb|CDX70077.1| BnaA10g24260D [Brassica napus]
Length=583

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  417  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPNKSLVFFRGYSASHFSGGQWNSGGAC  476

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++ER +  M+TPV YLNIT+L+ YRKD HP++Y RK+ 
Sbjct  477  DSETEPIKNETYLTPYPSKM-KVLERVLRGMRTPVTYLNITRLTDYRKDGHPSVY-RKHS  534

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                EKK      Y DCSHWCLP
Sbjct  535  LSDREKKT--PLLYQDCSHWCLP  555



>emb|CDX98947.1| BnaC09g48880D [Brassica napus]
Length=584

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  418  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPNKSLVFFRGYSASHFSGGQWNSGGAC  477

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++ER +  M+TPV YLNIT+L+ YRKD HP++Y RK+ 
Sbjct  478  DSETEPIKNETYLTPYPSKM-KVLERVLRGMRTPVTYLNITRLTDYRKDGHPSVY-RKHS  535

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                EKK      Y DCSHWCLP
Sbjct  536  LSDREKKT--PLLYQDCSHWCLP  556



>ref|XP_009146650.1| PREDICTED: protein trichome birefringence-like 1 [Brassica rapa]
Length=535

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF  A+ TWG+W+D N++P ++ VFFR  SP H  G  W     C
Sbjct  365  YQEGNNVYPKLDVDEAFGKALTTWGQWVDKNVNPKKSFVFFRGYSPSHFSGGQWNAGGAC  424

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  +  I+E  +  MKTPV YLNIT+L+ YRKDAHP++Y RK+ 
Sbjct  425  DDETEPIKNETYLTPYPSKML-ILETVLKGMKTPVTYLNITRLTDYRKDAHPSVY-RKHK  482

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E+K      Y DCSHWCLP
Sbjct  483  LSAKERK--SPLLYQDCSHWCLP  503



>ref|XP_009130955.1| PREDICTED: protein trichome birefringence-like [Brassica rapa]
 ref|XP_009130956.1| PREDICTED: protein trichome birefringence-like [Brassica rapa]
Length=601

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 91/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  435  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPDKSLVFFRGYSASHFSGGQWNSGGAC  494

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P+ + K++ER +  M+TPV YLNIT+L+ YRKD HP++Y +++ 
Sbjct  495  DSETEPIKNETYLTPYPDKM-KVLERVLKGMRTPVTYLNITRLTDYRKDGHPSVYRKQS-  552

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + +K+      Y DCSHWCLP
Sbjct  553  --LSDKEKKTPLLYQDCSHWCLP  573



>gb|ABK22287.1| unknown [Picea sitchensis]
 gb|ACN39781.1| unknown [Picea sitchensis]
Length=412

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 79/126 (63%), Gaps = 10/126 (8%)
 Frame = -1

Query  366  AFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH----QGRHWCYNETKPIIDVSGMTMFP  199
            A++  M TWG WID NIDP  T VFFRS SP H     G + CY+E +P    S +  +P
Sbjct  276  AYQKGMATWGNWIDSNIDPRRTKVFFRSFSPSHSSITNGGN-CYSEKEPTAGSSYLGAYP  334

Query  198  EPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNPEETYSDC  19
             P  ++ ER V  M++PV +LNIT LS  R+DAHP++Y+       + ++ NP+  Y+DC
Sbjct  335  -PQFQVAERVVRSMRSPVSFLNITTLSLLRQDAHPSVYSN---DLTVGQRKNPQR-YADC  389

Query  18   SHWCLP  1
            SHWCLP
Sbjct  390  SHWCLP  395



>ref|XP_010265940.1| PREDICTED: protein trichome birefringence-like [Nelumbo nucifera]
Length=617

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TW +W+D  IDP +T VFFR  S  H  G  W     C
Sbjct  446  YQEGSHVYGELNVVEAFRRALTTWARWVDAKIDPKKTMVFFRGYSASHFSGGQWNSGGQC  505

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P P  +++E  +  MKTPV YLNIT+++ YRKDAHP+IY +++ 
Sbjct  506  DHETEPIKNETYLTPYP-PKMRVLENVMKGMKTPVFYLNITRMTDYRKDAHPSIYRKQS-  563

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++      Y DCSHWCLP
Sbjct  564  --LTEEERKSPLRYQDCSHWCLP  584



>gb|ABK25068.1| unknown [Picea sitchensis]
Length=412

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 79/126 (63%), Gaps = 10/126 (8%)
 Frame = -1

Query  366  AFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH----QGRHWCYNETKPIIDVSGMTMFP  199
            A++  M TWG WID NIDP  T VFFRS SP H     G + CY+E +P    S +  +P
Sbjct  276  AYQKGMATWGNWIDSNIDPRRTKVFFRSFSPSHSSITNGGN-CYSEKEPTAGSSYLGAYP  334

Query  198  EPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNPEETYSDC  19
             P  ++ ER V  M++PV +LNIT LS  R+DAHP++Y+       + ++ NP+  Y+DC
Sbjct  335  -PQFQVAERVVRSMRSPVSFLNITTLSLLRQDAHPSVYSN---DLTVGQRKNPQR-YADC  389

Query  18   SHWCLP  1
            SHWCLP
Sbjct  390  SHWCLP  395



>gb|KHG20627.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=546

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 87/143 (61%), Gaps = 7/143 (5%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + + +E+ +  AF+ A+ TW KW+DDN++P++T VFFR  S  H  G  W     C
Sbjct  376  YQEGDHVYEELNVFEAFRRAVTTWSKWVDDNVNPSKTMVFFRGYSAIHFSGGQWNSGGMC  435

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +E +PI + + +  +  P+  ++E  +  MKT V YLNIT+L+ +RKD HP+IY R + 
Sbjct  436  DSEMEPIRNETFLKPY-MPMMAVLESVLEGMKTHVTYLNITRLTDFRKDGHPSIYRRYHK  494

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              I EK+      Y DCSHWCLP
Sbjct  495  HGITEKERTESVKYQDCSHWCLP  517



>ref|XP_006399144.1| hypothetical protein EUTSA_v10012993mg [Eutrema salsugineum]
 gb|ESQ40597.1| hypothetical protein EUTSA_v10012993mg [Eutrema salsugineum]
Length=613

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  447  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPDKSLVFFRGYSASHFSGGQWNSGGAC  506

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++ER +  M+TPV YLNIT+L+ YRKD HP++Y + + 
Sbjct  507  DSETEPIKNETYLTPYPSKM-KVLERVLRGMRTPVTYLNITRLTDYRKDGHPSVYRKHS-  564

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + EK+      Y DCSHWCLP
Sbjct  565  --LSEKEKRTPLLYQDCSHWCLP  585



>ref|XP_009391441.1| PREDICTED: protein trichome birefringence-like [Musa acuminata 
subsp. malaccensis]
Length=715

 Score =   119 bits (297),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 56/143 (39%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF  A+ TW KW+D N++P ++ VFFR  S  H  G  W     C
Sbjct  555  YQEGNHIYSELNVVEAFHKALDTWSKWVDTNVNPKKSLVFFRGYSASHFSGGQWNSGGQC  614

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI + + ++ +P  +  ++E  +  MKTP  YLNIT+++ YRKDAHP+IY +++ 
Sbjct  615  DKETEPIKNETYLSSYPSKM-TVLESVIKGMKTPASYLNITRMTDYRKDAHPSIYRKQH-  672

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++    E Y DCSHWCLP
Sbjct  673  --LTEEERRSPERYQDCSHWCLP  693



>ref|XP_009120981.1| PREDICTED: protein trichome birefringence-like 1 [Brassica rapa]
 emb|CDY47898.1| BnaAnng09300D [Brassica napus]
Length=529

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 91/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            FQ +  +  ++ ++ AF+ A+ TWG+W+D  ++P ++ VFFR  S  H  G  W     C
Sbjct  358  FQERSTVYPKLNVDEAFRKALTTWGRWVDKYVNPKKSLVFFRGFSLSHFSGGRWNAGGAC  417

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +  +P  + +I+ER +  MKTPV YLNIT+L+ YRKDAHP++Y ++  
Sbjct  418  DDETEPIKNEAYLMPYPSKM-EILERVLRGMKTPVTYLNITRLTDYRKDAHPSVYRKQ--  474

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K   E+  +P   Y DCSHWCLP
Sbjct  475  KFTAEESKSP-LLYQDCSHWCLP  496



>ref|XP_009122281.1| PREDICTED: protein trichome birefringence [Brassica rapa]
Length=644

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  478  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPNKSLVFFRGYSASHFSGGQWNSGGAC  537

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++ER +  M+TPV YLNIT+L+ YRKD HP++Y RK+ 
Sbjct  538  DSETEPIKNETYLTPYPSKM-KVLERVLRGMRTPVTYLNITRLTDYRKDGHPSVY-RKHS  595

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                EKK      Y DCSHWCLP
Sbjct  596  LSDREKKT--PLLYQDCSHWCLP  616



>ref|XP_010557950.1| PREDICTED: protein trichome birefringence-like [Tarenaya hassleriana]
Length=626

 Score =   118 bits (296),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 58/143 (41%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + DE+ +  AF+ A+ TW +W+D N++P ++ VFFR  S  H  G  W     C
Sbjct  460  YQEGSHVYDELNVLEAFRKALTTWSRWVDKNVNPNKSLVFFRGYSASHFSGGQWNSGGAC  519

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P P  +++ER +  MKT V YLNIT++S YRKD HP+IY +   
Sbjct  520  DSETEPIKNQTYLTPYP-PKMQVLERVLKGMKTSVTYLNITRMSDYRKDGHPSIYRK---  575

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++ E++      Y DCSHWCLP
Sbjct  576  QKLSEEERRSPLRYQDCSHWCLP  598



>ref|XP_002871228.1| hypothetical protein ARALYDRAFT_487481 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47487.1| hypothetical protein ARALYDRAFT_487481 [Arabidopsis lyrata subsp. 
lyrata]
Length=611

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  445  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPAKSLVFFRGYSASHFSGGQWNSGGAC  504

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++E+ +  MKTPV YLNIT+L+ YRKD HP++Y + + 
Sbjct  505  DSETEPIKNDTYLTPYPSKM-KVLEKVLRGMKTPVTYLNITRLTDYRKDGHPSVYRKHS-  562

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + EK+      Y DCSHWCLP
Sbjct  563  --LSEKEKKTPLLYQDCSHWCLP  583



>ref|XP_009133414.1| PREDICTED: protein trichome birefringence-like 28 [Brassica rapa]
Length=417

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 85/149 (57%), Gaps = 20/149 (13%)
 Frame = -1

Query  387  DEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKP  232
            DE+R   A++  ++TWG W+D +IDP  TTVFF S+SP H +   W       C  ET P
Sbjct  250  DEIRRPIAYERVLRTWGDWVDHHIDPLRTTVFFMSMSPLHIKSSDWGNPDGILCALETTP  309

Query  231  IIDVS-------GMTMFPE-----PLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTI  88
            I++ S          +F E      L   VE     MK P+R+LNIT LS+YRKDAH ++
Sbjct  310  ILNKSMVFNVGTNYRLFSEIGTDYRLFSSVENVTQSMKVPIRFLNITALSEYRKDAHTSV  369

Query  87   YARKNGKQIIEKKLNPEETYSDCSHWCLP  1
            Y  K GK + +++ N   TY+DC HWCLP
Sbjct  370  YTIKQGKLLTQEQQNDPATYADCIHWCLP  398



>ref|XP_003555633.2| PREDICTED: protein YLS7-like [Glycine max]
Length=525

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 90/143 (63%), Gaps = 11/143 (8%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + +  +M +E AF  A+ TW +WID N+DP +TTVFFR  SP H +G  W     C
Sbjct  361  YQEGDHIYGQMNVEEAFHKALLTWAQWIDSNVDPKKTTVFFRGYSPSHFRGGEWNSGGKC  420

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             NET+P+   S +   PE +   ++  + KMKTPV YLNITK++ +R+DAHP+++  +N 
Sbjct  421  DNETEPMESESDLET-PE-MMMTIDSVIKKMKTPVFYLNITKMTYFRRDAHPSLFRNENM  478

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             +  ++ +    ++ DCSHWCLP
Sbjct  479  TEETKRYM---LSHQDCSHWCLP  498



>gb|KDO70900.1| hypothetical protein CISIN_1g037533mg [Citrus sinensis]
Length=297

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 85/143 (59%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TW +W+D N++P ++ VFFR  S  H  G  W     C
Sbjct  128  YQEGSHVYGELNVLEAFRRALTTWARWVDANVNPMKSMVFFRGYSASHFSGGQWNSGGAC  187

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P P  K++E  +  MKT V YLNIT+L+ YRKD HP+IY +   
Sbjct  188  DHETEPIKNKTYLTAYP-PKMKVLESVLKGMKTHVTYLNITRLTDYRKDGHPSIYRK---  243

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            + I + +      Y DCSHWCLP
Sbjct  244  QHISDAERRSPLRYQDCSHWCLP  266



>gb|KFK25082.1| hypothetical protein AALP_AA8G063700 [Arabis alpina]
Length=587

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  421  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPEKSLVFFRGYSASHFSGGQWNSGGAC  480

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++E+ +  MKTPV YLNIT+L+ YRKD HP++Y + + 
Sbjct  481  DSETEPIKNDTYLTPYPAKM-KVLEKVLRGMKTPVTYLNITRLTDYRKDGHPSVYRKHS-  538

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + EK+      Y DCSHWCLP
Sbjct  539  --LSEKEKKSPLLYQDCSHWCLP  559



>ref|XP_010672635.1| PREDICTED: protein trichome birefringence-like 1 [Beta vulgaris 
subsp. vulgaris]
Length=602

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF+ A+ TWG+W+D NI+P  T VFFR  S  H  G  W     C
Sbjct  442  YQEGSNVYKQLDVQEAFRKAVTTWGRWVDANINPQRTHVFFRGYSSTHFSGGQWNSGGQC  501

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  +R + E  +  MKTPV YLNITKL+ YRKDAHP+IY ++  
Sbjct  502  DSETEPIRNDTYLTKYPWKMRTL-ETVMKGMKTPVSYLNITKLTDYRKDAHPSIYRKQ--  558

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +   E+K  P   + DCSHWCLP
Sbjct  559  RPSTEEKRTPLR-FQDCSHWCLP  580



>ref|XP_010498482.1| PREDICTED: protein trichome birefringence-like 1 [Camelina sativa]
Length=552

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 91/149 (61%), Gaps = 22/149 (15%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF+ A+ TWG+W+D N++P ++ VFFR  SP H  G  W     C
Sbjct  379  YQEGSNVYPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFSGGQWNAGGAC  438

Query  249  YNETKPIIDVSGMTMFPEPLR-KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKN  73
             +ET+PI + + +   P  L+ +I+ER +  MK PV YLNIT+L+ YRKDAHP+IY +  
Sbjct  439  NDETEPIKNETYLA--PYMLKMEILERVLKGMKAPVTYLNITRLTDYRKDAHPSIYRK--  494

Query  72   GKQIIEKKLNPEET-----YSDCSHWCLP  1
                  +KL  EE+     Y DCSHWCLP
Sbjct  495  ------QKLTAEESKSPLLYQDCSHWCLP  517



>ref|XP_010257492.1| PREDICTED: protein trichome birefringence [Nelumbo nucifera]
Length=597

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TW +W+D NIDP+ T VFFR  S  H  G  W     C
Sbjct  434  YQEGSHIYGELNVVEAFRKALTTWARWVDANIDPSNTMVFFRGYSASHFSGGQWNSGGQC  493

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +  +P P  K++E  +  MKT V YLNIT+++ YRKDAHP+IY +++ 
Sbjct  494  DHETEPIKNETYLNPYP-PKMKVLESVMKGMKTHVSYLNITRMTDYRKDAHPSIYRKQS-  551

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++      Y DCSHWCLP
Sbjct  552  --LTEEERRSPLRYQDCSHWCLP  572



>ref|XP_006590231.1| PREDICTED: protein YLS7-like [Glycine max]
Length=524

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 88/143 (62%), Gaps = 11/143 (8%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  +M +E AF  A+ TW +WID NIDP +TTVFFR  SP H +G  W     C
Sbjct  362  YQEGNHIYGQMNVEEAFHKALLTWAQWIDSNIDPKKTTVFFRGYSPSHFRGGEWNSGGKC  421

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             NET+P+   S +   PE +   ++  + KMKTPV YLNITK++ +R+DAHP+++  +N 
Sbjct  422  DNETEPLESESDLET-PE-MMMTIDSVIKKMKTPVFYLNITKMTYFRRDAHPSLFRNENM  479

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             +  ++ +     + DCSHWCLP
Sbjct  480  TEETKRHM---LIHQDCSHWCLP  499



>gb|KHG04354.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=552

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 88/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + + + ++ AF+ A+ TW KWID NID T+T VFFR  S  H +G  W     C
Sbjct  378  YQEGNTIYNRLHVKVAFRKALTTWAKWIDTNIDSTKTLVFFRGFSASHFRGGRWNSGGQC  437

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ETKPI +   +  +P  +R I E  ++ +  PV YLN+++++ +RKDAHP++Y ++N 
Sbjct  438  HGETKPITNGKYLKKYPSKMR-IFESVINGITNPVLYLNVSRMTGFRKDAHPSVYRKQNL  496

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             +  E+K +P     DCSHWCLP
Sbjct  497  TE--EEKTSPTRI-QDCSHWCLP  516



>ref|XP_010486896.1| PREDICTED: protein trichome birefringence-like 1 [Camelina sativa]
Length=546

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 91/149 (61%), Gaps = 22/149 (15%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF+ A+ TWG+W+D N++P ++ VFFR  SP H  G  W     C
Sbjct  379  YQEGSNVYRKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFSGGQWNAGGAC  438

Query  249  YNETKPIIDVSGMTMFPEPLR-KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKN  73
             +ET+PI + + +   P  L+ +I+ER +  MK PV YLNIT+L+ YRKDAHP+IY +  
Sbjct  439  DDETEPIKNETYLA--PYMLKMEILERVLRGMKAPVTYLNITRLTDYRKDAHPSIYRK--  494

Query  72   GKQIIEKKLNPEET-----YSDCSHWCLP  1
                  +KL  EE+     Y DCSHWCLP
Sbjct  495  ------QKLTAEESKSPLLYQDCSHWCLP  517



>ref|XP_009125778.1| PREDICTED: protein trichome birefringence-like [Brassica rapa]
Length=525

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 90/145 (62%), Gaps = 14/145 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  365  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPEKSLVFFRGFSATHFSGGQWNSGGAC  424

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++E  +  M+TPV YLNIT+L+ YRKD HP++Y     
Sbjct  425  DSETEPIKNETYLTPYPSKM-KVLESVLKGMRTPVTYLNITRLTDYRKDGHPSVYR----  479

Query  69   KQII--EKKLNPEETYSDCSHWCLP  1
            KQI+  E+K  P   Y DCSHWCLP
Sbjct  480  KQILSDEEKKTP-LLYQDCSHWCLP  503



>emb|CDY24925.1| BnaC03g22470D [Brassica napus]
Length=417

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 84/149 (56%), Gaps = 20/149 (13%)
 Frame = -1

Query  387  DEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKP  232
            DE+R   A++  ++TWG W+D +IDP  TTVFF S+SP H +   W       C  ET P
Sbjct  250  DEIRRPIAYERVLRTWGDWVDHHIDPLRTTVFFMSMSPLHIKSSDWGNPDGILCALETTP  309

Query  231  IIDVS-------GMTMFPE-----PLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTI  88
            I++ S          +F E      L   VE     MK P+R+LNIT LS+YRKDAH ++
Sbjct  310  ILNKSMVFNVGTNYRLFSEIGTDYRLFSSVENVTQSMKVPIRFLNITALSEYRKDAHTSV  369

Query  87   YARKNGKQIIEKKLNPEETYSDCSHWCLP  1
            Y  K GK +  ++ N   TY+DC HWCLP
Sbjct  370  YTIKQGKLLTREQQNDPATYADCIHWCLP  398



>gb|KHG00171.1| U3 small nucleolar RNA-associated 6 [Gossypium arboreum]
Length=179

 Score =   111 bits (278),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 91/145 (63%), Gaps = 11/145 (8%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF+ A+ TW +W+D +++P +T VFFR  S  H  G  W     C
Sbjct  9    YQEGSHVYNELNVLEAFRKALTTWARWVDASVNPMKTMVFFRGYSASHFGGGQWNSGGAC  68

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ETKPI + + +  +P P   ++E  +  MKT V YLNIT+L+ +RKD HP+IY RK+ 
Sbjct  69   DSETKPIKNETYLKPYP-PKMLVLESVLKGMKTHVTYLNITRLTDFRKDGHPSIY-RKHP  126

Query  69   KQII--EKKLNPEETYSDCSHWCLP  1
            KQ +  ++++ P + Y DCSHWCLP
Sbjct  127  KQTVPEDERVAPLK-YQDCSHWCLP  150



>ref|XP_010464957.1| PREDICTED: protein trichome birefringence-like 1 [Camelina sativa]
Length=547

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 91/149 (61%), Gaps = 22/149 (15%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF+ A+ TWG+W+D N++P ++ VFFR  SP H  G  W     C
Sbjct  380  YQEGSNVYPKLDVDEAFRKALTTWGRWVDKNVNPKKSLVFFRGYSPSHFSGGQWNAGGAC  439

Query  249  YNETKPIIDVSGMTMFPEPLR-KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKN  73
             +ET+PI + + +   P  L+ +I+ER +  MK PV +LNIT+L+ YRKDAHP+IY +  
Sbjct  440  DDETEPIKNETYLA--PNMLKMEILERVLRGMKAPVTFLNITRLTDYRKDAHPSIYRK--  495

Query  72   GKQIIEKKLNPEET-----YSDCSHWCLP  1
                  +KL  EE+     Y DCSHWCLP
Sbjct  496  ------QKLTAEESKSPLLYQDCSHWCLP  518



>ref|XP_008340353.1| PREDICTED: LOW QUALITY PROTEIN: protein trichome birefringence-like 
2 [Malus domestica]
Length=483

 Score =   115 bits (288),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 57/143 (40%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +   +++  A+K A+ TW +W+D+NID   T VFFR  S  H  G  W     C
Sbjct  321  YQEGNYVHPRLQVLEAYKRALTTWARWVDENIDVDRTQVFFRGYSVTHFSGGQWNSGGQC  380

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI + + +  +P  +R + E  + +MKTPV YLNI++L+ YRKD HP+IY  K  
Sbjct  381  HKETEPIFNETYLGNYPSKMRAL-EHVIEEMKTPVIYLNISRLTDYRKDGHPSIYRMK--  437

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             + +E+++  E +  DCSHWCLP
Sbjct  438  YKTVEERITAEGS-QDCSHWCLP  459



>ref|XP_010026659.1| PREDICTED: protein trichome birefringence-like 2 [Eucalyptus 
grandis]
Length=525

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/143 (38%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + +   +++  A+K A++TW KWID NI  T T V FR  S  H +G  W     C
Sbjct  364  YQEGKYVHPRLKVLDAYKRALRTWAKWIDKNIHQTRTQVLFRGYSVTHFRGGQWNSGGQC  423

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI + S +  +P  +R ++E  + +M+TPV YLNI++L+ YRKD HP++Y  +  
Sbjct  424  HKETEPIFNESYLENYPSKMR-VLENVLQEMRTPVTYLNISRLTDYRKDGHPSVY--RTA  480

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             +  ++++  E++  DCSHWCLP
Sbjct  481  YRTAQEQMAAEQS-QDCSHWCLP  502



>ref|XP_003520540.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN07442.1| hypothetical protein glysoja_012740 [Glycine soja]
Length=622

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 89/148 (60%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TW +W+D NI+P++TTVFFR  S  H  G  W     C
Sbjct  456  YQEGNHVYSELNVLEAFRRALTTWSRWVDANINPSKTTVFFRGYSASHFSGGQWNSGGQC  515

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET PI +   +T +P+ + K++E+ +  MKT V Y NIT+++ +RKD HP+IY ++N 
Sbjct  516  DSETDPIDNEKYLTEYPDKM-KVLEKVLKNMKTRVTYQNITRMTDFRKDGHPSIYRKQN-  573

Query  69   KQIIEKKLNPEET-----YSDCSHWCLP  1
                   L+PEE      + DCSHWCLP
Sbjct  574  -------LSPEELKSPLRFQDCSHWCLP  594



>ref|XP_007011182.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007011183.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY19992.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY19993.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=602

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 85/143 (59%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + D + ++ AF+ A+ TW +WID NIDP +T VFFR  S  H +G  W     C
Sbjct  429  YQEGTTIYDRLNVKEAFRKALTTWARWIDTNIDPMKTLVFFRGFSASHFRGGRWNSGGQC  488

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   +  +P  +R I E  +  M  PV YLN+++++ +RKDAHP+IY ++N 
Sbjct  489  DGETEPITNEKYLKKYPSKMR-IFESVIKGMNKPVLYLNVSRMTGFRKDAHPSIYRKQN-  546

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++ +      DCSHWCLP
Sbjct  547  --LTEEERSSPTRIQDCSHWCLP  567



>ref|XP_009414351.1| PREDICTED: protein trichome birefringence-like 1 [Musa acuminata 
subsp. malaccensis]
Length=668

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 85/143 (59%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +E A + A+ TW KW+D N++  ++ V FR  S  H  G  W     C
Sbjct  507  YQEGNHIYSELNVEEALRKALSTWAKWVDTNVNREKSLVVFRGYSNSHFSGGQWNSGGQC  566

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   +T +P  +  ++E  +  MKTPV YLNIT+++ YRKDAHP+IY  +N 
Sbjct  567  DQETEPIQNDEYLTTYPS-MMTLLESVIKGMKTPVSYLNITRMTDYRKDAHPSIYRTQN-  624

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E+++   E Y DCSHWCLP
Sbjct  625  --MTEEEMRDPEKYQDCSHWCLP  645



>ref|XP_003535115.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN35654.1| hypothetical protein glysoja_041356 [Glycine soja]
Length=588

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 88/148 (59%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + DE+ +  AF+ A+ TW +WID NI+P+++ VFFR  S  H  G  W     C
Sbjct  422  YQEGSHVYDELNVLEAFRRAITTWSRWIDANINPSKSMVFFRGYSASHFSGGQWNSGGQC  481

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET PI +   +  +P P  +++E+ +  MKT V YLN+TK++ +RKD HP+IY ++N 
Sbjct  482  DSETVPIKNEKYLREYP-PKMRVLEKVLKNMKTHVTYLNVTKMTDFRKDGHPSIYRKQN-  539

Query  69   KQIIEKKLNPEE-----TYSDCSHWCLP  1
                   L+PEE      Y DCSHWCLP
Sbjct  540  -------LSPEERKSPLRYQDCSHWCLP  560



>emb|CDY05000.1| BnaAnng01820D [Brassica napus]
Length=525

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 90/145 (62%), Gaps = 14/145 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W++ N++P ++ VFFR  S  H  G  W     C
Sbjct  365  YQEGSNVYHELAVLEAFRKALTTWGRWVEKNVNPEKSLVFFRGYSATHFSGGQWNSGGAC  424

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++E  +  M+TPV YLNIT+L+ YRKD HP++Y     
Sbjct  425  DSETEPIKNETYLTPYPSKM-KVLESVLKGMRTPVTYLNITRLTDYRKDGHPSVYR----  479

Query  69   KQII--EKKLNPEETYSDCSHWCLP  1
            KQI+  E+K  P   Y DCSHWCLP
Sbjct  480  KQILSDEEKKTP-LLYQDCSHWCLP  503



>ref|XP_010227191.1| PREDICTED: protein trichome birefringence-like 2 [Brachypodium 
distachyon]
Length=733

 Score =   116 bits (291),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 57/143 (40%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +   + +  A+K A+ TW +W+D N+DP  T V FR  S  H +G  W     C
Sbjct  571  YQEGNHVYPSLEVMDAYKKALTTWARWVDKNVDPGRTQVVFRGFSLTHFRGGQWNSGGRC  630

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI + + +T +PE +R I+E+ +S+MKTPV YLNI++L+ YRKD HP++Y  +  
Sbjct  631  HRETEPIFNQTYLTEYPERMR-ILEQVLSRMKTPVIYLNISRLTDYRKDGHPSVYRVRYD  689

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++        DCSHWCLP
Sbjct  690  T---EEERMAAVMKQDCSHWCLP  709



>ref|XP_008229144.1| PREDICTED: protein trichome birefringence-like 4 [Prunus mume]
Length=616

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 88/146 (60%), Gaps = 14/146 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ ++ AF+ A+ TW +W+D NI+P +T VFFR  SP H +G  W     C
Sbjct  442  YQEGSHVYGELNVDDAFEKALTTWARWVDTNINPKKTAVFFRGYSPSHFRGGEWNSGGHC  501

Query  249  YNETKPIIDVSGMTM---FPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
            + ETKP  ++        +P  + KI++  V KMKTP+ YLNIT ++ +RKDAHP+IY +
Sbjct  502  HGETKPTTNMESTEYGGEYPSNM-KILDSVVKKMKTPIFYLNITTMTDFRKDAHPSIYRK  560

Query  78   KNGKQIIEKKLNPEETYSDCSHWCLP  1
             N   + E++  P     DCSHWCLP
Sbjct  561  PN---LTEEERKP-PMIQDCSHWCLP  582



>gb|KCW88140.1| hypothetical protein EUGRSUZ_A00530 [Eucalyptus grandis]
Length=459

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 78/130 (60%), Gaps = 9/130 (7%)
 Frame = -1

Query  369  SAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHW-------CYNETKPIIDVSGM  211
            +A++LA++TW  WID  IDP  T +FF ++SP H    W       CYNETKP + V+  
Sbjct  318  TAYRLALKTWANWIDSAIDPNRTRLFFTTLSPTHINEDWGNKNGIKCYNETKPAMKVT--  375

Query  210  TMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNPEET  31
              + + +  +V   V KM+ PV ++NIT+LS+YR D H ++Y    GK + E++      
Sbjct  376  RSWVDRMPDVVSSIVKKMRVPVTFINITQLSEYRVDGHVSVYGESRGKVLTEEQRADPLR  435

Query  30   YSDCSHWCLP  1
            Y+DC HWCLP
Sbjct  436  YADCIHWCLP  445



>gb|ABK92679.1| unknown [Populus trichocarpa]
Length=212

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 82/140 (59%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  DEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKP  232
            DE+    A++  + TW KW++ N+DP  TTVFF S+SP H +   W       C  ET P
Sbjct  56   DEIERPVAYRRVLNTWSKWVEKNVDPNRTTVFFSSMSPLHIKSLDWENPDGIKCAKETAP  115

Query  231  IIDVSGMTMFPEPLRK---IVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQI  61
            I++VS M +     R+   +       MK PV +LNITKLS+YRKDAH +++  + GK +
Sbjct  116  ILNVS-MPLNVGTDRRLFVVAANITGSMKVPVHFLNITKLSEYRKDAHTSVHTIRQGKML  174

Query  60   IEKKLNPEETYSDCSHWCLP  1
              ++    ETY+DC HWCLP
Sbjct  175  TPEQQADPETYADCIHWCLP  194



>gb|KCW59798.1| hypothetical protein EUGRSUZ_H02546 [Eucalyptus grandis]
Length=268

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 85/133 (64%), Gaps = 10/133 (8%)
 Frame = -1

Query  381  MRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----CYNETKPIIDV  220
            +++  A+K A++TW KWID NI  T T V FR  S  H +G  W     C+ ET+PI + 
Sbjct  117  LKVLDAYKRALRTWAKWIDKNIHQTRTQVLFRGYSVTHFRGGQWNSGGQCHKETEPIFNE  176

Query  219  SGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNP  40
            S +  +P  +R ++E  + +M+TPV YLNI++L+ YRKD HP++Y  +   +  ++++  
Sbjct  177  SYLENYPSKMR-VLENVLQEMRTPVTYLNISRLTDYRKDGHPSVY--RTAYRTAQEQMAA  233

Query  39   EETYSDCSHWCLP  1
            E++  DCSHWCLP
Sbjct  234  EQS-QDCSHWCLP  245



>gb|KDP32509.1| hypothetical protein JCGZ_14712 [Jatropha curcas]
Length=220

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 82/136 (60%), Gaps = 8/136 (6%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKPI  229
            E  + +A+KLA++TW  W+  N++P +  VFF S+SP H     W       C+NE+ PI
Sbjct  63   EYNVTTAYKLALETWANWLQSNVNPLKQRVFFMSMSPTHLWSWEWRPGSDENCFNESYPI  122

Query  228  IDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKK  49
                  T     + KIV  T+ K+K  V +LNIT+LS+YRKDAH TIY  + GK + +++
Sbjct  123  RGPYWGTGSNLQIMKIVTDTLQKLKINVAFLNITQLSEYRKDAHTTIYGERKGKLLTKEQ  182

Query  48   LNPEETYSDCSHWCLP  1
             +  + ++DC HWCLP
Sbjct  183  RSDPKNFADCIHWCLP  198



>ref|XP_008444354.1| PREDICTED: protein trichome birefringence-like 2 [Cucumis melo]
Length=551

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++++  AFK A+ TWG+WID+N+D   T VFFR  S  H  G  W     C
Sbjct  389  YQEGNHVHSKLKVLEAFKRALTTWGRWIDNNVDKNRTLVFFRGYSYSHFSGGEWNSGGQC  448

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI + + +  +P+ +R + E  + +MKTPV YLNIT+L+ YRKDAHP+IY R   
Sbjct  449  NIETEPIYNKTHLGKYPKKMRAL-EYVIQEMKTPVSYLNITRLTHYRKDAHPSIY-RMEY  506

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K   EK+        DCSHWCLP
Sbjct  507  KTEAEKRAGLR--VQDCSHWCLP  527



>ref|XP_007207689.1| hypothetical protein PRUPE_ppa023743mg, partial [Prunus persica]
 gb|EMJ08888.1| hypothetical protein PRUPE_ppa023743mg, partial [Prunus persica]
Length=541

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 87/146 (60%), Gaps = 14/146 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ ++ AF+ A+ TW +W+D N++P +T VFFR  SP H +G  W     C
Sbjct  367  YQEGSHVYGELNVDDAFEKALTTWARWVDTNVNPNKTAVFFRGYSPSHFRGGEWNSGGHC  426

Query  249  YNETKPIIDVSGMTM---FPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
            + ETKP   +        +P  + KI++  V KMKTP+ YLNIT ++ +RKDAHP+IY +
Sbjct  427  HGETKPTTKMESTEYGGEYPSNM-KILDSVVKKMKTPIFYLNITTMTDFRKDAHPSIYRK  485

Query  78   KNGKQIIEKKLNPEETYSDCSHWCLP  1
             N   + E++  P     DCSHWCLP
Sbjct  486  PN---LTEEERKP-PMIQDCSHWCLP  507



>ref|XP_002308359.2| hypothetical protein POPTR_0006s20840g [Populus trichocarpa]
 gb|EEE91882.2| hypothetical protein POPTR_0006s20840g [Populus trichocarpa]
Length=611

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 88/148 (59%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF+ A+ TW +W+D N+DP ++ VFFR  S  H  G  W     C
Sbjct  444  YQEGNHVYNELNVLEAFRKALTTWARWVDANVDPMKSLVFFRGYSASHFSGGQWNSGGQC  503

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +E +PI +V+ +  +P P   ++E+ +  MKT V YLN+T+++ YRKD HP++Y ++N 
Sbjct  504  DSEAEPIKNVTYLRQYP-PKMLVLEKVLRNMKTHVTYLNVTQMTDYRKDGHPSVYRKQN-  561

Query  69   KQIIEKKLNPEET-----YSDCSHWCLP  1
                   L+PEE      + DCSHWCLP
Sbjct  562  -------LSPEERKSPLHFQDCSHWCLP  582



>ref|XP_009376704.1| PREDICTED: protein trichome birefringence-like 4 [Pyrus x bretschneideri]
Length=621

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 88/146 (60%), Gaps = 14/146 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+++++AF+ A+ TW +WID N++P +T VFFR  SP H +G  W     C
Sbjct  447  YQEGSHIYGELKVDNAFRKALTTWARWIDTNVNPKKTAVFFRGYSPSHFRGGAWNSGGHC  506

Query  249  YNETKPIIDVSGMTM---FPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
            + ETKP   +        +P  + KI++  +  MKTPV YLNIT ++ +RKDAHP+IY +
Sbjct  507  HGETKPTTSLESTEYGGEYPTNM-KILDSVLKGMKTPVNYLNITTMTDFRKDAHPSIYRK  565

Query  78   KNGKQIIEKKLNPEETYSDCSHWCLP  1
             N   + E++  P     DCSHWCLP
Sbjct  566  PN---LTEEERKP-PMIQDCSHWCLP  587



>gb|EMS61403.1| hypothetical protein TRIUR3_19587 [Triticum urartu]
Length=744

 Score =   116 bits (290),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 59/142 (42%), Positives = 87/142 (61%), Gaps = 10/142 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF  A+ TW +WID N++P +TTV FR  S  H  G  W     C
Sbjct  488  YQEGSHIYSELNVVDAFHKALITWSRWIDGNVNPKKTTVMFRGYSASHFSGGQWNSGGSC  547

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   ++ +P P   I+E  + KM+TPV YLNIT+L+ YRKDAHP+IY +++ 
Sbjct  548  DKETEPIKNEQYLSTYP-PKMSILEDVIHKMRTPVVYLNITRLTDYRKDAHPSIYRKQHL  606

Query  69   KQIIEKKLNPEETYSDCSHWCL  4
             +  E++ +PE  Y DCSHW +
Sbjct  607  SE--EERRSPER-YQDCSHWIM  625



>ref|XP_006429897.1| hypothetical protein CICLE_v10011263mg [Citrus clementina]
 gb|ESR43137.1| hypothetical protein CICLE_v10011263mg [Citrus clementina]
Length=644

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 85/143 (59%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TW +W+D N++P ++ VFFR  S  H  G  W     C
Sbjct  475  YQEGSHVYGELNVLEAFRRALTTWARWVDANVNPMKSMVFFRGYSASHFSGGQWNSGGAC  534

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P P  K++E  +  MKT V YLNIT+L+ YRKD HP+IY +   
Sbjct  535  DHETEPIKNKTYLTAYP-PKMKVLESVLKGMKTHVTYLNITRLTDYRKDGHPSIYRK---  590

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            + I + +      Y DCSHWCLP
Sbjct  591  QHISDAERRSPLRYQDCSHWCLP  613



>ref|XP_006492844.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=644

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 85/143 (59%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TW +W+D N++P ++ VFFR  S  H  G  W     C
Sbjct  475  YQEGSHVYGELNVLEAFRRALTTWARWVDANVNPMKSMVFFRGYSASHFSGGQWNSGGAC  534

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P P  K++E  +  MKT V YLNIT+L+ YRKD HP+IY +   
Sbjct  535  DHETEPIKNKTYLTAYP-PKMKVLESVLKGMKTHVTYLNITRLTDYRKDGHPSIYRK---  590

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            + I + +      Y DCSHWCLP
Sbjct  591  QHISDAERRSPLRYQDCSHWCLP  613



>ref|XP_004143065.1| PREDICTED: uncharacterized protein LOC101210768 [Cucumis sativus]
 ref|XP_004159591.1| PREDICTED: uncharacterized LOC101210768 [Cucumis sativus]
 gb|KGN62305.1| hypothetical protein Csa_2G348910 [Cucumis sativus]
Length=553

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++++  AFK A+ TWG+WID+N+D   T VFFR  S  H  G  W     C
Sbjct  391  YQEGNHVHSKLKVLEAFKRALTTWGRWIDNNVDKNRTLVFFRGYSYSHFSGGEWNSGGQC  450

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI + + +  +P+ +R + E  + +MKTPV YLNIT+L+ YRKDAHP+IY R   
Sbjct  451  NIETEPIYNKTHLGKYPKKMRAL-EYVIQEMKTPVSYLNITRLTHYRKDAHPSIY-RMEY  508

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K   EK+        DCSHWCLP
Sbjct  509  KTEAEKRAGLR--VQDCSHWCLP  529



>ref|XP_008352647.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=356

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + D + ++ AF+ A+ TW +W+D NI+P +T VFFR  SP H +G  W     C
Sbjct  184  YQEGSYIYDVLNVKEAFRKALTTWARWVDTNINPEKTIVFFRGFSPNHFRGGRWNSGGQC  243

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            ++  +P+   +    +   LR I +  ++ MKTP+ YLNIT+++ +R+DAHP+IY ++N 
Sbjct  244  HDLIEPLAKETNRGKYASKLR-IFDSVITGMKTPIFYLNITRMTDFRRDAHPSIYRKQNF  302

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             +  E++ +P   + DCSHWCLP
Sbjct  303  TE--EERKSPLR-HQDCSHWCLP  322



>ref|XP_010536111.1| PREDICTED: protein ESKIMO 1-like isoform X2 [Tarenaya hassleriana]
Length=444

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 80/139 (58%), Gaps = 10/139 (7%)
 Frame = -1

Query  387  DEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKP  232
            DE+   +A++  M+TWG W+D NIDP  TTVFF S+SP H +   W       C  E  P
Sbjct  288  DEIERSAAYERVMKTWGDWVDQNIDPNRTTVFFNSMSPLHIKSLDWENPDGIKCALERMP  347

Query  231  IIDVSGMTMFPEPLR--KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
            I+++S         R   I E     +K PV +LNIT+LS+YRKDAH ++Y  + GK + 
Sbjct  348  ILNMSMPFNVGTDYRLFSIAENVTHSLKVPVHFLNITRLSEYRKDAHTSVYTIRQGKMMT  407

Query  57   EKKLNPEETYSDCSHWCLP  1
             ++     TY+DC HWCLP
Sbjct  408  SEQQADPTTYADCIHWCLP  426



>gb|EEE64866.1| hypothetical protein OsJ_19723 [Oryza sativa Japonica Group]
Length=661

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGRHWCYNETKPIIDVSG-MT  208
            EM  E AF  A++TW +W+D N+D  +T VFFRSISPEH+ ++WCYNET P+      + 
Sbjct  266  EMGAEEAFNRALRTWTRWLDRNVDSHKTMVFFRSISPEHKNKNWCYNETAPMARAEEYVE  325

Query  207  MFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEK  52
             FP  +  IVER V + +T V YL+IT+LS+ R+DAHP+++     K+ ++K
Sbjct  326  AFPRGMVSIVERNVRRARTAVGYLDITRLSELRRDAHPSVFTPSTRKRDVKK  377



>ref|XP_011078818.1| PREDICTED: protein trichome birefringence-like [Sesamum indicum]
Length=634

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 91/143 (64%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+W+D NI+ T+T VFFR  S  H  G  W     C
Sbjct  468  YQEGSHVYGELNVLEAFRKAITTWGRWVDANINQTKTLVFFRGYSASHFSGGQWNSGGQC  527

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + ++ +P P   +VE+ +  +KTPV YLNIT+++ YRKD HP++Y +++ 
Sbjct  528  DHETEPIKNETYLSQYP-PKMTVVEKVLKGIKTPVTYLNITRMTDYRKDGHPSMYRKQHM  586

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++ +P  ++ DCSHWCLP
Sbjct  587  SD--EERRSP-LSFQDCSHWCLP  606



>ref|XP_010536034.1| PREDICTED: protein ESKIMO 1-like isoform X1 [Tarenaya hassleriana]
Length=455

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 80/139 (58%), Gaps = 10/139 (7%)
 Frame = -1

Query  387  DEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKP  232
            DE+   +A++  M+TWG W+D NIDP  TTVFF S+SP H +   W       C  E  P
Sbjct  299  DEIERSAAYERVMKTWGDWVDQNIDPNRTTVFFNSMSPLHIKSLDWENPDGIKCALERMP  358

Query  231  IIDVSGMTMFPEPLR--KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
            I+++S         R   I E     +K PV +LNIT+LS+YRKDAH ++Y  + GK + 
Sbjct  359  ILNMSMPFNVGTDYRLFSIAENVTHSLKVPVHFLNITRLSEYRKDAHTSVYTIRQGKMMT  418

Query  57   EKKLNPEETYSDCSHWCLP  1
             ++     TY+DC HWCLP
Sbjct  419  SEQQADPTTYADCIHWCLP  437



>ref|XP_011005287.1| PREDICTED: protein trichome birefringence-like [Populus euphratica]
Length=624

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 88/148 (59%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF+ A+ TW +W+D N+DP ++ VFFR  S  H  G  W     C
Sbjct  457  YQEGSHVYNELNVLEAFRKALTTWARWVDANVDPMKSLVFFRGYSASHFSGGQWNSGGQC  516

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +E +PI +V+ +  +P P   ++E+ +  MKT V YLN+T+++ YRKD HP++Y +   
Sbjct  517  DSEVEPIKNVTFLRQYP-PKMLVLEKVLRNMKTHVTYLNVTQMTDYRKDGHPSVYRK---  572

Query  69   KQIIEKKLNPEET-----YSDCSHWCLP  1
                 +KL+PEE      + DCSHWCLP
Sbjct  573  -----QKLSPEERKSPLHFQDCSHWCLP  595



>ref|XP_010268038.1| PREDICTED: protein trichome birefringence-like 4 [Nelumbo nucifera]
Length=467

 Score =   113 bits (283),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 54/143 (38%), Positives = 82/143 (57%), Gaps = 13/143 (9%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            FQ  + +  ++ +  A+  A+ TW +W+D NID   T VFFR  S  H +G  W     C
Sbjct  312  FQEGDHVHSKLGVAEAYTKALHTWARWVDGNIDSDRTRVFFRGYSASHFRGGQWSSGGNC  371

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             NET+PI + S +  +P+ +  I+E  + +M+TPV YLN+T+++ YRKD HP+I+ +  G
Sbjct  372  ENETQPITNSSYLAPYPQ-MMNILESVIREMRTPVFYLNVTRMTDYRKDGHPSIFRQPKG  430

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             +             DCSHWCLP
Sbjct  431  HR------QAAGMIQDCSHWCLP  447



>ref|XP_009392183.1| PREDICTED: protein trichome birefringence-like 2 [Musa acuminata 
subsp. malaccensis]
Length=718

 Score =   115 bits (288),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 56/133 (42%), Positives = 88/133 (66%), Gaps = 10/133 (8%)
 Frame = -1

Query  381  MRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----CYNETKPIIDV  220
            +++  A+K A+ TW +WID NID ++T V FR  S  H +G  W     C+ ET+PI + 
Sbjct  566  LKVMEAYKKALTTWSRWIDMNIDSSKTQVVFRGYSLTHFRGGQWNSGGQCHKETEPIFNQ  625

Query  219  SGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNP  40
            S ++ +P  +R +VE+ + + +TPV YLNI++L+ YRKD HP+IY +K     +E+++  
Sbjct  626  SYLSKYPSKMR-VVEQILKQTRTPVIYLNISRLTDYRKDGHPSIYRKK--YMSVEEQIAA  682

Query  39   EETYSDCSHWCLP  1
            E++  DCSHWCLP
Sbjct  683  EKS-QDCSHWCLP  694



>ref|XP_008363352.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=342

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 84/146 (58%), Gaps = 14/146 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ ++ AF+ A+ TW  WID N++P +T VFFR  SP H +G  W     C
Sbjct  168  YQEGSHIYGELNVDDAFRKALTTWAXWIDTNVNPKKTAVFFRGYSPSHFRGGAWNSGGHC  227

Query  249  YNETKPIIDVSGM---TMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
            + ETKP   +        +P  + KI +  +  MKTPV YLNIT ++ +RKDAHP+IY +
Sbjct  228  HGETKPTTSLESTEYGGAYPTNM-KIFDSVLKGMKTPVNYLNITTMTDFRKDAHPSIYRK  286

Query  78   KNGKQIIEKKLNPEETYSDCSHWCLP  1
             N  +  E++  P     DCSHWCLP
Sbjct  287  PNLTE--EERKXP--MIXDCSHWCLP  308



>gb|KDO61978.1| hypothetical protein CISIN_1g023751mg [Citrus sinensis]
Length=278

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (63%), Gaps = 18/131 (14%)
 Frame = -1

Query  366  AFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----CYNETKPIIDVSGMTM  205
            A++ A++TWGKWIDDNI P++  VF+R  S  H +G  W     C  ET+PI   SG  +
Sbjct  133  AYRRALKTWGKWIDDNIKPSKQLVFYRGYSSAHFRGGDWDSGGSCNGETEPIF--SGPFL  190

Query  204  FPEPLR-KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARK--NGKQIIEKKLNPEE  34
               PL+ KIVE  + +M+ PV  LN+T+L+ YRKD HP+IY +   +GK+I  ++     
Sbjct  191  DSYPLKMKIVEEVIQEMRNPVILLNVTRLTNYRKDGHPSIYGQNVTDGKKISRRR-----  245

Query  33   TYSDCSHWCLP  1
               DCSHWCLP
Sbjct  246  --QDCSHWCLP  254



>ref|XP_004296154.1| PREDICTED: uncharacterized protein LOC101303316 [Fragaria vesca 
subsp. vesca]
Length=520

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + + D++ ++ A+  A+ TW +W+D NI+P +T VFFR  SP H  G  W     C
Sbjct  361  YQEGDHVYDQLNVKEAYGKAIATWARWLDANINPEKTIVFFRGYSPNHFSGGRWNTGGQC  420

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            +  T+PI   +    +P  +R I++  + +MKTP+ YLNITK++ +R+DAHP++Y ++N 
Sbjct  421  HGRTEPIQYEAYKGKYPAKMR-ILDSVIREMKTPIFYLNITKMTDFRRDAHPSVYRKQN-  478

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E+         DCSHWCLP
Sbjct  479  --LTEEDRQLSLRSQDCSHWCLP  499



>ref|XP_007157368.1| hypothetical protein PHAVU_002G064300g [Phaseolus vulgaris]
 gb|ESW29362.1| hypothetical protein PHAVU_002G064300g [Phaseolus vulgaris]
Length=518

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 9/143 (6%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +   +++  A+  A+ TW KWID+NID   T VFFR  S  H +G  W     C
Sbjct  355  YQEGNHIYPRLKVLDAYTRALTTWAKWIDNNIDANRTQVFFRGYSVTHFRGGQWNSGGQC  414

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI D   +  +P  +R +    + KMKTPV Y+NI++L+ YRKD HP+IY R   
Sbjct  415  HKETEPITDGKHLRKYPSKMRALEHVVIPKMKTPVIYMNISRLTDYRKDGHPSIY-RMEY  473

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K   E+     E + DCSHWCLP
Sbjct  474  KTPEEQA--SAELHQDCSHWCLP  494



>ref|XP_011075105.1| PREDICTED: protein trichome birefringence-like [Sesamum indicum]
Length=616

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ +  AF+ A+ TWG+WID NI+P ++ VFFR  S  H  G  W     C
Sbjct  455  YQEGSHIYKDLNVLEAFRKALTTWGRWIDANINPMKSLVFFRGYSASHFSGGQWNSGGQC  514

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             NET+PI + + +T +P+ +  ++E+ +  MKT V YLN+T+++ YRKD HP+IY +   
Sbjct  515  DNETEPIKNETYLTPYPQKM-TVLEKVLRGMKTHVTYLNVTRMTDYRKDGHPSIYRK---  570

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            + + +++     ++ DCSHWCLP
Sbjct  571  QHLSDEERRSPLSFQDCSHWCLP  593



>ref|XP_003553434.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN45423.1| hypothetical protein glysoja_028430 [Glycine soja]
Length=615

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 88/148 (59%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TW KW+D NI+P++T VFFR  S  H  G  W     C
Sbjct  449  YQEGSHVYAELNVLEAFRRALTTWSKWVDANINPSKTMVFFRGYSASHFSGGQWNSGGQC  508

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET PI +   +T +P+ + K++E+ +  MKT V Y NIT+++ +RKD HP+IY ++N 
Sbjct  509  DSETDPIDNEKYLTEYPDKM-KVLEKVLKNMKTHVTYQNITRMTDFRKDGHPSIYRKQN-  566

Query  69   KQIIEKKLNPEE-----TYSDCSHWCLP  1
                   L+PEE      + DCSHWCLP
Sbjct  567  -------LSPEERKSPLRFQDCSHWCLP  587



>ref|XP_007044711.1| Uncharacterized protein TCM_010432 [Theobroma cacao]
 gb|EOY00543.1| Uncharacterized protein TCM_010432 [Theobroma cacao]
Length=643

 Score =   115 bits (287),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 57/143 (40%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + +   +++  A++ A+ TW +WID N+D +   +FFR  S  H +G  W     C
Sbjct  470  YQEGDYVYPRLKVLKAYQKALTTWSRWIDKNVDSSRAQIFFRGYSVTHFRGGQWNSGGKC  529

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI + + +T +P  +R  VE  + K KTPV YLNI++L+ YRKDAHP+IY R+  
Sbjct  530  HQETEPISNETYLTKYPSKMRA-VELVLQKTKTPVIYLNISRLTDYRKDAHPSIYRREYK  588

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++ N      DCSHWCLP
Sbjct  589  T---EEERNAAVRVQDCSHWCLP  608



>ref|XP_008221854.1| PREDICTED: protein trichome birefringence-like 2 [Prunus mume]
Length=620

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 83/133 (62%), Gaps = 10/133 (8%)
 Frame = -1

Query  381  MRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----CYNETKPIIDV  220
            +++  A+K A+ TW +W+D NID   T VFFR  S  H  G  W     C+ E +PI + 
Sbjct  468  LKVLKAYKRALTTWARWVDKNIDVKRTQVFFRGYSVTHFSGGQWNSGGQCHKEAEPIFNE  527

Query  219  SGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNP  40
            + +  +P  +R + E  + +MKTPV YLNI+KL+ YRKD HP+IY  K   + +E+++  
Sbjct  528  TYLGNYPSKMRAL-EHVLQEMKTPVTYLNISKLTDYRKDGHPSIYRMK--YKTVEEQITA  584

Query  39   EETYSDCSHWCLP  1
            E++  DCSHWCLP
Sbjct  585  EQS-QDCSHWCLP  596



>ref|XP_004493599.1| PREDICTED: uncharacterized protein LOC101511851 [Cicer arietinum]
Length=617

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 88/148 (59%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + DE+ +  AF+ A+ TW +W+D N++P+++ V FR  S  H  G  W     C
Sbjct  451  YQEGSHVYDELNVLEAFRRAITTWSRWVDANVNPSKSIVLFRGYSASHFSGGQWNSGGQC  510

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET PI +   +T +P P  +++E+ ++ MKT V YLNIT+++ +RKD HP+IY + N 
Sbjct  511  DSETAPIDNEKYLTEYP-PKMRVLEKVLNNMKTHVTYLNITRMTDFRKDGHPSIYRKHN-  568

Query  69   KQIIEKKLNPEET-----YSDCSHWCLP  1
                   L+PEE      + DCSHWCLP
Sbjct  569  -------LSPEEQKSPLRFQDCSHWCLP  589



>ref|XP_009375160.1| PREDICTED: protein trichome birefringence-like [Pyrus x bretschneideri]
Length=454

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + D + ++ AF+ A+ TW +W+D N++P +T VFFR+ SP H +G  W     C
Sbjct  282  YQEGSYIYDVLNVKEAFRKALTTWARWVDTNLNPEKTIVFFRAYSPNHFRGGRWNSGGQC  341

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            ++  +P+   +    +   LR I +  ++ MKTP+ YLNIT+++ +R+DAHP+IY ++N 
Sbjct  342  HDLIEPLAKETTRGKYASKLR-IFDSVITGMKTPIFYLNITRMTDFRRDAHPSIYRKQN-  399

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++      Y DCSHWCLP
Sbjct  400  --FTEEERKSPFRYQDCSHWCLP  420



>ref|XP_004249290.1| PREDICTED: protein trichome birefringence-like [Solanum lycopersicum]
Length=578

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF+ A+ TWG+WID +I+P +T V FR  S  H  G  W     C
Sbjct  413  YQEGNHVYNELNVLEAFRRALTTWGRWIDAHINPKKTFVLFRGYSASHFSGGQWNSGGAC  472

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++E     MKT V YLNIT+++ YRKD HP+IY + N 
Sbjct  473  DSETEPIKNDTYLTPYPSKM-KVLEDVFKGMKTQVSYLNITRMTDYRKDGHPSIYRKPN-  530

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              +  K+   +  Y DCSHWCLP
Sbjct  531  --LTLKERRSQWRYQDCSHWCLP  551



>ref|XP_007221982.1| hypothetical protein PRUPE_ppa002834mg [Prunus persica]
 gb|EMJ23181.1| hypothetical protein PRUPE_ppa002834mg [Prunus persica]
Length=629

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 83/133 (62%), Gaps = 10/133 (8%)
 Frame = -1

Query  381  MRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----CYNETKPIIDV  220
            +++  A+K A+ TW +W+D NID   T VFFR  S  H  G  W     C+ E +PI + 
Sbjct  477  LKVLEAYKRALTTWARWVDKNIDVKRTQVFFRGYSVTHFSGGQWNSGGQCHKEAEPIFNE  536

Query  219  SGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNP  40
            + +  +P  +R + E  + +MKTPV YLNI+KL+ YRKD HP+IY  K   + +E+++  
Sbjct  537  TYLGNYPSKMRAL-EHVLQEMKTPVTYLNISKLTDYRKDGHPSIYRMK--YKTVEEQITA  593

Query  39   EETYSDCSHWCLP  1
            E++  DCSHWCLP
Sbjct  594  EQS-QDCSHWCLP  605



>ref|XP_008804141.1| PREDICTED: protein trichome birefringence-like 33 [Phoenix dactylifera]
Length=451

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 88/138 (64%), Gaps = 11/138 (8%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ-GRHW-------CYNETKPI  229
            EM  E A++LA+++  +W++ N++P +T VFF S+SP H+    W       C+NET PI
Sbjct  298  EMETEQAYRLALRSMVRWVEKNMNPGKTRVFFTSMSPAHERSMEWGGEPDGNCHNETTPI  357

Query  228  IDVSGMTMFP--EPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            +D      F   + + ++V++ +SK K P+  LNIT+LS+YRKDAH +IY ++  K   E
Sbjct  358  LDNPAYWGFASSKSIMQVVKKVLSKSKVPIMVLNITQLSEYRKDAHTSIYKKQWNKLTPE  417

Query  54   KKLNPEETYSDCSHWCLP  1
            +  NP  +Y+DC HWCLP
Sbjct  418  QLANP-RSYADCVHWCLP  434



>ref|XP_009417662.1| PREDICTED: protein trichome birefringence-like [Musa acuminata 
subsp. malaccensis]
Length=719

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 56/143 (39%), Positives = 84/143 (59%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ + +AF  A+ TW KW+D N++   + VFFR  S  H  G  W     C
Sbjct  559  YQEGNHIYSDLNVVNAFHKALNTWAKWVDANVNSKNSLVFFRGYSVTHFSGGRWNSGGQC  618

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ET+PI +   ++ +P  +  ++E  +  MKTPV YLNIT ++ YRKDAHP+IY ++N 
Sbjct  619  DKETEPIKNEKYLSSYPWKM-TVLESVIKGMKTPVAYLNITTMTDYRKDAHPSIYRKQN-  676

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++    E Y DCSHWCLP
Sbjct  677  --LTEEERRSPERYQDCSHWCLP  697



>ref|XP_008361466.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=621

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 86/146 (59%), Gaps = 14/146 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ ++ AF+ A+ TW +WID N++P +T VFFR  SP H +G  W     C
Sbjct  447  YQEGSHIYGELDVDDAFRKALSTWARWIDTNVNPKKTAVFFRGYSPSHFRGGEWNSGGHC  506

Query  249  YNETKPIIDVSGMTM---FPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
            + ETKP   +        +P  + KI++  +  MKTPV YLNIT ++ +RKDAHP+IY +
Sbjct  507  HGETKPTTSLESTEYGGEYPTNM-KILDSVLKGMKTPVNYLNITTMTDFRKDAHPSIYRK  565

Query  78   KNGKQIIEKKLNPEETYSDCSHWCLP  1
             N   + E++  P     DCSHWCLP
Sbjct  566  PN---LTEEERKP-PMIQDCSHWCLP  587



>ref|XP_006351352.1| PREDICTED: uncharacterized protein LOC102598735 isoform X2 [Solanum 
tuberosum]
Length=656

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF+ A+ TWG+WID +I+P +T V FR  S  H  G  W     C
Sbjct  491  YQEGNHVHNELNVLEAFRRALTTWGRWIDAHINPKKTFVLFRGYSASHFSGGQWNSGGAC  550

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++E     MKT V YLNIT+++ YRKD HP+IY + N 
Sbjct  551  DSETEPIKNDTYLTPYPSKM-KVLEDVFKGMKTQVSYLNITRMTDYRKDGHPSIYRKPN-  608

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              +  K+   +  Y DCSHWCLP
Sbjct  609  --LTLKERRSQWRYQDCSHWCLP  629



>gb|EPS68903.1| hypothetical protein M569_05864, partial [Genlisea aurea]
Length=372

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 80/144 (56%), Gaps = 17/144 (12%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH--QGRHW-----  253
            +Q  +++  ++ + +AF+ A+ TW  W+DDNID   T +FFRS +P H   G  W     
Sbjct  222  YQVGDRVIPQLDVMAAFRRAVSTWASWVDDNIDGNRTQIFFRSSAPSHFRGGGAWNTGGH  281

Query  252  CYNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKN  73
            C     PIID    + +PE    + E    KMKTPV  LN+T+LS+YR DAHP+IY    
Sbjct  282  CREARNPIIDDESSSDYPEKDLIVEEIIRKKMKTPVTVLNVTRLSEYRPDAHPSIYGGGR  341

Query  72   GKQIIEKKLNPEETYSDCSHWCLP  1
             +Q       P E   DCSHWCLP
Sbjct  342  RRQ-------PSE---DCSHWCLP  355



>ref|XP_006351351.1| PREDICTED: uncharacterized protein LOC102598735 isoform X1 [Solanum 
tuberosum]
Length=713

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF+ A+ TWG+WID +I+P +T V FR  S  H  G  W     C
Sbjct  548  YQEGNHVHNELNVLEAFRRALTTWGRWIDAHINPKKTFVLFRGYSASHFSGGQWNSGGAC  607

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  + K++E     MKT V YLNIT+++ YRKD HP+IY + N 
Sbjct  608  DSETEPIKNDTYLTPYPSKM-KVLEDVFKGMKTQVSYLNITRMTDYRKDGHPSIYRKPN-  665

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              +  K+   +  Y DCSHWCLP
Sbjct  666  --LTLKERRSQWRYQDCSHWCLP  686



>ref|XP_010554669.1| PREDICTED: protein ESKIMO 1-like [Tarenaya hassleriana]
Length=500

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 82/139 (59%), Gaps = 10/139 (7%)
 Frame = -1

Query  387  DEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKP  232
            +E+   +A+   ++TWG W+D NIDP  TTVFF S+SP H +   W       C  ET+P
Sbjct  340  EEIERPTAYGRVLKTWGDWVDQNIDPNHTTVFFSSMSPLHIKSLDWENPDGIKCALETRP  399

Query  231  IIDVSGMTMFPEPLR--KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
            I+++S         R   + +     +K PVR+LNIT+LS+YRKDAH ++Y  + GK + 
Sbjct  400  ILNMSMPFSVGTDYRLFAVAKNVTHSLKVPVRFLNITRLSEYRKDAHTSVYTIRQGKMLT  459

Query  57   EKKLNPEETYSDCSHWCLP  1
             ++     TY+DC HWCLP
Sbjct  460  AEQQADPTTYADCIHWCLP  478



>ref|XP_006453211.1| hypothetical protein CICLE_v10008256mg [Citrus clementina]
 gb|ESR66451.1| hypothetical protein CICLE_v10008256mg [Citrus clementina]
Length=454

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (63%), Gaps = 18/131 (14%)
 Frame = -1

Query  366  AFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----CYNETKPIIDVSGMTM  205
            A++ A++TWGKWIDDNI P++  VF+R  S  H +G  W     C  ET+PI   SG  +
Sbjct  309  AYRRALKTWGKWIDDNIKPSKQLVFYRGYSSAHFRGGDWDSGGSCNGETEPIF--SGPFL  366

Query  204  FPEPLR-KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARK--NGKQIIEKKLNPEE  34
               PL+ KIVE  + +M+ PV  LN+T+L+ YRKD HP+IY +   +GK+I  ++     
Sbjct  367  DSYPLKMKIVEEVIQEMRNPVILLNVTRLTNYRKDGHPSIYGQNVTDGKKISRRR-----  421

Query  33   TYSDCSHWCLP  1
               DCSHWCLP
Sbjct  422  --QDCSHWCLP  430



>ref|XP_002323329.2| hypothetical protein POPTR_0016s05930g [Populus trichocarpa]
 gb|EEF05090.2| hypothetical protein POPTR_0016s05930g [Populus trichocarpa]
Length=592

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 88/148 (59%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + DE+ +  AF+ A+ TW +W+D N++P ++ V FR  S  H  G  W     C
Sbjct  426  YQEGSHVYDELNVLEAFRKALTTWARWVDANVNPMKSLVLFRGYSASHFSGGQWNSGGQC  485

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +E +PI +V+ +  +P P   ++E+ +  MKT VRYLN+T+++ +RKD HP++Y ++N 
Sbjct  486  DSEVEPIKNVTYLREYP-PKMLVLEKVLRNMKTHVRYLNVTQMTDFRKDGHPSVYRKQN-  543

Query  69   KQIIEKKLNPEE-----TYSDCSHWCLP  1
                   L+PEE      + DCSHWCLP
Sbjct  544  -------LSPEERKSPLLFQDCSHWCLP  564



>ref|XP_011100832.1| PREDICTED: protein trichome birefringence-like 4 [Sesamum indicum]
Length=463

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 83/143 (58%), Gaps = 14/143 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            FQ    +  ++ +  A+K A++TW +W+D NI+   T VFFR  S  H +G  W     C
Sbjct  302  FQEGNHVYRKLEVADAYKKALRTWARWVDANINSNRTRVFFRGYSSSHFKGGQWNSGGSC  361

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            Y E KPI + + +  +P  +   +E  +SKMKTPV +LNITK++ YRKD HP+I+  K  
Sbjct  362  YGEMKPITNETHLAPYPW-MMVALESVISKMKTPVFFLNITKMTDYRKDGHPSIF--KQS  418

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
               I + +     + DCSHWCLP
Sbjct  419  ASTIRQGM-----FQDCSHWCLP  436



>ref|XP_008352661.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=563

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + D + ++ AF+ A+ TW +W+D NI+P +T VFFR  SP H +G  W     C
Sbjct  391  YQEGSYIYDVLNVKEAFRXALTTWARWVDTNINPEKTIVFFRGFSPNHFRGGRWNSGGQC  450

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            ++  +P+   +    +   LR I +  ++ MKTP+ YLNIT+++ +R+DAHP+IY ++N 
Sbjct  451  HDLIEPLAKETNRGKYASKLR-IXDSVITGMKTPIFYLNITRMTDFRRDAHPSIYRKQN-  508

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++      + DCSHWCLP
Sbjct  509  --FTEEEXKSPLRHQDCSHWCLP  529



>ref|XP_008363351.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=563

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + D + ++ AF+ A+ TW +W+D NI+P +T VFFR  SP H +G  W     C
Sbjct  391  YQEGSYIYDVLNVKEAFRXALTTWARWVDTNINPEKTIVFFRGFSPNHFRGGRWNSGGQC  450

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            ++  +P+   +    +   LR I +  ++ MKTP+ YLNIT+++ +R+DAHP+IY ++N 
Sbjct  451  HDLIEPLAKETNRGKYASKLR-IFDSVITGMKTPIFYLNITRMTDFRRDAHPSIYRKQN-  508

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++      + DCSHWCLP
Sbjct  509  --FTEEERKSPLRHQDCSHWCLP  529



>ref|XP_006474304.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=490

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (63%), Gaps = 18/131 (14%)
 Frame = -1

Query  366  AFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----CYNETKPIIDVSGMTM  205
            A++ A++TWGKWIDDNI P++  VF+R  S  H +G  W     C  ET+PI   SG  +
Sbjct  345  AYRRALKTWGKWIDDNIKPSKQLVFYRGYSSAHFRGGDWDSGGSCNGETEPIF--SGPFL  402

Query  204  FPEPLR-KIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARK--NGKQIIEKKLNPEE  34
               PL+ KIVE  + +M+ PV  LN+T+L+ YRKD HP+IY +   +GK+I  ++     
Sbjct  403  DSYPLKMKIVEEVIQEMRNPVILLNVTRLTNYRKDGHPSIYGQNVTDGKKISRRR-----  457

Query  33   TYSDCSHWCLP  1
               DCSHWCLP
Sbjct  458  --QDCSHWCLP  466



>ref|XP_004252117.1| PREDICTED: protein trichome birefringence-like 31 [Solanum lycopersicum]
Length=409

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 84/138 (61%), Gaps = 8/138 (6%)
 Frame = -1

Query  390  TDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGR-HW-------CYNETK  235
              E  + +A+KLA++TWG+WI+ NI+P    VFF ++SP H     W       C+NET+
Sbjct  251  VQEYNVTTAYKLALETWGRWIESNINPQRQKVFFATMSPTHLWNWEWKGGIDGNCFNETQ  310

Query  234  PIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIE  55
            PI      T     +  I++  + K++  VR LNIT+LS+YRKD H +++  + GK + +
Sbjct  311  PIEGPYWGTGSNLEIMAILKDVIEKLEVDVRLLNITQLSEYRKDGHTSVFGERRGKLLTK  370

Query  54   KKLNPEETYSDCSHWCLP  1
            ++ +  +TY+DC HWCLP
Sbjct  371  EERSEPKTYADCIHWCLP  388



>gb|EYU39954.1| hypothetical protein MIMGU_mgv1a008556mg [Erythranthe guttata]
Length=369

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 87/143 (61%), Gaps = 16/143 (11%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ +  AF+ A+ TWG+WID N++P ++ VFFR  S  H  G  W     C
Sbjct  210  YQEGSHVYSDLNVLEAFRKALTTWGRWIDANVNPMKSHVFFRGYSASHFSGGQWNSGGQC  269

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + ++ +P  + +I+E+ +  MKT V YLN+T+++ YRKD HP+I+ +++ 
Sbjct  270  DHETEPIKNDTYLSHYPSKM-QILEKVLKGMKTKVTYLNVTRMTDYRKDGHPSIFRKQHS  328

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              +         ++ DCSHWCLP
Sbjct  329  ADL---------SFQDCSHWCLP  342



>ref|XP_008812175.1| PREDICTED: protein trichome birefringence-like 2 [Phoenix dactylifera]
Length=612

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 86/133 (65%), Gaps = 10/133 (8%)
 Frame = -1

Query  381  MRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----CYNETKPIIDV  220
            +++  A+K A+ TW +W+D NI+  +T V FR  S  H +G  W     C+ E +PI + 
Sbjct  460  LKVMEAYKKAITTWARWVDKNINSKQTQVIFRGYSLTHFRGGQWNSGGQCHKEAEPIFNQ  519

Query  219  SGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNP  40
            S +  +P  +R + E+ + +MKTP+ YLNI++L+ YRKD HP+IY +K   Q +E+++  
Sbjct  520  SYLAHYPSKMRAL-EQIIKQMKTPIIYLNISRLTDYRKDGHPSIYRKK--YQSVEEQIAA  576

Query  39   EETYSDCSHWCLP  1
            E+T  DCSHWCLP
Sbjct  577  EKT-QDCSHWCLP  588



>ref|XP_006358947.1| PREDICTED: uncharacterized protein LOC102605235 [Solanum tuberosum]
Length=434

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 84/136 (62%), Gaps = 8/136 (6%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQGR-HW-------CYNETKPI  229
            E  + +A+KLA++TWG WI+ +I+P +  VFF ++SP H     W       C+NET+P+
Sbjct  278  EYNVTTAYKLALETWGSWIESSINPQKQKVFFATMSPTHLWNWEWEGGIDGNCFNETQPV  337

Query  228  IDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKK  49
                  T     +  I++  + K+K  VR LNIT+LS+YRKD H ++Y  + GK + +++
Sbjct  338  EGPYWGTGSNLEIMSILKDVIEKLKVNVRLLNITQLSEYRKDGHTSVYGERRGKLLTKEE  397

Query  48   LNPEETYSDCSHWCLP  1
             +  +TY+DC HWCLP
Sbjct  398  RSEPKTYADCIHWCLP  413



>gb|KHN00372.1| hypothetical protein glysoja_000040 [Glycine soja]
Length=503

 Score =   112 bits (279),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 56/143 (39%), Positives = 80/143 (56%), Gaps = 9/143 (6%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +   +++  A+  A+ TW  W+D+NID   T VFFR  S  H +G  W     C
Sbjct  340  YQVGNHVYPRLKVLDAYTRALTTWATWVDNNIDANRTQVFFRGYSVTHFRGGQWNSGGKC  399

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI +   +  +P  +R      + KMKTPV Y+NI++L+ YRKD HP+IY R   
Sbjct  400  HKETEPISNGKHLRKYPSKMRAFEHVVIPKMKTPVIYMNISRLTDYRKDGHPSIY-RMEY  458

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K   E+     E + DCSHWCLP
Sbjct  459  KTAEEQ--TAAEQHQDCSHWCLP  479



>ref|XP_009604045.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=647

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ +  AF+ A+ TWG+W+D +I+P +T V FR  S  H  G  W     C
Sbjct  482  YQEGSHVHRQLNVVEAFRKALTTWGRWVDAHINPKKTVVLFRGYSASHFSGGQWNSGGAC  541

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  +  ++E+    MKT V YLNIT++S YRKD HP+IY + N 
Sbjct  542  DSETEPIKNDTYLTPYPSKM-TVLEQVFKGMKTQVSYLNITRMSDYRKDGHPSIYRKPN-  599

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + +K+   +  Y DCSHWCLP
Sbjct  600  --LTDKERKSQWRYQDCSHWCLP  620



>ref|XP_002282459.1| PREDICTED: protein trichome birefringence-like 43 [Vitis vinifera]
Length=361

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 83/148 (56%), Gaps = 26/148 (18%)
 Frame = -1

Query  414  VFQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----  253
            V QY+     +M    A+KLAM TWG+WID NID ++T VFF+ ISP+H  G  W     
Sbjct  212  VIQYRRNTYKDMNRLIAYKLAMTTWGRWIDSNIDSSKTQVFFQGISPDHSSGSDWNEPKA  271

Query  252  -CYNETKPIIDVSGMTMFP---EPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIY  85
             C  +T+ +      T +P    P + +VE+ +S+M  PV  LN+T LSQ RKD HP+IY
Sbjct  272  SCRGQTRAVQG----TKYPGGSNPAQVVVEQVLSQMSKPVYLLNVTSLSQLRKDGHPSIY  327

Query  84   ARKNGKQIIEKKLNPEETYSDCSHWCLP  1
                GK+            +DCSHWCLP
Sbjct  328  GY-GGKR-----------GNDCSHWCLP  343



>gb|EYU26676.1| hypothetical protein MIMGU_mgv1a006839mg [Erythranthe guttata]
Length=429

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 84/146 (58%), Gaps = 9/146 (6%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ-GRHW------  253
            F   E+  +E+    ++KL ++TW  W+D N++P +T VFF ++SP HQ    W      
Sbjct  267  FANGEEGYEELDAAVSYKLGLKTWANWVDSNVNPNKTKVFFTTMSPTHQRSADWGNEKGI  326

Query  252  -CYNETKPIIDVSGM-TMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
             C+NET+P+       T   + +  +V   VS+MK PV  LNIT+LS+YR DAH +IY  
Sbjct  327  KCFNETRPVKKKRHWGTGSDKRIMSVVAGVVSRMKVPVTLLNITQLSEYRIDAHSSIYTE  386

Query  78   KNGKQIIEKKLNPEETYSDCSHWCLP  1
              GK + E++      Y+DC HWCLP
Sbjct  387  LGGKLLTEEEKEDPLHYADCIHWCLP  412



>ref|XP_007029023.1| Emb:CAB82953.1, putative [Theobroma cacao]
 gb|EOY09525.1| Emb:CAB82953.1, putative [Theobroma cacao]
Length=650

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 86/143 (60%), Gaps = 7/143 (5%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF+ A+ TW +W+D  ++P ++ VFFR  S  H  G  W     C
Sbjct  480  YQEGSHVYNELNVLEAFRRALTTWARWVDARVNPMKSMVFFRGYSASHFSGGQWNSGGAC  539

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  +  ++E  +  MKT V YLNIT+L+ +RKD HP+IY +   
Sbjct  540  DSETEPIRNETYLTPYPSKML-VLESVLKGMKTHVTYLNITRLTDFRKDGHPSIYRKHQK  598

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +Q+ E++      Y DCSHWCLP
Sbjct  599  QQMSEEERIAPLKYQDCSHWCLP  621



>ref|XP_009783309.1| PREDICTED: protein trichome birefringence-like [Nicotiana sylvestris]
Length=658

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 85/143 (59%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ +  AF+ A+ TWG+W+D +I+P +T V FR  S  H  G  W     C
Sbjct  493  YQEGSHVHSQLNVLEAFRKALTTWGRWVDAHINPKKTIVLFRGYSASHFSGGQWNSGGAC  552

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  +  ++E     MKT V YLNIT++S YRKD HP+IY + N 
Sbjct  553  DSETEPIKNDTYLTPYPSKMT-VLENAFKGMKTQVSYLNITRMSDYRKDGHPSIYRKPN-  610

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + +K+   +  Y DCSHWCLP
Sbjct  611  --LTDKERKSQWRYQDCSHWCLP  631



>ref|XP_010032111.1| PREDICTED: protein trichome birefringence-like 3 [Eucalyptus 
grandis]
Length=429

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = -1

Query  369  SAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKPIIDVSG  214
            +A++LA++TW  WID  IDP  T +FF ++SP H +   W       CYNETKP + V+ 
Sbjct  287  TAYRLALKTWANWIDSAIDPNRTRLFFTTLSPTHIKSEDWGNKNGIKCYNETKPAMKVT-  345

Query  213  MTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNPEE  34
               + + +  +V   V KM+ PV ++NIT+LS+YR D H ++Y    GK + E++     
Sbjct  346  -RSWVDRMPDVVSSIVKKMRVPVTFINITQLSEYRVDGHVSVYGESRGKVLTEEQRADPL  404

Query  33   TYSDCSHWCLP  1
             Y+DC HWCLP
Sbjct  405  RYADCIHWCLP  415



>ref|XP_002311231.2| hypothetical protein POPTR_0008s06990g [Populus trichocarpa]
 gb|EEE88598.2| hypothetical protein POPTR_0008s06990g [Populus trichocarpa]
Length=490

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 82/140 (59%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  DEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKP  232
            DE+    A++  + TW KW++ N+DP  TTVFF S+SP H +   W       C  ET P
Sbjct  334  DEIERPVAYRRVLNTWSKWVEKNVDPNRTTVFFSSMSPLHIKSLDWENPDGIKCAKETAP  393

Query  231  IIDVSGMTMFPEPLRK---IVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQI  61
            I++VS M +     R+   +       MK PV +LNITKLS+YRKDAH +++  + GK +
Sbjct  394  ILNVS-MPLNVGTDRRLFVVAANITGSMKVPVHFLNITKLSEYRKDAHTSVHTIRQGKML  452

Query  60   IEKKLNPEETYSDCSHWCLP  1
              ++    ETY+DC HWCLP
Sbjct  453  TPEQQADPETYADCIHWCLP  472



>emb|CDP10159.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TW +W+D  ++P ++ VFFR  S  H  G  W     C
Sbjct  456  YQEGSHVYSELNVLEAFRKALTTWARWVDAKVNPAKSLVFFRGYSASHFSGGQWNSGGAC  515

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + ++ +P  +  ++E+ +  MKTPV YLN+T+++ YRKD HP++Y +++ 
Sbjct  516  DHETEPIKNETYLSQYPSKM-VVLEKILRNMKTPVSYLNVTRMTDYRKDGHPSVYRKQS-  573

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
              + E++      Y DCSHWCLP
Sbjct  574  --LTEEERRSPLRYQDCSHWCLP  594



>ref|XP_009592544.1| PREDICTED: protein trichome birefringence-like 3 isoform X1 [Nicotiana 
tomentosiformis]
Length=469

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 88/147 (60%), Gaps = 11/147 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ-GRHW------  253
            F+  E+  +E+    ++++A++TW  WID  +DP +T VFF ++SP HQ  + W      
Sbjct  310  FENGEEGYEELDTTVSYRVALRTWANWIDSTVDPKKTRVFFTTMSPSHQKNKEWGNINGI  369

Query  252  -CYNETKPIIDVSGM-TMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
             CYNET+P++      T   + +  +V   + +MK PV  LNIT+LS+YR DAH +IY  
Sbjct  370  RCYNETRPVMKKGHWGTGSNKEMMNVVANVMGRMKVPVTVLNITQLSEYRIDAHTSIYGE  429

Query  78   KNGKQI-IEKKLNPEETYSDCSHWCLP  1
              GK +  E++ NP   ++DC HWCLP
Sbjct  430  LRGKLLTAEQRANPLH-FADCIHWCLP  455



>gb|EYU46810.1| hypothetical protein MIMGU_mgv1a005200mg [Erythranthe guttata]
Length=493

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 83/143 (58%), Gaps = 17/143 (12%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  +++  ++    AF+ ++ TW  WID NI+P +T +FFRS +P H  G  W     C
Sbjct  338  YQEGDQVHPKLDATEAFRRSLSTWASWIDKNINPHKTRIFFRSSAPSHFSGGLWNTGGHC  397

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
                +PI +    T +PE    ++E T+SKM+ PV +LNIT+LS YR DAHP+IY RK  
Sbjct  398  KEAFRPINETFTSTDYPEK-NLVIEETISKMRNPVTFLNITRLSDYRPDAHPSIYGRKT-  455

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                   +NP     DCSHWCLP
Sbjct  456  -------INP--GVQDCSHWCLP  469



>ref|XP_009592552.1| PREDICTED: protein trichome birefringence-like 3 isoform X2 [Nicotiana 
tomentosiformis]
Length=461

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 88/147 (60%), Gaps = 11/147 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ-GRHW------  253
            F+  E+  +E+    ++++A++TW  WID  +DP +T VFF ++SP HQ  + W      
Sbjct  302  FENGEEGYEELDTTVSYRVALRTWANWIDSTVDPKKTRVFFTTMSPSHQKNKEWGNINGI  361

Query  252  -CYNETKPIIDVSGM-TMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
             CYNET+P++      T   + +  +V   + +MK PV  LNIT+LS+YR DAH +IY  
Sbjct  362  RCYNETRPVMKKGHWGTGSNKEMMNVVANVMGRMKVPVTVLNITQLSEYRIDAHTSIYGE  421

Query  78   KNGKQI-IEKKLNPEETYSDCSHWCLP  1
              GK +  E++ NP   ++DC HWCLP
Sbjct  422  LRGKLLTAEQRANPLH-FADCIHWCLP  447



>gb|KCW88139.1| hypothetical protein EUGRSUZ_A00530 [Eucalyptus grandis]
Length=460

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = -1

Query  369  SAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKPIIDVSG  214
            +A++LA++TW  WID  IDP  T +FF ++SP H +   W       CYNETKP + V+ 
Sbjct  318  TAYRLALKTWANWIDSAIDPNRTRLFFTTLSPTHIKSEDWGNKNGIKCYNETKPAMKVT-  376

Query  213  MTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNPEE  34
               + + +  +V   V KM+ PV ++NIT+LS+YR D H ++Y    GK + E++     
Sbjct  377  -RSWVDRMPDVVSSIVKKMRVPVTFINITQLSEYRVDGHVSVYGESRGKVLTEEQRADPL  435

Query  33   TYSDCSHWCLP  1
             Y+DC HWCLP
Sbjct  436  RYADCIHWCLP  446



>ref|XP_008360191.1| PREDICTED: protein trichome birefringence-like 4 [Malus domestica]
Length=544

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 85/146 (58%), Gaps = 14/146 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ ++ AF+ A+ TW +WID N++P +T VFFR  SP H +G  W     C
Sbjct  370  YQEGSHIYGELNVDDAFRKALTTWAQWIDTNVNPKKTAVFFRGYSPSHFRGGAWNSGGHC  429

Query  249  YNETKPIIDVSGMTM---FPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
            + ETKP   +        +P  + KI +  +  MKTPV YLNIT ++ +RKDAHP+IY +
Sbjct  430  HGETKPTTSLESTEYGGEYPTNM-KIFDSVLKGMKTPVNYLNITTMTDFRKDAHPSIYRK  488

Query  78   KNGKQIIEKKLNPEETYSDCSHWCLP  1
             N  +  E++  P     DCSHWCLP
Sbjct  489  PNLTE--EERKXP--MIQDCSHWCLP  510



>ref|XP_003541536.1| PREDICTED: protein YLS7-like [Glycine max]
Length=464

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 81/130 (62%), Gaps = 16/130 (12%)
 Frame = -1

Query  366  AFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----CYNETKPIIDVSGMTM  205
            A++ A++TWGKWIDDNI+P +  V++R  S  H +G  W     CY ET+P  + S +  
Sbjct  320  AYRKAIKTWGKWIDDNINPRKQIVYYRGYSNAHFRGGDWDSGGSCYGETEPAFNGSILNN  379

Query  204  FPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARK--NGKQIIEKKLNPEET  31
            +P  + K+VE  +  MK PV+ LN+TKL+ +RKD HP+++ +    G+++  +K      
Sbjct  380  YPLKM-KVVEEVIRGMKVPVKLLNVTKLTNFRKDGHPSVFGKNTMGGRKVSTRK------  432

Query  30   YSDCSHWCLP  1
              DCSHWCLP
Sbjct  433  -QDCSHWCLP  441



>ref|XP_009364158.1| PREDICTED: protein trichome birefringence-like 1 [Pyrus x bretschneideri]
Length=620

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 85/146 (58%), Gaps = 14/146 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ ++ AF+ A+ TW +WID N++P +T VFFR  SP H +G  W     C
Sbjct  446  YQEGSHIYGELDVDDAFRKALSTWARWIDTNVNPKKTAVFFRGYSPSHFRGGEWNSGGHC  505

Query  249  YNETKPIIDVSGMTM---FPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
            + E KP   +        +P  + KI++  +  MKTPV YLNIT ++ +RKDAHP+IY +
Sbjct  506  HGEIKPTTSLESTEYGGEYPTNM-KILDSVLKGMKTPVNYLNITTMTDFRKDAHPSIYRK  564

Query  78   KNGKQIIEKKLNPEETYSDCSHWCLP  1
             N   + E++  P     DCSHWCLP
Sbjct  565  PN---LTEEERKP-PMIQDCSHWCLP  586



>ref|XP_010259297.1| PREDICTED: protein trichome birefringence-like 6 [Nelumbo nucifera]
Length=504

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 83/143 (58%), Gaps = 15/143 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  +K+   + +  AF+ A+ TW  W+D +I+P +T VFFRS +P H +G  W     C
Sbjct  348  YQEGDKVHPHLDVSVAFRRALITWASWVDKHINPHKTRVFFRSSAPSHFRGGQWNSGGHC  407

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
               T+P+ ++SG+  +PE    I E  + +MKTPV  LNIT LS+YR D HP++Y RK  
Sbjct  408  KEATQPLNNISGIN-YPEK-NIIAEEVIKQMKTPVILLNITNLSEYRIDGHPSVYGRKPD  465

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K           +  DCSHWCLP
Sbjct  466  K-------GSSSSVQDCSHWCLP  481



>ref|XP_002448144.1| hypothetical protein SORBIDRAFT_06g022030 [Sorghum bicolor]
 gb|EES12472.1| hypothetical protein SORBIDRAFT_06g022030 [Sorghum bicolor]
Length=720

 Score =   113 bits (282),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 56/143 (39%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +   + +  A+K A+ TW +W+D NIDP  T V FR  S  H +G  W     C
Sbjct  558  YQEGNHVYPSLDVLDAYKRALVTWARWVDKNIDPRRTQVVFRGYSLSHFRGGQWNSGGRC  617

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI++ + +T +PE +  I+E+ + +MKTPV YLNI+ L+ YRKD HP++Y  +  
Sbjct  618  HTETEPILNQTYLTEYPEKM-VILEQVLRQMKTPVIYLNISALTDYRKDGHPSVYRVRYD  676

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
             +  E+++   +   DCSHWCLP
Sbjct  677  TE--EERMAMVKR-QDCSHWCLP  696



>ref|XP_009757308.1| PREDICTED: protein trichome birefringence-like [Nicotiana sylvestris]
Length=684

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TWG+WID +++P +T V FR  S  H  G  W     C
Sbjct  518  YQEGSHVYSELDVLEAFRKALTTWGRWIDSHVNPHKTFVLFRGYSASHFSGGQWNSGGAC  577

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  +  ++ER +  MKT V YLN+T+++ YRKD HP+IY +   
Sbjct  578  DHETEPIKNNTYLTPYPSKMN-VLERVLRGMKTQVSYLNVTRMTDYRKDGHPSIYRK---  633

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +++  ++   E  + DCSHWCLP
Sbjct  634  QKLTNEEKKSELLFQDCSHWCLP  656



>ref|XP_004296155.1| PREDICTED: uncharacterized protein LOC101303602 [Fragaria vesca 
subsp. vesca]
Length=797

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 83/147 (56%), Gaps = 19/147 (13%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + + DE+  E A++ A+ TWG+W+D  +DP +T VFFR  S  H +G  W     C
Sbjct  632  YQEGDHVYDELNGEEAYRRALSTWGRWLDTKVDPKKTAVFFRGYSLSHFRGAAWNAGGKC  691

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ETKP  +      +P  + KI E  + KMKTP+ YLNIT ++ +RKDAHP+ Y + N 
Sbjct  692  DGETKPTTETEYGGEYPSYV-KIFESVLEKMKTPILYLNITAMTDFRKDAHPSFYRKPN-  749

Query  69   KQIIEKKLNPEE----TYSDCSHWCLP  1
                   L  EE    +  DCSHWCLP
Sbjct  750  -------LTAEERQATSIQDCSHWCLP  769



>ref|XP_010913702.1| PREDICTED: protein trichome birefringence-like 5 [Elaeis guineensis]
Length=485

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 83/145 (57%), Gaps = 16/145 (11%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q  + L  +     AF+ AM+TWGKWID+N+DP    VF+R  S  H +G  W     C
Sbjct  325  YQEGDVLYPQFDAIEAFRRAMRTWGKWIDNNMDPARKLVFYRGYSAAHFRGGDWDSGGTC  384

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA--RK  76
              ET PI   + +  +P  + KIVE  + KM  PV  LN+TKL+ +RKD HP+IY   R 
Sbjct  385  NGETDPISTGALLDSYPLKM-KIVEEVIRKMHFPVILLNVTKLTNFRKDGHPSIYGKTRT  443

Query  75   NGKQIIEKKLNPEETYSDCSHWCLP  1
             G+++ ++K        DCSHWCLP
Sbjct  444  QGQKVSKRK-------QDCSHWCLP  461



>emb|CDP13190.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   112 bits (279),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 14/145 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +   +++  A+K A++TW +W+D +ID T + V FR  S  H  G  W     C
Sbjct  462  YQEGNHVHGRLKVLEAYKRALRTWARWVDKSIDKTRSQVVFRGYSVMHFSGGQWNSRGQC  521

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR--K  76
            + ET+PI++ + +  +P  +R + E  + KM+TPV YLNI++L+ +RKD HP+IY R  K
Sbjct  522  HKETEPILNETYLAKYPSKMRAL-EHLLHKMRTPVVYLNISRLTDFRKDGHPSIYRREYK  580

Query  75   NGKQIIEKKLNPEETYSDCSHWCLP  1
              K+ I  +LN      DCSHWCLP
Sbjct  581  TLKEQIAGELN-----QDCSHWCLP  600



>gb|AES91931.2| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=466

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 83/148 (56%), Gaps = 22/148 (15%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            FQ    + D + +  A + A++TW KW+D  +D T T VFF   S  H +G  W     C
Sbjct  303  FQEGNHVYDRLEVSEALQKALKTWAKWVDSTVDSTRTRVFFTGFSASHYKGGQWNSGGKC  362

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIY-----  85
              E +PI + S +  +P  +  IVE  +++MKTPV YLNITK++ YRKD HP+IY     
Sbjct  363  DGERQPITNESYLAAYPWTM-GIVEDVIAEMKTPVFYLNITKMTDYRKDGHPSIYREPGF  421

Query  84   ARKNGKQIIEKKLNPEETYSDCSHWCLP  1
            +   G+++++          DCSHWCLP
Sbjct  422  SDSKGRKMVQ----------DCSHWCLP  439



>ref|XP_009795769.1| PREDICTED: protein trichome birefringence-like 3 isoform X1 [Nicotiana 
sylvestris]
Length=461

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 86/147 (59%), Gaps = 11/147 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ-GRHW------  253
            F+  E+  +E+    ++++A++TW  WID  +DP +T VFF ++SP HQ  + W      
Sbjct  302  FKNGEEGYEELDTTVSYRIALRTWANWIDSTVDPKKTRVFFTTMSPSHQKNKEWGNINGI  361

Query  252  -CYNETKPIIDVSGM--TMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA  82
             CYNET+P++   G   T   + +  +V   + +MK PV  LNIT+LS+YR DAH +IY 
Sbjct  362  RCYNETRPVMK-KGFWGTGSNKEMMNVVANIIGRMKVPVTVLNITQLSEYRIDAHTSIYG  420

Query  81   RKNGKQIIEKKLNPEETYSDCSHWCLP  1
               GK +  ++      ++DC HWCLP
Sbjct  421  ELQGKLLTAEQRADPLHFADCIHWCLP  447



>gb|KDP24643.1| hypothetical protein JCGZ_25559 [Jatropha curcas]
Length=638

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 86/148 (58%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF+ A+ TW +W+D N++P ++ VFFR  S  H  G  W     C
Sbjct  471  YQEGSHIYNELNVLEAFRKALTTWARWVDHNVNPMKSLVFFRGYSASHFSGGQWNSGGAC  530

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +E +PI + + +  +P P   ++ER +  MKT V YLN+T+++ YRKD HP+IY ++N 
Sbjct  531  DSEVEPINNATYLRQYP-PKMLVLERVLRGMKTHVTYLNVTQMTDYRKDGHPSIYRKRN-  588

Query  69   KQIIEKKLNPEET-----YSDCSHWCLP  1
                   + PEE      + DCSHWCLP
Sbjct  589  -------IPPEERKSPLHFQDCSHWCLP  609



>emb|CCI55362.1| PH01B035L11.7 [Phyllostachys edulis]
Length=696

 Score =   112 bits (280),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 58/143 (41%), Positives = 83/143 (58%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +   + +  AFK A+ TW +W+D NID   T V FR  S  H +G  W     C
Sbjct  534  YQEGNHVYPSLEVTDAFKKALTTWARWVDKNIDSRRTQVVFRGYSLAHFRGGQWNSGGKC  593

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI + + +T +PE +R I+E+ + +MKTPV YLNI+ L+ YRKD HP++Y     
Sbjct  594  HRETEPIFNQTYLTAYPEKMR-ILEQVLRQMKTPVIYLNISTLTDYRKDGHPSVYRVWYN  652

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++     T  DCSHWCLP
Sbjct  653  T---EEERMAAVTKQDCSHWCLP  672



>gb|KDP44745.1| hypothetical protein JCGZ_01245 [Jatropha curcas]
Length=376

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 84/140 (60%), Gaps = 12/140 (9%)
 Frame = -1

Query  387  DEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKP  232
            DE++   A++  ++TW KW+++N+DP  T+VFF S+ P+H +   W       C+ ET P
Sbjct  220  DEIQRHIAYEKVLRTWAKWVEENVDPNHTSVFFSSMFPQHLRSSDWKNPDGINCFEETMP  279

Query  231  IIDVSGMTMFP--EPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
            I+++S        + +  I    +  MK P+ +LNIT LS+YRKDAH +IY    GK + 
Sbjct  280  ILNISTPVDVSTDKQVFAIARNVIESMKIPIHFLNITTLSEYRKDAHTSIYTSHGGKLLS  339

Query  57   -EKKLNPEETYSDCSHWCLP  1
             E+K NP   Y+DC HWCLP
Sbjct  340  PEQKSNPA-IYADCLHWCLP  358



>ref|XP_006362212.1| PREDICTED: uncharacterized protein LOC102599885 [Solanum tuberosum]
Length=691

 Score =   112 bits (279),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/143 (38%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + +E+ +  AF+ A+ TWG+W+D +++P +T V FR  S  H  G  W     C
Sbjct  525  YQEGSHVYNELDVLEAFRKALTTWGRWVDSHVNPKKTFVLFRGYSASHFSGGQWNSGGAC  584

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET+PI + + +T +P  +  ++ER +  MKT V YLNIT+++ +RKD HP++Y ++  
Sbjct  585  DHETEPIKNTTYLTPYPSKM-NVLERVLKGMKTQVSYLNITRMTDFRKDGHPSVYRKQ--  641

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K  +E+K  P   + DCSHWCLP
Sbjct  642  KFTVEEKKTP-LLFQDCSHWCLP  663



>ref|XP_002311402.2| hypothetical protein POPTR_0008s10790g [Populus trichocarpa]
 gb|EEE88769.2| hypothetical protein POPTR_0008s10790g [Populus trichocarpa]
Length=371

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 84/144 (58%), Gaps = 15/144 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-------QGRHW  253
            FQ   K+ + + +  A+K A+ TW KW+D NI+ + T VFF   S  H        G H 
Sbjct  211  FQEGRKVYNRLEVNEAYKKALWTWAKWVDSNINRSHTRVFFGGYSASHFRKGKWDSGGH-  269

Query  252  CYNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKN  73
            C+ E +P+ + + +  +P  + KI+E  +S+MKTPV YLNIT+++ YRKD HP++Y + N
Sbjct  270  CHEERQPVTNDTLLKPYP-LMMKILESVISEMKTPVFYLNITRMTGYRKDGHPSVYRKPN  328

Query  72   GKQIIEKKLNPEETYSDCSHWCLP  1
              Q I   +       DCSHWCLP
Sbjct  329  VHQRIPGII------QDCSHWCLP  346



>ref|XP_006355406.1| PREDICTED: uncharacterized protein LOC102580314 [Solanum tuberosum]
Length=457

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 82/143 (57%), Gaps = 14/143 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            FQ    + + + +  A+  A++TW  W+D  I+ T T VFFR  S  H +G  W     C
Sbjct  298  FQEGNHVYNRLEVADAYTKALKTWANWVDTTINSTRTRVFFRGYSASHFKGGQWNSGGNC  357

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
              ETKPII+ + +  +P  +R ++E  +S+MKTPV YLNITK++ YRK+ HP+I+     
Sbjct  358  DGETKPIINETQLGPYPWMMR-VLESVISEMKTPVVYLNITKMTDYRKEGHPSIFREAKS  416

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K+           + DCSHWCLP
Sbjct  417  KR-------RPGMFQDCSHWCLP  432



>ref|XP_006575204.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN41712.1| hypothetical protein glysoja_041257 [Glycine soja]
Length=596

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 86/148 (58%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    + DE+ +  AF+ A+ TW +WID NI+ +++ VFFR  S  H  G  W     C
Sbjct  432  YQEGSHVYDELNVLEAFRRAITTWSRWIDANINQSKSMVFFRGYSASHFSGGQWNSGGQC  491

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET PI +   +  +P P  +++E+ +  MK  V YLN+TK++ +RKD HP+IY ++N 
Sbjct  492  DSETVPIKNEKYLREYP-PKMRVLEKVLKNMKAHVTYLNVTKMTDFRKDGHPSIYRKQN-  549

Query  69   KQIIEKKLNPEE-----TYSDCSHWCLP  1
                   L+PEE      Y DCSHWCLP
Sbjct  550  -------LSPEERKSPLRYQDCSHWCLP  570



>gb|KDO82333.1| hypothetical protein CISIN_1g007771mg [Citrus sinensis]
Length=590

 Score =   111 bits (277),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 56/135 (41%), Positives = 84/135 (62%), Gaps = 14/135 (10%)
 Frame = -1

Query  381  MRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----CYNETKPIIDV  220
            +++  A+K A+ TW +W+D N+D   T VFFR  S  H +G  W     C+ ET+PI +V
Sbjct  438  LKVLEAYKRALTTWARWVDKNVDHNRTKVFFRGYSVTHFKGGQWNSGGQCHKETEPIFNV  497

Query  219  SGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIY--ARKNGKQIIEKKL  46
            + +  +P  +R + E  + +MKTPV YLNI++L+ +RKD HP+IY    KN ++ I   +
Sbjct  498  TYLAKYPSKMRAL-EYMLPEMKTPVVYLNISRLTDFRKDGHPSIYRMEYKNDQERI-AAV  555

Query  45   NPEETYSDCSHWCLP  1
            N +    DCSHWCLP
Sbjct  556  NAQ----DCSHWCLP  566



>ref|XP_002297655.2| hypothetical protein POPTR_0001s04810g, partial [Populus trichocarpa]
 gb|EEE82460.2| hypothetical protein POPTR_0001s04810g, partial [Populus trichocarpa]
Length=535

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 92/145 (63%), Gaps = 15/145 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF+ A++TW +W++   DP +T VFFR  S  H +G  W     C
Sbjct  368  YQEGSHVYSQLNVDKAFRKALRTWARWVETKTDPFKTLVFFRGYSVSHFRGGEWDSGGKC  427

Query  249  YNETKPIIDVSGMTMFPE--PLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARK  76
             +ETKP+++    T F E  P+ KI+E T+ +MKTPV YLN+T+++ +R+DAHP++Y  +
Sbjct  428  DSETKPLME---ETYFEEDPPMVKILESTLKRMKTPVFYLNVTRMTNFRRDAHPSVYREQ  484

Query  75   NGKQIIEKKLNPEETYSDCSHWCLP  1
            N  +  E+ L+  +   DCSHWCLP
Sbjct  485  NMTE-EERSLSRVQ---DCSHWCLP  505



>ref|XP_004489803.1| PREDICTED: uncharacterized protein LOC101513224 [Cicer arietinum]
Length=528

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 83/143 (58%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +   +++  A+K A+ TW +WID+NID   T VFFR  S  H +G  W     C
Sbjct  366  YQEGNHVYPRLKVLDAYKRALTTWARWIDNNIDVNRTQVFFRGYSVTHFRGGQWNSGGQC  425

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI   + +  +P  +R + +  + KMKTPV Y+NI++++ YRKD HP+IY     
Sbjct  426  HKETEPIFKGAHLRKYPSKMRAL-DYVIPKMKTPVIYMNISRMTDYRKDGHPSIYRM---  481

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            +   E +    E + DCSHWCLP
Sbjct  482  EYKTEAERTAAEQHQDCSHWCLP  504



>ref|XP_011037956.1| PREDICTED: protein trichome birefringence-like [Populus euphratica]
Length=554

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 89/145 (61%), Gaps = 15/145 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  ++ ++ AF+ A++TW +W++   DP +T VFFR  S  H +G  W     C
Sbjct  380  YQEGSHVYSQLNVDKAFRKALRTWARWVETKTDPFKTLVFFRGYSVSHFRGGEWDSGGKC  439

Query  249  YNETKPIIDVSGMTMFPE--PLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARK  76
             +ETKP+++    T F E  P+ KI+E T+ +MKTPV YLN+T+++ +R+DAHP++Y  +
Sbjct  440  DSETKPLME---ETYFEEDPPMVKILESTLKRMKTPVFYLNVTRMTNFRRDAHPSVYREQ  496

Query  75   NGKQIIEKKLNPEETYSDCSHWCLP  1
            N    + ++        DCSHWCLP
Sbjct  497  N----MTEEERSSSRVQDCSHWCLP  517



>ref|XP_002528302.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34060.1| conserved hypothetical protein [Ricinus communis]
Length=469

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 81/139 (58%), Gaps = 10/139 (7%)
 Frame = -1

Query  387  DEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-------CYNETKP  232
            DE+    A++  ++TW +W+D+NIDP  TTVFF S+SP H +   W       C  ET P
Sbjct  313  DEIERPVAYQRVLKTWSEWVDENIDPNRTTVFFSSMSPLHIKSLDWNNPDGIKCAKETTP  372

Query  231  IIDVSGMTMFPEPLRKIV--ERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQII  58
            I++ +         R +V  +   + MK PV ++NIT LS+YRKDAH ++Y  + GK + 
Sbjct  373  ILNTTKRVNVGTDRRLLVLAQNVTNSMKIPVHFINITALSEYRKDAHTSVYTIRQGKMLT  432

Query  57   EKKLNPEETYSDCSHWCLP  1
             ++     TY+DC HWCLP
Sbjct  433  PEQQADPATYADCIHWCLP  451



>ref|XP_008351025.1| PREDICTED: protein trichome birefringence-like 42 [Malus domestica]
Length=244

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 83/148 (56%), Gaps = 27/148 (18%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW------  253
            FQ  +K+  EM    A+K+A+ TWGKW+D +ID + T VFF+ ++  H  G+ W      
Sbjct  98   FQVGDKVVKEMDHMEAYKIALTTWGKWVDSSIDISNTKVFFQGVAAVHTDGKEWKDPKAG  157

Query  252  -CYNETKPIIDVSGMTMFP---EPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIY  85
             C  +T+PI+  +    +P    P   IV+  +S M+ PV  L+IT L+Q RKD HP+IY
Sbjct  158  SCLRQTQPILGPT----YPGPSHPGEAIVKSVLSGMEKPVYLLDITLLTQLRKDGHPSIY  213

Query  84   ARKNGKQIIEKKLNPEETYSDCSHWCLP  1
            A +  K            Y+DCSHWCLP
Sbjct  214  AGEGPK------------YNDCSHWCLP  229



>emb|CAH67561.1| OSIGBa0101P20.4 [Oryza sativa Indica Group]
Length=711

 Score =   111 bits (278),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/143 (38%), Positives = 84/143 (59%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +   + +  A+K A+ TW +W+D NID T T V FR  S  H +G  W     C
Sbjct  549  YQEGNYVHPSLEVMDAYKRALTTWARWVDKNIDSTRTQVVFRGYSLTHFRGGQWNSGGRC  608

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI + + +  +PE +R I+E+ + +M+TPV YLNI+ ++ YRKDAHP++Y  +  
Sbjct  609  HRETEPIFNRTHLAEYPEKMR-ILEQVLGRMRTPVIYLNISAMTDYRKDAHPSVYRVRYE  667

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++        DCSHWCLP
Sbjct  668  T---EEERMAAVAKQDCSHWCLP  687



>ref|XP_011020489.1| PREDICTED: protein trichome birefringence-like 4 [Populus euphratica]
Length=470

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 83/144 (58%), Gaps = 15/144 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-------QGRHW  253
            FQ   K+ + + +  A+K A+ TW KW+D NI+ + T VFF   S  H        G H 
Sbjct  310  FQEGRKVYNRLEVNEAYKKALWTWAKWVDSNINRSHTRVFFGGYSASHFRKGKWDSGGH-  368

Query  252  CYNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKN  73
            C+ E +P+ + + +  +P  + KI+E  +S+MKTPV YLNIT+++ YRKD HP++Y + N
Sbjct  369  CHEERQPVTNDTQLKPYPL-MMKILESVISEMKTPVFYLNITRMTGYRKDGHPSVYRKPN  427

Query  72   GKQIIEKKLNPEETYSDCSHWCLP  1
              Q     +       DCSHWCLP
Sbjct  428  AHQRTPGII------QDCSHWCLP  445



>gb|KDP26622.1| hypothetical protein JCGZ_17780 [Jatropha curcas]
Length=584

 Score =   111 bits (277),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 53/133 (40%), Positives = 81/133 (61%), Gaps = 10/133 (8%)
 Frame = -1

Query  381  MRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----CYNETKPIIDV  220
            +++  A++ A+ TW +W+D+NID   T VFFR  S  H +G  W     C+ ET+PI + 
Sbjct  432  LKVLEAYRRALLTWARWVDNNIDRNRTQVFFRGYSVTHFRGGQWNSGGQCHKETEPIFNA  491

Query  219  SGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKKLNP  40
              +  +P  +R   E  + +MK PV Y+NI++L+ YRKD HP+IY  K   +  E+++  
Sbjct  492  KYLAKYPSKMRAF-EHVLGEMKNPVIYMNISRLTDYRKDGHPSIYRMK--YKTAEEQIAA  548

Query  39   EETYSDCSHWCLP  1
            E +  DCSHWCLP
Sbjct  549  ERS-QDCSHWCLP  560



>ref|XP_007162340.1| hypothetical protein PHAVU_001G143600g [Phaseolus vulgaris]
 gb|ESW34334.1| hypothetical protein PHAVU_001G143600g [Phaseolus vulgaris]
Length=633

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 86/148 (58%), Gaps = 20/148 (14%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +  E+ +  AF+ A+ TW +W+D NI+P++T VFFR  S  H  G  W     C
Sbjct  467  YQEGSHVYSELNVLEAFRRALTTWSRWVDANINPSKTVVFFRGYSASHFSGGQWNSGGQC  526

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
             +ET PI +   +T +P+ +  ++E+ +  MK  V Y N+T+++ +RKD HP+IY ++N 
Sbjct  527  DSETDPIDNEKYLTQYPDKM-IVLEKVLKNMKNRVIYQNVTRMTDFRKDGHPSIYRKQN-  584

Query  69   KQIIEKKLNPEE-----TYSDCSHWCLP  1
                   L+PEE      Y DCSHWCLP
Sbjct  585  -------LSPEERKSPLRYQDCSHWCLP  605



>ref|NP_001053267.1| Os04g0508000 [Oryza sativa Japonica Group]
 emb|CAE04726.1| OSJNBa0043L24.14 [Oryza sativa Japonica Group]
 emb|CAE75965.1| OSJNBb0002J11.24 [Oryza sativa Japonica Group]
 dbj|BAF15181.1| Os04g0508000 [Oryza sativa Japonica Group]
 gb|EAY94794.1| hypothetical protein OsI_16573 [Oryza sativa Indica Group]
 gb|EAZ31295.1| hypothetical protein OsJ_15402 [Oryza sativa Japonica Group]
Length=711

 Score =   111 bits (278),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 55/143 (38%), Positives = 84/143 (59%), Gaps = 10/143 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +   + +  A+K A+ TW +W+D NID T T V FR  S  H +G  W     C
Sbjct  549  YQEGNYVHPSLEVMDAYKRALTTWARWVDKNIDSTRTQVVFRGYSLTHFRGGQWNSGGRC  608

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI + + +  +PE +R I+E+ + +M+TPV YLNI+ ++ YRKDAHP++Y  +  
Sbjct  609  HRETEPIFNRTHLAEYPEKMR-ILEQVLGRMRTPVIYLNISAMTDYRKDAHPSVYRVRYE  667

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
                E++        DCSHWCLP
Sbjct  668  T---EEERMAAVAKQDCSHWCLP  687



>ref|XP_006349533.1| PREDICTED: uncharacterized protein LOC102582870 [Solanum tuberosum]
Length=418

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 85/146 (58%), Gaps = 9/146 (6%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ-GRHW------  253
            F+  E+  +E+    ++++A++TW  WID  IDP++T VFF ++SP HQ  + W      
Sbjct  259  FENGEEGYEELETAVSYRVALRTWANWIDSTIDPSKTKVFFTTMSPSHQKNKEWGNVNGI  318

Query  252  -CYNETKPIIDVSGM-TMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
             C+NET+P+       T   + +  +V   + +MK PV  LN+T+LS+YR DAH +IY  
Sbjct  319  RCFNETRPVTKKGHWGTGSNKEMMNVVASVMRRMKVPVTVLNVTQLSEYRIDAHTSIYGE  378

Query  78   KNGKQIIEKKLNPEETYSDCSHWCLP  1
              GK +  ++      ++DC HWCLP
Sbjct  379  LQGKLLTNEQRADPLHFADCIHWCLP  404



>ref|XP_010921030.1| PREDICTED: protein trichome birefringence-like 33 [Elaeis guineensis]
Length=423

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 89/147 (61%), Gaps = 11/147 (7%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ-GRHW------  253
            F    K  +EM  E  ++LA+++  +W++ N++P  T VFF S+SP H+    W      
Sbjct  261  FDGDLKDIEEMETEDGYRLALRSLVRWVEKNMNPERTRVFFTSMSPAHERSMEWGGEPDG  320

Query  252  -CYNETKPIIDVSGMTMFP--EPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYA  82
             C+NET PI+D      F   + + ++V++ +S+ K P+  LNIT+LS+YRKDAH +IY 
Sbjct  321  NCFNETNPILDDPTYWGFASSKSIMQVVKKVLSRSKVPIIVLNITQLSEYRKDAHTSIYK  380

Query  81   RKNGKQIIEKKLNPEETYSDCSHWCLP  1
            ++  K   E+  NP  +Y+DC HWCLP
Sbjct  381  KQWNKLTPEQLANP-RSYADCVHWCLP  406



>ref|XP_004249070.1| PREDICTED: protein trichome birefringence-like 3 [Solanum lycopersicum]
Length=414

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 87/149 (58%), Gaps = 15/149 (10%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ-GRHW------  253
            F+  E+  +E+    ++++A++TW  WID  IDP++T VFF ++SP HQ  + W      
Sbjct  255  FENGEEGYEELETAVSYRVALRTWANWIDSTIDPSKTKVFFTTMSPSHQKNKEWGNINGI  314

Query  252  -CYNETKPIID----VSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTI  88
             C+NET+P+       SG     + +  +V   + +MK PV  LN+T+LS+YR DAH +I
Sbjct  315  RCFNETRPVTKKGHWGSGSN---KEMMNVVASVMRRMKVPVTVLNVTQLSEYRIDAHTSI  371

Query  87   YARKNGKQIIEKKLNPEETYSDCSHWCLP  1
            Y    GK + +++      ++DC HWCLP
Sbjct  372  YGELQGKLLTDEQRADPLHFADCIHWCLP  400



>ref|XP_010429700.1| PREDICTED: protein trichome birefringence-like 42 [Camelina sativa]
Length=360

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 81/146 (55%), Gaps = 24/146 (16%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW------  253
            FQ  +++  EM    AFK+A+ TW KWID NIDP++T VF++ +SP H  G  W      
Sbjct  213  FQTGDQIVKEMNRMEAFKIALTTWAKWIDHNIDPSKTRVFYQGVSPVHLNGSEWGKPGKT  272

Query  252  CYNETKPIIDVSGMTMFPEP--LRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYAR  79
            C  ET+P+    G +  P P     IV R +  M  PV  L++T +++ RKDAHP+IYA 
Sbjct  273  CLGETEPL---KGPSNNPGPNIGEAIVRRVIGGMAKPVELLDLTAMTELRKDAHPSIYAG  329

Query  78   KNGKQIIEKKLNPEETYSDCSHWCLP  1
                     +LN      DCSHWCLP
Sbjct  330  GG------SRLN------DCSHWCLP  343



>gb|KHN14559.1| hypothetical protein glysoja_027168 [Glycine soja]
Length=521

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 80/143 (56%), Gaps = 9/143 (6%)
 Frame = -1

Query  411  FQYKEKLTDEMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEH-QGRHW-----C  250
            +Q    +   +++  A+  A+ TW +W+D NID   T VFFR  S  H +G  W     C
Sbjct  358  YQVGNHVYPRLKVLDAYTRALTTWARWVDKNIDANRTQVFFRGYSVTHFRGGQWNSGGKC  417

Query  249  YNETKPIIDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNG  70
            + ET+PI +   +  +P  +R      + KMKTPV Y+NI++L+ YRKD HP+IY R   
Sbjct  418  HKETEPISNGKHLRKYPSKMRAFEHVVIPKMKTPVIYMNISRLTDYRKDGHPSIY-RMEY  476

Query  69   KQIIEKKLNPEETYSDCSHWCLP  1
            K   E+     E + DCSHWCLP
Sbjct  477  KTAEER--TAAEQHQDCSHWCLP  497



>ref|XP_010644139.1| PREDICTED: protein trichome birefringence-like 31 [Vitis vinifera]
Length=418

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 82/136 (60%), Gaps = 8/136 (6%)
 Frame = -1

Query  384  EMRIESAFKLAMQTWGKWIDDNIDPTETTVFFRSISPEHQ-GRHW-------CYNETKPI  229
            E  + +A+++A++TW  WID NI+P    V F S+SP H     W       C+NETKPI
Sbjct  258  EYNVTAAYRMALETWANWIDSNINPQTQKVLFMSMSPTHLWSWEWKPGSDENCFNETKPI  317

Query  228  IDVSGMTMFPEPLRKIVERTVSKMKTPVRYLNITKLSQYRKDAHPTIYARKNGKQIIEKK  49
                  T     + KIV   +  +K  V++LNIT+LS++RKDAH +++  + GK + +++
Sbjct  318  QGPYWGTGSNLEIMKIVGDVLRDLKIDVKFLNITQLSEFRKDAHTSVFTERKGKLLTKEQ  377

Query  48   LNPEETYSDCSHWCLP  1
             +  +TY+DC HWCLP
Sbjct  378  RSDPKTYADCIHWCLP  393



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517347226690