BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9445_g1_i1 len=852 path=[1:0-399 401:400-851]

Length=852
                                                                      Score     E

ref|XP_009628634.1|  PREDICTED: protein ODORANT1-like                   330   4e-109   
ref|XP_009788709.1|  PREDICTED: protein ODORANT1-like                   321   6e-106   
ref|XP_004245722.1|  PREDICTED: protein ODORANT1                        316   7e-104   
ref|XP_006355506.1|  PREDICTED: protein ODORANT1-like                   315   3e-103   
emb|CDP09898.1|  unnamed protein product                                311   1e-101   
gb|AEC11888.1|  MYB transcription factor ODO1                           310   2e-101   
sp|Q50EX6.1|ODO1_PETHY  RecName: Full=Protein ODORANT1; AltName: ...    310   2e-101   Petunia x hybrida [garden petunia]
gb|AEC11890.1|  MYB transcription factor ODO1                           310   3e-101   
gb|AEC11889.1|  MYB transcription factor ODO1                           304   5e-99    
ref|XP_011081193.1|  PREDICTED: protein ODORANT1                        296   6e-96    
gb|KHG18117.1|  Protein ODORANT1                                        294   1e-95    
gb|AGN52048.1|  MYB-related transcription factor                        293   4e-95    
gb|AAF22256.1|  myb-related transcription factor                        293   5e-95    Spuriopimpinella brachycarpa
gb|KDP25612.1|  hypothetical protein JCGZ_20768                         293   7e-95    
ref|XP_007039958.1|  Myb domain protein 42                              293   8e-95    
ref|XP_002264150.2|  PREDICTED: protein ODORANT1                        292   1e-94    Vitis vinifera
ref|XP_003516672.1|  PREDICTED: protein ODORANT1                        292   2e-94    
ref|XP_006368692.1|  hypothetical protein POPTR_0001s07830g             291   2e-94    
ref|XP_004515780.1|  PREDICTED: protein ODORANT1-like                   291   3e-94    
gb|EYU26820.1|  hypothetical protein MIMGU_mgv1a027167mg                292   3e-94    
gb|KHG16103.1|  Protein ODORANT1                                        290   9e-94    
ref|XP_004298679.1|  PREDICTED: protein ODORANT1-like isoform 1         286   2e-92    
ref|XP_011018242.1|  PREDICTED: protein ODORANT1-like                   286   3e-92    
gb|KEH31681.1|  myb transcription factor                                286   3e-92    
ref|XP_009595050.1|  PREDICTED: protein ODORANT1-like                   285   7e-92    
ref|XP_002303526.2|  myb family transcription factor family protein     284   1e-91    Populus trichocarpa [western balsam poplar]
ref|XP_011033909.1|  PREDICTED: protein ODORANT1-like                   283   3e-91    
ref|XP_007157323.1|  hypothetical protein PHAVU_002G060500g             283   3e-91    
ref|XP_006440395.1|  hypothetical protein CICLE_v10021695mg             283   3e-91    
gb|KDO48409.1|  hypothetical protein CISIN_1g024441mg                   283   3e-91    
ref|XP_008369511.1|  PREDICTED: protein ODORANT1                        283   7e-91    
ref|XP_007155582.1|  hypothetical protein PHAVU_003G214300g             284   1e-90    
ref|XP_010277005.1|  PREDICTED: protein ODORANT1-like                   281   2e-90    
ref|XP_009354562.1|  PREDICTED: protein ODORANT1-like                   282   3e-90    
ref|XP_006600811.1|  PREDICTED: protein ODORANT1-like                   281   3e-90    
ref|NP_001241087.1|  protein ODORANT1-like                              281   3e-90    
ref|XP_011069675.1|  PREDICTED: protein ODORANT1                        281   4e-90    
gb|KGN50209.1|  hypothetical protein Csa_5G160120                       279   8e-90    
ref|XP_007210741.1|  hypothetical protein PRUPE_ppa021568mg             280   1e-89    
ref|XP_006477265.1|  PREDICTED: protein ODORANT1-like                   278   5e-89    
ref|XP_008238636.1|  PREDICTED: protein ODORANT1                        278   6e-89    
ref|XP_003538655.1|  PREDICTED: protein ODORANT1-like                   277   8e-89    
ref|XP_008437136.1|  PREDICTED: protein ODORANT1-like                   276   1e-88    
ref|XP_009362121.1|  PREDICTED: LOW QUALITY PROTEIN: protein ODOR...    278   1e-88    
ref|XP_010439306.1|  PREDICTED: protein ODORANT1                        276   2e-88    
ref|XP_008810422.1|  PREDICTED: protein ODORANT1-like                   275   3e-88    
emb|CBI24555.3|  unnamed protein product                                275   5e-88    
ref|XP_010264189.1|  PREDICTED: protein ODORANT1-like                   275   6e-88    
ref|XP_010676207.1|  PREDICTED: protein ODORANT1-like                   275   7e-88    
ref|XP_010093656.1|  Protein ODORANT1                                   276   9e-88    
ref|XP_002266019.2|  PREDICTED: protein ODORANT1-like                   275   1e-87    Vitis vinifera
ref|XP_010448861.1|  PREDICTED: protein ODORANT1-like                   273   4e-87    
ref|XP_010434009.1|  PREDICTED: protein ODORANT1-like                   271   3e-86    
ref|XP_008376253.1|  PREDICTED: protein ODORANT1-like                   269   9e-86    
gb|AAZ20435.1|  MYB19                                                   268   1e-85    Malus domestica [apple tree]
ref|XP_002867757.1|  hypothetical protein ARALYDRAFT_492601             269   1e-85    
ref|XP_010934413.1|  PREDICTED: protein ODORANT1-like                   268   1e-85    
ref|XP_002509589.1|  ODORANT1 protein, putative                         269   1e-85    Ricinus communis
ref|XP_009374509.1|  PREDICTED: protein ODORANT1-like                   268   2e-85    
ref|NP_567664.1|  myb domain protein 85                                 267   7e-85    Arabidopsis thaliana [mouse-ear cress]
gb|ABK28645.1|  unknown                                                 267   7e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137269.1|  PREDICTED: protein ODORANT1-like                   266   1e-84    
ref|XP_006413635.1|  hypothetical protein EUTSA_v10027281mg             266   2e-84    
ref|XP_009372900.1|  PREDICTED: protein ODORANT1-like                   266   3e-84    
ref|XP_009370487.1|  PREDICTED: protein ODORANT1-like                   266   3e-84    
emb|CDY64316.1|  BnaA03g58600D                                          265   3e-84    
ref|XP_002462722.1|  hypothetical protein SORBIDRAFT_02g030900          265   4e-84    Sorghum bicolor [broomcorn]
ref|XP_008234380.1|  PREDICTED: protein ODORANT1-like                   264   5e-84    
ref|XP_004307827.1|  PREDICTED: protein ODORANT1-like                   264   8e-84    
ref|NP_001106007.1|  LOC100101510                                       264   1e-83    Zea mays [maize]
ref|XP_006284312.1|  hypothetical protein CARUB_v10005483mg             264   1e-83    
ref|XP_008650756.1|  PREDICTED: LOC100101510 isoform X1                 265   2e-83    
emb|CDX94109.1|  BnaC07g37430D                                          263   2e-83    
ref|XP_008376445.1|  PREDICTED: protein ODORANT1-like                   263   4e-83    
emb|CDX79170.1|  BnaA01g12370D                                          261   9e-83    
ref|XP_010433580.1|  PREDICTED: protein ODORANT1                        262   9e-83    
ref|XP_006396775.1|  hypothetical protein EUTSA_v10028864mg             262   1e-82    
ref|XP_002872653.1|  hypothetical protein ARALYDRAFT_327351             262   1e-82    
emb|CDX82958.1|  BnaC01g14080D                                          261   2e-82    
ref|XP_004957458.1|  PREDICTED: protein ODORANT1-like                   260   3e-82    
ref|XP_010053417.1|  PREDICTED: protein ODORANT1-like                   261   4e-82    
ref|XP_002321838.2|  hypothetical protein POPTR_0015s14600g             260   5e-82    Populus trichocarpa [western balsam poplar]
gb|KCW46285.1|  hypothetical protein EUGRSUZ_K00153                     257   6e-82    
ref|XP_010539859.1|  PREDICTED: protein ODORANT1-like                   260   6e-82    
ref|XP_009136061.1|  PREDICTED: protein ODORANT1                        259   8e-82    
gb|KFK28838.1|  hypothetical protein AALP_AA7G055500                    259   9e-82    
ref|XP_010035019.1|  PREDICTED: protein ODORANT1                        259   1e-81    
ref|XP_006289620.1|  hypothetical protein CARUB_v10003172mg             258   2e-81    
ref|NP_567390.4|  myb domain protein 42                                 259   2e-81    Arabidopsis thaliana [mouse-ear cress]
gb|AGV22119.1|  MYB transcription factor 2                              258   2e-81    
ref|XP_006660886.1|  PREDICTED: protein ODORANT1-like                   258   3e-81    
gb|AAS10075.1|  MYB transcription factor                                258   3e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011029963.1|  PREDICTED: protein ODORANT1-like                   257   6e-81    
ref|XP_010101097.1|  Protein ODORANT1                                   256   7e-81    
emb|CAN68308.1|  hypothetical protein VITISV_043506                     254   1e-80    Vitis vinifera
ref|XP_010529493.1|  PREDICTED: protein ODORANT1-like                   256   1e-80    
ref|XP_008679710.1|  PREDICTED: protein ODORANT1                        256   2e-80    
ref|XP_008467265.1|  PREDICTED: protein ODORANT1                        254   3e-80    
ref|XP_002318878.1|  hypothetical protein POPTR_0012s14540g             254   7e-80    Populus trichocarpa [western balsam poplar]
ref|NP_001063765.1|  Os09g0532900                                       254   1e-79    Oryza sativa Japonica Group [Japonica rice]
gb|ACN91625.1|  transcription factor MYBL1                              254   1e-79    Populus x canadensis [Canadian poplar]
ref|XP_007218420.1|  hypothetical protein PRUPE_ppa011549mg             251   1e-79    
ref|XP_004143714.1|  PREDICTED: protein ODORANT1-like                   252   1e-79    
ref|XP_004162772.1|  PREDICTED: protein ODORANT1-like                   252   2e-79    
ref|XP_009108579.1|  PREDICTED: protein ODORANT1-like                   253   2e-79    
ref|XP_006421721.1|  hypothetical protein CICLE_v10005666mg             253   2e-79    
ref|XP_006490087.1|  PREDICTED: protein ODORANT1-like                   253   2e-79    
ref|XP_011041720.1|  PREDICTED: protein ODORANT1-like                   253   3e-79    
ref|XP_007038425.1|  Myb domain protein 42                              252   4e-79    
dbj|BAF80451.1|  MYB-related transcription factor                       253   8e-79    Nicotiana tabacum [American tobacco]
emb|CAC85051.1|  Myb13 protein                                          251   2e-78    Oryza sativa [red rice]
dbj|BAD10751.1|  putative Myb13 protein                                 250   3e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009589696.1|  PREDICTED: protein ODORANT1                        251   3e-78    
ref|XP_004974136.1|  PREDICTED: protein ODORANT1-like isoform X1        248   1e-77    
ref|XP_003616278.1|  P-type R2R3 Myb protein                            250   1e-77    
ref|XP_009616533.1|  PREDICTED: protein ODORANT1-like                   249   2e-77    
ref|XP_009407976.1|  PREDICTED: protein ODORANT1-like                   248   2e-77    
ref|XP_006364618.1|  PREDICTED: protein ODORANT1-like                   249   2e-77    
ref|XP_010312447.1|  PREDICTED: myb-related transcription factor ...    249   2e-77    
ref|NP_001234300.1|  myb-related transcription factor                   248   2e-77    
gb|KHG13514.1|  Protein ODORANT1                                        248   4e-77    
ref|XP_006659660.1|  PREDICTED: protein ODORANT1-like                   246   5e-77    
ref|XP_009412832.1|  PREDICTED: protein ODORANT1-like                   246   6e-77    
ref|XP_003574901.1|  PREDICTED: protein ODORANT1-like                   246   6e-77    
ref|XP_009792876.1|  PREDICTED: protein ODORANT1-like                   248   7e-77    
ref|XP_010062267.1|  PREDICTED: protein ODORANT1-like isoform X1        247   1e-76    
gb|KHN39463.1|  Protein ODORANT1                                        248   1e-76    
ref|XP_009401426.1|  PREDICTED: protein ODORANT1-like                   244   2e-76    
gb|KHN07541.1|  Protein ODORANT1                                        248   2e-76    
ref|XP_003538391.1|  PREDICTED: protein ODORANT1                        248   2e-76    
ref|XP_006838010.1|  hypothetical protein AMTR_s00091p00025820          246   2e-76    
ref|XP_003553077.1|  PREDICTED: protein ODORANT1-like                   247   2e-76    
gb|AIT13038.1|  myb-related transcription factor                        246   3e-76    
ref|XP_007032972.1|  Myb domain protein 20                              246   3e-76    
ref|XP_010108985.1|  Protein ODORANT1                                   247   3e-76    
emb|CDP01637.1|  unnamed protein product                                247   5e-76    
ref|XP_010660298.1|  PREDICTED: protein ODORANT1                        245   5e-76    
ref|XP_010551759.1|  PREDICTED: protein ODORANT1-like                   245   6e-76    
gb|KDO50806.1|  hypothetical protein CISIN_1g021498mg                   246   6e-76    
ref|XP_006430591.1|  hypothetical protein CICLE_v10012265mg             246   6e-76    
ref|XP_010032717.1|  PREDICTED: protein ODORANT1-like                   246   6e-76    
ref|XP_006482113.1|  PREDICTED: protein ODORANT1-like                   245   6e-76    
emb|CBI33476.3|  unnamed protein product                                244   7e-76    
ref|XP_007163381.1|  hypothetical protein PHAVU_001G229900g             246   8e-76    
gb|AGN52067.1|  MYB-related transcription factor                        244   8e-76    
gb|KHG06720.1|  Protein ODORANT1                                        245   9e-76    
ref|XP_004490820.1|  PREDICTED: protein ODORANT1-like                   245   9e-76    
ref|XP_010525304.1|  PREDICTED: protein ODORANT1-like                   239   1e-75    
ref|NP_001169938.1|  putative MYB DNA-binding domain superfamily ...    243   1e-75    Zea mays [maize]
ref|XP_008227926.1|  PREDICTED: protein ODORANT1-like                   243   1e-75    
gb|KHG25520.1|  Protein ODORANT1                                        243   1e-75    
ref|XP_003578505.1|  PREDICTED: protein ODORANT1-like                   243   1e-75    
ref|XP_004956767.1|  PREDICTED: protein ODORANT1-like                   243   1e-75    
ref|XP_007215806.1|  hypothetical protein PRUPE_ppa009966mg             243   2e-75    
ref|XP_010268020.1|  PREDICTED: protein ODORANT1-like                   243   2e-75    
ref|NP_001242827.1|  uncharacterized protein LOC100800494               244   2e-75    
ref|XP_010528552.1|  PREDICTED: protein ODORANT1-like                   243   2e-75    
ref|XP_002305215.1|  hypothetical protein POPTR_0004s08480g             244   3e-75    Populus trichocarpa [western balsam poplar]
emb|CDX85496.1|  BnaA02g03170D                                          244   3e-75    
emb|CDX76358.1|  BnaA08g10420D                                          242   3e-75    
gb|EMT18012.1|  Protein ODORANT1                                        243   3e-75    
ref|XP_011007235.1|  PREDICTED: protein ODORANT1-like                   244   3e-75    
ref|XP_003519327.1|  PREDICTED: protein ODORANT1-like                   244   3e-75    
ref|XP_004973482.1|  PREDICTED: myb-related protein 315-like            243   4e-75    
gb|AAL84615.1|AF474118_1  typical P-type R2R3 Myb protein               240   5e-75    Zea mays [maize]
ref|XP_009381446.1|  PREDICTED: protein ODORANT1-like                   242   5e-75    
tpg|DAA61360.1|  TPA: LOW QUALITY PROTEIN: putative MYB DNA-bindi...    239   5e-75    
ref|XP_004503126.1|  PREDICTED: protein ODORANT1-like                   244   7e-75    
gb|AFK47512.1|  unknown                                                 243   7e-75    
dbj|BAJ97263.1|  predicted protein                                      242   8e-75    
ref|XP_003600714.1|  P-type R2R3 Myb protein                            243   9e-75    
emb|CDY38100.1|  BnaC02g06730D                                          243   9e-75    
ref|XP_002452601.1|  hypothetical protein SORBIDRAFT_04g028850          237   1e-74    Sorghum bicolor [broomcorn]
gb|AGN52115.1|  MYB-related transcription factor                        241   1e-74    
ref|XP_006372565.1|  myb family transcription factor family protein     243   1e-74    
ref|XP_008652684.1|  PREDICTED: protein ODORANT1-like                   241   1e-74    
ref|XP_004289590.1|  PREDICTED: protein ODORANT1-like                   241   1e-74    
gb|KHG02341.1|  Protein ODORANT1                                        241   2e-74    
ref|XP_010271304.1|  PREDICTED: myb-related protein 315                 245   2e-74    
ref|XP_003578088.1|  PREDICTED: protein ODORANT1-like                   240   2e-74    
emb|CDX69440.1|  BnaA10g17890D                                          241   2e-74    
emb|CDY49650.1|  BnaC09g41280D                                          241   2e-74    
gb|AGZ16414.1|  MYB15                                                   239   3e-74    
ref|XP_006391368.1|  hypothetical protein EUTSA_v10019852mg             240   3e-74    
gb|KDP25786.1|  hypothetical protein JCGZ_22508                         242   3e-74    
ref|XP_010415165.1|  PREDICTED: protein ODORANT1-like                   240   3e-74    
ref|XP_002887017.1|  hypothetical protein ARALYDRAFT_894261             240   3e-74    
gb|AFW63820.1|  putative MYB DNA-binding domain superfamily protein     240   4e-74    
ref|NP_176797.1|  myb domain protein 20                                 240   4e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370562.1|  PREDICTED: protein ODORANT1-like                   239   4e-74    
ref|XP_006400198.1|  hypothetical protein EUTSA_v10014086mg             241   4e-74    
ref|NP_001149774.1|  odorant 1 protein                                  239   5e-74    Zea mays [maize]
ref|XP_008343128.1|  PREDICTED: protein ODORANT1-like                   239   5e-74    
ref|XP_010926121.1|  PREDICTED: protein ODORANT1-like                   240   5e-74    
ref|XP_009121472.1|  PREDICTED: protein ODORANT1                        241   5e-74    
gb|EAZ07061.1|  hypothetical protein OsI_29307                          241   5e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_010470497.1|  PREDICTED: protein ODORANT1-like                   240   5e-74    
tpg|DAA61361.1|  TPA: putative MYB DNA-binding domain superfamily...    240   5e-74    
ref|XP_006302662.1|  hypothetical protein CARUB_v10020766mg             239   6e-74    
ref|NP_001061847.1|  Os08g0428200                                       240   6e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956766.1|  PREDICTED: protein ODORANT1-like                   239   6e-74    
ref|XP_004140299.1|  PREDICTED: myb-related protein 315-like            240   8e-74    
ref|XP_008652685.1|  PREDICTED: protein ODORANT1-like                   239   8e-74    
ref|XP_007141914.1|  hypothetical protein PHAVU_008G236500g             241   9e-74    
ref|XP_003572214.1|  PREDICTED: protein ODORANT1                        239   1e-73    
ref|XP_010525072.1|  PREDICTED: myb-related protein 330-like            240   1e-73    
gb|EMT20029.1|  Protein ODORANT1                                        238   1e-73    
ref|XP_004173153.1|  PREDICTED: myb-related protein 315-like            239   1e-73    
ref|XP_011001567.1|  PREDICTED: protein ODORANT1-like                   240   1e-73    
gb|EAZ09037.1|  hypothetical protein OsI_31298                          238   2e-73    Oryza sativa Indica Group [Indian rice]
emb|CDP01404.1|  unnamed protein product                                239   2e-73    
ref|NP_001063118.1|  Os09g0401000                                       238   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009409253.1|  PREDICTED: protein ODORANT1-like                   239   2e-73    
ref|XP_010511551.1|  PREDICTED: protein ODORANT1-like                   238   2e-73    
dbj|BAJ98593.1|  predicted protein                                      238   2e-73    
ref|XP_002871726.1|  hypothetical protein ARALYDRAFT_909643             239   2e-73    
gb|ACY74342.1|  putative MYB-related transcription factor               240   2e-73    Artemisia annua [sweet Annie]
ref|XP_004956765.1|  PREDICTED: protein ODORANT1-like                   237   3e-73    
ref|NP_001281099.1|  uncharacterized protein LOC100216895               238   3e-73    
ref|XP_006288141.1|  hypothetical protein CARUB_v10001378mg             239   3e-73    
ref|XP_008803910.1|  PREDICTED: protein ODORANT1-like                   238   3e-73    
ref|XP_010917650.1|  PREDICTED: protein ODORANT1-like                   238   4e-73    
gb|AAL84764.1|AF474131_1  typical P-type R2R3 Myb protein               233   5e-73    Sorghum bicolor [broomcorn]
gb|ABR92760.1|  transcription factor TF1                                236   6e-73    Gossypium hirsutum [American cotton]
ref|XP_008803475.1|  PREDICTED: protein ODORANT1-like                   237   6e-73    
ref|XP_010932583.1|  PREDICTED: protein ODORANT1-like                   237   7e-73    
ref|XP_011085868.1|  PREDICTED: protein ODORANT1                        238   7e-73    
ref|XP_002460190.1|  hypothetical protein SORBIDRAFT_02g024260          238   7e-73    Sorghum bicolor [broomcorn]
gb|AAL84763.1|AF474130_1  typical P-type R2R3 Myb protein               233   8e-73    Sorghum bicolor [broomcorn]
gb|AAL84766.1|AF474133_1  typical P-type R2R3 Myb protein               234   8e-73    Sorghum bicolor [broomcorn]
gb|EMT17735.1|  Protein ODORANT1                                        231   9e-73    
ref|XP_004953828.1|  PREDICTED: protein ODORANT1-like                   235   1e-72    
ref|XP_006647848.1|  PREDICTED: protein ODORANT1-like                   235   1e-72    
ref|XP_009757133.1|  PREDICTED: protein ODORANT1-like                   236   1e-72    
ref|XP_009370048.1|  PREDICTED: protein ODORANT1-like                   235   2e-72    
ref|XP_006346756.1|  PREDICTED: protein ODORANT1-like                   236   2e-72    
ref|XP_010916181.1|  PREDICTED: protein ODORANT1-like                   236   2e-72    
ref|XP_009398709.1|  PREDICTED: protein ODORANT1-like                   234   2e-72    
ref|XP_009126127.1|  PREDICTED: myb-related protein 308-like            236   2e-72    
ref|XP_004236690.1|  PREDICTED: protein ODORANT1-like                   236   3e-72    
ref|XP_009620990.1|  PREDICTED: protein ODORANT1-like                   235   3e-72    
emb|CDY49639.1|  BnaCnng17910D                                          234   4e-72    
gb|AAC83591.1|  putative transcription factor                           234   4e-72    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197163.1|  myb domain protein 43                                 236   4e-72    Arabidopsis thaliana [mouse-ear cress]
gb|EAY87414.1|  hypothetical protein OsI_08821                          233   5e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_009105194.1|  PREDICTED: protein ODORANT1                        234   6e-72    
ref|NP_001048028.1|  Os02g0732600                                       233   6e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660610.1|  PREDICTED: protein ODORANT1-like                   234   7e-72    
gb|ACF82542.1|  unknown                                                 239   7e-72    Zea mays [maize]
ref|NP_001057322.1|  Os06g0258000                                       233   8e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010474190.1|  PREDICTED: protein ODORANT1-like                   234   1e-71    
gb|EAZ00411.1|  hypothetical protein OsI_22425                          233   1e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_008381375.1|  PREDICTED: protein ODORANT1-like                   233   1e-71    
ref|XP_008457024.1|  PREDICTED: protein ODORANT1-like                   233   1e-71    
ref|XP_008802445.1|  PREDICTED: protein ODORANT1-like                   233   3e-71    
ref|XP_004956764.1|  PREDICTED: myb-related protein 315-like            232   3e-71    
ref|XP_003570507.1|  PREDICTED: protein ODORANT1-like                   232   3e-71    
gb|AAL84620.1|AF474123_1  typical P-type R2R3 Myb protein               228   4e-71    Zea mays [maize]
ref|XP_002460189.1|  hypothetical protein SORBIDRAFT_02g024250          232   4e-71    Sorghum bicolor [broomcorn]
gb|EMT12444.1|  Protein ODORANT1                                        231   4e-71    
ref|XP_004965175.1|  PREDICTED: protein ODORANT1-like                   232   5e-71    
ref|XP_002436815.1|  hypothetical protein SORBIDRAFT_10g009330          232   7e-71    Sorghum bicolor [broomcorn]
ref|XP_004145848.1|  PREDICTED: protein ODORANT1-like                   231   1e-70    
ref|XP_009410072.1|  PREDICTED: protein ODORANT1-like                   231   1e-70    
gb|ADU78722.1|  MYB1                                                    230   2e-70    
gb|ACF81234.1|  unknown                                                 232   2e-70    Zea mays [maize]
ref|XP_008667722.1|  PREDICTED: uncharacterized protein LOC100191...    232   2e-70    
gb|AGT16554.1|  hypothetical protein SHCRBa_130_G08_R_150               230   3e-70    
ref|XP_010424128.1|  PREDICTED: protein ODORANT1-like                   227   3e-70    
ref|XP_009408320.1|  PREDICTED: protein ODORANT1-like                   228   1e-69    
ref|XP_010453823.1|  PREDICTED: protein ODORANT1-like                   231   1e-69    
ref|XP_006655982.1|  PREDICTED: myb-related protein Zm38-like           228   2e-69    
gb|KDP22403.1|  hypothetical protein JCGZ_26234                         227   2e-69    
gb|ABD60296.2|  R2R3-MYB transcription factor MYB1                      223   4e-69    
ref|XP_010492571.1|  PREDICTED: protein ODORANT1-like                   229   4e-69    
gb|EMS60842.1|  Protein ODORANT1                                        222   6e-69    
gb|AAQ62541.1|  R2R3-MYB transcription factor                           227   3e-68    Pinus taeda
gb|ACA33839.1|  R2R3-Myb1 transcription factor                          226   4e-68    Pinus pinaster [cluster pine]
ref|XP_009400120.1|  PREDICTED: protein ODORANT1-like                   224   7e-68    
gb|ABP04051.1|  R2R3MYB                                                 225   1e-67    
ref|XP_009417822.1|  PREDICTED: protein ODORANT1-like                   223   1e-67    
gb|ABQ51217.1|  R2R3-MYB transcription factor MYB1                      224   2e-67    
gb|ADF57329.1|  R2R3 MYB transcription factor                           224   4e-67    
ref|XP_003560842.1|  PREDICTED: protein ODORANT1-like                   221   4e-67    
gb|ABK23245.1|  unknown                                                 223   4e-67    
gb|AFD36431.1|  R2R3 MYB transcription factor                           224   5e-67    
ref|XP_010456892.1|  PREDICTED: protein ODORANT1-like                   218   3e-66    
gb|AFX98073.1|  R2R3 transcription factor                               220   4e-66    
ref|XP_006338652.1|  PREDICTED: myb-related protein 315-like            218   4e-66    
ref|XP_002444623.1|  hypothetical protein SORBIDRAFT_07g024970          216   2e-65    
ref|XP_004239173.1|  PREDICTED: protein ODORANT1                        214   4e-65    
ref|XP_009593357.1|  PREDICTED: protein ODORANT1-like                   216   6e-65    
gb|EPS65487.1|  hypothetical protein M569_09290                         211   7e-65    
gb|EYU45797.1|  hypothetical protein MIMGU_mgv1a017983mg                216   8e-65    
ref|XP_006341811.1|  PREDICTED: protein ODORANT1-like                   214   1e-64    
ref|XP_009763213.1|  PREDICTED: protein ODORANT1-like                   214   2e-64    
ref|XP_010550577.1|  PREDICTED: protein ODORANT1                        214   2e-64    
ref|XP_010913029.1|  PREDICTED: myb-related protein 315-like            214   4e-64    
gb|AGN52072.1|  MYB-related transcription factor                        212   6e-64    
ref|XP_001784979.1|  predicted protein                                  209   6e-64    
gb|KCW52982.1|  hypothetical protein EUGRSUZ_J02279                     213   6e-64    
ref|XP_009151351.1|  PREDICTED: protein ODORANT1                        211   1e-63    
ref|XP_008807214.1|  PREDICTED: protein ODORANT1                        213   1e-63    
ref|XP_003520138.1|  PREDICTED: transcription factor MYB39-like         214   1e-63    
gb|AGN52099.1|  MYB-related transcription factor                        211   2e-63    
ref|XP_011071180.1|  PREDICTED: protein ODORANT1                        210   3e-63    
ref|XP_003548543.1|  PREDICTED: myb-related protein 315-like            212   3e-63    
ref|XP_006573182.1|  PREDICTED: transcription factor MYB39-like         213   3e-63    
ref|XP_010033365.1|  PREDICTED: myb-related protein 315                 213   4e-63    
ref|XP_010907486.1|  PREDICTED: transcription factor MYB39-like         213   4e-63    
gb|KDP41381.1|  hypothetical protein JCGZ_15788                         214   4e-63    
emb|CDY00277.1|  BnaA06g21780D                                          210   6e-63    
emb|CDX86905.1|  BnaC03g51750D                                          210   6e-63    
ref|XP_004231815.2|  PREDICTED: myb-related protein 315-like            216   6e-63    
gb|KHG22733.1|  Transcription factor MYB39 -like protein                212   7e-63    
gb|KDP46819.1|  hypothetical protein JCGZ_24028                         212   8e-63    
emb|CDP13286.1|  unnamed protein product                                207   9e-63    
ref|XP_006282174.1|  hypothetical protein CARUB_v10028436mg             209   1e-62    
ref|XP_002866484.1|  hypothetical protein ARALYDRAFT_919487             209   1e-62    
ref|XP_007047937.1|  Myb domain protein 93                              211   1e-62    
ref|XP_007018775.1|  Myb domain protein 93                              211   2e-62    
ref|XP_006433987.1|  hypothetical protein CICLE_v10003958mg             212   2e-62    
ref|XP_010483899.1|  PREDICTED: protein ODORANT1-like                   208   2e-62    
dbj|BAD43450.1|  MYB99                                                  208   3e-62    
ref|XP_008775952.1|  PREDICTED: transcription factor MYB39-like         208   3e-62    
ref|NP_201038.1|  myb domain protein 99                                 208   3e-62    
gb|ABK28774.1|  unknown                                                 208   3e-62    
ref|XP_002284142.1|  PREDICTED: transcription factor MYB39              211   3e-62    
emb|CBI17697.3|  unnamed protein product                                213   3e-62    
ref|XP_002271033.3|  PREDICTED: myb-related protein 315                 213   4e-62    
ref|XP_009338099.1|  PREDICTED: transcription factor MYB39-like         211   4e-62    
ref|XP_007207610.1|  hypothetical protein PRUPE_ppa019923mg             211   4e-62    
ref|XP_008338578.1|  PREDICTED: transcription factor MYB39-like         211   5e-62    
ref|XP_006447177.1|  hypothetical protein CICLE_v10017764mg             208   6e-62    
ref|XP_006473009.1|  PREDICTED: transcription factor MYB39-like         211   6e-62    
ref|XP_010444041.1|  PREDICTED: protein ODORANT1-like                   207   7e-62    
ref|XP_002301053.1|  hypothetical protein POPTR_0002s09720g             210   8e-62    
ref|XP_008234088.1|  PREDICTED: transcription factor MYB28              210   8e-62    
ref|XP_006394409.1|  hypothetical protein EUTSA_v10004868mg             206   1e-61    
ref|XP_006355335.1|  PREDICTED: transcription factor MYB39-like         209   1e-61    
ref|XP_006597393.1|  PREDICTED: protein ODORANT1-like                   210   2e-61    
ref|XP_010438501.1|  PREDICTED: transcription factor MYB39-like         207   2e-61    
ref|XP_010551924.1|  PREDICTED: myb-related protein 315                 206   2e-61    
ref|XP_011090566.1|  PREDICTED: transcription factor MYB39-like         208   2e-61    
ref|XP_011022802.1|  PREDICTED: myb-related protein 308-like            209   2e-61    
ref|XP_010448029.1|  PREDICTED: transcription factor MYB39-like         207   3e-61    
gb|AGN52111.1|  MYB-related transcription factor                        206   3e-61    
ref|XP_002867465.1|  AtMYB41                                            207   3e-61    
ref|XP_004288189.1|  PREDICTED: uncharacterized protein LOC101292449    209   3e-61    
ref|XP_008345730.1|  PREDICTED: transcription factor MYB39-like         209   3e-61    
ref|NP_194540.1|  myb domain protein 41                                 207   3e-61    
gb|KDP26736.1|  hypothetical protein JCGZ_17894                         204   3e-61    
emb|CBI40862.3|  unnamed protein product                                208   3e-61    
ref|XP_004136397.1|  PREDICTED: transcription factor MYB39-like         207   3e-61    
ref|XP_010240896.1|  PREDICTED: transcription factor MYB39-like         209   3e-61    
ref|XP_010433260.1|  PREDICTED: transcription factor MYB39-like         207   3e-61    
ref|XP_009371720.1|  PREDICTED: myb-related protein 315-like            207   3e-61    
gb|EPS74409.1|  hypothetical protein M569_00345                         202   3e-61    
ref|XP_002298589.1|  hypothetical protein POPTR_0001s36220g             207   3e-61    
ref|XP_008450053.1|  PREDICTED: transcription repressor MYB6            207   3e-61    
ref|XP_001768811.1|  predicted protein                                  202   4e-61    
ref|XP_010917107.1|  PREDICTED: transcription factor MYB39-like         207   4e-61    
ref|XP_002310560.2|  hypothetical protein POPTR_0007s05360g             208   4e-61    
ref|XP_009370698.1|  PREDICTED: transcription factor MYB39-like         208   4e-61    
ref|XP_010274278.1|  PREDICTED: transcription factor MYB39-like         209   4e-61    
ref|XP_007217823.1|  hypothetical protein PRUPE_ppa026877mg             206   4e-61    
gb|KDP46348.1|  hypothetical protein JCGZ_10188                         206   5e-61    
ref|XP_010111643.1|  Myb-related protein 315                            207   5e-61    
ref|XP_006286241.1|  hypothetical protein CARUB_v10007810mg             206   5e-61    
ref|XP_002307080.2|  hypothetical protein POPTR_0005s07590g             208   6e-61    
ref|XP_002266049.1|  PREDICTED: protein ODORANT1                        208   6e-61    
ref|XP_011031021.1|  PREDICTED: myb-related protein 308-like            208   6e-61    
dbj|BAC75671.1|  transcription factor MYB101                            208   6e-61    
ref|XP_008465998.1|  PREDICTED: transcription factor MYB39              207   6e-61    
ref|XP_008786382.1|  PREDICTED: transcription factor MYB39-like         204   6e-61    
ref|XP_009766820.1|  PREDICTED: myb-related protein 315-like            206   6e-61    
ref|XP_010939659.1|  PREDICTED: transcription repressor MYB6-like       207   7e-61    
ref|XP_009790391.1|  PREDICTED: myb-related protein 315-like            208   7e-61    
ref|XP_009405092.1|  PREDICTED: protein ODORANT1-like                   204   8e-61    
ref|XP_010250867.1|  PREDICTED: myb-related protein 315-like            205   8e-61    
ref|XP_008795592.1|  PREDICTED: transcription factor MYB34-like         207   8e-61    
ref|XP_011045215.1|  PREDICTED: myb-related protein 315                 206   8e-61    
ref|XP_004240108.1|  PREDICTED: protein ODORANT1-like                   207   8e-61    
ref|XP_009594598.1|  PREDICTED: transcription factor MYB39-like         207   8e-61    
ref|XP_006412992.1|  hypothetical protein EUTSA_v10027463mg             206   8e-61    
ref|XP_004510807.1|  PREDICTED: protein ODORANT1-like                   206   9e-61    
emb|CDP01059.1|  unnamed protein product                                207   9e-61    
ref|XP_009137761.1|  PREDICTED: transcription repressor MYB6-like...    206   9e-61    
ref|XP_007153451.1|  hypothetical protein PHAVU_003G036400g             206   1e-60    
ref|XP_001765703.1|  predicted protein                                  209   1e-60    
ref|XP_009137762.1|  PREDICTED: transcription repressor MYB6-like...    206   1e-60    
emb|CDY68230.1|  BnaCnng58140D                                          206   1e-60    
ref|XP_004143558.1|  PREDICTED: transcription factor MYB39-like         207   1e-60    
ref|XP_010904805.1|  PREDICTED: transcription factor MYB3-like          207   1e-60    
ref|XP_008782327.1|  PREDICTED: transcription factor MYB39-like         206   1e-60    
gb|KHG11747.1|  Transcription factor MYB39 -like protein                207   1e-60    
ref|XP_006428207.1|  hypothetical protein CICLE_v10026023mg             207   1e-60    
ref|NP_191684.1|  LATE MERISTEM IDENTITY2                               206   1e-60    
gb|AHN60122.1|  MYB transcription factor 16                             206   1e-60    
ref|XP_007151568.1|  hypothetical protein PHAVU_004G057800g             205   1e-60    
ref|XP_004146632.1|  PREDICTED: uncharacterized protein LOC101216901    207   1e-60    
ref|XP_006352596.1|  PREDICTED: protein ODORANT1-like                   206   1e-60    
ref|XP_009596112.1|  PREDICTED: myb-related protein 315-like            205   1e-60    
ref|XP_009370316.1|  PREDICTED: myb-related protein 315-like            205   1e-60    
ref|XP_006288195.1|  hypothetical protein CARUB_v10001433mg             204   1e-60    
ref|XP_010645217.1|  PREDICTED: myb-related protein Myb4                207   1e-60    
ref|XP_010240908.1|  PREDICTED: myb-related protein 315-like            207   1e-60    
ref|XP_009386695.1|  PREDICTED: protein ODORANT1-like                   204   1e-60    
ref|XP_008366447.1|  PREDICTED: myb-related protein 315-like            206   1e-60    
gb|AGN52097.1|  MYB-related transcription factor                        205   1e-60    
ref|XP_009131398.1|  PREDICTED: protein ODORANT1-like                   203   1e-60    
ref|XP_010910603.1|  PREDICTED: myb-related protein 315-like            206   1e-60    
ref|XP_007021241.1|  MYB-like 102, putative                             207   1e-60    
ref|XP_010680536.1|  PREDICTED: transcription factor MYB39-like         206   2e-60    
ref|XP_002444392.1|  hypothetical protein SORBIDRAFT_07g021210          207   2e-60    
gb|KEH34935.1|  myb transcription factor                                207   2e-60    
ref|XP_009121584.1|  PREDICTED: myb-related protein Hv1                 206   2e-60    
ref|XP_010926300.1|  PREDICTED: transcription factor MYB39-like         206   2e-60    
gb|KDP39527.1|  hypothetical protein JCGZ_02547                         207   2e-60    
ref|XP_007029608.1|  Myb domain protein 107                             207   2e-60    
ref|XP_004975862.1|  PREDICTED: myb-related protein Myb4-like           207   2e-60    
ref|XP_010519490.1|  PREDICTED: transcription factor MYB39              206   2e-60    
gb|AFW71999.1|  putative MYB DNA-binding domain superfamily protein     206   2e-60    
ref|XP_003621270.1|  MYB transcription factor                           206   2e-60    
ref|XP_001784732.1|  predicted protein                                  209   2e-60    
ref|XP_006594633.1|  PREDICTED: protein ODORANT1                        207   2e-60    
ref|XP_011004803.1|  PREDICTED: transcription factor MYB39-like         206   2e-60    
ref|XP_009617932.1|  PREDICTED: transcription factor MYB39-like         206   2e-60    
ref|XP_010458549.1|  PREDICTED: protein ODORANT1-like                   203   2e-60    
ref|XP_006400051.1|  hypothetical protein EUTSA_v10014101mg             206   2e-60    
ref|XP_004504959.1|  PREDICTED: transcription factor MYB39-like         206   2e-60    
emb|CDP01469.1|  unnamed protein product                                206   2e-60    
ref|XP_011098995.1|  PREDICTED: uncharacterized protein LOC105177506    216   2e-60    
ref|XP_003527903.1|  PREDICTED: transcription factor MYB39-like         206   2e-60    
emb|CDX78625.1|  BnaA03g05370D                                          206   3e-60    
gb|KHN03903.1|  Transcription factor MYB39                              206   3e-60    
ref|XP_002307380.1|  hypothetical protein POPTR_0005s17080g             206   3e-60    
ref|XP_010492363.1|  PREDICTED: myb-related protein Hv1-like isof...    206   3e-60    
ref|XP_008441942.1|  PREDICTED: transcription factor MYB86-like         207   3e-60    
ref|XP_009376291.1|  PREDICTED: transcription factor MYB34              207   3e-60    
gb|KDO56544.1|  hypothetical protein CISIN_1g045434mg                   205   3e-60    
gb|KDP38959.1|  hypothetical protein JCGZ_00716                         205   3e-60    
gb|KDP20873.1|  hypothetical protein JCGZ_21344                         206   3e-60    
emb|CDY63474.1|  BnaC01g41180D                                          206   3e-60    
ref|XP_006288196.1|  hypothetical protein CARUB_v10001433mg             206   3e-60    
gb|KHG04077.1|  Myb-related protein                                     203   3e-60    
ref|XP_010463732.1|  PREDICTED: transcription factor MYB3-like          206   3e-60    
gb|AIQ77661.1|  MYB117                                                  202   3e-60    
ref|XP_004159150.1|  PREDICTED: protein ODORANT1-like                   205   3e-60    
emb|CDX85555.1|  BnaA02g02580D                                          206   3e-60    
ref|XP_006413779.1|  hypothetical protein EUTSA_v10027571mg             206   3e-60    
ref|XP_010087606.1|  Transcription factor                               206   3e-60    
ref|XP_011091956.1|  PREDICTED: myb-related protein Zm38-like           205   3e-60    
ref|XP_010060488.1|  PREDICTED: protein ODORANT1                        207   3e-60    
ref|XP_010525098.1|  PREDICTED: myb-related protein 306 isoform X2      206   3e-60    
ref|XP_011096186.1|  PREDICTED: protein ODORANT1-like                   207   3e-60    
ref|XP_008669319.1|  PREDICTED: uncharacterized protein LOC103646361    208   3e-60    
ref|XP_011016457.1|  PREDICTED: transcription factor MYB39-like         206   3e-60    
ref|XP_008678586.1|  PREDICTED: transcription factor MYB32-like         206   3e-60    
ref|XP_010671094.1|  PREDICTED: transcription factor MYB39              206   3e-60    
ref|XP_009131458.1|  PREDICTED: myb-related protein Hv1-like            205   3e-60    
ref|XP_003554566.1|  PREDICTED: transcription factor MYB51              208   3e-60    
ref|XP_008440591.1|  PREDICTED: myb-related protein Hv1                 206   3e-60    
ref|XP_008341354.1|  PREDICTED: myb-related protein 315                 204   4e-60    
ref|XP_010525095.1|  PREDICTED: transcription factor MYB122 isofo...    206   4e-60    
ref|NP_197035.1|  myb domain protein 16                                 205   4e-60    
ref|XP_010492364.1|  PREDICTED: myb-related protein Hv1-like isof...    206   4e-60    
gb|EPS71496.1|  hypothetical protein M569_03262                         201   4e-60    
ref|XP_009778686.1|  PREDICTED: transcription factor MYB39-like         205   4e-60    
ref|XP_010277911.1|  PREDICTED: transcription factor MYB39              206   4e-60    
ref|NP_001078589.1|  myb domain protein 16                              205   4e-60    
ref|XP_004505589.1|  PREDICTED: transcription factor MYB39-like         206   4e-60    
ref|XP_007136252.1|  hypothetical protein PHAVU_009G031200g             206   4e-60    
ref|XP_010032514.1|  PREDICTED: myb-related protein 306                 207   4e-60    
ref|XP_006408360.1|  hypothetical protein EUTSA_v10022405mg             205   4e-60    
ref|XP_010269280.1|  PREDICTED: protein ODORANT1                        206   4e-60    
ref|XP_002882262.1|  MYB107                                             205   4e-60    
ref|XP_009380206.1|  PREDICTED: transcription factor MYB39-like         204   4e-60    
ref|XP_002871660.1|  AtMIXTA/AtMYB16                                    205   4e-60    
gb|KDP34830.1|  hypothetical protein JCGZ_11192                         204   4e-60    
ref|XP_008379158.1|  PREDICTED: myb-related protein 315-like            204   4e-60    
ref|XP_002871736.1|  hypothetical protein ARALYDRAFT_488535             206   4e-60    
ref|XP_009134770.1|  PREDICTED: myb-related protein 308                 206   4e-60    
ref|XP_006653483.1|  PREDICTED: transcription factor MYB39-like         202   5e-60    
ref|XP_004237385.1|  PREDICTED: myb-related protein 315-like            205   5e-60    
ref|XP_008379378.1|  PREDICTED: transcription factor MYB34              207   5e-60    
emb|CDX70606.1|  BnaC03g06900D                                          205   5e-60    
ref|XP_008341595.1|  PREDICTED: transcription factor MYB34-like         207   5e-60    
ref|XP_010424105.1|  PREDICTED: myb-related protein Hv1-like            204   5e-60    
ref|XP_009606781.1|  PREDICTED: myb-related protein 330-like            205   5e-60    
ref|XP_007217733.1|  hypothetical protein PRUPE_ppa006769mg             207   5e-60    
gb|KFK27960.1|  hypothetical protein AALP_AA8G453700                    202   5e-60    
gb|AGN52091.1|  MYB-related transcription factor                        205   5e-60    
ref|XP_008796312.1|  PREDICTED: transcription factor MYB39-like         204   5e-60    
ref|NP_567626.1|  R2R3 family MYB transcription factor                  206   5e-60    
gb|AAM64808.1|  myb-related protein M4                                  206   5e-60    
ref|XP_006431202.1|  hypothetical protein CICLE_v10011948mg             206   5e-60    
ref|XP_006841861.1|  hypothetical protein AMTR_s00003p00271440          206   5e-60    
ref|NP_186944.1|  putative transcription factor MYB107                  205   6e-60    
ref|XP_010523735.1|  PREDICTED: transcription repressor MYB6            204   6e-60    



>ref|XP_009628634.1| PREDICTED: protein ODORANT1-like [Nicotiana tomentosiformis]
Length=281

 Score =   330 bits (845),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 182/268 (68%), Positives = 207/268 (77%), Gaps = 12/268 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE+LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSDAEEKLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTT-------DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            PVTHEPL K+         +S  +K NG  QVQVVPE T  T     SE  NSS STS +
Sbjct  123  PVTHEPLKKEANLIDQPIPESDQNKNNGHQQVQVVPECTSVTAAATSSELDNSSSSTSSS  182

Query  332  ssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNL--SDDHQMIFENLTIPKLD  159
             + +S  DE + VL+T+ +NDPLL SLLE +AP VD  W L  S + Q  F+N+T    D
Sbjct  183  ENSSSITDESKLVLNTLCENDPLLRSLLEADAPLVDSLWELPVSSEEQKNFDNMT--SWD  240

Query  158  ENFAWLMDHQDFGIHDFGYE-CSNVATL  78
            ++F WL+D QDFGIHDFG++ C N   L
Sbjct  241  DSFNWLLDCQDFGIHDFGFDNCFNDVEL  268



>ref|XP_009788709.1| PREDICTED: protein ODORANT1-like [Nicotiana sylvestris]
Length=284

 Score =   321 bits (823),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 176/271 (65%), Positives = 203/271 (75%), Gaps = 15/271 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTA+EDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTADEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE+LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSDAEEKLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTT-------DSTSDKGNGQLQVQVVPEGTPPTVPNLISE---DLnsscst  342
            PVTHEPL K+         +S  +K NG  QVQVVPE T  T     SE      S+ S 
Sbjct  123  PVTHEPLKKEANLIDQPIPESDQNKNNGHQQVQVVPECTSVTAAATSSELDNSSYSASSI  182

Query  341  senssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNL--SDDHQMIFENLTIP  168
            S + + +S  DE + VL+ + +NDPLLSSLLE +AP VD  W L  S + Q  F+N+   
Sbjct  183  SSSENSSSITDESKLVLNALGENDPLLSSLLEVDAPLVDSLWELPVSCEEQKKFDNMA--  240

Query  167  KLDENFAWLMDHQDFGIHDFGYE-CSNVATL  78
              D++  WL+D QDFGIHDFG++ C N   L
Sbjct  241  SWDDSLNWLLDCQDFGIHDFGFDNCFNDVEL  271



>ref|XP_004245722.1| PREDICTED: protein ODORANT1 [Solanum lycopersicum]
Length=287

 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 181/272 (67%), Positives = 209/272 (77%), Gaps = 14/272 (5%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSEAEEKLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKD-------TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            PVTHEPL K+        ++S  +K N    V VVPE T  T     SE  NSS S+S  
Sbjct  123  PVTHEPLKKEENPIDQIISESDQNKNNDHQLVVVVPESTSVTAAATSSELENSSTSSSSA  182

Query  332  ssitstNDEFQRVLDTMSDNDPLLSSLLE-NNAPP-VDLTWNLS----DDHQMIFENLTI  171
            SS  ++ +E + VLDT ++NDPLL+SLLE N+APP +D +W LS    D+  +   N+T 
Sbjct  183  SSSENSCNESKLVLDTFNENDPLLNSLLESNDAPPLIDSSWELSVKSFDNIIINNNNVTS  242

Query  170  PKLDENFAWLMDHQDFGIHDFGYE-CSNVATL  78
               DENF WL+D QDFGIHDFG++ C N   L
Sbjct  243  SWDDENFNWLLDCQDFGIHDFGFDNCFNDVEL  274



>ref|XP_006355506.1| PREDICTED: protein ODORANT1-like [Solanum tuberosum]
Length=281

 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 176/269 (65%), Positives = 208/269 (77%), Gaps = 7/269 (3%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSEAEEKLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPLIK    +  +K N    V VVPE T  T   + SE  NSS S+S  SS  ++ 
Sbjct  123  PVTHEPLIKAENPADKNKNNDHQLVVVVPESTSVTAAAISSELENSSTSSSSASSSENSC  182

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPP-VDLTWNL---SDDHQMIFEN--LTIPKLDENF  150
            +E + VLDT ++NDPLL+SLLE++  P ++ +W L   S D+ +   N  +T    DE+F
Sbjct  183  NESKLVLDTFNENDPLLNSLLESDVTPLINSSWELPIKSFDNIINNSNNHMTSSWDDESF  242

Query  149  AWLMDHQDFGIHDFGYE-CSNVATLM*IF  66
             WL+D QDFGIHDFG++ C N    + +F
Sbjct  243  NWLLDCQDFGIHDFGFDNCFNNDVELEVF  271



>emb|CDP09898.1| unnamed protein product [Coffea canephora]
Length=292

 Score =   311 bits (796),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/260 (63%), Positives = 197/260 (76%), Gaps = 12/260 (5%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI+FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDT--TDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssits  318
            PVTHEPL K+T   +++ D  + + Q   +PE    +    IS   +S    S + +  S
Sbjct  123  PVTHEPLQKETKVAETSPDAESEKHQKLELPEINSGST---ISASASSEDQNSCSPTENS  179

Query  317  tNDE---FQRVLDTMSDNDPLLSSLLENNA---PPVDLTWNLSDDHQMIFENLTIPKLDE  156
            ++DE      +L+ +SD DPL+S LLE  A   P VD  W      Q  F+N  +P LD+
Sbjct  180  SSDESRLLDNILENVSDYDPLISYLLEEEAPVPPVVDAPWEFPAAAQN-FDNPGMPLLDD  238

Query  155  NFAWLMDHQDFGIHDFGYEC  96
            N +WL+D QDFG+HDFG++C
Sbjct  239  NCSWLLDCQDFGVHDFGFDC  258



>gb|AEC11888.1| MYB transcription factor ODO1 [Petunia axillaris]
Length=294

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 168/280 (60%), Positives = 200/280 (71%), Gaps = 24/280 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI+FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE+LVIDLH+ LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSDAEEKLVIDLHSRLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKD-------TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            PVTHEPL K+       TT+S  +K NG  QVQVVP+ T  T     S + + + S S +
Sbjct  123  PVTHEPLKKEANLSDQPTTESDQNKENGHQQVQVVPQSTNVTAAAATSTEFDINSSFSSS  182

Query  332  ssits----tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNL----------SDDHQ  195
            +S +     T +E + V D +S+NDPLLS LLE + P +D  W                 
Sbjct  183  ASSSENSSCTTNESKLVFDNLSENDPLLSCLLEADTPLIDSPWEFPMSSTTTAEEPKSFD  242

Query  194  MIFENLTIPKLDENFAWLMDHQDFGIHDFGYE-CSNVATL  78
             I  N+T    ++ F WL  +Q+FGI+DFG++ C N   L
Sbjct  243  SIISNMT--SWEDTFNWLSGYQEFGINDFGFDNCFNHVEL  280



>sp|Q50EX6.1|ODO1_PETHY RecName: Full=Protein ODORANT1; AltName: Full=MYB-like protein 
ODO1 [Petunia x hybrida]
 gb|AAV98200.1| MYB-like protein ODORANT1 [Petunia x hybrida]
Length=294

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 168/280 (60%), Positives = 201/280 (72%), Gaps = 24/280 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI+FIL+NGQCCWRA+PKLAGL+RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLKRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE+LVIDLH+ LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSDAEEKLVIDLHSRLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKD-------TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            PVTHEPL K+       TT+S  +K NG  QVQVVP+ T  T     S + +++ S S +
Sbjct  123  PVTHEPLKKEANLSDQPTTESDQNKENGHQQVQVVPQSTNVTAAAATSTEFDNNSSFSSS  182

Query  332  ssits----tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNL----------SDDHQ  195
            +S +     T DE + V D +S+NDPLLS LLE + P +D  W                 
Sbjct  183  ASSSENSSCTTDESKLVFDNLSENDPLLSCLLEADTPLIDSPWEFPMSSTTTVEEPKSFD  242

Query  194  MIFENLTIPKLDENFAWLMDHQDFGIHDFGYE-CSNVATL  78
             I  N+T    ++ F WL  +Q+FGI+DFG++ C N   L
Sbjct  243  SIISNMT--SWEDTFNWLSGYQEFGINDFGFDNCFNHVEL  280



>gb|AEC11890.1| MYB transcription factor ODO1 [Petunia exserta]
Length=294

 Score =   310 bits (794),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 168/280 (60%), Positives = 201/280 (72%), Gaps = 24/280 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI+FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE+LVIDLH+ LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSDAEEKLVIDLHSRLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKD-------TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            PVTHEPL K+       TT+S  +K NG  QVQVVP+ T  T     S + +++ S S +
Sbjct  123  PVTHEPLKKEANLSDQPTTESDQNKENGHQQVQVVPQSTNVTAAAATSTEFDNNSSFSSS  182

Query  332  ssits----tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNL----------SDDHQ  195
            +S +     T +E + V D +S+NDPLLS LLE + P +D  W                 
Sbjct  183  ASSSENSSCTTNESKLVFDNLSENDPLLSCLLEADTPLIDSPWEFPMSSTTTVEEPKSFD  242

Query  194  MIFENLTIPKLDENFAWLMDHQDFGIHDFGYE-CSNVATL  78
             I  N+T    ++ F WL  +Q+FGI+DFG++ C N   L
Sbjct  243  SIISNMT--SWEDTFNWLSGYQEFGINDFGFDNCFNHVEL  280



>gb|AEC11889.1| MYB transcription factor ODO1 [Petunia axillaris]
Length=294

 Score =   304 bits (779),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 165/280 (59%), Positives = 199/280 (71%), Gaps = 24/280 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI+FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE+LVIDLH+ LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSDAEEKLVIDLHSRLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDT-------TDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            PVTHEPL K+        T+S  +K NG  QVQVVP+ T  T     S + +++ S S +
Sbjct  123  PVTHEPLKKEANLSDQPNTESDQNKENGHQQVQVVPQSTNVTAAAATSTEFDNNSSFSSS  182

Query  332  ssits----tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNL----------SDDHQ  195
            +S +     T +E + + D +S+NDPLLS LLE + P +D  W                 
Sbjct  183  ASSSENSSCTTNESKLIFDNLSENDPLLSCLLEADTPLIDSPWEFPMSSTTTAEEPKSFD  242

Query  194  MIFENLTIPKLDENFAWLMDHQDFGIHDFGYE-CSNVATL  78
             I  N+T    ++ F WL   ++FGI+DFG++ C N   L
Sbjct  243  SIISNMT--SWEDTFNWLSGCEEFGINDFGFDNCFNHVEL  280



>ref|XP_011081193.1| PREDICTED: protein ODORANT1 [Sesamum indicum]
Length=277

 Score =   296 bits (757),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 182/257 (71%), Gaps = 3/257 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLNEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPT-VPNLISEDLnsscstsenssitst  315
            PVTHEPL K+T          Q   Q        T +P      +N   ++   +   S 
Sbjct  123  PVTHEPLHKETDQDPQQSHAAQKSPQSDSNHDDQTQLPGADVVPVNLDENSYSPTDQNSC  182

Query  314  NDEFQRVLDTMSDNDPLLSSLLE--NNAPPVDLTWNLSDDHQMIFENLTIPKLDENFAWL  141
            +DE       + +NDPL+S L +  N+ P  D++W L    +  F++L     +EN  WL
Sbjct  183  SDESNLPDANLYENDPLISCLFQDDNDPPQADVSWELFPSPEENFDSLFATSWEENCPWL  242

Query  140  MDHQDFGIHDFGYECSN  90
            +D QDFG+HDF Y C N
Sbjct  243  LDCQDFGVHDFDYGCFN  259



>gb|KHG18117.1| Protein ODORANT1 [Gossypium arboreum]
Length=263

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/260 (59%), Positives = 193/260 (74%), Gaps = 18/260 (7%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEED+KLI FIL+NGQCCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDQKLINFILTNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLVKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL            N Q + +  P     +  N I+E+  ++ ++SE++S T+  
Sbjct  123  PVTHEPL------------NKQSKTEQSPSHGHNSADNHITENDGTAANSSEDNSSTTPT  170

Query  311  DEFQR-----VLDTMSDNDPLLSSLLENNAPPVDLTWNLS-DDHQMIFENLTIPKLDENF  150
            +         +LD++ +++ LL+SL  +  P  D +WN +    +   +  ++P  +++ 
Sbjct  171  ENCSTTDDSILLDSICNDESLLTSLWLDEPPLADDSWNSTVPAAETCNDQTSLPSWEDSI  230

Query  149  AWLMDHQDFGIHDFGYECSN  90
            AWL+D QDFGIHDFG++C N
Sbjct  231  AWLLDCQDFGIHDFGFDCLN  250



>gb|AGN52048.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52158.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=252

 Score =   293 bits (749),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/254 (61%), Positives = 174/254 (69%), Gaps = 25/254 (10%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLNDAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL KD T+            Q  P   PP VP    E          + S T  N
Sbjct  123  PVTHEPLNKDQTEEKQ---------QTPP---PPDVPFAGDE---------TSCSPTDQN  161

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDENFAWLMDH  132
                     M +NDPL+S L  ++ P +D  W          E +     D +  WL+D 
Sbjct  162  SSSDESNSNMYENDPLISCLFRDDPPQMDFPWEFPSAE----EGVAASAWDHSCQWLLDC  217

Query  131  QDFGIHDFGYECSN  90
            QDFG+HDFG+EC N
Sbjct  218  QDFGVHDFGFECFN  231



>gb|AAF22256.1| myb-related transcription factor [Spuriopimpinella brachycarpa]
Length=269

 Score =   293 bits (750),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 158/257 (61%), Positives = 186/257 (72%), Gaps = 11/257 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTA+ED KLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTADEDNKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQLVIDLHA LGNRWSKIA +LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTDAEEQLVIDLHARLGNRWSKIAGRLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL K+ T+S  +      Q     E   P +P+  + D+ SS ++   +   S+ 
Sbjct  123  PVTHEPLHKEETNSQKEILLQPFQSPAETENHVPPIPH--TNDMASSENSCTPTDQNSSG  180

Query  311  DEFQRVLDTMSD--NDPLLSSLLENNAPP-VDLTWNLSDDHQMIFENLTIPKLDENFAWL  141
            DE    L  + D  +D L+S L E++ P  VD  W   +   M+     +P  DE+F WL
Sbjct  181  DE-SNSLSAICDQIDDSLISYLFEDDTPGLVDAPWENFNKVDMV-----LPSWDESFPWL  234

Query  140  MDHQDFGIHDFGYECSN  90
            +D QDFGI DFG++C N
Sbjct  235  LDCQDFGIQDFGFDCFN  251



>gb|KDP25612.1| hypothetical protein JCGZ_20768 [Jatropha curcas]
 gb|AIT52314.1| MYB family protein [Jatropha curcas]
Length=282

 Score =   293 bits (750),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 160/273 (59%), Positives = 198/273 (73%), Gaps = 17/273 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL K+    T +  +      ++PE    +  + I E+     S+ ENSS +  +
Sbjct  123  PVTHEPLQKEA--KTEESSSVSQTDHLLPEPANNSSNDSIQENDGIVNSSEENSSSSQND  180

Query  311  DEFQR----VLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQM-----IFEN------L  177
              F R    +LD++ ++  LL+SLL +  P +D +WN ++++         EN       
Sbjct  181  QNFCRDESILLDSICNDTTLLNSLLMDEPPLIDASWNNTNNNNNNNSPPALENPNREMGY  240

Query  176  TIPKLDENFAWLMDHQDFGIHDFGYECSNVATL  78
              P  ++N  WL+D QDFG+HDFG++CS+ A L
Sbjct  241  PYPSWEDNCTWLLDCQDFGVHDFGFDCSDSAAL  273



>ref|XP_007039958.1| Myb domain protein 42 [Theobroma cacao]
 gb|EOY24459.1| Myb domain protein 42 [Theobroma cacao]
Length=285

 Score =   293 bits (750),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 155/256 (61%), Positives = 188/256 (73%), Gaps = 10/256 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDT-TDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitst  315
            PVTHE L K+   + +S   +     Q   E          SED     ++S  +   S+
Sbjct  123  PVTHESLNKEAKAEESSSHADHSADNQNTTENDGIVNS---SED-----NSSTPTENCSS  174

Query  314  NDEFQRVLDTMSDNDPLLSSLLENNAPP-VDLTWNLSDDHQMIFENLTIPKLDENFAWLM  138
              +   +LD++ +++ LL+SLL  + PP VD +WN     +   +  ++P  +++ AWL 
Sbjct  175  TTDDSNLLDSICNDESLLTSLLWMDEPPLVDASWNSVPAGETACKGTSLPPWEDDCAWLP  234

Query  137  DHQDFGIHDFGYECSN  90
            D QDFGIHDFG++C N
Sbjct  235  DCQDFGIHDFGFDCLN  250



>ref|XP_002264150.2| PREDICTED: protein ODORANT1 [Vitis vinifera]
 emb|CBI41085.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/254 (60%), Positives = 183/254 (72%), Gaps = 4/254 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTESEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEP  K      +                 P    +I+   +   S+S     +S+ 
Sbjct  123  PVTHEPFHKQAAAKETSPRADHFPENDTHNLQLPDSDGIINS--DQDNSSSSPPENSSST  180

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDENFAWLMDH  132
            DE  R+LD++ ++D L++ L  +  P VD +W      +  F N+ +P  D++ AWL+D 
Sbjct  181  DE-SRLLDSVCNDDSLMNCLWGDEMPLVDASWKFPSAGEN-FSNMGLPSWDDSCAWLLDC  238

Query  131  QDFGIHDFGYECSN  90
            QDFGIHDFG +C N
Sbjct  239  QDFGIHDFGIDCFN  252



>ref|XP_003516672.1| PREDICTED: protein ODORANT1 [Glycine max]
 gb|KHN42714.1| Protein ODORANT1 [Glycine soja]
Length=269

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 185/252 (73%), Gaps = 4/252 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FILSNGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILSNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+Q EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTQAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL K    S+ D  +       V       V    ++ + +S   S +S   +++
Sbjct  123  PVTHEPLNKQV--SSKDSSSPAEHFSQVNNINIHQVEQ--NDGVLNSEENSTSSPAENSS  178

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDENFAWLMDH  132
             E   ++D++  +  L++S+  +  P +D  W+ +   +    N+ +P  ++N AWL+D 
Sbjct  179  GEESLLVDSICSDVSLINSMWLDETPLMDTLWDNTPKVENANNNMGLPIGEDNCAWLLDC  238

Query  131  QDFGIHDFGYEC  96
            QDFGIHDFG+ C
Sbjct  239  QDFGIHDFGFNC  250



>ref|XP_006368692.1| hypothetical protein POPTR_0001s07830g [Populus trichocarpa]
 gb|ERP65261.1| hypothetical protein POPTR_0001s07830g [Populus trichocarpa]
Length=270

 Score =   291 bits (746),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/254 (59%), Positives = 182/254 (72%), Gaps = 6/254 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+K GID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKRGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL K+     S          ++PE +   V       + +S     + +  S++
Sbjct  123  PVTHEPLHKEARPEESSSS----HADILPESSNNNVMQENDGIVINSDDNPRSPTENSSS  178

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWN--LSDDHQMIFENLTIPKLDENFAWLM  138
             E   +LD++ +++ LL+SL     P VD +WN  +        ++   P  +EN+ WL 
Sbjct  179  PEDSILLDSICNDEMLLNSLWMEEPPLVDASWNNIIPPAAANTNDDTGYPSWEENYTWLS  238

Query  137  DHQDFGIHDFGYEC  96
            D QDFG+HDFG EC
Sbjct  239  DCQDFGVHDFGLEC  252



>ref|XP_004515780.1| PREDICTED: protein ODORANT1-like [Cicer arietinum]
Length=275

 Score =   291 bits (746),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/259 (60%), Positives = 185/259 (71%), Gaps = 9/259 (3%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTEQEEQLVIDLHARLGNRWSKIASRLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            P+THEPL K TT   S   +        P              + +S   S +S   +++
Sbjct  123  PITHEPLNKQTTSQDSTNSS---PADNFPHAENNHEVKGTDGVVVNSEENSSSSPAENSS  179

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLT-----IPKLDENFA  147
             E   +LD++  +D L++SL  +  P V+  W   D+  +I EN       +P  ++N +
Sbjct  180  GEDSLLLDSICSDDSLMNSLWLDETPLVEALWEW-DNTTVIEENTKNDMSFVPSWEDNCS  238

Query  146  WLMDHQDFGIHDFGYECSN  90
            WL+D QDFGIHDFG+ C N
Sbjct  239  WLLDCQDFGIHDFGFNCFN  257



>gb|EYU26820.1| hypothetical protein MIMGU_mgv1a027167mg [Erythranthe guttata]
Length=288

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 189/271 (70%), Gaps = 18/271 (7%)
 Frame = -2

Query  848  QPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLRP  669
            QPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLRP
Sbjct  4    QPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLRP  63

Query  668  DLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGIDP  489
            DLKRGLL+Q EEQLVIDLH+  GNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGIDP
Sbjct  64   DLKRGLLNQAEEQLVIDLHSRFGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGIDP  123

Query  488  VTHEPLIKDTTDSTSDKGNGQLQVQV-VPEGTP------------PTVPNLISEDLnssc  348
            VTHEPL  +TT+  +   N     Q   P+GT              T P+  S + NS  
Sbjct  124  VTHEPLHNETTNKENSNDNDPKNTQSHTPQGTSLGLENGTLSPEGATAPSAASLEENSYN  183

Query  347  stsenssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNL-----SDDHQMIFE  183
            S +     ++++++ +   + + +NDPL+S L  +  P ++  W L     S++   +  
Sbjct  184  SPASTDQNSTSSEDTESNNEKLYENDPLISCLFNDEDPIIESPWELLLQAHSNEQDNLDS  243

Query  182  NLTIPKLDENFAWLMDHQDFGIHDFGYECSN  90
               +   +EN  WL+D QDFGIHDFG++  N
Sbjct  244  FWAMMPWEENCPWLLDCQDFGIHDFGFDSFN  274



>gb|KHG16103.1| Protein ODORANT1 [Gossypium arboreum]
Length=262

 Score =   290 bits (741),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 151/253 (60%), Positives = 185/253 (73%), Gaps = 13/253 (5%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLSETEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKD--TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssits  318
            PVTHEPL K+  T +S+S   +         +G   +     SED       S + +   
Sbjct  123  PVTHEPLNKEAKTEESSSHAHHSADNHTTENDGIANS-----SED------NSSSPTENC  171

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDENFAWLM  138
            +  +   +LD + +++ LL+SL  +  P VD++W      +      ++P  +E+ AWL+
Sbjct  172  STTDDPNLLDAICNDESLLNSLWMDEPPLVDVSWTSISAGESNCNLTSLPSWEEDCAWLL  231

Query  137  DHQDFGIHDFGYE  99
            D+QDFG +DFG++
Sbjct  232  DYQDFGTNDFGFD  244



>ref|XP_004298679.1| PREDICTED: protein ODORANT1-like isoform 1 [Fragaria vesca subsp. 
vesca]
 ref|XP_004298680.1| PREDICTED: protein ODORANT1-like isoform 2 [Fragaria vesca subsp. 
vesca]
Length=279

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 185/266 (70%), Gaps = 20/266 (8%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL++MGID
Sbjct  63   PDLKRGLLTESEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLRMGID  122

Query  491  PVTHEPLIKD---------TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscsts  339
            PVTHE L KD         T  S +D  N  L        +  + P   S  +      S
Sbjct  123  PVTHELLHKDQDDLANKETTISSHTDPANSNLPQSTAENSSSNSSPAENSSSI------S  176

Query  338  enssitstNDEFQRVLDTMSDND-PLLSSLLENNAPPVDLTWN---LSDDHQMIFENL-T  174
              +   ST D+   ++D++ + D  L++SL  +  P +D  WN   ++D    I   +  
Sbjct  177  SPNENPSTGDDQSTLIDSICNIDESLMNSLWVDETPLIDALWNNDQVADGGNYIENGMGM  236

Query  173  IPKLDENFAWLMDHQDFGIHDFGYEC  96
            +   +EN +WL+D QDFG+HDFG +C
Sbjct  237  VSNWEENCSWLLDCQDFGVHDFGMDC  262



>ref|XP_011018242.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=270

 Score =   286 bits (732),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 184/256 (72%), Gaps = 10/256 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGK CR RWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKRCRHRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+K GID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKRGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISED--Lnsscstsenssits  318
            PVTHEPL K+     S          ++PE +   V  ++  D  + +S     + +  S
Sbjct  123  PVTHEPLHKEARPEESSSS----HADILPESSNNNV--MLENDGIVINSDDNPRSPTENS  176

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWN--LSDDHQMIFENLTIPKLDENFAW  144
            ++ E   +LD++ +++ LL+SL  +  P VD +WN  +        ++   P  +EN+ W
Sbjct  177  SSPEDSILLDSICNDEMLLNSLWMDEPPLVDASWNNIIPPAAANTNDDTGYPSWEENYTW  236

Query  143  LMDHQDFGIHDFGYEC  96
            L D QDFG+HDFG EC
Sbjct  237  LSDCQDFGVHDFGLEC  252



>gb|KEH31681.1| myb transcription factor [Medicago truncatula]
Length=272

 Score =   286 bits (732),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 156/261 (60%), Positives = 187/261 (72%), Gaps = 15/261 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLITFIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLITFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIASRLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISE--DLnsscstsenssits  318
            P+THEPL K  + + S               + P   + + E   + +S   S +S   +
Sbjct  123  PITHEPLNKQASSNDS------STSSPAENFSQPVNNHEVKETDGVVNSEENSSSSPAEN  176

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLT-----IPKLDEN  153
            ++ E   +LD++  +D L++S+  +  P V+  W +  D   I EN       +P  ++N
Sbjct  177  SSGEESLLLDSICSDDSLMNSIWLDETPLVEALWEM--DTTPIAENTKNDINFMPSWEDN  234

Query  152  FAWLMDHQDFGIHDFGYECSN  90
             AWL D QDFGIHDFG+ C N
Sbjct  235  CAWLFDCQDFGIHDFGFNCFN  255



>ref|XP_009595050.1| PREDICTED: protein ODORANT1-like [Nicotiana tomentosiformis]
Length=277

 Score =   285 bits (730),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 183/274 (67%), Gaps = 34/274 (12%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWT EEDKKLI F+L+NGQCCWR++PKLAGLRRCGKSCRLRWTNYL 
Sbjct  3    RQPCCDKLGVKKGPWTTEEDKKLINFLLTNGQCCWRSVPKLAGLRRCGKSCRLRWTNYLH  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRG+L++ EE+LVIDLH+ LGNRWSKIA +LPGRTDNEIKN+WNTHIKKKL+KMGID
Sbjct  63   PDLKRGVLTEVEEKLVIDLHSCLGNRWSKIAVRLPGRTDNEIKNNWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTV--PNLISEDLnsscstsenssits  318
            P+THEPL K+T  S      G  QV VVPE T       N+++E  N + +++      S
Sbjct  123  PITHEPLHKETKPSNQSTTTGHQQVHVVPESTNVIAQSTNVVAESTNVTKASTSLELENS  182

Query  317  t-----------------NDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMI  189
            +                  DE Q VLDT +D   L+ S  E +A       N        
Sbjct  183  SIFSYDLSFSPNENSSCITDETQLVLDTFTDVAHLIDSPWEFSASATAQKQN--------  234

Query  188  FENLTIPKLDENFAWLMDHQDFGIHDFGYECSNV  87
            F+N       ENF WL+D QDFGI DFG++  NV
Sbjct  235  FDN-------ENFNWLLDCQDFGIQDFGFDNFNV  261



>ref|XP_002303526.2| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE78505.2| myb family transcription factor family protein [Populus trichocarpa]
Length=270

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/260 (58%), Positives = 185/260 (71%), Gaps = 6/260 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+K GID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKRGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL K+     S      L    +PE +           + +S   S + +  S +
Sbjct  123  PVTHEPLHKEAKPEESSSSPADL----LPESSNNNDMQEKDGIVINSDDNSRSPTENSCS  178

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWN--LSDDHQMIFENLTIPKLDENFAWLM  138
             E   +LD++ +++ LL+SL  +  P VD +WN  +    +    ++  P  ++N+  L 
Sbjct  179  TEDSLLLDSICNDEMLLNSLWMDEPPLVDASWNKIIPLAAENTNNDMGYPSWEDNYTGLS  238

Query  137  DHQDFGIHDFGYECSNVATL  78
            D QDFG+HDFG++C +   L
Sbjct  239  DCQDFGVHDFGFDCFDTIEL  258



>ref|XP_011033909.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=270

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 187/262 (71%), Gaps = 10/262 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+K GID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKSGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL K+     S          ++PE +           + +S   S + +  S +
Sbjct  123  PVTHEPLHKEAKPEES----SSYPADLLPESSNNNDMQEKDGIVINSDDNSRSPTENSCS  178

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWN----LSDDHQMIFENLTIPKLDENFAW  144
             E   +LD++ +++ LL+SL  +  P VD +WN    L+ ++   +  +  P  ++N+  
Sbjct  179  TEDSLLLDSICNDEMLLNSLWMDEPPLVDASWNKIIPLAAENTNNY--MDYPSWEDNYTG  236

Query  143  LMDHQDFGIHDFGYECSNVATL  78
            L D QDFG+HDFG++C +   L
Sbjct  237  LSDCQDFGVHDFGFDCFDTIEL  258



>ref|XP_007157323.1| hypothetical protein PHAVU_002G060500g [Phaseolus vulgaris]
 gb|ESW29317.1| hypothetical protein PHAVU_002G060500g [Phaseolus vulgaris]
Length=267

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 182/253 (72%), Gaps = 8/253 (3%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+Q EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTQAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQL-QVQVVPEGTPPTVPNLISEDLnsscstsenssitst  315
            PVTHEPL K  +   S      L QV  + +     V     E+       S +S   ++
Sbjct  123  PVTHEPLNKQLSSHDSSSPADHLPQVDNIHQVKENGVTLNWEEN-------STSSPAENS  175

Query  314  NDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDENFAWLMD  135
            + E   +++++  +  L++S+  +  P +D  W+ +   +     + +P  ++N  WL+D
Sbjct  176  SGEESLLMNSICSDVYLMNSMWLDETPLMDTLWDSTPKLENENNGMGLPMWEDNCPWLLD  235

Query  134  HQDFGIHDFGYEC  96
             QDFGIHDFG+ C
Sbjct  236  CQDFGIHDFGFNC  248



>ref|XP_006440395.1| hypothetical protein CICLE_v10021695mg [Citrus clementina]
 gb|ESR53635.1| hypothetical protein CICLE_v10021695mg [Citrus clementina]
Length=267

 Score =   283 bits (724),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 156/261 (60%), Positives = 188/261 (72%), Gaps = 23/261 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTS---DKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssit  321
            PVTHEPL K+T    +   D  N Q       +GT   V +  S           + +  
Sbjct  123  PVTHEPLHKETKAEDNLLPDSSNQQKAES--SDGTNNNVEDNSSS----------SPTEN  170

Query  320  stNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKL------D  159
            S++ +   +L+ + ++D LL+SL  +  P +D  WN+S+  Q + EN+    L       
Sbjct  171  SSSTDDSLLLENICNDDCLLNSLWIDEPPLIDAPWNISN--QPVEENINETGLPVAWDHQ  228

Query  158  ENFAWLMDHQDFGIHDFGYEC  96
            +N +WL+D QDFGIHDFG +C
Sbjct  229  DNCSWLLDCQDFGIHDFGIDC  249



>gb|KDO48409.1| hypothetical protein CISIN_1g024441mg [Citrus sinensis]
Length=267

 Score =   283 bits (724),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/260 (60%), Positives = 190/260 (73%), Gaps = 21/260 (8%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTT--DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssits  318
            PVTHEPL K+T   D+     + Q + +   +GT   V +  S           + +  S
Sbjct  123  PVTHEPLHKETKAEDNLPPDSSNQQKAE-SSDGTNNNVEDNSSS----------SPTENS  171

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKL------DE  156
            ++ +   +L+ + ++D LL+SL  +  P +D  WN+S+  Q + EN+    L       +
Sbjct  172  SSTDDSLLLENICNDDCLLNSLWIDEPPLIDAPWNISN--QPVEENINETGLPVAWDHQD  229

Query  155  NFAWLMDHQDFGIHDFGYEC  96
            N +WL+D QDFGIHDFG +C
Sbjct  230  NCSWLLDCQDFGIHDFGIDC  249



>ref|XP_008369511.1| PREDICTED: protein ODORANT1 [Malus domestica]
Length=302

 Score =   283 bits (725),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 158/288 (55%), Positives = 192/288 (67%), Gaps = 43/288 (15%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI+FI++NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLISFIITNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA +LPGRTDNEIKNHWNTHIKKKL++MGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAGRLPGRTDNEIKNHWNTHIKKKLLRMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQ---------------------VQVVPEGTPPTVPNL  375
            PVTHEPL K+    ++ KG                          +    E     V + 
Sbjct  123  PVTHEPLHKEEELPSNIKGTNSSSSSSHDHDDHNNNLPADQSTNDLHNSQENDQSVVNSS  182

Query  374  ISEDLnsscstsenssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQ  195
             SED+NSS   S   + ++       +LD + ++D L++SL  +  P +D  WN  D++Q
Sbjct  183  GSEDINSSTENSSTGAESA-------LLDNICNDDSLMNSLWMDETPLIDALWN--DNNQ  233

Query  194  M----------IFENLTI---PKLDENFAWLMDHQDFGIHDFGYECSN  90
            +          I EN  +      ++N AWL+D QDFGIHDFG +C N
Sbjct  234  VELDQGGIDYNIIENNGMGFQSNWEDNCAWLLDCQDFGIHDFGMDCFN  281



>ref|XP_007155582.1| hypothetical protein PHAVU_003G214300g [Phaseolus vulgaris]
 gb|ESW27576.1| hypothetical protein PHAVU_003G214300g [Phaseolus vulgaris]
Length=319

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 187/255 (73%), Gaps = 5/255 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  52   RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  111

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMG+D
Sbjct  112  PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGVD  171

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL K      S         + +P+     V    ++ + +S   S +S   +++
Sbjct  172  PVTHEPLNKQAASQDSS----SSPSEHLPQPGNNLVQVKETDGVLNSEENSSSSQAENSS  227

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENL-TIPKLDENFAWLMD  135
             +   +L+++  +D LL++L  +  P ++  W+ +   +    N+ ++P  ++N  WL+D
Sbjct  228  GDDSLLLESICSDDSLLNTLWLDETPLMEALWDTTPKLENTSSNMGSVPSWEDNCGWLLD  287

Query  134  HQDFGIHDFGYECSN  90
             QDFGIHDFG+ C N
Sbjct  288  CQDFGIHDFGFNCFN  302



>ref|XP_010277005.1| PREDICTED: protein ODORANT1-like [Nelumbo nucifera]
Length=274

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 182/259 (70%), Gaps = 15/259 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NG  CWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGHYCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQLVIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLSEAEEQLVIDLHARLGNRWSKIASGLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGT-------PPTVPNLISEDLnsscstsen  333
            PVTHEPL K    +T++  +       + E               +ISED     ++S +
Sbjct  123  PVTHEPLHKQAAATTTELPSSPADHHELTESNNHGSSSSSEAGGRVISED-----NSSSS  177

Query  332  ssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTI--PKLD  159
            ++   + DE  R+ D    +  L+S L  ++ PP + +WN S      + N+ +  P  +
Sbjct  178  TAENCSGDE-SRLSDNNWVDGSLMSCLWGDDEPPQEASWNKSPVTGETYNNVDVGLPSWE  236

Query  158  ENFAWLMDHQDFGIHDFGY  102
            +N AWL+D QDFG+ +FG+
Sbjct  237  DNCAWLLDCQDFGVEEFGF  255



>ref|XP_009354562.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
 ref|XP_009354566.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=300

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 156/290 (54%), Positives = 192/290 (66%), Gaps = 46/290 (16%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI+FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA +LPGRTDNEIKNHWNTHIKKKL++MGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAGRLPGRTDNEIKNHWNTHIKKKLLRMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQ-------------------VQVVPEGTPPTVPNLIS  369
            PVTHEPL K+   S   + N                       +    E     V +  S
Sbjct  123  PVTHEPLHKEELPSNIKENNSSSSSHDHSDHENNLPADKSINGLHNSQENDQSMVNSSGS  182

Query  368  EDLnsscstsenssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWN--------  213
            ED+NSS   S   + +        +LD++ +++ L+++L  +  P +D  WN        
Sbjct  183  EDINSSTENSSTGAESV-------LLDSICNDNLLMNTLWMDETPLIDALWNDNNQVELD  235

Query  212  -------LSDDHQMIFENLTIPKLDENFAWLMDHQDFGIHDFGYEC-SNV  87
                   +++++ M F+       D+N+ WL+D QDFGIHDFG +C SNV
Sbjct  236  RGGINYSITENNGMGFQ----SNWDDNWTWLLDCQDFGIHDFGMDCFSNV  281



>ref|XP_006600811.1| PREDICTED: protein ODORANT1-like [Glycine max]
 gb|KHN09750.1| Protein ODORANT1 [Glycine soja]
Length=274

 Score =   281 bits (719),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 186/255 (73%), Gaps = 1/255 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL+RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLKRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+K+GID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKIGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL K    S+ D  +   +    P              L +S   S +S   +++
Sbjct  123  PVTHEPLKKQAAASSQDSSSSPAEHLPQPGNNLDDQVKETEGILLNSEENSSSSQAENSS  182

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLT-IPKLDENFAWLMD  135
             +   +LD++  +D LL+S+  +  P V+  W+ + + +    N+  +P  ++N AWL+D
Sbjct  183  GDDSLLLDSICSDDSLLNSMWLDETPLVEALWDTTPNLENTSNNMGLLPSWEDNCAWLLD  242

Query  134  HQDFGIHDFGYECSN  90
             QDFGIHDFG+ C N
Sbjct  243  CQDFGIHDFGFTCFN  257



>ref|NP_001241087.1| protein ODORANT1-like [Glycine max]
 gb|ACU24041.1| unknown [Glycine max]
 gb|AGO06072.1| transcription factor MYBJ1 [Glycine max]
 gb|KHN34452.1| Protein ODORANT1 [Glycine soja]
Length=271

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/251 (60%), Positives = 186/251 (74%), Gaps = 1/251 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLIKFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL K    S+ D  +   +    P           +  L +S   S +S   +++
Sbjct  123  PVTHEPLNKQAAASSQDSSSSPAEHLPQPGNNLDDQVKETNGVLLNSEENSSSSQAENSS  182

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLT-IPKLDENFAWLMD  135
             +   +L+++  +D LL+S+  +  P V+  W+ + + +    N++ +P  +EN AWL+D
Sbjct  183  GDDSLLLESICSDDSLLNSMWLDETPLVEALWDTTPNLENTNNNMSLLPSWEENCAWLLD  242

Query  134  HQDFGIHDFGY  102
             QDFGIHDFG+
Sbjct  243  CQDFGIHDFGF  253



>ref|XP_011069675.1| PREDICTED: protein ODORANT1 [Sesamum indicum]
Length=269

 Score =   281 bits (718),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 151/261 (58%), Positives = 178/261 (68%), Gaps = 20/261 (8%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHAHLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEPL K+   S S   +        PE          + DL     +       S++
Sbjct  123  PVTHEPLHKEHEKSESHAADN------FPESEKMNQLQETNNDL----GSGSPEDQNSSS  172

Query  311  DEFQRVLDTMSDNDPLLSSLLE-------NNAPPVDLTWNLSDDHQMIFENLTIPKLDEN  153
            DE       + +NDPL+S L         N+   + + W    ++   F        DE+
Sbjct  173  DESNLPDRNLYENDPLISCLFRDDDHDQDNDPDQLQVPWEFQSENLGSF---CPTSWDES  229

Query  152  FAWLMDHQDFGIHDFGYECSN  90
             +WL+D QDFG+HDFG++C N
Sbjct  230  CSWLLDCQDFGVHDFGFDCFN  250



>gb|KGN50209.1| hypothetical protein Csa_5G160120 [Cucumis sativus]
Length=258

 Score =   279 bits (714),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 180/256 (70%), Gaps = 18/256 (7%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTA+EDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTADEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTDTEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVV--PEGTPPTVPNLISEDLnsscstsenssits  318
            PVTHEP+ K   +  +   N + +   V     +PPT+ N  S   + S    +N+  +S
Sbjct  123  PVTHEPIQKQPENEKNQSSNTKTENNTVLDSSSSPPTMENSSSVTTDESSFLLDNNLSSS  182

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDENFAWLM  138
             N+     +   S    +    L NN PP+      S+    ++E        EN +WL+
Sbjct  183  NNNHESSFITNTS--FWIDEEALWNNNPPI------SNGANFLWE--------ENCSWLL  226

Query  137  DHQDFGIHDFGYECSN  90
            D +DFGIHDFG++C N
Sbjct  227  DCEDFGIHDFGFDCFN  242



>ref|XP_007210741.1| hypothetical protein PRUPE_ppa021568mg [Prunus persica]
 gb|EMJ11940.1| hypothetical protein PRUPE_ppa021568mg [Prunus persica]
Length=291

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 204/298 (68%), Gaps = 27/298 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL++MGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLRMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPP---------TVPNLISEDLnsscsts  339
            PVTHEPL K+     S + N            P           V +  SED+NSS S  
Sbjct  123  PVTHEPLHKEDQLGCSKETNSSSSSHDHKNNLPDHQSTNDHSMVVNSAGSEDMNSSSSPP  182

Query  338  enssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWN----LSDDH---QMIFEN  180
            ENSS     DE   +LD++ +++ L+ +L  +  P +D  W+    +  DH   ++  EN
Sbjct  183  ENSSSG---DE-STLLDSICNDESLMKNLWVDETPLIDALWSNNGQVVADHGGNEINIEN  238

Query  179  -LTIPKLDENFAWLMDHQDFGIHDFGYE-CSNVATLM*IF*VQ*IPRIMYNKLIKTIN  12
             + +   ++N AWL+D QDFG+HDFG + C N   L  +  ++     M +KL  TIN
Sbjct  239  GMGLQSWEDNCAWLLDCQDFGVHDFGMDYCFNDVELNGLSTLE-----MGDKLSTTIN  291



>ref|XP_006477265.1| PREDICTED: protein ODORANT1-like [Citrus sinensis]
Length=267

 Score =   278 bits (710),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 188/259 (73%), Gaps = 21/259 (8%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTT--DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssits  318
            PVTHEPL K+T   D+     + Q + +   +GT   V +  S           + +  S
Sbjct  123  PVTHEPLHKETKAEDNLPPDSSNQQKAE-SSDGTNNNVEDNSSS----------SPTENS  171

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKL------DE  156
            ++ +   +L+ + ++D LL+SL  +  P +D  WN+S+    + EN+    L       +
Sbjct  172  SSTDDSLLLENICNDDCLLNSLWIDEPPLIDAPWNISN--PPVEENINETGLPVAWDHQD  229

Query  155  NFAWLMDHQDFGIHDFGYE  99
            N +WL+D QDFGIHDFG +
Sbjct  230  NCSWLLDCQDFGIHDFGID  248



>ref|XP_008238636.1| PREDICTED: protein ODORANT1 [Prunus mume]
Length=291

 Score =   278 bits (711),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 163/298 (55%), Positives = 202/298 (68%), Gaps = 27/298 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL++MGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLRMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTP--------PTVPNLI-SEDLnsscsts  339
            PVTHEPL K+     S + N            P          V N   SED+    S+S
Sbjct  123  PVTHEPLHKEDQLGCSKETNSSSSSHDHKNNLPDHQSTNDHSMVANSAGSEDM---NSSS  179

Query  338  enssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWN----LSDDH---QMIFEN  180
                 +S+ DE   +LD++ +++ L+ +L  +  P +D  W+    +  DH   ++  EN
Sbjct  180  SPPENSSSGDE-STLLDSICNDESLMKNLWVDETPLIDALWSNNGQVVADHGGNEINIEN  238

Query  179  -LTIPKLDENFAWLMDHQDFGIHDFGYE-CSNVATLM*IF*VQ*IPRIMYNKLIKTIN  12
             + +   ++N AWL+D QDFG+HDFG + C N   L  +  ++     M +KL  TIN
Sbjct  239  GMGLQSWEDNCAWLLDCQDFGVHDFGMDYCFNDVELNGLSTLE-----MGDKLSTTIN  291



>ref|XP_003538655.1| PREDICTED: protein ODORANT1-like [Glycine max]
 gb|KHN34962.1| Protein ODORANT1 [Glycine soja]
Length=264

 Score =   277 bits (708),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 181/252 (72%), Gaps = 9/252 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FI +NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFIFTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+Q EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTQAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            P+THEPL K  +   S      L     P+             LNS  ++S +++  S+ 
Sbjct  123  PLTHEPLNKQVSSKDSSSSEENL-----PQADNTHQVKESDRVLNSEENSSSSAAENSSG  177

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDENFAWLMDH  132
            +E   V   +S    L++++  +  P +D  W+ +   +    N+ +P  ++N AWL+D 
Sbjct  178  EESLLVESDVS----LMNTMWLDETPLMDTLWDNTPKLENANSNMGLPIWEDNCAWLLDC  233

Query  131  QDFGIHDFGYEC  96
            QDFGIHDFG+ C
Sbjct  234  QDFGIHDFGFNC  245



>ref|XP_008437136.1| PREDICTED: protein ODORANT1-like [Cucumis melo]
Length=258

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 180/256 (70%), Gaps = 18/256 (7%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTA+EDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTADEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTDTEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVV--PEGTPPTVPNLISEDLnsscstsenssits  318
            PVTHEP+ K   +  +   + + +   V     +PP + N  S   + S    +N+  +S
Sbjct  123  PVTHEPIQKQPENEKNQSSSTKTENNTVLDSSSSPPMMENSSSVTTDESSFLLDNNLSSS  182

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDENFAWLM  138
             N+     +   S    +    L NN+PP+      S+    ++E        EN +WL+
Sbjct  183  NNNNESSFITNTS--FWIDEEALWNNSPPI------SNGANFLWE--------ENCSWLL  226

Query  137  DHQDFGIHDFGYECSN  90
            D +DFGIHDFG++C N
Sbjct  227  DCEDFGIHDFGFDCFN  242



>ref|XP_009362121.1| PREDICTED: LOW QUALITY PROTEIN: protein ODORANT1 [Pyrus x bretschneideri]
Length=304

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 157/297 (53%), Positives = 191/297 (64%), Gaps = 59/297 (20%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLIT--FILSNGQCCWRALPKLAGLRRCGKSCRLRWTNY  678
            RQPCCDKLGVKKGPWTAEEDKKLI+  FI++NGQCCWRA+PKLAGLRRCGKSCRLRWTNY
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLISLLFIITNGQCCWRAVPKLAGLRRCGKSCRLRWTNY  62

Query  677  LRPDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMG  498
            LRPDLKRGLL++ EEQLVIDLHA LGNRWSKIA +LPGRTDNEIKNHWNTHIKKKL++MG
Sbjct  63   LRPDLKRGLLTEAEEQLVIDLHARLGNRWSKIAGRLPGRTDNEIKNHWNTHIKKKLLRMG  122

Query  497  IDPVTHEPL---------IKDTT-------------------DSTSDKGNGQLQVQVVPE  402
            IDPVTHEPL         IK+T                     ST+D  N Q   Q V  
Sbjct  123  IDPVTHEPLHKEEELASNIKETNSSSSSSHDHDDHNNNLPADQSTNDLHNSQENDQSVVN  182

Query  401  GTPPTVPNLISEDLnsscstsenssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDL  222
             +     N  +E+ ++   +               +L+ + ++D L++SL  +  P +D 
Sbjct  183  SSGSEEINSSTENSSTGAESV--------------LLNNICNDDSLMNSLWMDETPLIDA  228

Query  221  TWNLSDDHQM----------IFENLTI---PKLDENFAWLMDHQDFGIHDFGYECSN  90
             WN  D++Q+          I EN  +      ++N AWL+D QDFGIHDFG +C N
Sbjct  229  LWN--DNNQVELDQGGIDYNIIENNGMGFQSNWEDNCAWLLDCQDFGIHDFGMDCFN  283



>ref|XP_010439306.1| PREDICTED: protein ODORANT1 [Camelina sativa]
Length=269

 Score =   276 bits (706),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 181/267 (68%), Gaps = 17/267 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NG CCWRALPK+AGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGHCCWRALPKMAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQ+VIDLHA LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSNDEEQIVIDLHAHLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKD--TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssits  318
            PVTH+PL ++   TD++    + Q    + P+ T      +         S+S  +   S
Sbjct  123  PVTHQPLTQEPCNTDNSKTISSNQDDGSLEPKTTSTKTLEISGTTTTEDESSSTVTDQNS  182

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSD---------DHQMIFENLTIPK  165
              D    +LD + ++D L S L  +     + +W+ S+         D+ M+     IP 
Sbjct  183  LVDNENHILDNIYNDDELFSYLWSDETTKAEGSWSDSNYGAVGGTLCDNNMLGTVADIPI  242

Query  164  L------DENFAWLMDHQDFGIHDFGY  102
                   D+++ +L   QDFG+HDFG+
Sbjct  243  WSPEGINDKDWMFLDYCQDFGVHDFGF  269



>ref|XP_008810422.1| PREDICTED: protein ODORANT1-like [Phoenix dactylifera]
Length=245

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 174/258 (67%), Gaps = 20/258 (8%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI+FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLISFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTHEP+ +            Q  +Q   + T  T     S+DL       E  + +S N
Sbjct  123  PVTHEPIDR------------QPSLQKSSQSTAATESK--SDDLQLQSQGCEGQNHSSEN  168

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNL---SDDHQMIFENLTIPKLDENFAWL  141
                      S NDP++ SL E + P +D +W      DD+  +   L      E   WL
Sbjct  169  SSPPEESSNTSSNDPVVGSLWEEDIPLIDESWMFPCNEDDYSSVVGPLPWEGSSE---WL  225

Query  140  MDHQDFGIHDFGYECSNV  87
            +D+QDFGI D G   S +
Sbjct  226  LDYQDFGIGDMGLGSSAI  243



>emb|CBI24555.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   275 bits (704),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 185/267 (69%), Gaps = 35/267 (13%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+TFIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVTFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNEAEEQLVIDLHARLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLI----------SEDLnsscst  342
            PVTHEPL +                      TPP +P L+          +++L +S + 
Sbjct  123  PVTHEPLHEHV--------------------TPPEMPTLVDTEHQELSKTNDNLITSDAN  162

Query  341  senssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFE---NLTI  171
            S ++   ++ DE  R L   S++DPL+ S + ++    +++W+     +   E   + T 
Sbjct  163  SSSTLENNSTDE-HRPLGPASEDDPLMMSYIWSDEFLSNVSWSFLAQGEECSELGFSSTT  221

Query  170  PKLDENFAWLMDHQDFGIHDFGYECSN  90
            P  D + +W +D++DF   DFG+ C N
Sbjct  222  PSEDGS-SWWLDYEDFMNEDFGFNCLN  247



>ref|XP_010264189.1| PREDICTED: protein ODORANT1-like [Nelumbo nucifera]
Length=277

 Score =   275 bits (704),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 183/260 (70%), Gaps = 6/260 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLTKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQL-QVQVVPEGTPPTVPNLISED---Lnsscstsenssi  324
            PVTHEPL K    +T+ +    +      P+ +  T+     E+   L +    + +S+ 
Sbjct  123  PVTHEPLHKHAATTTATQVTSSITSADRHPDSSKKTLRLPSPENNGRLTTPDQENSSSAA  182

Query  323  tstNDEFQRVLDTMSDNDPLLSSLL-ENNAPPVDLTWNL-SDDHQMIFENLTIPKLDENF  150
             + + +  R+ D       L+S LL  ++ P V+ +W   +      + ++     +EN 
Sbjct  183  ENCSGDESRLSDNNGGQGSLMSCLLWGDDKPLVEASWKFPTTSAGETYNDVGSLSWEENC  242

Query  149  AWLMDHQDFGIHDFGYECSN  90
            AWL+D+QDFG+ +FG+ C N
Sbjct  243  AWLLDYQDFGVEEFGFGCFN  262



>ref|XP_010676207.1| PREDICTED: protein ODORANT1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010676208.1| PREDICTED: protein ODORANT1-like [Beta vulgaris subsp. vulgaris]
Length=294

 Score =   275 bits (704),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 155/277 (56%), Positives = 183/277 (66%), Gaps = 30/277 (11%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLSDSEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKD-------------------------TTDSTSDKGNGQLQVQVVPEGTPPT  387
            P+THEPL KD                         T +S +   +  L+          T
Sbjct  123  PITHEPLNKDQSPNNQIIPNQSSSSSNNNNNSDISTAESLNQAQSSSLETNNSGPTNSTT  182

Query  386  VPNLISEDLnsscstsenssitstNDEFQRVLDTMSDNDPLLSSLL-ENNAPPVDLTWNL  210
                ISED+  +   +ENSS  +       + + +S +D L+S L  +N+  P++  ++ 
Sbjct  183  TIYSISEDIAHNSPPTENSSSINNQ-SSMSLTEIISIDDALMSYLWDDNDVTPLEFPYSY  241

Query  209  SDDHQMIFENLTIPKLDENFAWLMDHQDFGIHDFGYE  99
              D   +  N T    D+N +WL D QDFGI DFG +
Sbjct  242  KVDQPCLSSNNT---WDDNCSWLFDCQDFGIQDFGLD  275



>ref|XP_010093656.1| Protein ODORANT1 [Morus notabilis]
 gb|EXB54436.1| Protein ODORANT1 [Morus notabilis]
Length=318

 Score =   276 bits (706),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 157/300 (52%), Positives = 198/300 (66%), Gaps = 52/300 (17%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NG CCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGHCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIASRLPGRTDNEIKNHWNTHIKKKLVKMGID  122

Query  491  PVTHEPLIKDTTD-------------STSDKGNGQLQVQVVPEGTPPTVPNLI-------  372
            PVTHEPL K+  D             +T+   +      ++    P +  N I       
Sbjct  123  PVTHEPLHKENVDDQLPSNKKTILETTTTPVQDVNSTSNIINNSLPQSTENPIHHLSQES  182

Query  371  ------SEDLnsscstsenssitstND-EFQRVLDTMSDNDPLLSSLLENNAPPVD----  225
                  SE++N S S+    + +++ D E   +LD + +++ L++++L     PVD    
Sbjct  183  SGSTINSEEVNYSSSSPAAENSSASGDNESTLLLDNLCNDESLMNNVLW----PVDKSPQ  238

Query  224  -------LTWNLS--DDH-------QMIFENLTI-PKLDENFAWLMDHQDFGIHDFGYEC  96
                   + W+ S  DDH       +++  ++ I P  ++N +WL+D QDFGI DFG +C
Sbjct  239  LTSVDHAILWSSSCHDDHHPTLSGEKVVNSDMGILPSFEDNCSWLLDCQDFGIQDFGLDC  298



>ref|XP_002266019.2| PREDICTED: protein ODORANT1-like [Vitis vinifera]
Length=290

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 185/267 (69%), Gaps = 35/267 (13%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+TFIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  33   RQPCCDKLGVKKGPWTAEEDKKLVTFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  92

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  93   PDLKRGLLNEAEEQLVIDLHARLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  152

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLI----------SEDLnsscst  342
            PVTHEPL +                      TPP +P L+          +++L +S + 
Sbjct  153  PVTHEPLHEHV--------------------TPPEMPTLVDTEHQELSKTNDNLITSDAN  192

Query  341  senssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFE---NLTI  171
            S ++   ++ DE  R L   S++DPL+ S + ++    +++W+     +   E   + T 
Sbjct  193  SSSTLENNSTDE-HRPLGPASEDDPLMMSYIWSDEFLSNVSWSFLAQGEECSELGFSSTT  251

Query  170  PKLDENFAWLMDHQDFGIHDFGYECSN  90
            P  D + +W +D++DF   DFG+ C N
Sbjct  252  PSEDGS-SWWLDYEDFMNEDFGFNCLN  277



>ref|XP_010448861.1| PREDICTED: protein ODORANT1-like [Camelina sativa]
Length=269

 Score =   273 bits (697),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 178/267 (67%), Gaps = 17/267 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVIDLHA LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSNDEEQLVIDLHAHLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKD--TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssits  318
            P TH+PL ++   TD++    +    V + P+ T      +         S+S  +   S
Sbjct  123  PATHQPLNQEPCNTDNSKTISSNPDDVSLEPKTTSTKTLEISGTTTIEDESSSTVTDQNS  182

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSD---------DHQMIFENLTIPK  165
            + D    +LD + ++D L S L  +     + +W  S+         D+ M       P 
Sbjct  183  SMDNENHILDNIYNDDELFSYLWSDETTKAEGSWGDSNYGAVGGTLCDNNMFGTVADFPI  242

Query  164  L------DENFAWLMDHQDFGIHDFGY  102
                   D+++ +L   QDFG+HDFG+
Sbjct  243  WSPEGINDKDWMFLDYCQDFGVHDFGF  269



>ref|XP_010434009.1| PREDICTED: protein ODORANT1-like [Camelina sativa]
Length=270

 Score =   271 bits (692),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 179/268 (67%), Gaps = 18/268 (7%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+DEEQLVIDLHA LGN+WSKIAS+LPGRTDNEIKNHWNT+IKKKL+KMGID
Sbjct  63   PDLKRGLLSKDEEQLVIDLHAHLGNKWSKIASRLPGRTDNEIKNHWNTNIKKKLLKMGID  122

Query  491  PVTHEPLIKD--TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssits  318
            PVTH+ L ++   TD++    +    V + P+ T      +         S+S  +   S
Sbjct  123  PVTHQSLTQEPCNTDNSKTISSNPDDVSLEPKTTSTKTLEISGTTTTEDESSSTVTDQNS  182

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENL-------TIPKL-  162
            + D    +LD + ++D L S L  +     + +W    ++  +   L       T+    
Sbjct  183  SMDNENHILDNIYNDDELFSYLWSDETTKAEGSWRSDSNYGAVGGTLCDNNMFGTVADFP  242

Query  161  --------DENFAWLMDHQDFGIHDFGY  102
                    D+++ +L   QDFG+HDFG+
Sbjct  243  IWSPEGINDKDWMFLDYCQDFGVHDFGF  270



>ref|XP_008376253.1| PREDICTED: protein ODORANT1-like [Malus domestica]
Length=251

 Score =   269 bits (687),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 179/255 (70%), Gaps = 15/255 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ F+L++GQCCWRA+PKLAGLRRCGKSCRLRW NYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFLLTHGQCCWRAVPKLAGLRRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLNDAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLVKMGID  122

Query  491  PVTHEPLIKDTT-------DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            P+THEPL K  T       ++++   N  + +Q +    P    +  S+      +++  
Sbjct  123  PITHEPLHKQVTTXQEMPCEASNQPANSDMSIQQMNTNIPEHGISTNSD-----GNSTSE  177

Query  332  ssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDEN  153
            +S ++ ++  +   +   + DPL+S +L +     DLTW+ S   +  + +   P  + +
Sbjct  178  NSPSNDSEPAEPNPNYSEEEDPLVSFILSDTFLE-DLTWDFSTSSE--YSSADNPTEENS  234

Query  152  FAWLMDHQDFGIHDF  108
             AW MD  DFG+ DF
Sbjct  235  LAWFMDCNDFGVEDF  249



>gb|AAZ20435.1| MYB19 [Malus domestica]
 dbj|BAG48172.1| myb-related transcription factor [Malus domestica]
Length=251

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 179/255 (70%), Gaps = 15/255 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ F+L++GQCCWRA+PKLAGLRRCGKSCRLRW NYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFLLTHGQCCWRAVPKLAGLRRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLNDAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLVKMGID  122

Query  491  PVTHEPLIKDTT-------DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            P+THEPL K  T       ++++   N  + +Q +    P    +  S+      +++  
Sbjct  123  PITHEPLHKQVTTPQEMPCEASNQPANSDMSIQQMNTNIPEHGISTNSD-----GNSTSE  177

Query  332  ssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDEN  153
            +S ++ ++  +   +   + DPL+S +L +     DLTW+ S   +  + +   P  + +
Sbjct  178  NSPSNDSEPAEPNPNYSEEEDPLVSFILSDTFLE-DLTWDFSTSSE--YSSADNPTEENS  234

Query  152  FAWLMDHQDFGIHDF  108
             AW MD  DFG+ DF
Sbjct  235  LAWFMDCNDFGVEDF  249



>ref|XP_002867757.1| hypothetical protein ARALYDRAFT_492601 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44016.1| hypothetical protein ARALYDRAFT_492601 [Arabidopsis lyrata subsp. 
lyrata]
Length=267

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 183/266 (69%), Gaps = 17/266 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVIDLHA LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSHDEEQLVIDLHAHLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTT---DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssit  321
            P+TH+PL ++ +   +S +   N    + V P+ T  T    IS       S+S  +   
Sbjct  123  PMTHQPLPQEPSNIGNSKTISSNPADAISVEPK-TTNTKDVEISGTTTEEESSSTVTDQN  181

Query  320  stNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSD--------DHQMIFENLTIP-  168
            S+ D    ++D + ++D L S L  +     + +W+ S+        D+ +   +   P 
Sbjct  182  SSMDSENHLIDNIYNDDELFSYLWSDETTKAEASWSDSNFGVGGTLYDNNISGADADFPI  241

Query  167  ----KLDENFAWLMDHQDFGIHDFGY  102
                ++++   +L   QDFG+HDFG+
Sbjct  242  WSPERINDEKMFLDYCQDFGVHDFGF  267



>ref|XP_010934413.1| PREDICTED: protein ODORANT1-like [Elaeis guineensis]
Length=246

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 173/265 (65%), Gaps = 33/265 (12%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI+FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLISFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKD----------TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscst  342
            PVTH+P+ +           TT+S SD  + QLQ Q   EG   +  N  S         
Sbjct  123  PVTHKPINRQPSPKSSQSTATTESKSD--DHQLQSQGY-EGQNQSSENSRS---------  170

Query  341  senssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKL  162
                                S ND L+ SL E + P ++ +W    + +     +     
Sbjct  171  -----------SPPEESSNTSSNDLLVGSLWEEDIPLINESWTFPCNEEDYSSVVAPLPW  219

Query  161  DENFAWLMDHQDFGIHDFGYECSNV  87
            + +  WL+D+QDFGI D G   S +
Sbjct  220  EGSSEWLLDYQDFGIGDMGLGSSAI  244



>ref|XP_002509589.1| ODORANT1 protein, putative [Ricinus communis]
 gb|EEF50976.1| ODORANT1 protein, putative [Ricinus communis]
Length=281

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 187/265 (71%), Gaps = 11/265 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDT-TDSTSDKGNGQLQVQVVPEGTPPTVPNLISED--Lnsscstsenssit  321
            PVTHEP  K+  T+  S   +  L              +  + D  +NSS   S +S   
Sbjct  123  PVTHEPFHKEAKTEQISSHADNFLPETTNNMDNNNNNNSQENNDGNVNSSEDNSSSSPHE  182

Query  320  stNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDH------QMIFENLTIP--K  165
            +   +   +LD++ +++ LL+SL  +    VD +W+ ++D        M   ++  P   
Sbjct  183  NCCSDESVLLDSICNDETLLNSLWMDEPFLVDASWSHNNDINNNNPPAMENTDMGFPYSS  242

Query  164  LDENFAWLMDHQDFGIHDFGYECSN  90
             ++N  WL+D QDFG+ DFG++C +
Sbjct  243  WEDNCTWLLDCQDFGVQDFGFDCYD  267



>ref|XP_009374509.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=251

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 178/258 (69%), Gaps = 21/258 (8%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+TF+L++GQCCWRA+PKLAGLRRCGKSCRLRW NYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLMTFLLTHGQCCWRAVPKLAGLRRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQ+VIDLHA LGNRWSKIA+ LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLNDAEEQIVIDLHARLGNRWSKIAASLPGRTDNEIKNHWNTHIKKKLVKMGID  122

Query  491  PVTHEPLIKDTT-------DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            P+THEPL K  T       ++++   N  + +Q +    P        E    + S   +
Sbjct  123  PITHEPLHKQVTTPQEMPREASNQPANSDMNIQQINTNIP--------EHGICTNSDGNS  174

Query  332  ssitstNDEFQRVL---DTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKL  162
            +S  S +D+ +      +   ++DPL+S +L +     DLTW+ S   +  + +   P  
Sbjct  175  ASENSPSDDSEPAEPNPNCSEEDDPLVSFILSDTFLE-DLTWDFSTSSE--YSSADNPTE  231

Query  161  DENFAWLMDHQDFGIHDF  108
            + + AW MD  DFG+ DF
Sbjct  232  ENSLAWFMDCNDFGVEDF  249



>ref|NP_567664.1| myb domain protein 85 [Arabidopsis thaliana]
 gb|AAD53098.2|AF175993_1 putative transcription factor [Arabidopsis thaliana]
 gb|AAM62722.1| myb-like protein [Arabidopsis thaliana]
 gb|AAS10078.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAD43481.1| myb-like protein [Arabidopsis thaliana]
 dbj|BAD43540.1| myb-like protein [Arabidopsis thaliana]
 gb|ABE66086.1| myb family transcription factor [Arabidopsis thaliana]
 gb|AEE84639.1| myb domain protein 85 [Arabidopsis thaliana]
Length=266

 Score =   267 bits (682),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 182/265 (69%), Gaps = 16/265 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWT EEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTVEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVIDLHA+LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSHDEEQLVIDLHANLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTT--DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssits  318
            P+TH+PL ++ +  D++    +    V V P+ T       IS       S+S  +   S
Sbjct  123  PMTHQPLNQEPSNIDNSKTIPSNPDDVSVEPKTTNTKYVE-ISVTTTEEESSSTVTDQNS  181

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSD--------DHQMIFENLTIP--  168
            + D    ++D + D+D L S L  +     + +W+ S+        DH +   +   P  
Sbjct  182  SMDNENHLIDNIYDDDELFSYLWSDETTKDEASWSDSNFGVGGTLYDHNISGADADFPIW  241

Query  167  ---KLDENFAWLMDHQDFGIHDFGY  102
               ++++   +L   QDFG+HDFG+
Sbjct  242  SPERINDEKMFLDYCQDFGVHDFGF  266



>gb|ABK28645.1| unknown [Arabidopsis thaliana]
Length=267

 Score =   267 bits (682),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 183/265 (69%), Gaps = 16/265 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWT EEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTVEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVIDLHA+LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSHDEEQLVIDLHANLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTT--DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssits  318
            P+TH+PL ++ +  D++    +    V V P+ T  T    IS       S+S  +   S
Sbjct  123  PMTHQPLNQEPSNIDNSKTIPSNPDDVSVEPK-TTNTKYVEISVTTTEEESSSTVTDQNS  181

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSD--------DHQMIFENLTIP--  168
            + D    ++D + D+D L S L  +     + +W+ S+        DH +   +   P  
Sbjct  182  SMDNENHLIDNIYDDDELFSYLWSDETTKDEASWSDSNFGVGGTLYDHNISGADADFPIW  241

Query  167  ---KLDENFAWLMDHQDFGIHDFGY  102
               ++++   +L   QDFG+HDFG+
Sbjct  242  SPERINDEKMFLDYCQDFGVHDFGF  266



>ref|XP_009137269.1| PREDICTED: protein ODORANT1-like [Brassica rapa]
Length=269

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 182/268 (68%), Gaps = 19/268 (7%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKL VKKGPWT EEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLEVKKGPWTTEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVIDLHA LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSHDEEQLVIDLHAHLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLVKMGID  122

Query  491  PVTHEPLIKD--TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssits  318
            PVTH+PL ++   TD+ +   +    + + P+   P      S       S++     +S
Sbjct  123  PVTHQPLNQEPNNTDNPNSSSSTSDNILMEPKSRSPKNVQTNSTTTEDESSSTATGQNSS  182

Query  317  tNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQM---IFENLTIPKLDENF-  150
             N+E Q +L  +++++ L S L  ++    D + + S+ + +   ++    IP    +F 
Sbjct  183  INNENQ-LLSNITNDEELFSYLWSDDTAKADASRSCSNYYGVGGTLYNEDNIPGARADFP  241

Query  149  AW-----------LMDH-QDFGIHDFGY  102
             W            +D+ QDFG+HDFG+
Sbjct  242  IWSPERVGGKDLMFLDYCQDFGVHDFGF  269



>ref|XP_006413635.1| hypothetical protein EUTSA_v10027281mg [Eutrema salsugineum]
 gb|ESQ55088.1| hypothetical protein EUTSA_v10027281mg [Eutrema salsugineum]
Length=270

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 181/269 (67%), Gaps = 20/269 (7%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEED+KLI F+L+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDRKLINFMLTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVIDLHA LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSHDEEQLVIDLHAHLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLVKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssi----  324
            PVTH+PL ++  +ST++  N       +    P T      E    + +  E+SS     
Sbjct  123  PVTHQPLNQE-PNSTANPNNISSTSDDIISMEPKTSSTKKVETRTGATTEEESSSTVTDQ  181

Query  323  tstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTW---NLSDDHQMIFENLTIPKLD--  159
             S+ D     L  + +++ L S L  +       +W   N   D  +  +N++    D  
Sbjct  182  NSSIDNENHQLGNICNDEELFSYLWSDETTIGQASWSDINYGVDGTLYEDNISGAGADFP  241

Query  158  ---------ENFAWLMDH-QDFGIHDFGY  102
                     +++ +LMD+ QDFG+HDFG+
Sbjct  242  MWSPDRINGKDWTFLMDYCQDFGVHDFGF  270



>ref|XP_009372900.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=279

 Score =   266 bits (679),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 182/278 (65%), Gaps = 33/278 (12%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ F+L++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFLLTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+ DEEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNDDEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTD------STSDKGNGQ------------------LQVQVVPEGTPPTV  384
            P+THEPL K            SD+  G                    +    P G    +
Sbjct  123  PITHEPLHKQVITPEEMPCEASDQPAGSDVNIPQNMGIPEHEVYSNSEASNQPAGLDMNI  182

Query  383  P---NLISEDLnsscstsenssitstNDEFQRVL---DTMSDNDPLLSSLLENNAPPVDL  222
            P   N+   +++S+     ++S  S ++E Q      + + + DPL+S +L +     DL
Sbjct  183  PRNMNIPEHEISSNSDGGGSASENSPSNESQSAEPNPNYIEEGDPLVSFILSDTFLE-DL  241

Query  221  TWNLSDDHQMIFENLTIPKLDENFAWLMDHQDFGIHDF  108
            TW+ S   +    +   P  + + AW MD +DFG+ DF
Sbjct  242  TWDFSTSSED--GSADNPTEENSLAWFMDCKDFGVQDF  277



>ref|XP_009370487.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=279

 Score =   266 bits (679),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 182/278 (65%), Gaps = 33/278 (12%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ F+L++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFLLTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+ DEEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNDDEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTD------STSDKGNGQ------------------LQVQVVPEGTPPTV  384
            P+THEPL K            SD+  G                    +    P G    +
Sbjct  123  PITHEPLHKQVITPEEMPCEASDQPAGSDVNIPQNMDIPEHEVYSNSEASNQPAGLDMNI  182

Query  383  P---NLISEDLnsscstsenssitstNDEFQRVL---DTMSDNDPLLSSLLENNAPPVDL  222
            P   N+   +++S+     ++S  S ++E Q      + + + DPL+S +L +     DL
Sbjct  183  PRNMNIPEHEISSNSDGGGSASENSPSNESQSAEPNPNYIEEGDPLVSFILSDTFLE-DL  241

Query  221  TWNLSDDHQMIFENLTIPKLDENFAWLMDHQDFGIHDF  108
            TW+ S   +    +   P  + + AW MD +DFG+ DF
Sbjct  242  TWDFSTSSED--GSADNPTEENSLAWFMDCKDFGVQDF  277



>emb|CDY64316.1| BnaA03g58600D [Brassica napus]
Length=269

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 182/267 (68%), Gaps = 17/267 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKL VKKGPWT EEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLEVKKGPWTTEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVIDLHA LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSHDEEQLVIDLHAHLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLVKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnss-cstsenssitst  315
            PVTH+PL ++  ++ +   +      ++ E    +  N+ +    +   S+S  +   S+
Sbjct  123  PVTHQPLNQEPNNTDNPNSSSSTSDNILMEPKSRSTKNVQTNSTTTEDESSSTATGQNSS  182

Query  314  NDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQM---IFENLTIPKLDENF-A  147
             +   ++L  +++++ L S +  ++    D + + S+ + +   ++    IP    +F  
Sbjct  183  INNENQLLSNITNDEELFSYIWSDDTAKADASRSCSNYYGVGGTLYNEDNIPAAGADFPI  242

Query  146  W-----------LMDH-QDFGIHDFGY  102
            W            +D+ QDFG+HDFG+
Sbjct  243  WSPEIVGGKDLMFLDYCQDFGVHDFGF  269



>ref|XP_002462722.1| hypothetical protein SORBIDRAFT_02g030900 [Sorghum bicolor]
 gb|EER99243.1| hypothetical protein SORBIDRAFT_02g030900 [Sorghum bicolor]
Length=275

 Score =   265 bits (678),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 147/268 (55%), Positives = 176/268 (66%), Gaps = 12/268 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVK+GPWTAEED+KLI FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKRGPWTAEEDRKLINFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQ+VIDLH  LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTDAEEQVVIDLHGKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnssc-stsenssitst  315
            PVTHEPL + T+ S +         +   + +P     ++  D+ +   S +E+S+ T +
Sbjct  123  PVTHEPLDRKTSSSPATTSQSAKSDEATKQQSPENDDVVVMRDVPADGCSPTESSTNTVS  182

Query  314  NDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTW-NLS-----DDHQMIFENLTIPKLDEN  153
                        D DPL+  LLE   P  D  W N S     D+   I     +   D  
Sbjct  183  TGGSSSSSSGGHDQDPLVKWLLEEEPPTGDEPWLNFSGSVDVDEFSSIAAGPELLPWDGA  242

Query  152  FAWLMDHQDFGIHDF-----GYECSNVA  84
              WL+D+QDFG+ D      GY  +N +
Sbjct  243  TDWLLDYQDFGLGDSATLVDGYMVNNSS  270



>ref|XP_008234380.1| PREDICTED: protein ODORANT1-like [Prunus mume]
Length=245

 Score =   264 bits (674),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 181/255 (71%), Gaps = 13/255 (5%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ F+L++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFLLAHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLH+ LGNRWSKIA+ LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNEAEEQLVIDLHSRLGNRWSKIAAGLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            P+THEPL K  T           ++   P   PP    +  +++N       +++ +S++
Sbjct  123  PITHEPLRKQVTPP---------EMPCKP-NNPPADLEMNQQNVNIPEHGISSAAESSSS  172

Query  311  DEFQRVLDTM-SDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDENFAWLMD  135
            +E Q +   + S++DPL+S +L +     DLTW+ S   +        P  D + AW +D
Sbjct  173  NESQPLEPNLKSEDDPLMSYILSDTF-LEDLTWDFSASSE-DSSPADNPAEDNSLAWFLD  230

Query  134  HQDFGIHDFGYECSN  90
             +DFG+ DF   C N
Sbjct  231  CKDFGVEDFELGCIN  245



>ref|XP_004307827.1| PREDICTED: protein ODORANT1-like [Fragaria vesca subsp. vesca]
Length=250

 Score =   264 bits (674),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 178/257 (69%), Gaps = 25/257 (10%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ FIL++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFILTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHASLGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNEAEEQLVIDLHASLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNL-----ISEDLnsscstsenss  327
            P+TH PL              Q QV   P+ TP    N+     I E   S      +++
Sbjct  123  PITHVPL--------------QKQVTTTPQETPCEA-NIQQSVNIPEHGVSGNENGSSAT  167

Query  326  itstNDEFQRVL--DTMSDNDPLLSSLLENNAPPVDLTWNL--SDDHQMIFENLTIPKLD  159
              ST++E Q ++  D   ++DPL+S +L +     D +W+    +D        +    D
Sbjct  168  ENSTSNEAQSLIEADANVEDDPLVSYILSDTFLE-DWSWSFPAVEDGYNDLGLSSTSSED  226

Query  158  ENFAWLMDHQDFGIHDF  108
             + AW MD +DFG+ DF
Sbjct  227  SSSAWFMDCKDFGVEDF  243



>ref|NP_001106007.1| LOC100101510 [Zea mays]
 gb|AAS45643.1| MYB-like protein 1 [Zea mays]
 gb|AAS45644.1| MYB-like protein 2 [Zea mays]
 gb|ACN27134.1| unknown [Zea mays]
 gb|ADX60109.1| MYB transcription factor [Zea mays]
 tpg|DAA62458.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=275

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 174/265 (66%), Gaps = 11/265 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVK+GPWTAEED+KLI FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKRGPWTAEEDRKLINFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQ+VIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTDAEEQVVIDLHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDST-SDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitst  315
            PVTHEPL + TT S  +         +   E +P     +I +     CS +E+S+ T +
Sbjct  123  PVTHEPLDRKTTSSGPATTSQSTKSDEATKEQSPQNDDAVIRDVPADGCSPTESSTNTVS  182

Query  314  NDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTW-NLS-----DDHQMIFENLTIPKLDEN  153
                        D DPL+  LLE      D  W N +     D+   I     +   D  
Sbjct  183  TGGSSSSGGGGHDQDPLVKWLLEEEPATGDEAWLNFTGSVDVDEFSSIAAGPELLPWDGA  242

Query  152  FAWLMDHQDFGIHDF----GYECSN  90
              WL+D+QDFG+ D     GY  +N
Sbjct  243  TDWLLDYQDFGLGDSSLVDGYMVNN  267



>ref|XP_006284312.1| hypothetical protein CARUB_v10005483mg [Capsella rubella]
 gb|EOA17210.1| hypothetical protein CARUB_v10005483mg [Capsella rubella]
Length=271

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 181/269 (67%), Gaps = 19/269 (7%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWT EEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTVEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVIDLHA LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLSHDEEQLVIDLHAHLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKD--TTDSTSDKGNGQLQVQVVPEGTPPTVPNLIS-EDLnsscstsenssit  321
            P+TH+PL ++   TD +    +    +   P+       ++IS        S+S  +   
Sbjct  123  PMTHQPLNQEPSNTDPSKTISSNPDDISKEPKTASTKTLDIISGTTTTEDESSSTVTDQN  182

Query  320  stNDEFQRVLDTMSDNDPLLS------------SLLENNAPPVDLTWNLSDDHQMIFENL  177
            S+ D    +LD   ++D L S            SL ++N   V  T   S++      +L
Sbjct  183  SSMDNENHLLDNNYNDDELFSYLWSDETTKADASLGDSNYGAVGGTLYDSNNISTTVSDL  242

Query  176  TI--PKLDENFAWL-MDH-QDFGIHDFGY  102
             I  P+   +  W+ +D+ QDFG+HDFG+
Sbjct  243  PIWSPEGINDKDWMFLDYCQDFGVHDFGF  271



>ref|XP_008650756.1| PREDICTED: LOC100101510 isoform X1 [Zea mays]
 ref|XP_008650757.1| PREDICTED: LOC100101510 isoform X1 [Zea mays]
 ref|XP_008650758.1| PREDICTED: LOC100101510 isoform X1 [Zea mays]
 gb|ACF86776.1| unknown [Zea mays]
 tpg|DAA62459.1| TPA: putative MYB DNA-binding domain superfamily protein isoform 
1 [Zea mays]
 tpg|DAA62460.1| TPA: putative MYB DNA-binding domain superfamily protein isoform 
2 [Zea mays]
Length=299

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 174/265 (66%), Gaps = 11/265 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVK+GPWTAEED+KLI FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  27   RQPCCDKLGVKRGPWTAEEDRKLINFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  86

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQ+VIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  87   PDLKRGLLTDAEEQVVIDLHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  146

Query  491  PVTHEPLIKDTTDST-SDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitst  315
            PVTHEPL + TT S  +         +   E +P     +I +     CS +E+S+ T +
Sbjct  147  PVTHEPLDRKTTSSGPATTSQSTKSDEATKEQSPQNDDAVIRDVPADGCSPTESSTNTVS  206

Query  314  NDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTW-NLS-----DDHQMIFENLTIPKLDEN  153
                        D DPL+  LLE      D  W N +     D+   I     +   D  
Sbjct  207  TGGSSSSGGGGHDQDPLVKWLLEEEPATGDEAWLNFTGSVDVDEFSSIAAGPELLPWDGA  266

Query  152  FAWLMDHQDFGIHDF----GYECSN  90
              WL+D+QDFG+ D     GY  +N
Sbjct  267  TDWLLDYQDFGLGDSSLVDGYMVNN  291



>emb|CDX94109.1| BnaC07g37430D [Brassica napus]
Length=269

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 182/267 (68%), Gaps = 17/267 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKL VKKGPWT EEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLEVKKGPWTTEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRG+LS DEEQLVIDLHA LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGILSHDEEQLVIDLHAHLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLVKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNL-ISEDLnsscstsenssitst  315
            PVTH+PL ++  ++ + K +      ++ E    +  N+  +       S+S  +   S+
Sbjct  123  PVTHQPLNQEPNNTDNPKSSSSTSDNILMEPKSRSSKNVQTNSTTTEEESSSTATGQNSS  182

Query  314  NDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQM---IFENLTIPKLDENF-A  147
             +   ++L  +++++ L S L  ++    D + + S+ + +   ++    IP    +F  
Sbjct  183  INNENQLLSNITNDEELFSYLWSDDTAKADASRSCSNYYGVGGTLYNEDNIPGAGADFPI  242

Query  146  W-----------LMDH-QDFGIHDFGY  102
            W            +D+ QDFG+HDFG+
Sbjct  243  WSPERVGGKDLMFLDYCQDFGVHDFGF  269



>ref|XP_008376445.1| PREDICTED: protein ODORANT1-like [Malus domestica]
Length=279

 Score =   263 bits (672),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 146/278 (53%), Positives = 179/278 (64%), Gaps = 33/278 (12%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ F+L++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFLLTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNDAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPL------------------------IKDTTDSTSDKGNGQLQVQVVPEGTPPTV  384
            P+THEPL                        I    D    +     +    P G    +
Sbjct  123  PITHEPLHKQAITPEEMPCEASNQPAGSDVNIPQNMDIPEHEVYSNSEASNQPAGLDMNI  182

Query  383  P---NLISEDLnsscstsenssitstNDEFQRVL---DTMSDNDPLLSSLLENNAPPVDL  222
            P   N+   +++S+     ++S  S ++E Q      +   ++DPLLS +L +     DL
Sbjct  183  PRNMNIPEHEISSNSDGGGSASENSPSNESQSAEPNPNYSEEDDPLLSFILSDTF-LEDL  241

Query  221  TWNLSDDHQMIFENLTIPKLDENFAWLMDHQDFGIHDF  108
            TW+ S   +    +   P  + + AW MD +DFG+ DF
Sbjct  242  TWDFSTSSED--GSADNPTEENSLAWFMDCKDFGVQDF  277



>emb|CDX79170.1| BnaA01g12370D [Brassica napus]
Length=267

 Score =   261 bits (668),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 180/269 (67%), Gaps = 23/269 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKL VKKGPWTAEEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLVVKKGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVIDLHA LGN+W+KIAS+LPGRTDNEIKNHWNTHIKKKL+K GID
Sbjct  63   PDLKRGLLSHDEEQLVIDLHAHLGNKWAKIASRLPGRTDNEIKNHWNTHIKKKLVKKGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQ--VQVVP-EGTPPTVPNLISEDLnsscstsenssit  321
            P+TH+PL ++  ++T+ K        + + P  G+       I+ED     S+S  +   
Sbjct  123  PMTHQPLNQEPYNTTNPKNISSTSDDISMKPRSGSTKERNGTITED----ESSSTVTGQN  178

Query  320  stNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSD----------DHQMIFENLTI  171
            S+ D    +L  + +++ L S L  +     + +W+ S+          D+ M       
Sbjct  179  SSTDNENHLLSNIYNDEELFSHLWSDETTTAEASWSDSNDGFGGTFYHHDNNMSGAGADF  238

Query  170  P-----KLDENFAWLMDH-QDFGIHDFGY  102
            P      ++ N    +D+ QDFG+HDFG+
Sbjct  239  PIWSPEGINGNDWKFLDYCQDFGVHDFGF  267



>ref|XP_010433580.1| PREDICTED: protein ODORANT1 [Camelina sativa]
Length=284

 Score =   262 bits (670),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 150/275 (55%), Positives = 189/275 (69%), Gaps = 31/275 (11%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKL VKKGPWTAEEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLLVKKGPWTAEEDKKLINFILNNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KM ID
Sbjct  63   PDLKRGLLSDAEEQLVIDLHALLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMEID  122

Query  491  PVTHEPLIK--------DTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstse  336
            P+TH+PL K        D ++++S  GN +     + +    T  N I E       +S 
Sbjct  123  PLTHQPLNKVPTDKNFADISETSSKAGNVKRSDDKIIK-VDETTKNTIDE-------SST  174

Query  335  nssitstNDEFQRVLDTMSDNDPLLSSLLENNAPP-VDLTW---------NLSDDHQMIF  186
             +   S+ D+++ + D + +++ L + L  N+ PP +D +W          ++D + +  
Sbjct  175  ITHQDSSKDDYELLGDIIHNDEDLFNILWTNDEPPLLDASWCNNNVGVVGTVADKNNIAA  234

Query  185  -ENLTIPKLDENF--AWL-MDH-QDFGIHDFGYEC  96
             E+     L+E    +W+ +D+ QDFG+ DFGYEC
Sbjct  235  GEDFPTWPLEEKNGDSWMFLDYCQDFGVQDFGYEC  269



>ref|XP_006396775.1| hypothetical protein EUTSA_v10028864mg [Eutrema salsugineum]
 gb|ESQ38228.1| hypothetical protein EUTSA_v10028864mg [Eutrema salsugineum]
Length=285

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/275 (54%), Positives = 179/275 (65%), Gaps = 30/275 (11%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FI+ NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFIVKNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KM ID
Sbjct  63   PDLKRGLLSNAEEQLVIDLHALLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMEID  122

Query  491  PVTHEPLIKDTTD--------STSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstse  336
            P+TH+PL K +TD        ++S  G+ +       E    T+ N I E    S   S 
Sbjct  123  PMTHQPLNKVSTDKKAFHKCETSSKAGSVKRNDSKSKEIDGTTMINSIDESSTISHQNSP  182

Query  335  nssitstNDEFQRVLDTMSDNDPLLSSLLENNAPP-VDLTW--NLSDDHQMIFENLTIPK  165
            +        +++ + D + ++D L + L  ++  P VD +W  N  D      EN     
Sbjct  183  HV-------DYELLGDIIHNDDDLFNILWNDDEHPLVDASWSNNNVDGGGSAAENNNFSA  235

Query  164  LDENFAW-----------LMDH-QDFGIHDFGYEC  96
             ++   W            +D+ QDFG+ DFG+EC
Sbjct  236  GEDFPTWPSEEKNVESQMFLDYCQDFGVQDFGFEC  270



>ref|XP_002872653.1| hypothetical protein ARALYDRAFT_327351 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48912.1| hypothetical protein ARALYDRAFT_327351 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 152/280 (54%), Positives = 181/280 (65%), Gaps = 33/280 (12%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKL VKKGPWTAEEDKKLI FILSNG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLLVKKGPWTAEEDKKLINFILSNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KM ID
Sbjct  63   PDLKRGLLSDAEEQLVIDLHALLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMEID  122

Query  491  PVTHEPLIKDTTDS------TSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsens  330
            P TH+PL K +TD       TS K     +     +    T  N I E       TS  +
Sbjct  123  PSTHQPLNKVSTDKKFVDRLTSSKAGNVKRSDSKSKEIDGTTTNTIDE-------TSTIT  175

Query  329  sitstNDEFQRVLDTMSDNDPLLSSLLENNAPPV--DLTW-------------NLSDDHQ  195
               S+ D+++ + D + + + L + L  N+ PP+  D +W             + SD + 
Sbjct  176  HKNSSKDDYELLGDIIHNYEDLFNILWTNDEPPLVDDASWSNNNVGIGGTAAVSASDKNN  235

Query  194  MIF-ENLTIPKLD----ENFAWLMDHQDFGIHDFGYECSN  90
            +   E+     L+    E++ +L   QDF + DFG EC N
Sbjct  236  IAAGEDFPAQSLEEQNGESWMFLNYCQDFCVQDFGLECYN  275



>emb|CDX82958.1| BnaC01g14080D [Brassica napus]
Length=267

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 179/269 (67%), Gaps = 23/269 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKL VKKGPWTAEEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLVVKKGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVIDLHA LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSHDEEQLVIDLHAHLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLVKMGID  122

Query  491  PVTHEPLIKD--TTDSTSDKGNGQLQVQVVP-EGTPPTVPNLISEDLnsscstsenssit  321
            P+TH+PL ++   T++     +    + + P  G+       ++ED     S+S  +   
Sbjct  123  PMTHQPLNQEPNNTNNPQSLSSTSDDISMKPRSGSTKETNGTLTED----ESSSTVTGQN  178

Query  320  stNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSD----------DHQMIFENLTI  171
            ++ D    +L  + +++ L S L  +     +  W+ S+          D+ M       
Sbjct  179  NSTDNENHLLSNIYNDEELFSHLWSDETTTAEAPWSDSNDGFGGTLYHHDNNMSGAGADF  238

Query  170  P-----KLDENFAWLMDH-QDFGIHDFGY  102
            P      ++ N    +D+ QDFG+HDFG+
Sbjct  239  PIWSPEGINGNDWTFLDYCQDFGVHDFGF  267



>ref|XP_004957458.1| PREDICTED: protein ODORANT1-like [Setaria italica]
Length=278

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 177/265 (67%), Gaps = 25/265 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVK+GPWTAEED+KLI FILSNG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKRGPWTAEEDRKLINFILSNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQ+VIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTDAEEQVVIDLHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTT------------DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnssc  348
            PVTHEPL + T+            DSTS       Q     +     V ++++ D     
Sbjct  123  PVTHEPLDRKTSSPATTSHSVVTADSTSKSDEATKQQSPASD----VVRDVLAAD---GF  175

Query  347  stsenssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTW-NLSDDHQMIFENLTI  171
            S +E+S+ T +            D DPL+  LLE + P  D  W + +     + E  +I
Sbjct  176  SPTESSTNTVSTGGSSSSSGGSHDQDPLVKWLLEEDPPTGDEPWLDFTAGSVDVDEFSSI  235

Query  170  ---PKL--DENFAWLMDHQDFGIHD  111
               P+L  D    WL+D+QDFG+ D
Sbjct  236  AAGPELPWDGATDWLLDYQDFGLED  260



>ref|XP_010053417.1| PREDICTED: protein ODORANT1-like [Eucalyptus grandis]
 gb|KCW77710.1| hypothetical protein EUGRSUZ_D02014 [Eucalyptus grandis]
Length=301

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 157/279 (56%), Positives = 183/279 (66%), Gaps = 29/279 (10%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK GVKKGPWTAEEDKKLI FIL+NG CCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKSGVKKGPWTAEEDKKLINFILTNGHCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIK-DTTDSTSDKGNGQLQVQVVPEGTPPT---VPNLISED----Lnsscstse  336
            PVTHEPL K   T S  D        Q  P    P     PN    D     +SS S S 
Sbjct  123  PVTHEPLNKPQKTPSEHDPEASLSSSQADPTSESPANTHQPNNAHADEYNSSSSSPSASS  182

Query  335  nssitstNDEFQRVLDTM-------SDNDPLLSSL-LENNAPPVDLTWNLS---------  207
              +  S  DE   +L+ +        D   L+ SL ++ + P    T+++S         
Sbjct  183  AENCCSGRDESTVLLEYICSGGGGDDDQSFLMDSLWVDESQPAGPPTFDVSPKENPSGGG  242

Query  206  -DDHQMIFENLTIPKLDENFAWLMDHQDFGIHDF-GYEC  96
              D    F   + P  +E+F+WL+  QD+GIHDF G++C
Sbjct  243  GGDVAGFFP--SWPDENESFSWLLGGQDYGIHDFDGFDC  279



>ref|XP_002321838.2| hypothetical protein POPTR_0015s14600g [Populus trichocarpa]
 gb|EEF05965.2| hypothetical protein POPTR_0015s14600g [Populus trichocarpa]
Length=274

 Score =   260 bits (664),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 172/258 (67%), Gaps = 7/258 (3%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL++FILS+GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVSFILSHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+ DEE+LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNDDEEKLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSD-KGNGQLQVQVVPEGTPPTVPNLISE--DLnsscstsenssit  321
            PVTH  L K  +   S    +      ++       +P + +       + ST+   +  
Sbjct  123  PVTHGSLSKQVSPQESTVSCHTNYDQPIINADNQQVLPKICAHASSRTDNSSTTTTPTEN  182

Query  320  stNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLS---DDHQMIFENLTIPKLDENF  150
            S+ DE     +  +DNDP + S + + A   D +WN     +D+     + +    D   
Sbjct  183  SSVDECVGSSEPNNDNDPTM-SFIWSEAFLDDSSWNFQATREDYSEFGVSNSSSDQDSYS  241

Query  149  AWLMDHQDFGIHDFGYEC  96
             W +D +D G   FG  C
Sbjct  242  TWFLDCKDLGDEFFGLSC  259



>gb|KCW46285.1| hypothetical protein EUGRSUZ_K00153 [Eucalyptus grandis]
Length=206

 Score =   257 bits (657),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEED+KL+ FIL++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDRKLVNFILTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EE LVIDLHA+LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLI+MGID
Sbjct  63   PDLKRGLLNEAEESLVIDLHATLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIRMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTP  393
            PVTH+PL +   +    K N Q + +V    TP
Sbjct  123  PVTHKPLQEQANEQVPSKANEQAKFEVSNHETP  155



>ref|XP_010539859.1| PREDICTED: protein ODORANT1-like [Tarenaya hassleriana]
Length=286

 Score =   260 bits (664),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 141/271 (52%), Positives = 181/271 (67%), Gaps = 21/271 (8%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FI++NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFIVANGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL++MGID
Sbjct  63   PDLKRGLLSDSEEQLVIDLHAHLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLRMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTH+PL K+  D  +      +  Q   E    + PN        +  ++EN+S  ++ 
Sbjct  123  PVTHQPLTKEPNDQNNIDNPEIIATQNPDENL--SEPNTGHAQSVETNVSAENTSDQNSL  180

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTW---------------NLSDDHQMIFENL  177
             +  ++  ++++++ L +SL  +     D +W               N+S ++ +   + 
Sbjct  181  TDDSQLFGSINNDEDLFNSLWTDEPLWGDTSWTNNNVGLSGEDAGRDNISGENMVSVGDF  240

Query  176  TI----PKLDENFAWLMDHQDFGIHDFGYEC  96
                    + EN+ +    QDFG+ DFG+ C
Sbjct  241  PAWSQEEMVSENWTFWDYCQDFGVQDFGFGC  271



>ref|XP_009136061.1| PREDICTED: protein ODORANT1 [Brassica rapa]
Length=267

 Score =   259 bits (662),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 145/275 (53%), Positives = 180/275 (65%), Gaps = 35/275 (13%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKL VKKGPWTAEEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLVVKKGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVIDLHA LGN+WSKIAS+LPGRTDNEIKNHWNT IKKKL+KMGID
Sbjct  63   PDLKRGLLSHDEEQLVIDLHAHLGNKWSKIASRLPGRTDNEIKNHWNTRIKKKLVKMGID  122

Query  491  PVTHEPLIKDTTD--------STSDKGNGQLQVQVVP-EGTPPTVPNLISEDLnsscsts  339
            P+TH+PL ++  +        STSD       + + P  G+       ++ED     S+S
Sbjct  123  PMTHQPLNQEPNNTYNPQNLSSTSD------DISMKPRSGSTKETNGTLTED----ESSS  172

Query  338  enssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSD----------DHQMI  189
              +   ++ D    +L  + +++ L S L  +     + +W+ S+          D+ M 
Sbjct  173  TVTGQNNSTDSENHLLSNIYNDEELFSHLWSDETTTAEASWSDSNDGFGGTLYHHDNNMS  232

Query  188  FENLTIP-----KLDENFAWLMDH-QDFGIHDFGY  102
                  P      ++ N    +D+ QDFG+HDFG+
Sbjct  233  GAGADFPIWSPEGINGNDWTFLDYCQDFGVHDFGF  267



>gb|KFK28838.1| hypothetical protein AALP_AA7G055500 [Arabis alpina]
Length=265

 Score =   259 bits (662),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 177/265 (67%), Gaps = 19/265 (7%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQLVI+LHA LGN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+K+GID
Sbjct  63   PDLKRGLLSHDEEQLVIELHALLGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLLKIGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            P+TH+PL ++  ++ + K N  L    + + +                S++     +S +
Sbjct  123  PMTHQPLNQEPNNNDNPK-NISLNPDDISKHSNTKTVKTSGTSTEDESSSTVTDQNSSMD  181

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENL---TIPKLDENF---  150
            +E   ++D + ++D L S L  +     + +W  SD +  +   L    +P    +F   
Sbjct  182  NENHLLIDKIYNDDDLFSYLWSDQTTIAEASW--SDSNYGVGGTLYDDNVPGAGADFPIW  239

Query  149  ----------AWLMDHQDFGIHDFG  105
                       +L   +DFG+HDFG
Sbjct  240  SPEGINGNDWRYLDYCEDFGVHDFG  264



>ref|XP_010035019.1| PREDICTED: protein ODORANT1 [Eucalyptus grandis]
 gb|KCW46286.1| hypothetical protein EUGRSUZ_K00153 [Eucalyptus grandis]
Length=269

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 167/250 (67%), Gaps = 4/250 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEED+KL+ FIL++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDRKLVNFILTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EE LVIDLHA+LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLI+MGID
Sbjct  63   PDLKRGLLNEAEESLVIDLHATLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIRMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTH+PL +   +    K N Q + +V    TP    +  S++ +S    + ++  + + 
Sbjct  123  PVTHKPLQEQANEQVPSKANEQAKFEVSNHETPVYPCDGSSDNFSSPIIDNFSTGKSPSF  182

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTI-PKLDENFAWLMD  135
            D      D    N     + L N   P    +    D Q  +    + P    + +WL +
Sbjct  183  DPNISSFDDPWMNHVRWETFLGN---PSSWNFMFEGDRQEDYGEFGVCPSAGGDPSWLFN  239

Query  134  HQDFGIHDFG  105
             +  G+  F 
Sbjct  240  RESTGVESFA  249



>ref|XP_006289620.1| hypothetical protein CARUB_v10003172mg [Capsella rubella]
 gb|EOA22518.1| hypothetical protein CARUB_v10003172mg [Capsella rubella]
Length=280

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 155/282 (55%), Positives = 190/282 (67%), Gaps = 33/282 (12%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKL VKKGPWTAEEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLMVKKGPWTAEEDKKLINFILNNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KM ID
Sbjct  63   PDLKRGLLSEAEEQLVIDLHALLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMEID  122

Query  491  PVTHEPLIK--------DTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstse  336
            P+TH+PL K        D ++++S  GN +       E T  +  N I+E       TS 
Sbjct  123  PLTHQPLNKVSSDKKFDDKSETSSKDGNVKRSDDKSLE-TDESTKNTINE-------TST  174

Query  335  nssitstNDEFQRVLDTMSDNDP-LLSSLLENNAPP-VDLTWNLS----------DDHQM  192
             +   S+ DE++ + D +   D  L + L  N+ PP VD++W+ S          D   M
Sbjct  175  ITHQNSSKDEYELLGDIIDHKDEDLFNILWTNDEPPLVDVSWSNSIGGAASVVAADKINM  234

Query  191  -IFENLTIPKLDE----NFAWLMDHQDFGIHDFGYECSNVAT  81
               E+L    L+E    N+ +L   +DFG+ DFG+  +++ T
Sbjct  235  EAGEDLPTWPLEEKNGDNWMFLDYCKDFGVQDFGFCQTSMET  276



>ref|NP_567390.4| myb domain protein 42 [Arabidopsis thaliana]
 gb|AAD53104.1|AF175999_1 putative transcription factor [Arabidopsis thaliana]
 gb|AEE83118.1| myb domain protein 42 [Arabidopsis thaliana]
Length=286

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/281 (53%), Positives = 183/281 (65%), Gaps = 41/281 (15%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKL VKKGPWTAEEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLMVKKGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KM ID
Sbjct  63   PDLKRGLLSDAEEQLVIDLHALLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMEID  122

Query  491  PVTHEPLIKDTTDS-------TSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            P TH+PL K  TD+       TS K +     ++V      T  N I + +         
Sbjct  123  PSTHQPLNKVFTDTNLVDKSETSSKADNVNDNKIVE--IDGTTTNTIDDSI--------I  172

Query  332  ssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPV--DLTWNLSDDHQMIFENLTIPKLD  159
            +   S+ND+++ + D + +   L + L  N+ PP+  D +W  S+ +  I     +   D
Sbjct  173  THQNSSNDDYELLGDIIHNYGDLFNILWTNDEPPLVDDASW--SNHNVGIGGTAAVAASD  230

Query  158  ENF------------------AWL-MDH-QDFGIHDFGYEC  96
            +N                   +W+ +D+ Q+FG+ DFG+EC
Sbjct  231  KNNTAAEEDFPERSFEKQNGESWMFLDYCQEFGVEDFGFEC  271



>gb|AGV22119.1| MYB transcription factor 2 [Betula luminifera]
Length=252

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/263 (56%), Positives = 173/263 (66%), Gaps = 30/263 (11%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWT EEDKKL+ FIL++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTVEEDKKLVNFILTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTESEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDST----SDKGNGQLQVQVV----PEGTPPTVPNLISEDLnsscstse  336
            P+THEPL K+ T       S   +  L ++V+     E      P   S           
Sbjct  123  PLTHEPLQKEDTPQQTFCHSTTADDDLDLEVINHEQEESQKICAPTENSS----------  172

Query  335  nssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKL-D  159
                    DE  R L    D+D L+S +        D  WN S      + +L +P   D
Sbjct  173  -------TDE-SRSLSDPGDDDLLMSYIWSETIFLDDSFWN-SPAASGSYGSLGLPSSED  223

Query  158  ENFAWLMDH-QDFG-IHDFGYEC  96
            ++  WL+D+ +DFG   DFG+ C
Sbjct  224  DSDRWLLDYKKDFGDEEDFGFGC  246



>ref|XP_006660886.1| PREDICTED: protein ODORANT1-like [Oryza brachyantha]
Length=275

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 174/257 (68%), Gaps = 12/257 (5%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVK+GPWTAEEDKKL++FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKRGPWTAEEDKKLMSFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQLVIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTDAEEQLVIDLHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPL-IKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitst  315
            PVTHEPL +K  + +T+ +       +   + +P     ++ +      S  E+S+ T++
Sbjct  123  PVTHEPLDLKQASPTTTSQSTVTESGEATRQQSPQLDDVVLRDMSAGGDSPPESSTNTAS  182

Query  314  NDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTW------NLSDDHQMIFENLTIPKLDEN  153
                     +    DPL+  LLE + P  D  W      N  D+   I      P L  +
Sbjct  183  TAGGSSSSSSSHYQDPLVKWLLEEDLPTGDEPWLNFTAGNDVDEFSSIAP--AAPSLPWD  240

Query  152  FA---WLMDHQDFGIHD  111
                 WL+D+QDFG+ D
Sbjct  241  VGVTDWLLDYQDFGMGD  257



>gb|AAS10075.1| MYB transcription factor [Arabidopsis thaliana]
Length=286

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 149/281 (53%), Positives = 182/281 (65%), Gaps = 41/281 (15%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKL VKKGPWTAEEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLMVKKGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KM ID
Sbjct  63   PDLKRGLLSDAEEQLVIDLHALLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMEID  122

Query  491  PVTHEPLIKDTTDS-------TSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            P TH+PL K  TD+       TS K +     ++V      T  N I + +         
Sbjct  123  PSTHQPLNKVFTDTNLVDKSETSSKADNVNDNKIVE--IDGTTTNTIDDSI--------I  172

Query  332  ssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPV--DLTWNLSDDHQMIFENLTIPKLD  159
            +   S+ND+++ + D + +   L   L  N+ PP+  D +W  S+ +  I     +   D
Sbjct  173  THQNSSNDDYELLGDIIHNYGDLFDILWTNDEPPLVDDASW--SNHNVGIGGTAAVAASD  230

Query  158  ENF------------------AWL-MDH-QDFGIHDFGYEC  96
            +N                   +W+ +D+ Q+FG+ DFG+EC
Sbjct  231  KNNTAAEEDFPERSFEKQNGESWMFLDYCQEFGVEDFGFEC  271



>ref|XP_011029963.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=276

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 179/270 (66%), Gaps = 29/270 (11%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ FIL++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFILTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++DEEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNEDEEQLVIDLHACLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNL-------ISEDLnsscstsen  333
            PVTHEPL K           G  Q  +VP  T    PN        + ++   + S++ +
Sbjct  123  PVTHEPLNK----------QGSPQESIVPCHTNYDQPNFNADGQQVLPQNCGHASSSTTD  172

Query  332  ssitstNDEFQRVLDTM--------SDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENL  177
            +S ++T  E   V + +        +D+DPL+S +  +     D +WN        F   
Sbjct  173  NSSSTTPTENSSVDECIGSSEPNSTTDSDPLMSCIW-SEVFLDDSSWNFQATRGGDFSEF  231

Query  176  TIPKLDENFA---WLMDHQDFGIHDFGYEC  96
             + K     +   W++D +D G   FG  C
Sbjct  232  GLSKSSSEDSNSPWVLDSKDLGDEFFGLSC  261



>ref|XP_010101097.1| Protein ODORANT1 [Morus notabilis]
 gb|EXB86983.1| Protein ODORANT1 [Morus notabilis]
Length=258

 Score =   256 bits (655),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ FIL++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFILTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNEAEEQLVIDLHAHLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPL--IKDTTDSTS  444
            PVTHEPL   KD   STS
Sbjct  123  PVTHEPLNGQKDKYSSTS  140



>emb|CAN68308.1| hypothetical protein VITISV_043506 [Vitis vinifera]
Length=203

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLTESEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTT  456
            PVTHEP  K   
Sbjct  123  PVTHEPFHKQAA  134



>ref|XP_010529493.1| PREDICTED: protein ODORANT1-like [Tarenaya hassleriana]
Length=278

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 179/263 (68%), Gaps = 13/263 (5%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKLI+F++ +GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLISFMVRSGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVIDLH+ LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSDSEEQLVIDLHSHLGNRWSKIASRLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            P+TH+PL K+  D  + + + ++  +     + P   +  S + + S + S     +ST+
Sbjct  123  PMTHQPLNKEPNDHKNIENSDKISPKTDENRSEPKTSDTKSIETDISTANSSIDQNSSTD  182

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMI---------FENLTIPKL-  162
            D   R   +++D++ L +SL  +     D     ++              F   T  ++ 
Sbjct  183  D--SRPFGSINDDEDLFNSLWSDEPFSFDTISWSNNGGGGGNSVAAAGGDFPAWTPEEMN  240

Query  161  -DENFAWLMDHQDFGIHDFGYEC  96
             D +  +L   QDFG+ DFG+ C
Sbjct  241  GDHDRMFLDYCQDFGVQDFGFGC  263



>ref|XP_008679710.1| PREDICTED: protein ODORANT1 [Zea mays]
 gb|AFW65654.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04818.1| MYB transcription factor, partial [Zea mays]
Length=264

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 175/254 (69%), Gaps = 20/254 (8%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK GVK+GPWTAEEDKKLI+FIL++GQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKQGVKRGPWTAEEDKKLISFILTHGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSTAEEQLVIDLHAMLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLVKMGID  122

Query  491  PVTHEPLIKD---------TTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscsts  339
            P TH+PL             TD ++   N + ++ +  +G+    P  +S D +   S  
Sbjct  123  PATHQPLANSKEAASSQSTVTDESAKTSNSREELSLKNDGSRREAP--LSTDSSEQSSWP  180

Query  338  enssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLD  159
            E+ S ++  D+   +L+       L  + L  + P +D T   S + ++     T+P  D
Sbjct  181  ESGSGSNVCDQGPELLENW-----LSETGLSMDEPWLDFT---SRNDELGNVEGTLP-WD  231

Query  158  ENFAWLMDHQDFGI  117
                WL+D+QDFG+
Sbjct  232  GTTDWLLDYQDFGM  245



>ref|XP_008467265.1| PREDICTED: protein ODORANT1 [Cucumis melo]
Length=236

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+TFIL+ G CCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVTFILTYGHCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL + EEQLVIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLDETEEQLVIDLHAHLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTD  453
            PVTH+PL K  T+
Sbjct  123  PVTHQPLKKQQTE  135



>ref|XP_002318878.1| hypothetical protein POPTR_0012s14540g [Populus trichocarpa]
 gb|EEE97098.1| hypothetical protein POPTR_0012s14540g [Populus trichocarpa]
Length=276

 Score =   254 bits (650),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 173/267 (65%), Gaps = 23/267 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ FIL++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFILTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++DEEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNEDEEQLVIDLHACLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIK------------DTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnssc  348
            PVTHEPL K               D  +   +GQ   QV+P+       +       ++ 
Sbjct  123  PVTHEPLNKLESPQESTVPCHTNYDQPNFNADGQ---QVLPQNCGHASSSTTDNSSTTTP  179

Query  347  stsenssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIP  168
            + + +      + E     ++  D+DPL+S +  +     D +WN        F    + 
Sbjct  180  TENSSVDECIGSSE----PNSTPDSDPLMSCIW-SEVFLDDSSWNFQASRGGDFSEFGLS  234

Query  167  KLDENFA---WLMDHQDFGIHDFGYEC  96
            K     +   W++D +D G   FG  C
Sbjct  235  KSSSEDSNSPWVLDSKDLGDEFFGLSC  261



>ref|NP_001063765.1| Os09g0532900 [Oryza sativa Japonica Group]
 dbj|BAD33318.1| putative myb-related transcription factor [Oryza sativa Japonica 
Group]
 dbj|BAD46027.1| putative myb-related transcription factor [Oryza sativa Japonica 
Group]
 dbj|BAF25679.1| Os09g0532900 [Oryza sativa Japonica Group]
 dbj|BAG97524.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99392.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84939.1| hypothetical protein OsI_32154 [Oryza sativa Indica Group]
 gb|EEE70106.1| hypothetical protein OsJ_30116 [Oryza sativa Japonica Group]
Length=285

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 173/265 (65%), Gaps = 18/265 (7%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVK+GPWTAEEDKKL++FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKRGPWTAEEDKKLMSFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQLVIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTDAEEQLVIDLHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPL-IKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNL---ISEDLnsscstse---n  333
            PVTHEPL  K  + +T+ +     +     E T      L   +  D++ S        +
Sbjct  123  PVTHEPLDRKQESPATTSQSTVTAESSKSGEATRQQSRQLDDAVVRDMSVSAGGDSPPES  182

Query  332  ssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPV-DLTW------NLSDDHQMIFENLT  174
            S+ T++         +    DPL+  LLE +  P  D  W      N  D+   I     
Sbjct  183  STNTASTAGGSSSSSSSHHQDPLVKWLLEEDLLPTGDEPWLNFTASNDVDEFSSIAATGA  242

Query  173  IPKLDENFA----WLMDHQDFGIHD  111
             P L  +      WL+D+QDFG+ D
Sbjct  243  TPALPWDVGMTTDWLLDYQDFGMGD  267



>gb|ACN91625.1| transcription factor MYBL1 [Populus x canadensis]
Length=276

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 175/267 (66%), Gaps = 23/267 (9%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPC DKLGVKKGPWTAEEDKKL+ FIL++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCRDKLGVKKGPWTAEEDKKLVNFILTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++DEEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNEDEEQLVIDLHACLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTT------------DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnssc  348
            PVTHEPL K  +            D  +   +GQ   QV+P+ +     +       ++ 
Sbjct  123  PVTHEPLNKQESPQESIVPCHTNYDQPNFNADGQ---QVLPQNSGHASSSTTDNSSTTTP  179

Query  347  stsenssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIP  168
            + + +      + E     ++ +D+DPL+S L  +     D +WN        +    + 
Sbjct  180  TENSSVDECIGSSE----PNSTTDSDPLMSCLW-SEVFLDDSSWNFQATRGGDYSEFGLS  234

Query  167  KLDENFA---WLMDHQDFGIHDFGYEC  96
            K     +   W++D QD G   FG  C
Sbjct  235  KSSSEDSNSPWVLDSQDLGDEFFGLSC  261



>ref|XP_007218420.1| hypothetical protein PRUPE_ppa011549mg [Prunus persica]
 gb|EMJ19619.1| hypothetical protein PRUPE_ppa011549mg [Prunus persica]
Length=206

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 162/254 (64%), Gaps = 50/254 (20%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ F+L++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFLLAHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLH+ LGNRWSKIA+ LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNEAEEQLVIDLHSRLGNRWSKIAAGLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            P+THEPL K  T                PE   P  PN    DL                
Sbjct  123  PITHEPLCKQATP---------------PEM--PCKPNNPPADL----------------  149

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKLDENFAWLMDH  132
            D  Q+ ++        +SS  E ++       N ++D+ +              AW +D 
Sbjct  150  DMNQQNVNIPEHG---ISSAAETSSEDSSAADNPAEDNSL--------------AWFLDC  192

Query  131  QDFGIHDFGYECSN  90
            +DFG+ DF   C N
Sbjct  193  KDFGVEDFELGCIN  206



>ref|XP_004143714.1| PREDICTED: protein ODORANT1-like [Cucumis sativus]
Length=236

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+TFIL+ G CCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVTFILTYGHCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL + EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLDETEEQLVIDLHAHLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTD  453
            P TH+PL K  T+
Sbjct  123  PATHQPLKKQQTE  135



>ref|XP_004162772.1| PREDICTED: protein ODORANT1-like, partial [Cucumis sativus]
Length=229

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+TFIL+ G CCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVTFILTYGHCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL + EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLDETEEQLVIDLHAHLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTD  453
            P TH+PL K  T+
Sbjct  123  PATHQPLKKQQTE  135



>ref|XP_009108579.1| PREDICTED: protein ODORANT1-like [Brassica rapa]
Length=268

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 173/266 (65%), Gaps = 16/266 (6%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWT EEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTTEEDKKLINFILNNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDL+RGLLS +EEQLVIDLHA +GN+WSKIAS+L GRTDNEIKNHWNT IKKKL+KMGID
Sbjct  63   PDLRRGLLSHEEEQLVIDLHAHMGNKWSKIASRLRGRTDNEIKNHWNTRIKKKLVKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscst-senssitst  315
            PVTH+PL +D   + + K +  +   +       +  N+ +    +   + S  +   S+
Sbjct  123  PVTHQPLNQDPNSTDNPKNSCSVSDDISMVTKSSSTKNIETNGTRTEDESISTITDQNSS  182

Query  314  NDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLS--DDHQMIFENLTIPKLDENFA--  147
             D     L  + +++ L S L  + +   +  W+ S  D    ++ +  +     +F   
Sbjct  183  MDNDNHQLSNIYNDEELFSYLWSDESTKAETPWSDSNYDVGGTLYHDNNVSCAGADFPIC  242

Query  146  ---------W-LMDH-QDFGIHDFGY  102
                     W   D+ QDFG+HDFG+
Sbjct  243  SPERINGVDWTFQDYCQDFGVHDFGF  268



>ref|XP_006421721.1| hypothetical protein CICLE_v10005666mg [Citrus clementina]
 gb|ESR34961.1| hypothetical protein CICLE_v10005666mg [Citrus clementina]
Length=261

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 167/254 (66%), Gaps = 30/254 (12%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTA+EDKKL+TFIL++G CCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTADEDKKLVTFILTHGHCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTT--------DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstse  336
            PVTHEPL +           +S  D         +   G     P + SE          
Sbjct  123  PVTHEPLQQQANITEDQAPINSHDDHQQAASNFDIANVGEQQEKPRICSE----------  172

Query  335  nssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMI-FENLTIPKLD  159
                  + D   +   T SD+D L+S +  ++      T++L+D      F   +  + +
Sbjct  173  ---QNYSTDHESKNRPTTSDDD-LMSYMWSSD------TFDLADTFTSWNFPTASSSEGN  222

Query  158  ENFAWLMD-HQDFG  120
             +  WLMD HQ FG
Sbjct  223  PSSPWLMDYHQGFG  236



>ref|XP_006490087.1| PREDICTED: protein ODORANT1-like [Citrus sinensis]
 gb|KDO65428.1| hypothetical protein CISIN_1g024849mg [Citrus sinensis]
Length=261

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 167/254 (66%), Gaps = 30/254 (12%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTA+EDKKL+TFIL++G CCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTADEDKKLVTFILTHGHCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++ EEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNEAEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTT--------DSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstse  336
            PVTHEPL +           +S  D         +   G     P + SE          
Sbjct  123  PVTHEPLQQQANITEDQAPINSHDDHQQAASNFDIANVGEQQEKPRICSE----------  172

Query  335  nssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMI-FENLTIPKLD  159
                  + D   +   T SD+D L+S +  ++      T++L+D      F   +  + +
Sbjct  173  ---KNYSTDHESKNRPTTSDDD-LMSYMWSSD------TFDLADTFTSWNFPTASSSEGN  222

Query  158  ENFAWLMD-HQDFG  120
             +  WLMD HQ FG
Sbjct  223  PSSPWLMDYHQGFG  236



>ref|XP_011041720.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=273

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 167/257 (65%), Gaps = 6/257 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ FIL++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFILTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++DEE+LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLNEDEEKLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            PVTH  L K  T   S         Q +       V   I  + +S    S   +  + N
Sbjct  123  PVTHGSLSKQVTPIESTVSCHTNYDQPIINADNQQVLPKICANASSRTDNSSTPTTPTEN  182

Query  311  DEFQRVLDTMS---DNDPLLSSLLENNAPPVDLTWNL--SDDHQMIFENLTIPKLDENFA  147
                  + +     DNDP + S + ++A   D +WN   + D    F        D +  
Sbjct  183  SSVDVCVGSSEPNKDNDPTM-SFIWSDAFLDDSSWNFPATRDDYSEFGVSNSSSEDSDST  241

Query  146  WLMDHQDFGIHDFGYEC  96
            W +D +D G   FG  C
Sbjct  242  WFLDCKDLGDEFFGLSC  258



>ref|XP_007038425.1| Myb domain protein 42 [Theobroma cacao]
 gb|EOY22926.1| Myb domain protein 42 [Theobroma cacao]
Length=271

 Score =   252 bits (644),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ FIL++GQCCWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKKGPWTAEEDKKLVNFILTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL++DEEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLNEDEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIK  465
            PVTHEPL K
Sbjct  123  PVTHEPLQK  131



>dbj|BAF80451.1| MYB-related transcription factor [Nicotiana tabacum]
Length=302

 Score =   253 bits (645),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 135/167 (81%), Gaps = 4/167 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FILSNGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILSNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL----IKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISED  363
            PVTH+PL      D   S     N  +Q + V E  PP   N +S D
Sbjct  123  PVTHKPLSTTITNDQITSIQQPENLPIQQEKVQEIMPPCTVNDVSID  169



>emb|CAC85051.1| Myb13 protein [Oryza sativa]
 emb|CAC85052.1| Myb15 protein [Oryza sativa]
Length=285

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 172/265 (65%), Gaps = 18/265 (7%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPC DKLGVK+GPWTAEEDKKL++FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCSDKLGVKRGPWTAEEDKKLMSFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+  EEQLVIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTDAEEQLVIDLHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPL-IKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNL---ISEDLnsscstse---n  333
            PVTHEPL  K  + +T+ +     +     E T      L   +  D++ S        +
Sbjct  123  PVTHEPLDRKQESPATTSQSTVTAESSKSGEATRQQSRQLDDAVVRDMSVSAGGDSPPES  182

Query  332  ssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPV-DLTW------NLSDDHQMIFENLT  174
            S+ T++         +    DPL+  LLE +  P  D  W      N  D+   I     
Sbjct  183  STNTASTAGGSSSSSSSHHQDPLVKWLLEEDLLPTGDEPWLNFTASNDVDEFSSIAATGA  242

Query  173  IPKLDENFA----WLMDHQDFGIHD  111
             P L  +      WL+D+QDFG+ D
Sbjct  243  TPALPWDVGMTTDWLLDYQDFGMGD  267



>dbj|BAD10751.1| putative Myb13 protein [Oryza sativa Japonica Group]
 dbj|BAD09945.1| putative Myb13 protein [Oryza sativa Japonica Group]
 gb|EAZ07894.1| hypothetical protein OsI_30149 [Oryza sativa Indica Group]
 gb|EAZ43562.1| hypothetical protein OsJ_28183 [Oryza sativa Japonica Group]
Length=262

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 169/262 (65%), Gaps = 34/262 (13%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK  VK+GPWTAEEDKKLI+FIL++G+CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKKKVKRGPWTAEEDKKLISFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+ DEEQLV+DLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTADEEQLVVDLHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPL-----IKDTTDST-------SDKGNGQLQVQVVPEGTPPTVPNLISEDLnssc  348
            P TH+PL     +  T  ST       S K NG +     PEG         S D++   
Sbjct  123  PATHQPLPNTKVVSQTRTSTLSTATTESAKSNG-MAYPFDPEGG-------CSRDMSVPT  174

Query  347  stsenssitstNDEFQRVLDTMSDN-DPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTI  171
             + E           Q   +T S   DPL++ LLE   P  +   N +  ++  F  +  
Sbjct  175  DSME-----------QSSRNTSSHGLDPLVNWLLEAELPADEPWLNFTSSNEDDFSGIVK  223

Query  170  PKL--DENFAWLMDHQDFGIHD  111
                      WL+D+QDF + D
Sbjct  224  QSAWDGSTTDWLLDYQDFSMDD  245



>ref|XP_009589696.1| PREDICTED: protein ODORANT1 [Nicotiana tomentosiformis]
Length=302

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 135/167 (81%), Gaps = 4/167 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILNNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL----IKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISED  363
            PVTH+PL      D   S     N  +Q + V E  PP   N +S D
Sbjct  123  PVTHKPLSTTITNDQITSIQQPENLPIQQEKVQEIMPPCTVNDVSID  169



>ref|XP_004974136.1| PREDICTED: protein ODORANT1-like isoform X1 [Setaria italica]
 ref|XP_004974137.1| PREDICTED: protein ODORANT1-like isoform X2 [Setaria italica]
Length=262

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/247 (57%), Positives = 168/247 (68%), Gaps = 9/247 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVK+GPWTAEEDKKLI+FIL++G+CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKLGVKRGPWTAEEDKKLISFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVIDLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLSTAEEQLVIDLHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitstN  312
            P TH+PL  ++  STS   +     +        +V      D+       E SS   + 
Sbjct  123  PATHQPLA-NSKMSTSQSTDTTKSAKSSDTRDELSVKEGSRRDMALPTDPLEQSSWLESG  181

Query  311  DEFQRVLDTMSDNDPLLSSLLENNAPPVD--LTWNLSDDHQMIFENLTIPKLDENFAWLM  138
            +   R      D + L++ L E + P  +  L +  SD+  +      +P  D    WL+
Sbjct  182  NNAGR-----QDQEHLVNWLSETDLPMDEPWLNFTSSDNDVLGIVEGPLP-WDGATDWLL  235

Query  137  DHQDFGI  117
            D+QDFG+
Sbjct  236  DYQDFGM  242



>ref|XP_003616278.1| P-type R2R3 Myb protein [Medicago truncatula]
 gb|AES99236.1| myb transcription factor [Medicago truncatula]
Length=320

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL-IKDTTDSTSDKGNGQLQVQVVPE  402
            P+TH+PL + + +D T D+   QL   +  E
Sbjct  123  PMTHKPLALSNASDQTQDQPKQQLHQSLEKE  153



>ref|XP_009616533.1| PREDICTED: protein ODORANT1-like [Nicotiana tomentosiformis]
Length=290

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 134/163 (82%), Gaps = 4/163 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKL GL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILNNGQCCWRAVPKLTGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISED  363
            PVTH+PL    + +     N  +Q + V E  PP   N +S D
Sbjct  123  PVTHKPL----STNIEQPENLPIQQEKVQEIMPPCTVNYVSID  161



>ref|XP_009407976.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=251

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 169/250 (68%), Gaps = 25/250 (10%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            R+PCCDKLGVKKGPW+AEED KLI FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RRPCCDKLGVKKGPWSAEEDNKLINFILANGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EE+LVID HA LGNRWSKIA+ LPGRTDNEIKN WNTHIKKKL+KMGID
Sbjct  63   PDLKRGLLSEEEERLVIDFHARLGNRWSKIAAMLPGRTDNEIKNLWNTHIKKKLLKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISED-Lnsscstsenssitst  315
            PVTH PL +                Q  PE +P TV    S+D L S  +  +  S  + 
Sbjct  123  PVTHRPLHR----------------QASPEASPSTVTTDKSDDQLQSQGNEGQIPSSDNR  166

Query  314  NDEFQRVLDTMSDNDPLLSSLLENNAPP-VDLTWNL-SDDHQMIFENLTIPKL----DEN  153
            +      +D     DPL+S L E++AP  +D  W L SDD    + ++   ++    + +
Sbjct  167  SPAEASSID--GGTDPLMSCLWEDSAPVLLDELWQLSSDDDGNNYGSVIAGRMPWEEEGS  224

Query  152  FAWLMDHQDF  123
              WL+D QD 
Sbjct  225  SEWLLDIQDL  234



>ref|XP_006364618.1| PREDICTED: protein ODORANT1-like [Solanum tuberosum]
Length=311

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 129/142 (91%), Gaps = 2/142 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILNNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTS--DKGN  432
            P+TH+PL   T D T+  ++GN
Sbjct  123  PITHKPLSTITIDQTNTLEQGN  144



>ref|XP_010312447.1| PREDICTED: myb-related transcription factor isoform X1 [Solanum 
lycopersicum]
Length=309

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILNNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTS  444
            P+TH+PL   T D T+
Sbjct  123  PITHKPLSTITIDHTN  138



>ref|NP_001234300.1| myb-related transcription factor [Solanum lycopersicum]
 emb|CAA67600.1| myb-related transcription factor [Solanum lycopersicum]
Length=274

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILNNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTS  444
            P+TH+PL   T D T+
Sbjct  123  PITHKPLSTITIDHTN  138



>gb|KHG13514.1| Protein ODORANT1 [Gossypium arboreum]
Length=303

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 140/171 (82%), Gaps = 8/171 (5%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTSDK-----GNGQLQVQVV---PEGTPPTVPNLISED  363
            P+TH+PL   TT+    +       G L+ QVV   P+    ++ + ISE+
Sbjct  123  PLTHKPLSSTTTEPQQSQQKNQVSKGGLKSQVVDKSPKEPETSLQSTISEE  173



>ref|XP_006659660.1| PREDICTED: protein ODORANT1-like [Oryza brachyantha]
Length=262

 Score =   246 bits (629),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 167/261 (64%), Gaps = 36/261 (14%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK  VK+GPWTAEEDKKLI+FIL++G+CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKKRVKRGPWTAEEDKKLISFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+ DEE+LV+DLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTADEEKLVVDLHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIK-----------DTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscs  345
            P TH+PL              +T +T    +  +   V P+G      ++ ++ L     
Sbjct  123  PATHQPLANTKAISQTGTSTQSTVTTESAKSNDMAYPVDPKGGCSRSMSVPTDSLE----  178

Query  344  tsenssitstNDEFQRVLDTMSDN-DPLLSSLLENNAPP----VDLTWNLSDDHQMIFEN  180
                          Q   +T S   DPLL+ LLE   P     ++ T +  DD   I + 
Sbjct  179  --------------QSSRNTSSQGLDPLLNWLLETELPADEPWLNFTSSNDDDLCGIVKQ  224

Query  179  LTIPKLDENFAWLMDHQDFGI  117
              +        WL+D+QDF +
Sbjct  225  SALD--GSTTDWLLDYQDFSM  243



>ref|XP_009412832.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=234

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 160/254 (63%), Gaps = 32/254 (13%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            R+PCCDKLGVKKGPW+ EEDKKLI+FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RRPCCDKLGVKKGPWSTEEDKKLISFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVID HA LGNRWSKIA+ LPGRTDNEIKN WNTHIKKKL+KMG+D
Sbjct  63   PDLKRGLLSPAEEQLVIDFHARLGNRWSKIAAMLPGRTDNEIKNLWNTHIKKKLVKMGVD  122

Query  491  PVTHEPLIK-------DTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            PVTH+PL +        +T +T  K + QLQ +   +G   +  N  S            
Sbjct  123  PVTHKPLDRKANSVSSQSTATTESKSDQQLQSRGT-DGQIQSSENTSSP-----------  170

Query  332  ssitstNDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLSDDHQMIFENLTIPKL---  162
                                DPLLS L E+N   +D  W    +  + + ++  P     
Sbjct  171  ----------TEASSNADGADPLLSCLWEDNTSLLDELWQFPSNEDVDYGSVAGPVWPWD  220

Query  161  DENFAWLMDHQDFG  120
            + +  WL+D Q  G
Sbjct  221  EGSCEWLLDDQALG  234



>ref|XP_003574901.1| PREDICTED: protein ODORANT1-like [Brachypodium distachyon]
Length=268

 Score =   246 bits (629),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 169/267 (63%), Gaps = 26/267 (10%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK GVK+GPWTAEED KL++FIL++G+CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKQGVKRGPWTAEEDNKLVSFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+ DEE+LV+DLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  63   PDLKRGLLTADEEKLVVDLHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsenssitst-  315
            P TH+PL      S              P GT     +  S D  +   +        + 
Sbjct  123  PATHQPLANTKAAS--------------PIGTTSQSTSFKSSDTVNQLDSKGTHGEGVSR  168

Query  314  -NDEFQRVLDTMSDNDP-LLSSLLENNAPPVDLTW-NLSDDHQMIFENLTIPKL-DENFA  147
              D  +      SD+D  LL++LL     PVD  W N    +   F ++    L D    
Sbjct  169  PTDSSEHSSRNTSDDDQDLLANLLLEEELPVDEPWLNFESSNDDEFSSIIGQLLCDGPTD  228

Query  146  WLMDHQDFGI-------HDFGYECSNV  87
            WL+D+QD G+        DFG   SN+
Sbjct  229  WLLDYQDVGMGGSSLIDQDFGSPSSNL  255



>ref|XP_009792876.1| PREDICTED: protein ODORANT1-like [Nicotiana sylvestris]
Length=299

 Score =   248 bits (632),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILNNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTSD  441
            PVTH+PL   T D  ++
Sbjct  123  PVTHKPLSTITNDQITN  139



>ref|XP_010062267.1| PREDICTED: protein ODORANT1-like isoform X1 [Eucalyptus grandis]
 gb|KCW69381.1| hypothetical protein EUGRSUZ_F02864 [Eucalyptus grandis]
Length=300

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL++GQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTHGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLIS  369
            P+TH+PL+ +  D+T+D+   Q   Q  P+ +    P L S
Sbjct  123  PLTHKPLVTN-NDNTTDQQPPQ-AAQTHPQESTDPEPTLSS  161



>gb|KHN39463.1| Protein ODORANT1 [Glycine soja]
Length=328

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI+FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVP  405
            PVTH+PL  + T+ T ++   + Q+   P
Sbjct  123  PVTHKPL-PNATEQTKNQTKQEQQLHHQP  150



>ref|XP_009401426.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=226

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KLITFIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDEKLITFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEEQ+VI+LH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDDEEQMVIELHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            PVTH+PL
Sbjct  123  PVTHKPL  129



>gb|KHN07541.1| Protein ODORANT1 [Glycine soja]
Length=333

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRALPKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRALPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTS  444
            PVTH+PL   T ++ +
Sbjct  123  PVTHKPLSNKTEETQA  138



>ref|XP_003538391.1| PREDICTED: protein ODORANT1 [Glycine max]
 gb|KHN17952.1| Protein ODORANT1 [Glycine soja]
Length=336

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVP  381
            PVTH+PL  + T+ T  + + Q   Q + E     +P
Sbjct  123  PVTHKPL-SNKTEQTQAQPDEQQTHQPLQEQQEEPIP  158



>ref|XP_006838010.1| hypothetical protein AMTR_s00091p00025820 [Amborella trichopoda]
 gb|ERN00579.1| hypothetical protein AMTR_s00091p00025820 [Amborella trichopoda]
Length=284

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 131/153 (86%), Gaps = 3/153 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTA+EDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTADEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VID+HA LGNRWSKIA+ LPGRTDNEIKN+WNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSESEEQMVIDIHAYLGNRWSKIAAHLPGRTDNEIKNYWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTP  393
            PVTH+P+   +  +T +K    L     PE TP
Sbjct  123  PVTHKPIASSSPATTEEKPADSLS---KPEETP  152



>ref|XP_003553077.1| PREDICTED: protein ODORANT1-like [Glycine max]
Length=331

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRALPKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRALPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTS  444
            PVTH+PL   T ++ +
Sbjct  123  PVTHKPLSNKTEETQA  138



>gb|AIT13038.1| myb-related transcription factor [Vitis amurensis]
Length=300

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDFEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTT  456
            P+TH+PLI   T
Sbjct  123  PLTHKPLIPAAT  134



>ref|XP_007032972.1| Myb domain protein 20 [Theobroma cacao]
 gb|EOY03898.1| Myb domain protein 20 [Theobroma cacao]
Length=308

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>ref|XP_010108985.1| Protein ODORANT1 [Morus notabilis]
 gb|EXC20625.1| Protein ODORANT1 [Morus notabilis]
Length=325

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDSEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDST  447
            P+TH+P+I   TD +
Sbjct  123  PLTHKPIISTVTDQS  137



>emb|CDP01637.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTA+EDKKLI+FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTADEDKKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTT  456
            PVTH+PL   TT
Sbjct  123  PVTHKPLPPSTT  134



>ref|XP_010660298.1| PREDICTED: protein ODORANT1 [Vitis vinifera]
Length=289

 Score =   245 bits (625),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDFEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTT  456
            P+TH+PLI   T
Sbjct  123  PLTHKPLIPAAT  134



>ref|XP_010551759.1| PREDICTED: protein ODORANT1-like [Tarenaya hassleriana]
Length=302

 Score =   245 bits (626),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KLI FIL+NGQCCWRALPKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLINFILANGQCCWRALPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            PVTH+PL
Sbjct  123  PVTHKPL  129



>gb|KDO50806.1| hypothetical protein CISIN_1g021498mg [Citrus sinensis]
Length=311

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 135/158 (85%), Gaps = 8/158 (5%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPN  378
            P+TH+PL      ST+D  + Q QV++  +   P + N
Sbjct  123  PLTHKPL------STTD--DQQPQVKINQQEQEPLMIN  152



>ref|XP_006430591.1| hypothetical protein CICLE_v10012265mg [Citrus clementina]
 gb|ESR43831.1| hypothetical protein CICLE_v10012265mg [Citrus clementina]
Length=311

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 135/158 (85%), Gaps = 8/158 (5%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPN  378
            P+TH+PL      ST+D  + Q QV++  +   P + N
Sbjct  123  PLTHKPL------STTD--DQQPQVKINQQEQEPLMIN  152



>ref|XP_010032717.1| PREDICTED: protein ODORANT1-like [Eucalyptus grandis]
 gb|KCW52162.1| hypothetical protein EUGRSUZ_J01601 [Eucalyptus grandis]
Length=321

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCC+K+G+KKGPWTAEEDKKLI FIL++GQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCEKVGLKKGPWTAEEDKKLINFILTHGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+LVIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMG+D
Sbjct  63   PDLKRGLLSEQEEKLVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGVD  122

Query  491  PVTHEPLIKDTTD  453
            PVTH+PL+ + +D
Sbjct  123  PVTHKPLVSNPSD  135



>ref|XP_006482113.1| PREDICTED: protein ODORANT1-like [Citrus sinensis]
Length=311

 Score =   245 bits (626),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 135/158 (85%), Gaps = 8/158 (5%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPN  378
            P+TH+PL      ST+D  + Q QV++  +   P + N
Sbjct  123  PLTHKPL------STTD--DQQPQVKINQQEQEPLMIN  152



>emb|CBI33476.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   244 bits (623),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDFEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTT  456
            P+TH+PLI   T
Sbjct  123  PLTHKPLIPAAT  134



>ref|XP_007163381.1| hypothetical protein PHAVU_001G229900g [Phaseolus vulgaris]
 gb|ESW35375.1| hypothetical protein PHAVU_001G229900g [Phaseolus vulgaris]
Length=326

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 128/153 (84%), Gaps = 11/153 (7%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTP  393
            PVTH+ L   T            Q+QV P+  P
Sbjct  123  PVTHKSLSTTTE-----------QIQVQPDQQP  144



>gb|AGN52067.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52177.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=271

 Score =   244 bits (622),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTA+EDKKLI FIL+NGQCCWRALPKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTADEDKKLINFILTNGQCCWRALPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE+LVIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSACEEKLVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            PVTH+PL
Sbjct  123  PVTHQPL  129



>gb|KHG06720.1| Protein ODORANT1 [Gossypium arboreum]
Length=311

 Score =   245 bits (626),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCC+K+G+KKGPWTAEEDKKLI+FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCEKVGLKKGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>ref|XP_004490820.1| PREDICTED: protein ODORANT1-like [Cicer arietinum]
Length=319

 Score =   245 bits (626),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT EEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTVEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEHEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTSDK  438
            P+TH+PL  +T+D T ++
Sbjct  123  PLTHKPL-SNTSDLTQNE  139



>ref|XP_010525304.1| PREDICTED: protein ODORANT1-like [Tarenaya hassleriana]
Length=159

 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT EEDKKLI FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTVEEDKKLINFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VIDLH  LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEQVVIDLHVQLGNRWSKIASQLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            PVTH+PL
Sbjct  123  PVTHKPL  129



>ref|NP_001169938.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 ref|XP_008645558.1| PREDICTED: putative MYB DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 ref|XP_008645563.1| PREDICTED: putative MYB DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 gb|ACN35307.1| unknown [Zea mays]
 tpg|DAA48759.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05136.1| MYB transcription factor, partial [Zea mays]
Length=261

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 169/256 (66%), Gaps = 27/256 (11%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK GVK+GPWTAEEDKKLI+FIL++G+CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKEGVKRGPWTAEEDKKLISFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQLVIDLHA LGNRWS+IA+KLPGRTDNEIKNHWNTHIKKKLIKMGI+
Sbjct  63   PDLKRGLLSTAEEQLVIDLHAKLGNRWSQIAAKLPGRTDNEIKNHWNTHIKKKLIKMGIN  122

Query  491  PVTHEPLIKDT--------TDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstse  336
            P TH+PL            TD ++   + + ++ +  +     VP  +S D         
Sbjct  123  PATHQPLANSKAAPSHSTGTDESAKSSDTREELSLKDDNHHREVP--LSTD---------  171

Query  335  nssitstNDEFQRVLDTMSDNDP-LLSSLLENNAPPVDLTW--NLSDDHQMIFENLTIPK  165
                +S    +      + D DP LL +        VD +W   +S+ +++     T P 
Sbjct  172  ----SSEQSSWPEPGSNVGDQDPELLVNWPSETDLSVDESWLGFMSNGNELGDVEGTSP-  226

Query  164  LDENFAWLMDHQDFGI  117
             D    WL+D+QDFG+
Sbjct  227  WDGTTDWLLDYQDFGM  242



>ref|XP_008227926.1| PREDICTED: protein ODORANT1-like [Prunus mume]
Length=270

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSETEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTD  453
            P+TH+P+  D  D
Sbjct  123  PLTHKPIANDVND  135



>gb|KHG25520.1| Protein ODORANT1 [Gossypium arboreum]
Length=256

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ F+ ++G  CWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  14   RQPCCDKLGVKKGPWTAEEDKKLVNFMRTHGYYCWRAVPKLAGLRRCGKSCRLRWTNYLR  73

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLL+ DEEQLVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKLIKMGID
Sbjct  74   PDLKRGLLNHDEEQLVIDLHARLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLIKMGID  133

Query  491  PVTHEPLIKDTT  456
            P THEPL K  T
Sbjct  134  PATHEPLQKPDT  145



>ref|XP_003578505.1| PREDICTED: protein ODORANT1-like [Brachypodium distachyon]
Length=274

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 3/130 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFIL---SNGQCCWRALPKLAGLRRCGKSCRLRWTN  681
            RQPCCDKLGVK+GPWTAEEDKKL+ FIL   + G+CCWRA+PK+AGL RCGKSCRLRWTN
Sbjct  3    RQPCCDKLGVKRGPWTAEEDKKLMGFILRSGAGGRCCWRAVPKMAGLLRCGKSCRLRWTN  62

Query  680  YLRPDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKM  501
            YLRPDLKRGLL+ DEEQLV+DLHASLGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKM
Sbjct  63   YLRPDLKRGLLTHDEEQLVVDLHASLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKM  122

Query  500  GIDPVTHEPL  471
            GIDPVTH+PL
Sbjct  123  GIDPVTHQPL  132



>ref|XP_004956767.1| PREDICTED: protein ODORANT1-like [Setaria italica]
Length=273

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 132/156 (85%), Gaps = 7/156 (4%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL++F+L+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVSFLLNNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS +EE+ VIDLHA LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSPEEEKTVIDLHAELGNRWSKIASQLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL--IKDTTDSTSDKGNGQLQVQVVPEGTPP  390
            PVTH+PL  + DT  S  D+        V    TPP
Sbjct  123  PVTHKPLQPVPDTGSSPEDEAKA-----VAAAITPP  153



>ref|XP_007215806.1| hypothetical protein PRUPE_ppa009966mg [Prunus persica]
 gb|EMJ17005.1| hypothetical protein PRUPE_ppa009966mg [Prunus persica]
Length=270

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEIEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTD  453
            P+TH+P+  D  D
Sbjct  123  PLTHKPIANDVND  135



>ref|XP_010268020.1| PREDICTED: protein ODORANT1-like [Nelumbo nucifera]
Length=288

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTA+EDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTADEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSESEEQMVIDLHARLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            PVTH+P+
Sbjct  123  PVTHKPI  129



>ref|NP_001242827.1| uncharacterized protein LOC100800494 [Glycine max]
 gb|ACU20065.1| unknown [Glycine max]
Length=326

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI+FIL+NGQCCWRA+PKLAGL RC KSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLLRCVKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVP  405
            PVTH+PL  + T+ T ++   + Q+   P
Sbjct  123  PVTHKPL-PNATEQTKNQTKQEQQLHHQP  150



>ref|XP_010528552.1| PREDICTED: protein ODORANT1-like [Tarenaya hassleriana]
Length=294

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL+ FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLVNFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            PVTH+PL
Sbjct  123  PVTHKPL  129



>ref|XP_002305215.1| hypothetical protein POPTR_0004s08480g [Populus trichocarpa]
 gb|EEE85726.1| hypothetical protein POPTR_0004s08480g [Populus trichocarpa]
Length=319

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT++EDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTSDEDKKLINFILANGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQ  414
            P+TH+PL    T         ++QVQ
Sbjct  123  PLTHKPLSAIETPPPPPPPQQEVQVQ  148



>emb|CDX85496.1| BnaA02g03170D [Brassica napus]
Length=306

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT EEDKKLI FIL+NGQCCWRALPKL+GL RCGKSCRLRW NYLR
Sbjct  3    RQPCCDKVGLKKGPWTVEEDKKLINFILTNGQCCWRALPKLSGLLRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSENEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLI-KDTTDSTSDKGNGQLQVQ  414
            P+TH+PL  +D +    +   GQ   Q
Sbjct  123  PMTHKPLSEQDVSRDEKNTNQGQEDQQ  149



>emb|CDX76358.1| BnaA08g10420D [Brassica napus]
Length=264

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 170/266 (64%), Gaps = 20/266 (8%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPC     VKKGPWT EEDKKLI FIL+NG CCWRALPKLAGLRRCGKSCRLRWTNYLR
Sbjct  3    RQPCF----VKKGPWTTEEDKKLINFILNNGHCCWRALPKLAGLRRCGKSCRLRWTNYLR  58

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDL+RGLLS +EEQLVIDLHA +GN+WSKIAS+LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  59   PDLRRGLLSHEEEQLVIDLHAHMGNKWSKIASRLPGRTDNEIKNHWNTHIKKKLVKMGID  118

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscst-senssitst  315
            PVTH+PL +D   + + K +  +   +       +  N+ +    +   + S  +   S+
Sbjct  119  PVTHQPLNQDPNSTDNPKNSCSVSDDISMVTKSSSTKNIETNGTTTEDESISTITDQNSS  178

Query  314  NDEFQRVLDTMSDNDPLLSSLLENNAPPVDLTWNLS--DDHQMIFENLTIPKLDENFA--  147
             D     L  + +++ L S L  + +   +  W+ S  D    ++ +  +     +F   
Sbjct  179  MDNDNHQLSNIYNDEELFSYLWSDESTKAETPWSDSNYDVGGTLYHDNNVSCAGADFPIC  238

Query  146  ---------W-LMDH-QDFGIHDFGY  102
                     W   D+ QDFG+HDFG+
Sbjct  239  SPERINGVDWTFQDYCQDFGVHDFGF  264



>gb|EMT18012.1| Protein ODORANT1 [Aegilops tauschii]
Length=287

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSN-GQCCWRALPKLAGLRRCGKSCRLRWTNYL  675
            RQPCCDKLGVK+GPWTAEED+KL+ FIL N G+CCWRA+PKLAGL RCGKSCRLRWTNYL
Sbjct  3    RQPCCDKLGVKRGPWTAEEDRKLMAFILGNAGRCCWRAVPKLAGLLRCGKSCRLRWTNYL  62

Query  674  RPDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGI  495
            RPDLKRGLL+ DEE+LV+ LHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGI
Sbjct  63   RPDLKRGLLTDDEERLVVALHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGI  122

Query  494  DPVTHEPL  471
            DP+THEPL
Sbjct  123  DPITHEPL  130



>ref|XP_011007235.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=319

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTA+EDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTADEDKKLINFILANGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQ  414
            P+TH+PL    T          +QVQ
Sbjct  123  PLTHKPLSTVETPPPPPPPQQDVQVQ  148



>ref|XP_003519327.1| PREDICTED: protein ODORANT1-like [Glycine max]
 gb|KHN41066.1| Protein ODORANT1 [Glycine soja]
Length=336

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI+FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            P TH+PL
Sbjct  123  PATHKPL  129



>ref|XP_004973482.1| PREDICTED: myb-related protein 315-like [Setaria italica]
Length=304

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL++FIL NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVSFILGNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE+LVIDLHA LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDAEEKLVIDLHAQLGNRWSKIASQLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>gb|AAL84615.1|AF474118_1 typical P-type R2R3 Myb protein [Zea mays]
Length=212

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPW+AEED+KL+TF+L+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWSAEEDEKLVTFLLTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS +EE  VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSSEEETTVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P TH+PL
Sbjct  123  PATHKPL  129



>ref|XP_009381446.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=285

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDK+LI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKRLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VI+LH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL +MGID
Sbjct  63   PDLKRGLLSEAEEKMVIELHSKLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRRMGID  122

Query  491  PVTHEPLIKDTTD  453
            P+THEPLI    D
Sbjct  123  PLTHEPLIPSAND  135



>tpg|DAA61360.1| TPA: LOW QUALITY PROTEIN: putative MYB DNA-binding domain superfamily 
protein, partial [Zea mays]
Length=211

 Score =   239 bits (611),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPW+AEED+KL+TF+L+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWSAEEDEKLVTFLLTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS +EE  VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSSEEETTVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P TH+PL
Sbjct  123  PATHKPL  129



>ref|XP_004503126.1| PREDICTED: protein ODORANT1-like [Cicer arietinum]
Length=334

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDS  450
            P+TH+ L  + T +
Sbjct  123  PITHKLLSNEQTQT  136



>gb|AFK47512.1| unknown [Lotus japonicus]
Length=324

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G++KGPW+AEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLRKGPWSAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIA+ LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSESEEKMVIDLHAQLGNRWSKIATHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQV  417
            PVTH+PL  + T+ T  +   Q Q+
Sbjct  123  PVTHKPL-PNVTEQTQIQPKEQQQL  146



>dbj|BAJ97263.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 1/128 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSN-GQCCWRALPKLAGLRRCGKSCRLRWTNYL  675
            RQPCCDKLGVK+GPWTAEED+KL+ FIL N G+CCWRA+PKLAGL RCGKSCRLRWTNYL
Sbjct  3    RQPCCDKLGVKRGPWTAEEDRKLMGFILGNAGRCCWRAVPKLAGLLRCGKSCRLRWTNYL  62

Query  674  RPDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGI  495
            RPDLKRGLL+ DEE+LV+DLHA LGNRWSKIA+KLPGRTDNEIKNHWNTHIKKKLIKMGI
Sbjct  63   RPDLKRGLLTDDEERLVVDLHAKLGNRWSKIAAKLPGRTDNEIKNHWNTHIKKKLIKMGI  122

Query  494  DPVTHEPL  471
            DPVTHEPL
Sbjct  123  DPVTHEPL  130



>ref|XP_003600714.1| P-type R2R3 Myb protein [Medicago truncatula]
 gb|AES70965.1| myb transcription factor [Medicago truncatula]
Length=311

 Score =   243 bits (619),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDST  447
            PVTH+ L     + T
Sbjct  123  PVTHKLLSNAIIEQT  137



>emb|CDY38100.1| BnaC02g06730D [Brassica napus]
Length=316

 Score =   243 bits (619),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT EEDKKLI FIL+NGQCCWRALPKL+GL RCGKSCRLRW NYLR
Sbjct  3    RQPCCDKVGLKKGPWTVEEDKKLINFILTNGQCCWRALPKLSGLLRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EEQ++IDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSENEEQVIIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGN-GQLQVQVVPE  402
            P+TH+PL +        K N GQ   Q   E
Sbjct  123  PMTHKPLSEQEVSRDEKKRNQGQEDQQTRKE  153



>ref|XP_002452601.1| hypothetical protein SORBIDRAFT_04g028850 [Sorghum bicolor]
 gb|EES05577.1| hypothetical protein SORBIDRAFT_04g028850 [Sorghum bicolor]
Length=164

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCC+K+G+KKGPWTAEED+KL+TF+LS+G CCWR +PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCEKVGLKKGPWTAEEDQKLVTFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EE LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEEEEALVIDLHAQLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            PVTH PL
Sbjct  123  PVTHRPL  129



>gb|AGN52115.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52225.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=288

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KLI FI++NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLINFIITNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PD+KRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDVKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPT  387
            P+TH+PL   T +    + + +++  + P     T
Sbjct  123  PLTHKPLPPPTVEQPPPEESNKVEQVINPAAESAT  157



>ref|XP_006372565.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|ERP50362.1| myb family transcription factor family protein [Populus trichocarpa]
Length=321

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 130/147 (88%), Gaps = 3/147 (2%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT++EDKKLITFIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTSDEDKKLITFILANGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQV  411
            P+TH+PL   +T  T      Q +VQV
Sbjct  123  PLTHKPL---STIETPPSPPPQQEVQV  146



>ref|XP_008652684.1| PREDICTED: protein ODORANT1-like [Zea mays]
 tpg|DAA61358.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04682.1| MYB transcription factor, partial [Zea mays]
Length=277

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL+TF+L NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVTFLLINGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EE+ VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEEEERTVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            PVTH+PL
Sbjct  123  PVTHKPL  129



>ref|XP_004289590.1| PREDICTED: protein ODORANT1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS +EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDNEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>gb|KHG02341.1| Protein ODORANT1 [Gossypium arboreum]
Length=296

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKL  FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLFNFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>ref|XP_010271304.1| PREDICTED: myb-related protein 315 [Nelumbo nucifera]
Length=410

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSESEEQTVIDLHARLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            P+TH+P+
Sbjct  123  PLTHKPI  129



>ref|XP_003578088.1| PREDICTED: protein ODORANT1-like [Brachypodium distachyon]
Length=268

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL++F+LSNGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVSFLLSNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+ VI+LHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSESEEKTVIELHAELGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLI  468
            P TH+PL+
Sbjct  123  PATHKPLL  130



>emb|CDX69440.1| BnaA10g17890D [Brassica napus]
Length=313

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NG CCWRALPKL+GL RCGKSCRLRW NYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGHCCWRALPKLSGLLRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSECEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PMTHKPL  129



>emb|CDY49650.1| BnaC09g41280D [Brassica napus]
Length=302

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NG CCWRALPKL+GL RCGKSCRLRW NYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGHCCWRALPKLSGLLRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSECEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PMTHKPL  129



>gb|AGZ16414.1| MYB15, partial [Scutellaria baicalensis]
Length=258

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PD+KRGLLS  EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL+KMGID
Sbjct  63   PDVKRGLLSDYEEKIVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLMKMGID  122

Query  491  PVTHE  477
            P+TH+
Sbjct  123  PLTHK  127



>ref|XP_006391368.1| hypothetical protein EUTSA_v10019852mg [Eutrema salsugineum]
 gb|ESQ28654.1| hypothetical protein EUTSA_v10019852mg [Eutrema salsugineum]
Length=283

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>gb|KDP25786.1| hypothetical protein JCGZ_22508 [Jatropha curcas]
 gb|AIT52315.1| MYB family protein [Jatropha curcas]
Length=329

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>ref|XP_010415165.1| PREDICTED: protein ODORANT1-like [Camelina sativa]
Length=289

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL+ FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLMNFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>ref|XP_002887017.1| hypothetical protein ARALYDRAFT_894261 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63276.1| hypothetical protein ARALYDRAFT_894261 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED KLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDMKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>gb|AFW63820.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04532.1| MYB transcription factor, partial [Zea mays]
Length=278

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCC+K+G+KKGPWTAEED+KL+TF+LS+G CCWR +PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCEKIGIKKGPWTAEEDQKLVTFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EE LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEEEEALVIDLHAQLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDT  459
            PVTH PL   T
Sbjct  123  PVTHGPLAPAT  133



>ref|NP_176797.1| myb domain protein 20 [Arabidopsis thaliana]
 gb|AAG51765.1|AC066691_5 myb-related transcription factor, putative; 17635-18559 [Arabidopsis 
thaliana]
 gb|AAS10035.1| MYB transcription factor [Arabidopsis thaliana]
 gb|ABI49451.1| At1g66230 [Arabidopsis thaliana]
 gb|AEE34479.1| myb domain protein 20 [Arabidopsis thaliana]
Length=282

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KLI FIL+NGQCCWRA+PKL+GL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLINFILTNGQCCWRAVPKLSGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVP  405
            P+TH+PL     +   ++   +LQ   VP
Sbjct  123  PLTHKPL--SIVEKEDEEPLKKLQNNTVP  149



>ref|XP_009370562.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=275

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLIKFILANGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+P+
Sbjct  123  PLTHKPI  129



>ref|XP_006400198.1| hypothetical protein EUTSA_v10014086mg [Eutrema salsugineum]
 gb|ESQ41651.1| hypothetical protein EUTSA_v10014086mg [Eutrema salsugineum]
Length=329

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT EEDKKLI FIL+NG CCWRALPKL+GL RCGKSCRLRW NYLR
Sbjct  3    RQPCCDKVGLKKGPWTVEEDKKLINFILTNGHCCWRALPKLSGLLRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>ref|NP_001149774.1| odorant 1 protein [Zea mays]
 gb|ACG36738.1| odorant 1 protein [Zea mays]
Length=273

 Score =   239 bits (611),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCC+K+G+KKGPWTAEED+KL+TF+LS+G CCWR +PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCEKIGIKKGPWTAEEDQKLVTFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EE LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEEEEALVIDLHAQLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDT  459
            PVTH PL   T
Sbjct  123  PVTHGPLAPAT  133



>ref|XP_008343128.1| PREDICTED: protein ODORANT1-like [Malus domestica]
Length=276

 Score =   239 bits (611),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLIKFILANGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+P+
Sbjct  123  PLTHKPI  129



>ref|XP_010926121.1| PREDICTED: protein ODORANT1-like [Elaeis guineensis]
Length=288

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKL+ FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLVNFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+LVI+LH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSESEEKLVIELHSRLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+P+
Sbjct  123  PITHKPI  129



>ref|XP_009121472.1| PREDICTED: protein ODORANT1 [Brassica rapa]
Length=313

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NG CCWRALPKL+GL RCGKSCRLRW NYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGHCCWRALPKLSGLLRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDCEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PMTHKPL  129



>gb|EAZ07061.1| hypothetical protein OsI_29307 [Oryza sativa Indica Group]
Length=309

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KLITF+L+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLITFLLTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++V+DLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDAEEKIVVDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            P+TH PL
Sbjct  123  PLTHRPL  129



>ref|XP_010470497.1| PREDICTED: protein ODORANT1-like [Camelina sativa]
Length=290

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL+ FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLMNFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>tpg|DAA61361.1| TPA: putative MYB DNA-binding domain superfamily protein, partial 
[Zea mays]
Length=289

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPW+AEED+KL+TF+L+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWSAEEDEKLVTFLLTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS +EE  VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSSEEETTVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P TH+PL
Sbjct  123  PATHKPL  129



>ref|XP_006302662.1| hypothetical protein CARUB_v10020766mg [Capsella rubella]
 gb|EOA35560.1| hypothetical protein CARUB_v10020766mg [Capsella rubella]
Length=279

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL+ FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLMNFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>ref|NP_001061847.1| Os08g0428200 [Oryza sativa Japonica Group]
 emb|CAC85050.1| Myb51 protein [Oryza sativa]
 dbj|BAC75626.1| Myb51 protein [Oryza sativa Japonica Group]
 dbj|BAD01194.1| Myb51 protein [Oryza sativa Japonica Group]
 dbj|BAF23761.1| Os08g0428200 [Oryza sativa Japonica Group]
Length=309

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KLITF+L+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLITFLLTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++V+DLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDAEEKIVVDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            P+TH PL
Sbjct  123  PLTHRPL  129



>ref|XP_004956766.1| PREDICTED: protein ODORANT1-like [Setaria italica]
Length=278

 Score =   239 bits (610),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL++F+L+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVSFLLNNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS +EE+ VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSPEEEKTVIDLHAELGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            PVTH+PL
Sbjct  123  PVTHKPL  129



>ref|XP_004140299.1| PREDICTED: myb-related protein 315-like [Cucumis sativus]
 gb|KGN51062.1| hypothetical protein Csa_5G425400 [Cucumis sativus]
Length=300

 Score =   240 bits (612),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI+FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKIGLKKGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDST  447
            P TH+  I  T+D T
Sbjct  123  PQTHKS-ISQTSDDT  136



>ref|XP_008652685.1| PREDICTED: protein ODORANT1-like [Zea mays]
 tpg|DAA61362.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=300

 Score =   239 bits (611),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPW+AEED+KL+TF+L+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWSAEEDEKLVTFLLTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS +EE  VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSSEEETTVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P TH+PL
Sbjct  123  PATHKPL  129



>ref|XP_007141914.1| hypothetical protein PHAVU_008G236500g [Phaseolus vulgaris]
 gb|ESW13908.1| hypothetical protein PHAVU_008G236500g [Phaseolus vulgaris]
Length=332

 Score =   241 bits (614),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQ CWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLICFILTNGQYCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PITHKPL  129



>ref|XP_003572214.1| PREDICTED: protein ODORANT1 [Brachypodium distachyon]
Length=286

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL++FIL NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVSFILGNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ +E+LV+DLHA LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL K+GID
Sbjct  63   PDLKRGLLSEADEKLVVDLHAQLGNRWSKIASQLPGRTDNEIKNHWNTHIKKKLRKLGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>ref|XP_010525072.1| PREDICTED: myb-related protein 330-like [Tarenaya hassleriana]
 ref|XP_010525074.1| PREDICTED: myb-related protein 330-like [Tarenaya hassleriana]
Length=310

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT EEDKKLI FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTVEEDKKLINFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VIDLH  LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEQVVIDLHVQLGNRWSKIASQLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            PVTH+PL
Sbjct  123  PVTHKPL  129



>gb|EMT20029.1| Protein ODORANT1 [Aegilops tauschii]
Length=281

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL++F+LSNGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVSFLLSNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS +EE+ VIDLH  LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDEEEKTVIDLHEQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P TH+PL
Sbjct  123  PATHKPL  129



>ref|XP_004173153.1| PREDICTED: myb-related protein 315-like [Cucumis sativus]
Length=300

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 123/135 (91%), Gaps = 1/135 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKIGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDST  447
            P TH+  I  T+D T
Sbjct  123  PQTHKS-ISQTSDDT  136



>ref|XP_011001567.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=321

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT++EDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTSDEDKKLIHFILANGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>gb|EAZ09037.1| hypothetical protein OsI_31298 [Oryza sativa Indica Group]
Length=279

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL++F+L NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVSFLLGNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+ VIDLH  LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSETEEKTVIDLHEQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLI  468
            PVTH+PL 
Sbjct  123  PVTHKPLY  130



>emb|CDP01404.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            R+PCCDK+G+ +GPW+A+ED KLI+FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RRPCCDKVGLTRGPWSADEDMKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL+ MGID
Sbjct  63   PDLKRGLLSEHEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLMNMGID  122

Query  491  PVTHEPLIKDTTDS  450
            PVTH+PL + T+ +
Sbjct  123  PVTHKPLPQSTSST  136



>ref|NP_001063118.1| Os09g0401000 [Oryza sativa Japonica Group]
 emb|CAA72186.1| myb factor [Oryza sativa Japonica Group]
 dbj|BAD28515.1| putative Myb51 protein [Oryza sativa Japonica Group]
 dbj|BAD28616.1| putative Myb51 protein [Oryza sativa Japonica Group]
 dbj|BAF25032.1| Os09g0401000 [Oryza sativa Japonica Group]
 gb|EAZ44664.1| hypothetical protein OsJ_29287 [Oryza sativa Japonica Group]
Length=279

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL++F+L NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVSFLLGNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+ VIDLH  LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSETEEKTVIDLHEQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLI  468
            PVTH+PL 
Sbjct  123  PVTHKPLY  130



>ref|XP_009409253.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=296

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEE++VI+LH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL +MGID
Sbjct  63   PDLKRGLLSDDEEKMVIELHSRLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRRMGID  122

Query  491  PVTHEPL  471
            P+TH+P+
Sbjct  123  PMTHKPI  129



>ref|XP_010511551.1| PREDICTED: protein ODORANT1-like [Camelina sativa]
Length=287

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL+ FIL+NGQCCWRA+PKLAGL RCGK CRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLMNFILTNGQCCWRAVPKLAGLLRCGKRCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>dbj|BAJ98593.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06458.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL++F+LSNGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVSFLLSNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS +EE+ VIDLH  LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDEEEKTVIDLHEQLGNRWSKIAAQLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P TH+PL
Sbjct  123  PATHKPL  129



>ref|XP_002871726.1| hypothetical protein ARALYDRAFT_909643 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47985.1| hypothetical protein ARALYDRAFT_909643 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT EEDKKLI FIL+NG CCWRALPKL+GL RCGKSCRLRW NYLR
Sbjct  3    RQPCCDKVGLKKGPWTIEEDKKLINFILTNGHCCWRALPKLSGLLRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>gb|ACY74342.1| putative MYB-related transcription factor [Artemisia annua]
Length=344

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+K+GPWTA+EDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKQGPWTADEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSENEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHE  477
            P+TH+
Sbjct  123  PLTHK  127



>ref|XP_004956765.1| PREDICTED: protein ODORANT1-like [Setaria italica]
Length=255

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL++F+L+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVSFLLNNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS +EE+ VIDLHA LGNRWSKIAS+LPGRTDNEIKNHWNTHIK+KL KMGID
Sbjct  63   PDLKRGLLSPEEEKTVIDLHAELGNRWSKIASQLPGRTDNEIKNHWNTHIKEKLRKMGID  122

Query  491  PVTHEPL  471
            P TH+PL
Sbjct  123  PATHKPL  129



>ref|NP_001281099.1| uncharacterized protein LOC100216895 [Zea mays]
 gb|ACG23991.1| odorant 1 protein [Zea mays]
 gb|AFU81608.1| MYB-type transcription factor, partial [Zea mays subsp. mays]
 gb|AFW76945.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=278

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+GVKKGPWTAEED+KL+ F+L++G CCWR +PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGVKKGPWTAEEDQKLVGFLLTHGHCCWRVVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEE+LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHI+KKL++MGID
Sbjct  63   PDLKRGLLSDDEERLVIDLHAQLGNRWSKIAAQLPGRTDNEIKNHWNTHIRKKLVRMGID  122

Query  491  PVTHEPL  471
            PVTH PL
Sbjct  123  PVTHLPL  129



>ref|XP_006288141.1| hypothetical protein CARUB_v10001378mg [Capsella rubella]
 gb|EOA21039.1| hypothetical protein CARUB_v10001378mg [Capsella rubella]
Length=336

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT EEDKKLI FIL+NG CCWRALPKL+GL RCGKSCRLRW NYLR
Sbjct  3    RQPCCDKVGLKKGPWTIEEDKKLINFILTNGHCCWRALPKLSGLLRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL K+GID
Sbjct  63   PDLKRGLLSEYEEQMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKLGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>ref|XP_008803910.1| PREDICTED: protein ODORANT1-like [Phoenix dactylifera]
Length=291

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKG WTAEEDKKLI FILSN QCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGAWTAEEDKKLINFILSNRQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+LVI+LH+ LGNRWSKIA+ LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSESEEKLVIELHSQLGNRWSKIAAHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQ  420
            P+TH+P I  T D    +G+  + 
Sbjct  123  PLTHKP-IASTVDQQQQQGDASVH  145



>ref|XP_010917650.1| PREDICTED: protein ODORANT1-like [Elaeis guineensis]
Length=292

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTNGPCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+LVI+LH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSESEEKLVIELHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+P+
Sbjct  123  PLTHKPI  129



>gb|AAL84764.1|AF474131_1 typical P-type R2R3 Myb protein [Sorghum bicolor]
Length=162

 Score =   233 bits (594),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCC K+G+K+GPWT EED+KL+TF+L+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCAKVGLKRGPWTVEEDQKLVTFLLTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PD+KRGLLS +EE+ VIDLH  LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDVKRGLLSSEEERTVIDLHEQLGNRWSKIASQLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTP  393
            PVTH+PL +  +         Q Q +    G+P
Sbjct  123  PVTHKPLHQPASPPPPPPLTRQEQEEKDTRGSP  155



>gb|ABR92760.1| transcription factor TF1 [Gossypium hirsutum]
Length=256

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDKLGVKKGPWTAEEDKKL+ F+ ++G  CWRA+PKLAGLRRCGKSCRLRWTNYLR
Sbjct  14   RQPCCDKLGVKKGPWTAEEDKKLVNFMRTHGYYCWRAVPKLAGLRRCGKSCRLRWTNYLR  73

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
             DLKRGLL+ DEEQLVIDL+A LGNRWSKIA++LPGRTDNEIKNHWN HIKKKLIKMGID
Sbjct  74   LDLKRGLLNHDEEQLVIDLYARLGNRWSKIAARLPGRTDNEIKNHWNAHIKKKLIKMGID  133

Query  491  PVTHEPLIKDTT  456
            P THEPL K  T
Sbjct  134  PATHEPLQKPDT  145



>ref|XP_008803475.1| PREDICTED: protein ODORANT1-like [Phoenix dactylifera]
Length=294

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEEDKKLI FIL++GQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDKKLINFILTHGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+LVI+LH+ LGNRWSKIA+ LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSESEEKLVIELHSQLGNRWSKIAAHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+P+
Sbjct  123  PLTHKPI  129



>ref|XP_010932583.1| PREDICTED: protein ODORANT1-like [Elaeis guineensis]
Length=294

 Score =   237 bits (605),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 136/170 (80%), Gaps = 8/170 (5%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKG WTAEEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGAWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VI+LH+ LGNRWSKIA+ LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSESEEKMVIELHSQLGNRWSKIAAHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKG-------NGQLQVQVVPEGTPPTVPNLISED  363
            P+TH+P I +T D    +        NG  + + + E  PP V    +E+
Sbjct  123  PLTHKP-IAETVDQQQQQQQQGDASVNGNDKNEQLCEQCPPKVAQEEAEE  171



>ref|XP_011085868.1| PREDICTED: protein ODORANT1 [Sesamum indicum]
Length=318

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTA+EDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTADEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PD+KRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDVKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHE  477
            P+TH+
Sbjct  123  PLTHK  127



>ref|XP_002460190.1| hypothetical protein SORBIDRAFT_02g024260 [Sorghum bicolor]
 gb|EER96711.1| hypothetical protein SORBIDRAFT_02g024260 [Sorghum bicolor]
Length=311

 Score =   238 bits (606),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL+TF+L+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVTFLLANGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PD+KRGLLS +EE+ VIDLH  LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDVKRGLLSSEEERTVIDLHEQLGNRWSKIASQLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            PVTH+PL
Sbjct  123  PVTHKPL  129



>gb|AAL84763.1|AF474130_1 typical P-type R2R3 Myb protein [Sorghum bicolor]
Length=184

 Score =   233 bits (594),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 124/146 (85%), Gaps = 5/146 (3%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL+TF+L+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVTFLLANGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PD+KRGLLS +EE+ VIDLH  LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL KMGI 
Sbjct  63   PDVKRGLLSSEEERTVIDLHEQLGNRWSKIASQLPGRTDNEIKNHWNTHIKKKLRKMGIY  122

Query  491  PVTHEPLIKDT-----TDSTSDKGNG  429
            PVTH+PL +       T    D G G
Sbjct  123  PVTHKPLHQPASPPPLTRQEQDTGGG  148



>gb|AAL84766.1|AF474133_1 typical P-type R2R3 Myb protein [Sorghum bicolor]
Length=204

 Score =   234 bits (596),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL+TF+L+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVTFLLANGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PD+KRGLLS +EE+ VIDLH  LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL KMGI 
Sbjct  63   PDVKRGLLSSEEERTVIDLHEQLGNRWSKIASQLPGRTDNEIKNHWNTHIKKKLRKMGIY  122

Query  491  PVTHEPL  471
            PVTH+PL
Sbjct  123  PVTHKPL  129



>gb|EMT17735.1| Protein ODORANT1 [Aegilops tauschii]
Length=137

 Score =   231 bits (590),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCC+K+G+KKGPWTAEED+KL+ F+LS+G CCWR +PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCEKVGLKKGPWTAEEDQKLVAFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEE+LVIDLH+ LGNRWSKIA++LPGRTDNEIKNHWNTHI+KKL KMG+D
Sbjct  63   PDLKRGLLSDDEEKLVIDLHSQLGNRWSKIAARLPGRTDNEIKNHWNTHIRKKLKKMGLD  122

Query  491  PVTHEPLI-KDTTD  453
            PVTH+P+  K T D
Sbjct  123  PVTHQPMCPKQTYD  136



>ref|XP_004953828.1| PREDICTED: protein ODORANT1-like [Setaria italica]
Length=258

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCC+K+G+KKGPWTAEED+KL+ F+LS+G CCWR +PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCEKVGLKKGPWTAEEDQKLVAFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EE LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL +MGID
Sbjct  63   PDLKRGLLSEEEEALVIDLHAQLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLKRMGID  122

Query  491  PVTHEPL  471
            PVTH PL
Sbjct  123  PVTHRPL  129



>ref|XP_006647848.1| PREDICTED: protein ODORANT1-like [Oryza brachyantha]
Length=258

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCC+K+G+KKGPWTAEED+KL+ F+LSNG CCWR +PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCEKVGLKKGPWTAEEDQKLVAFLLSNGHCCWRLVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EE+LVIDLH  LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEEEEKLVIDLHEQLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPLI  468
            PVTH P +
Sbjct  123  PVTHRPAV  130



>ref|XP_009757133.1| PREDICTED: protein ODORANT1-like [Nicotiana sylvestris]
Length=280

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 128/158 (81%), Gaps = 1/158 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            R+PCCDK  VKKGPW+AEEDKKLI FIL NGQCCWR+LP+LAGL RCGKSCRLRWTNYLR
Sbjct  3    RKPCCDKDEVKKGPWSAEEDKKLINFILINGQCCWRSLPRLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPN  378
            P TH+P+  D  +      N Q  +Q   + T P  P+
Sbjct  123  PATHQPITVDQPNIEHPTKN-QPIIQQEKQKTMPISPS  159



>ref|XP_009370048.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=269

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            R+PCCDK+G+KKGPW AEED KLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RKPCCDKVGLKKGPWIAEEDTKLINFILANGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAELGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+P+
Sbjct  123  PLTHKPI  129



>ref|XP_006346756.1| PREDICTED: protein ODORANT1-like [Solanum tuberosum]
Length=295

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK  VKKGPW++EEDKKL  FIL+NGQCCWR+LPKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKNVVKKGPWSSEEDKKLTNFILNNGQCCWRSLPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKD  462
            P TH P+  D
Sbjct  123  PTTHNPITSD  132



>ref|XP_010916181.1| PREDICTED: protein ODORANT1-like [Elaeis guineensis]
Length=293

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT EEDKKLI FIL+NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTTEEDKKLIDFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+LVI+LH+ LGN+WSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSESEEKLVIELHSRLGNKWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH P+
Sbjct  123  PITHRPI  129



>ref|XP_009398709.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=249

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 165/263 (63%), Gaps = 33/263 (13%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            R+PCCDKLGVKKGPW+AEED+KL+ FIL+NG CCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RRPCCDKLGVKKGPWSAEEDEKLVGFILANGHCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDL+RGLLS  EEQLVIDLHA LGNRWSKIA+ LPGRTDNEIKN WNTHIKKKL++ GID
Sbjct  63   PDLRRGLLSDVEEQLVIDLHARLGNRWSKIAAMLPGRTDNEIKNLWNTHIKKKLLRRGID  122

Query  491  PVTHE-------PLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVPNLISEDLnsscstsen  333
            PVTH+       P+   +T +T  K +         +G  P+  N               
Sbjct  123  PVTHQLLDRQASPVASQSTVTTDSKSDADQFQSPGNQGHIPSWDN---------------  167

Query  332  ssitstNDEFQRVLDTMSDNDPLLSSLLENNAPP-VDLTWNL---SDDHQMIFENLTIPK  165
                   +  +      S + PL++ L E++AP  ++  W L    D++  I     +P 
Sbjct  168  ------KNPAEASSSAGSADPPLMNCLWEDDAPVLLEELWQLPGNEDNYGAIAAAGQVPW  221

Query  164  LDENFA-WLMDHQDFGIHDFGYE  99
              E    WL+D+QDF   D G E
Sbjct  222  DYEGCCEWLLDYQDFEEGDVGSE  244



>ref|XP_009126127.1| PREDICTED: myb-related protein 308-like [Brassica rapa]
Length=319

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT EEDKKLI FIL+NGQCCWRALPKL+GL RCGKSCRLRW NYLR
Sbjct  3    RQPCCDKVGLKKGPWTVEEDKKLINFILTNGQCCWRALPKLSGLLRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EEQ+VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTH KKKL KMGI 
Sbjct  63   PDLKRGLLSENEEQMVIDLHAQLGNRWSKIASNLPGRTDNEIKNHWNTHRKKKLRKMGIG  122

Query  491  PVTHEPL  471
            P+ H+PL
Sbjct  123  PMAHKPL  129



>ref|XP_004236690.1| PREDICTED: protein ODORANT1-like [Solanum lycopersicum]
Length=296

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK  VKKGPW++EEDKKL  FIL+NGQCCWR+LPKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKNEVKKGPWSSEEDKKLTNFILNNGQCCWRSLPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKD  462
            P TH P+  D
Sbjct  123  PTTHNPITSD  132



>ref|XP_009620990.1| PREDICTED: protein ODORANT1-like [Nicotiana tomentosiformis]
Length=280

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 127/157 (81%), Gaps = 1/157 (1%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            R+PCCDK GVKKGPW+AEEDKKLI FIL NGQCCWR+LPK+AGL RCGKSCRLRWTNYLR
Sbjct  3    RKPCCDKDGVKKGPWSAEEDKKLINFILINGQCCWRSLPKVAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLKKMGID  122

Query  491  PVTHEPLIKDTTDSTSDKGNGQLQVQVVPEGTPPTVP  381
            P+TH  +  D  +      N Q  +Q   + T P  P
Sbjct  123  PITHRSITVDQPNIEQPTKN-QPIIQQEKQTTMPISP  158



>emb|CDY49639.1| BnaCnng17910D [Brassica napus]
Length=260

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPW+A+ED+KL+ FIL++GQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWSADEDRKLMNFILTHGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>gb|AAC83591.1| putative transcription factor [Arabidopsis thaliana]
Length=278

 Score =   234 bits (598),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KLI FIL+NGQCCWRA+PKL+GL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDRKLINFILTNGQCCWRAVPKLSGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIK KL KMGID
Sbjct  63   PDLKRGLLSDYEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKTKLRKMGID  122

Query  491  PVTHEPL  471
             +TH+PL
Sbjct  123  LLTHKPL  129



>ref|NP_197163.1| myb domain protein 43 [Arabidopsis thaliana]
 gb|AAD53095.1|AF175990_1 putative transcription factor [Arabidopsis thaliana]
 dbj|BAB10187.1| transcription factor [Arabidopsis thaliana]
 gb|AAO22590.1| unknown protein [Arabidopsis thaliana]
 gb|AAS10095.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AED92315.1| myb domain protein 43 [Arabidopsis thaliana]
Length=327

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWT EEDKKLI FIL+NG CCWRALPKL+GL RCGKSCRLRW NYLR
Sbjct  3    RQPCCDKVGLKKGPWTIEEDKKLINFILTNGHCCWRALPKLSGLLRCGKSCRLRWINYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EEQ VI+LHA LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEYEEQKVINLHAQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>gb|EAY87414.1| hypothetical protein OsI_08821 [Oryza sativa Indica Group]
Length=254

 Score =   233 bits (595),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCC+K+G+KKGPWTA+ED+KL+TF+LSNG CCWR +PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCEKVGLKKGPWTADEDQKLVTFLLSNGHCCWRLVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EE+LVIDLH  LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL KMG+D
Sbjct  63   PDLKRGLLSEEEEKLVIDLHEQLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLKKMGLD  122

Query  491  PVTHEPLI  468
            PVTH P++
Sbjct  123  PVTHRPVM  130



>ref|XP_009105194.1| PREDICTED: protein ODORANT1 [Brassica rapa]
 emb|CDY07493.1| BnaA07g25720D [Brassica napus]
Length=280

 Score =   234 bits (597),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPW+A+ED+KL+ FIL++GQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWSADEDRKLMNFILTHGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS  EE++VIDLH+ LGNRWSKIAS LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDHEEKMVIDLHSQLGNRWSKIASHLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHEPL  471
            P+TH+PL
Sbjct  123  PLTHKPL  129



>ref|NP_001048028.1| Os02g0732600 [Oryza sativa Japonica Group]
 dbj|BAD16141.1| putative Myb51 protein [Oryza sativa Japonica Group]
 dbj|BAF09942.1| Os02g0732600 [Oryza sativa Japonica Group]
 gb|EEE57754.1| hypothetical protein OsJ_08275 [Oryza sativa Japonica Group]
Length=255

 Score =   233 bits (595),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCC+K+G+KKGPWTA+ED+KL+TF+LSNG CCWR +PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCEKVGLKKGPWTADEDQKLVTFLLSNGHCCWRLVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS++EE+LVIDLH  LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL KMG+D
Sbjct  63   PDLKRGLLSEEEEKLVIDLHEQLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLKKMGLD  122

Query  491  PVTHEPLI  468
            PVTH P++
Sbjct  123  PVTHRPVM  130



>ref|XP_006660610.1| PREDICTED: protein ODORANT1-like [Oryza brachyantha]
Length=293

 Score =   234 bits (598),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL++F+L NGQCCWRA+PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVSFLLGNGQCCWRAVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS+ EE+ VIDLH  LGNRWSKIAS+LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSEAEEKTVIDLHEQLGNRWSKIASQLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHE  477
            PVTH+
Sbjct  123  PVTHK  127



>gb|ACF82542.1| unknown [Zea mays]
Length=438

 Score =   239 bits (609),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+GVKKGPWTAEED+KL+ F+L++G CCWR +PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGVKKGPWTAEEDQKLVGFLLTHGHCCWRVVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEE+LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHI+KKL++MGID
Sbjct  63   PDLKRGLLSDDEERLVIDLHAQLGNRWSKIAAQLPGRTDNEIKNHWNTHIRKKLVRMGID  122

Query  491  PVTHEPL  471
            PVTH PL
Sbjct  123  PVTHLPL  129



>ref|NP_001057322.1| Os06g0258000 [Oryza sativa Japonica Group]
 dbj|BAD46186.1| putative myb factor [Oryza sativa Japonica Group]
 dbj|BAD46321.1| putative myb factor [Oryza sativa Japonica Group]
 dbj|BAF19236.1| Os06g0258000 [Oryza sativa Japonica Group]
 gb|EAZ36535.1| hypothetical protein OsJ_20870 [Oryza sativa Japonica Group]
 gb|ADB84639.1| Myb related transcription factor [Oryza sativa Japonica Group]
Length=267

 Score =   233 bits (595),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  851  RQPCCDKLGVKKGPWTAEEDKKLITFILSNGQCCWRALPKLAGLRRCGKSCRLRWTNYLR  672
            RQPCCDK+G+KKGPWTAEED+KL+ F+L++G CCWR +PKLAGL RCGKSCRLRWTNYLR
Sbjct  3    RQPCCDKVGLKKGPWTAEEDQKLVAFLLTHGHCCWRVVPKLAGLLRCGKSCRLRWTNYLR  62

Query  671  PDLKRGLLSQDEEQLVIDLHASLGNRWSKIASKLPGRTDNEIKNHWNTHIKKKLIKMGID  492
            PDLKRGLLS DEE+LVIDLHA LGNRWSKIA++LPGRTDNEIKNHWNTHIKKKL KMGID
Sbjct  63   PDLKRGLLSDDEERLVIDLHAQLGNRWSKIAARLPGRTDNEIKNHWNTHIKKKLRKMGID  122

Query  491  PVTHE  477
            PVTH+
Sbjct  123  PVTHQ  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1715910939005