BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9420_g1_i1 len=857 path=[1:0-662 664:663-856]

Length=857
                                                                      Score     E

gb|KDO82649.1|  hypothetical protein CISIN_1g027536mg                   296   7e-97   
emb|CBI32073.3|  unnamed protein product                                296   9e-97   
ref|XP_002271090.2|  PREDICTED: germin-like protein subfamily 1 m...    296   2e-96   Vitis vinifera
ref|XP_006483755.1|  PREDICTED: germin-like protein subfamily 1 m...    295   2e-96   
ref|XP_006438507.1|  hypothetical protein CICLE_v10033943mg             294   5e-96   
ref|XP_010044669.1|  PREDICTED: germin-like protein subfamily 1 m...    293   1e-95   
ref|XP_002520204.1|  Nectarin-1 precursor, putative                     291   5e-95   Ricinus communis
ref|NP_001237622.1|  uncharacterized protein LOC100500154 precursor     287   2e-93   
ref|XP_011087075.1|  PREDICTED: germin-like protein subfamily 1 m...    286   8e-93   
ref|XP_003613431.1|  Germin-like protein subfamily 1 member             285   1e-92   
gb|AFK46631.1|  unknown                                                 285   1e-92   
ref|XP_008221479.1|  PREDICTED: germin-like protein subfamily 1 m...    285   2e-92   
ref|NP_001241459.1|  germin-like protein subfamily 1 member 1-lik...    283   6e-92   
ref|XP_006829478.1|  hypothetical protein AMTR_s00074p00061830          283   1e-91   
gb|KDP21281.1|  hypothetical protein JCGZ_21752                         281   5e-91   
gb|EYU28657.1|  hypothetical protein MIMGU_mgv1a023310mg                280   1e-90   
ref|XP_011006614.1|  PREDICTED: germin-like protein subfamily 1 m...    279   3e-90   
ref|XP_004298594.1|  PREDICTED: germin-like protein subfamily 1 m...    279   4e-90   
ref|XP_004504494.1|  PREDICTED: germin-like protein subfamily 1 m...    278   6e-90   
ref|XP_010100533.1|  Germin-like protein subfamily 1 member 1           277   1e-89   
ref|XP_007157527.1|  hypothetical protein PHAVU_002G077300g             276   3e-89   
ref|XP_006378204.1|  Germin-like protein subfamily 1 member 1 pre...    275   1e-88   
ref|XP_010543966.1|  PREDICTED: germin-like protein subfamily 1 m...    273   1e-87   
ref|XP_010255423.1|  PREDICTED: germin-like protein subfamily 1 m...    271   9e-87   
ref|XP_004146743.1|  PREDICTED: germin-like protein subfamily 1 m...    269   3e-86   
ref|XP_007044465.1|  Germin-like protein subfamily 1 member 1           269   3e-86   
ref|XP_008456470.1|  PREDICTED: germin-like protein subfamily 1 m...    268   4e-86   
ref|XP_009799046.1|  PREDICTED: germin-like protein subfamily 1 m...    268   7e-86   
ref|XP_004162541.1|  PREDICTED: germin-like protein subfamily 1 m...    268   1e-85   
ref|XP_006357214.1|  PREDICTED: germin-like protein subfamily 1 m...    264   2e-84   
ref|XP_008339987.1|  PREDICTED: germin-like protein subfamily 1 m...    263   4e-84   
gb|AFK38629.1|  unknown                                                 263   4e-84   
ref|XP_004238732.1|  PREDICTED: germin-like protein subfamily 1 m...    263   6e-84   
ref|XP_008665879.1|  PREDICTED: germin-like protein 3-1                 262   2e-83   
ref|XP_002468403.1|  hypothetical protein SORBIDRAFT_01g045270          258   1e-81   Sorghum bicolor [broomcorn]
ref|XP_009598940.1|  PREDICTED: germin-like protein subfamily 1 m...    254   1e-80   
ref|XP_004985498.1|  PREDICTED: germin-like protein 3-1-like            254   3e-80   
ref|NP_563870.2|  germin-like protein 7                                 250   5e-79   Arabidopsis thaliana [mouse-ear cress]
sp|Q8H021.1|GL31_ORYSJ  RecName: Full=Germin-like protein 3-1; Fl...    250   8e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008786884.1|  PREDICTED: germin-like protein 3-1                 249   2e-78   
gb|ABK26250.1|  unknown                                                 247   1e-77   Picea sitchensis
gb|EAY88774.1|  hypothetical protein OsI_10250                          245   8e-77   Oryza sativa Indica Group [Indian rice]
ref|XP_010491268.1|  PREDICTED: germin-like protein subfamily 1 m...    242   6e-76   
ref|XP_009408777.1|  PREDICTED: germin-like protein 3-1                 243   6e-76   
dbj|BAK02988.1|  predicted protein                                      241   4e-75   
ref|XP_010937018.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    241   6e-75   
ref|XP_007223443.1|  hypothetical protein PRUPE_ppa011533mg             239   6e-75   
ref|XP_002892572.1|  hypothetical protein ARALYDRAFT_888315             239   9e-75   
ref|XP_010320636.1|  PREDICTED: germin-like protein subfamily 1 m...    235   2e-73   
ref|XP_010458392.1|  PREDICTED: germin-like protein subfamily 1 m...    232   5e-72   
ref|XP_009118253.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    231   1e-71   
ref|XP_010475908.1|  PREDICTED: germin-like protein subfamily 1 m...    230   2e-71   
gb|AAC99473.1|  germin-like protein                                     219   9e-67   Pinus caribaea [Caribbean pine]
gb|AAT09853.1|  germin-like protein                                     219   1e-66   Pinus taeda
gb|AAL79929.1|  germin-like protein                                     218   1e-66   Pinus sylvestris [Scotch pine]
gb|AAC05146.1|  germin-like protein                                     217   7e-66   Pinus radiata
gb|AAY57280.1|  germin-like protein                                     213   2e-64   Larix x marschlinsii [Dunkeld larch]
gb|KCW86768.1|  hypothetical protein EUGRSUZ_B03378                     197   9e-59   
ref|XP_010251869.1|  PREDICTED: putative germin-like protein 2-1 ...    197   2e-58   
ref|XP_010251871.1|  PREDICTED: putative germin-like protein 2-1        197   2e-58   
gb|AAB51580.1|  germin-like protein                                     194   6e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010251870.1|  PREDICTED: putative germin-like protein 2-1 ...    195   1e-57   
ref|XP_004155681.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    195   2e-57   
ref|XP_004142551.1|  PREDICTED: germin-like protein subfamily 1 m...    194   3e-57   
ref|XP_009414512.1|  PREDICTED: putative germin-like protein 2-1        194   3e-57   
ref|XP_009396913.1|  PREDICTED: germin-like protein 3-8                 193   8e-57   
ref|XP_009414514.1|  PREDICTED: putative germin-like protein 2-1        193   1e-56   
ref|XP_009360505.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    192   1e-56   
ref|XP_004158659.1|  PREDICTED: putative germin-like protein 2-1-...    193   1e-56   
ref|XP_008808516.1|  PREDICTED: putative germin-like protein 2-1        193   1e-56   
ref|XP_002453357.1|  hypothetical protein SORBIDRAFT_04g004510          192   3e-56   Sorghum bicolor [broomcorn]
ref|XP_006857270.1|  hypothetical protein AMTR_s00067p00014150          192   3e-56   
ref|XP_008645277.1|  PREDICTED: putative germin-like protein 2-1        192   3e-56   
ref|XP_008237524.1|  PREDICTED: germin-like protein subfamily 1 m...    192   5e-56   
ref|XP_008237526.1|  PREDICTED: germin-like protein subfamily 1 m...    191   6e-56   
ref|XP_004134617.1|  PREDICTED: putative germin-like protein 2-1-...    191   7e-56   
ref|XP_006845051.1|  hypothetical protein AMTR_s00794p00001640          190   2e-55   
ref|XP_003573399.1|  PREDICTED: germin-like protein 8-11 isoform X2     190   2e-55   
ref|XP_008443751.1|  PREDICTED: germin-like protein subfamily 1 m...    189   2e-55   
ref|XP_010251867.1|  PREDICTED: putative germin-like protein 2-1        189   3e-55   
ref|XP_008375054.1|  PREDICTED: germin-like protein subfamily 1 m...    189   3e-55   
ref|XP_010234323.1|  PREDICTED: germin-like protein 8-11 isoform X1     190   3e-55   
ref|XP_010241946.1|  PREDICTED: putative germin-like protein 2-1        189   3e-55   
ref|XP_002266983.1|  PREDICTED: putative germin-like protein 2-1        189   4e-55   Vitis vinifera
ref|XP_008779054.1|  PREDICTED: oxalate oxidase 1-like                  189   4e-55   
emb|CDP22064.1|  unnamed protein product                                189   5e-55   
gb|EMT01744.1|  Germin-like protein 8-5                                 189   5e-55   
gb|KDP23769.1|  hypothetical protein JCGZ_23602                         189   5e-55   
emb|CBI33612.3|  unnamed protein product                                188   7e-55   
gb|KDP32127.1|  hypothetical protein JCGZ_12588                         188   8e-55   
ref|XP_007031299.1|  Germin-like protein 10                             188   8e-55   
ref|XP_008360941.1|  PREDICTED: germin-like protein subfamily 1 m...    188   9e-55   
ref|XP_003633724.1|  PREDICTED: putative germin-like protein 2-1        188   9e-55   
ref|XP_008439537.1|  PREDICTED: putative germin-like protein 2-1        188   9e-55   
ref|XP_009357348.1|  PREDICTED: germin-like protein subfamily 1 m...    188   1e-54   
ref|XP_009415610.1|  PREDICTED: putative germin-like protein 2-1        188   1e-54   
ref|XP_009414511.1|  PREDICTED: putative germin-like protein 2-1        187   1e-54   
ref|XP_002265608.1|  PREDICTED: putative germin-like protein 2-1        187   1e-54   Vitis vinifera
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600          187   2e-54   
ref|XP_007200157.1|  hypothetical protein PRUPE_ppa016753mg             187   2e-54   
gb|EYU20539.1|  hypothetical protein MIMGU_mgv1a013072mg                187   2e-54   
ref|XP_003633711.2|  PREDICTED: putative germin-like protein 2-1        187   2e-54   
emb|CAN72994.1|  hypothetical protein VITISV_000563                     187   2e-54   Vitis vinifera
ref|XP_010251872.1|  PREDICTED: putative germin-like protein 2-1        187   2e-54   
gb|AGZ13502.1|  germin-like protein 2                                   187   3e-54   
emb|CDP16787.1|  unnamed protein product                                187   3e-54   
ref|XP_009355938.1|  PREDICTED: germin-like protein subfamily 1 m...    187   3e-54   
ref|XP_009795501.1|  PREDICTED: putative germin-like protein 2-1        187   3e-54   
ref|XP_010257844.1|  PREDICTED: putative germin-like protein 2-1        187   3e-54   
ref|XP_008237522.1|  PREDICTED: germin-like protein subfamily 1 m...    187   3e-54   
ref|XP_010934325.1|  PREDICTED: oxalate oxidase 1-like                  187   3e-54   
emb|CBI33611.3|  unnamed protein product                                189   3e-54   
gb|EYU40211.1|  hypothetical protein MIMGU_mgv1a013108mg                187   3e-54   
ref|XP_008393482.1|  PREDICTED: germin-like protein subfamily 1 m...    187   3e-54   
ref|XP_008778966.1|  PREDICTED: putative germin-like protein 2-1        187   3e-54   
ref|XP_003633723.2|  PREDICTED: putative germin-like protein 2-1        187   3e-54   
ref|XP_006362219.1|  PREDICTED: putative germin-like protein 2-3-...    186   3e-54   
ref|XP_011099651.1|  PREDICTED: germin-like protein subfamily 1 m...    187   3e-54   
ref|XP_007201862.1|  hypothetical protein PRUPE_ppa020162mg             187   4e-54   
ref|XP_009414513.1|  PREDICTED: putative germin-like protein 2-1        186   4e-54   
ref|XP_009402558.1|  PREDICTED: putative germin-like protein 2-1        186   4e-54   
ref|XP_007201148.1|  hypothetical protein PRUPE_ppa016020mg             186   4e-54   
ref|XP_007200183.1|  hypothetical protein PRUPE_ppa016284mg             186   5e-54   
ref|XP_009786127.1|  PREDICTED: putative germin-like protein 2-1        186   5e-54   
ref|XP_008777189.1|  PREDICTED: germin-like protein 3-8                 186   6e-54   
ref|XP_009349816.1|  PREDICTED: germin-like protein subfamily 1 m...    186   6e-54   
ref|XP_010544125.1|  PREDICTED: germin-like protein subfamily 2 m...    186   6e-54   
ref|XP_006346966.1|  PREDICTED: putative germin-like protein 2-1-...    186   6e-54   
gb|EMS67056.1|  Germin-like protein 12-2                                186   6e-54   
ref|XP_004249175.1|  PREDICTED: putative germin-like protein 2-3        186   7e-54   
gb|EYU38444.1|  hypothetical protein MIMGU_mgv1a013102mg                186   8e-54   
ref|XP_002265857.1|  PREDICTED: putative germin-like protein 2-1        186   8e-54   Vitis vinifera
gb|EMS52045.1|  Germin-like protein 12-2                                186   8e-54   
ref|XP_008777190.1|  PREDICTED: germin-like protein subfamily T m...    186   8e-54   
ref|XP_010911724.1|  PREDICTED: putative germin-like protein 2-1        186   9e-54   
gb|ABS86851.1|  oxalate oxidase                                         185   9e-54   Arachis hypogaea [goober]
ref|XP_008393483.1|  PREDICTED: germin-like protein subfamily 1 m...    186   1e-53   
ref|XP_008777188.1|  PREDICTED: germin-like protein 3-7                 187   1e-53   
emb|CBI33610.3|  unnamed protein product                                188   1e-53   
ref|XP_009388248.1|  PREDICTED: putative germin-like protein 2-1 ...    185   1e-53   
emb|CAN66771.1|  hypothetical protein VITISV_022559                     184   1e-53   Vitis vinifera
dbj|BAK01981.1|  predicted protein                                      185   1e-53   
ref|XP_006362217.1|  PREDICTED: putative germin-like protein 2-3-...    185   1e-53   
gb|EYU28622.1|  hypothetical protein MIMGU_mgv1a018753mg                185   2e-53   
ref|XP_006290312.1|  hypothetical protein CARUB_v10019262mg             185   2e-53   
ref|XP_002276644.1|  PREDICTED: putative germin-like protein 2-1        185   2e-53   Vitis vinifera
ref|XP_008240380.1|  PREDICTED: germin-like protein subfamily 1 m...    185   2e-53   
ref|XP_010463900.1|  PREDICTED: germin-like protein subfamily 1 m...    185   2e-53   
ref|XP_007200176.1|  hypothetical protein PRUPE_ppa016529mg             185   2e-53   
ref|XP_002276315.2|  PREDICTED: putative germin-like protein 2-1        185   2e-53   Vitis vinifera
ref|XP_006349267.1|  PREDICTED: germin-like protein subfamily 1 m...    185   2e-53   
ref|XP_002277055.1|  PREDICTED: putative germin-like protein 2-1        185   2e-53   Vitis vinifera
ref|XP_006362216.1|  PREDICTED: putative germin-like protein 2-3-...    184   2e-53   
gb|EMS45228.1|  Germin-like protein 8-9                                 184   2e-53   
ref|XP_009116872.1|  PREDICTED: germin-like protein subfamily 2 m...    184   2e-53   
emb|CDY11392.1|  BnaA09g39580D                                          184   3e-53   
ref|XP_002270404.2|  PREDICTED: putative germin-like protein 2-1        184   3e-53   Vitis vinifera
ref|XP_006402421.1|  hypothetical protein EUTSA_v10006227mg             184   3e-53   
gb|KHN26213.1|  Germin-like protein 5-1                                 184   3e-53   
gb|EYU20535.1|  hypothetical protein MIMGU_mgv1a013054mg                184   3e-53   
ref|XP_002276756.2|  PREDICTED: putative germin-like protein 2-1        184   3e-53   Vitis vinifera
ref|NP_001239734.1|  germin-like protein 5-1-like precursor             184   4e-53   
ref|XP_006349265.1|  PREDICTED: germin-like protein subfamily 1 m...    184   4e-53   
ref|XP_002267617.1|  PREDICTED: putative germin-like protein 2-2        183   5e-53   Vitis vinifera
ref|XP_007163279.1|  hypothetical protein PHAVU_001G221200g             183   5e-53   
gb|AAM28275.1|  germin-like protein                                     183   6e-53   Ananas comosus
gb|AJA71634.1|  germin-like protein                                     184   6e-53   
ref|XP_007199217.1|  hypothetical protein PRUPE_ppa021882mg             184   6e-53   
ref|XP_011034445.1|  PREDICTED: germin-like protein subfamily 1 m...    183   6e-53   
ref|XP_008237521.1|  PREDICTED: germin-like protein subfamily 1 m...    184   6e-53   
ref|XP_010251866.1|  PREDICTED: putative germin-like protein 2-1        183   6e-53   
ref|XP_007210592.1|  hypothetical protein PRUPE_ppa016616mg             183   7e-53   
ref|XP_006576138.1|  PREDICTED: germin-like protein 21 isoform X1       183   7e-53   
ref|XP_004142552.1|  PREDICTED: germin-like protein subfamily 1 m...    183   8e-53   
gb|EYU40209.1|  hypothetical protein MIMGU_mgv1a013129mg                183   8e-53   
gb|EYU20545.1|  hypothetical protein MIMGU_mgv1a020779mg                183   9e-53   
gb|EMT29286.1|  Germin-like protein 1-3                                 183   9e-53   
emb|CBI36790.3|  unnamed protein product                                182   9e-53   
ref|NP_001267940.1|  germin-like protein 1                              182   1e-52   
gb|AFW90592.1|  germin-like protein subfamily 1 member 20 precursor     183   1e-52   
ref|XP_009341765.1|  PREDICTED: germin-like protein subfamily 1 m...    183   1e-52   
ref|XP_009402557.1|  PREDICTED: putative germin-like protein 2-1        183   1e-52   
gb|KHG29875.1|  Germin-like protein subfamily 2 member 4                182   1e-52   
ref|XP_006358464.1|  PREDICTED: germin-like protein subfamily 1 m...    183   1e-52   
ref|XP_011038440.1|  PREDICTED: germin-like protein subfamily 1 m...    182   1e-52   
gb|KHN43382.1|  Germin-like protein 5-1                                 182   1e-52   
ref|XP_009620404.1|  PREDICTED: germin-like protein subfamily 1 m...    183   1e-52   
ref|XP_009625530.1|  PREDICTED: putative germin-like protein 2-1        183   1e-52   
ref|XP_009385875.1|  PREDICTED: putative germin-like protein 2-1        182   1e-52   
ref|XP_004236166.1|  PREDICTED: germin-like protein subfamily T m...    182   1e-52   
ref|XP_006659194.1|  PREDICTED: germin-like protein 8-5-like            182   1e-52   
ref|XP_008237525.1|  PREDICTED: germin-like protein subfamily 1 m...    183   1e-52   
ref|XP_006840196.1|  hypothetical protein AMTR_s00089p00119480          182   1e-52   
ref|XP_010544902.1|  PREDICTED: germin-like protein subfamily 2 m...    182   1e-52   
ref|XP_003554594.1|  PREDICTED: rhicadhesin receptor-like               182   1e-52   
ref|XP_006358462.1|  PREDICTED: germin-like protein subfamily 1 m...    182   1e-52   
gb|AJA71638.1|  germin-like protein                                     182   1e-52   
ref|XP_009786129.1|  PREDICTED: putative germin-like protein 2-1        182   2e-52   
ref|XP_009366009.1|  PREDICTED: germin-like protein 5-1                 182   2e-52   
ref|XP_003573398.1|  PREDICTED: germin-like protein 8-11                182   2e-52   
ref|XP_009612542.1|  PREDICTED: putative germin-like protein 2-1        182   2e-52   
ref|XP_008443754.1|  PREDICTED: germin-like protein subfamily 1 m...    182   2e-52   
ref|XP_004134614.1|  PREDICTED: putative germin-like protein 2-3-...    182   2e-52   
ref|XP_010528770.1|  PREDICTED: germin-like protein subfamily 1 m...    183   2e-52   
ref|XP_008678208.1|  PREDICTED: putative germin-like protein 12-4       182   2e-52   
ref|XP_002281186.2|  PREDICTED: uncharacterized protein LOC100244552    189   2e-52   Vitis vinifera
ref|XP_010412923.1|  PREDICTED: germin-like protein subfamily 1 m...    182   2e-52   
ref|XP_010485791.1|  PREDICTED: germin-like protein subfamily 1 m...    182   2e-52   
ref|NP_001061156.1|  Os08g0189100                                       182   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008243694.1|  PREDICTED: germin-like protein 9-1                 188   3e-52   
emb|CDP16790.1|  unnamed protein product                                182   3e-52   
gb|EYU20548.1|  hypothetical protein MIMGU_mgv1a013109mg                182   3e-52   
ref|XP_008246341.1|  PREDICTED: germin-like protein subfamily 2 m...    181   3e-52   
emb|CDM86515.1|  unnamed protein product                                181   3e-52   
ref|XP_002265447.3|  PREDICTED: uncharacterized protein LOC100242782    188   3e-52   Vitis vinifera
ref|XP_006358461.1|  PREDICTED: germin-like protein subfamily 1 m...    182   3e-52   
gb|EYU20542.1|  hypothetical protein MIMGU_mgv1a020630mg                182   3e-52   
gb|EYU20540.1|  hypothetical protein MIMGU_mgv1a013117mg                182   3e-52   
ref|XP_006659192.1|  PREDICTED: germin-like protein 8-5-like            181   4e-52   
ref|XP_002878427.1|  hypothetical protein ARALYDRAFT_486710             181   4e-52   
ref|XP_003574983.1|  PREDICTED: putative germin-like protein 2-1        181   4e-52   
ref|XP_008351931.1|  PREDICTED: germin-like protein subfamily 1 m...    181   4e-52   
ref|XP_002531992.1|  Rhicadhesin receptor precursor, putative           181   4e-52   Ricinus communis
emb|CAN71140.1|  hypothetical protein VITISV_005471                     181   4e-52   Vitis vinifera
ref|NP_001061160.1|  Os08g0189500                                       181   4e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05851.1|  hypothetical protein OsI_28086                          181   4e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_008775504.1|  PREDICTED: germin-like protein 3-8                 181   4e-52   
ref|NP_001061155.1|  Os08g0188900                                       181   4e-52   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061162.2|  Os08g0189700                                       181   4e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010528694.1|  PREDICTED: germin-like protein subfamily 1 m...    181   4e-52   
ref|XP_006349263.1|  PREDICTED: germin-like protein subfamily 1 m...    181   4e-52   
ref|XP_009402551.1|  PREDICTED: putative germin-like protein 2-1        181   5e-52   
gb|EMT02678.1|  Putative germin-like protein 2-1                        181   5e-52   
gb|AJA71635.1|  germin-like protein                                     181   5e-52   
ref|XP_006362279.1|  PREDICTED: putative germin-like protein 2-3-...    181   6e-52   
gb|EEC83018.1|  hypothetical protein OsI_28085                          180   6e-52   Oryza sativa Indica Group [Indian rice]
ref|NP_001175415.1|  Os08g0189850                                       181   6e-52   
ref|NP_001267914.1|  germin-like protein 2 precursor                    181   6e-52   
ref|NP_001046876.1|  Os02g0491800                                       181   6e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EYU20549.1|  hypothetical protein MIMGU_mgv1a020596mg                181   6e-52   
ref|XP_004302315.1|  PREDICTED: germin-like protein 5-1-like            181   7e-52   
ref|XP_008367619.1|  PREDICTED: germin-like protein subfamily 1 m...    181   7e-52   
ref|XP_007030273.1|  RmlC-like cupins superfamily protein               181   7e-52   
ref|XP_004290344.1|  PREDICTED: germin-like protein subfamily 1 m...    181   7e-52   
gb|EAY85910.1|  hypothetical protein OsI_07273                          181   7e-52   Oryza sativa Indica Group [Indian rice]
gb|AJA71637.1|  germin-like protein                                     181   7e-52   
ref|XP_004972683.1|  PREDICTED: germin-like protein 8-5-like            181   8e-52   
gb|EMT11886.1|  Germin-like protein 1-3                                 181   8e-52   
ref|XP_002265297.3|  PREDICTED: uncharacterized protein LOC100247931    187   8e-52   Vitis vinifera
ref|XP_002443981.1|  hypothetical protein SORBIDRAFT_07g005330          181   8e-52   Sorghum bicolor [broomcorn]
emb|CDM86521.1|  unnamed protein product                                181   8e-52   
ref|XP_003575896.1|  PREDICTED: germin-like protein 5-1                 181   8e-52   
ref|XP_004494499.1|  PREDICTED: rhicadhesin receptor-like               180   8e-52   
ref|XP_010909644.1|  PREDICTED: germin-like protein 5-1                 181   8e-52   
gb|EYU20546.1|  hypothetical protein MIMGU_mgv1a013111mg                181   9e-52   
gb|EYU20547.1|  hypothetical protein MIMGU_mgv1a023357mg                181   9e-52   
gb|AJA71639.1|  germin-like protein                                     181   9e-52   
ref|XP_004230404.1|  PREDICTED: putative germin-like protein 2-1        181   9e-52   
ref|XP_009402547.1|  PREDICTED: putative germin-like protein 2-1 ...    180   9e-52   
ref|NP_001061303.1|  Os08g0231400                                       180   9e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008807191.1|  PREDICTED: putative germin-like protein 2-1        180   1e-51   
ref|XP_006377950.1|  germin-like protein 1                              180   1e-51   
emb|CDP16788.1|  unnamed protein product                                180   1e-51   
ref|XP_004954703.1|  PREDICTED: putative germin-like protein 2-1-...    180   1e-51   
ref|XP_006659188.1|  PREDICTED: germin-like protein 12-2-like           180   1e-51   
ref|XP_010234322.1|  PREDICTED: germin-like protein 8-8                 180   1e-51   
gb|AAM76226.1|  putative germin E protein precursor                     179   1e-51   Gossypium raimondii
ref|XP_008678207.1|  PREDICTED: germin-like protein 8-5                 180   1e-51   
ref|NP_191761.1|  germin-like protein 10                                180   1e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDP21353.1|  unnamed protein product                                186   1e-51   
ref|XP_006371122.1|  Germin-like protein subfamily 1 member 6 pre...    180   2e-51   
ref|XP_010312062.1|  PREDICTED: putative germin-like protein 2-3 ...    179   2e-51   
gb|ABS44860.1|  putative germin-like protein                            180   2e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004138293.1|  PREDICTED: germin-like protein subfamily T m...    179   2e-51   
ref|XP_006840195.1|  hypothetical protein AMTR_s00089p00119070          179   2e-51   
gb|EEE68171.1|  hypothetical protein OsJ_26291                          179   2e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008678224.1|  PREDICTED: putative germin-like protein 12-4       179   2e-51   
ref|NP_001061164.1|  Os08g0190100                                       179   2e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002443972.1|  hypothetical protein SORBIDRAFT_07g005260          180   2e-51   Sorghum bicolor [broomcorn]
gb|EYU20536.1|  hypothetical protein MIMGU_mgv1a025658mg                180   2e-51   
ref|XP_007030267.1|  Germin-like protein subfamily 1 member 18          182   2e-51   
gb|EMS61024.1|  Putative germin-like protein 2-1                        179   2e-51   
ref|XP_002443979.1|  hypothetical protein SORBIDRAFT_07g005310          179   2e-51   
ref|XP_011075126.1|  PREDICTED: putative germin-like protein 2-1 ...    179   2e-51   
ref|XP_010413321.1|  PREDICTED: germin-like protein subfamily 2 m...    179   2e-51   
ref|XP_003566360.1|  PREDICTED: germin-like protein 5-1                 179   2e-51   
emb|CDM86517.1|  unnamed protein product                                179   2e-51   
ref|XP_008239677.1|  PREDICTED: germin-like protein subfamily T m...    179   2e-51   
ref|XP_011037735.1|  PREDICTED: putative germin-like protein 2-1        179   2e-51   
emb|CDP16791.1|  unnamed protein product                                179   2e-51   
ref|XP_009402550.1|  PREDICTED: putative germin-like protein 2-1        179   2e-51   
gb|EMS35760.1|  Germin-like protein 1-3                                 179   3e-51   
ref|NP_001061161.1|  Os08g0189600                                       179   3e-51   
ref|XP_004495826.1|  PREDICTED: rhicadhesin receptor-like               179   3e-51   
ref|XP_006405658.1|  hypothetical protein EUTSA_v10027918mg             179   3e-51   
ref|XP_009402546.1|  PREDICTED: germin-like protein 12-2                179   3e-51   
ref|XP_008439536.1|  PREDICTED: germin-like protein 8-2                 179   3e-51   
emb|CDM86516.1|  unnamed protein product                                179   3e-51   
ref|XP_006659195.1|  PREDICTED: germin-like protein 8-11-like           179   3e-51   
ref|XP_003591272.1|  Germin-like protein                                179   3e-51   
ref|XP_010450835.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    179   3e-51   
emb|CDX76609.1|  BnaC08g31950D                                          179   3e-51   
ref|XP_010042643.1|  PREDICTED: germin-like protein 5-1                 179   3e-51   
ref|XP_010457206.1|  PREDICTED: germin-like protein subfamily 2 m...    179   4e-51   
gb|KDO86730.1|  hypothetical protein CISIN_1g027725mg                   179   4e-51   
gb|AAB51752.1|  germin-like protein                                     178   4e-51   
ref|XP_008370330.1|  PREDICTED: germin-like protein 5-1                 179   4e-51   
ref|XP_010094925.1|  hypothetical protein L484_022675                   179   4e-51   
gb|KDP23768.1|  hypothetical protein JCGZ_23601                         179   4e-51   
gb|EMT14183.1|  Putative germin-like protein 2-1                        178   4e-51   
ref|XP_011075128.1|  PREDICTED: putative germin-like protein 2-1        179   4e-51   
ref|NP_001061159.2|  Os08g0189400                                       178   4e-51   
ref|XP_009627660.1|  PREDICTED: germin-like protein subfamily 1 m...    179   4e-51   
ref|NP_001061163.1|  Os08g0189900                                       179   4e-51   
sp|Q6YZA6.1|GL85_ORYSJ  RecName: Full=Germin-like protein 8-5; Fl...    179   4e-51   
gb|EYU40208.1|  hypothetical protein MIMGU_mgv1a020439mg                179   4e-51   
ref|XP_002443976.1|  hypothetical protein SORBIDRAFT_07g005300          179   5e-51   
ref|XP_004971282.1|  PREDICTED: germin-like protein 1-3-like            179   5e-51   
ref|XP_007145062.1|  hypothetical protein PHAVU_007G206600g             179   5e-51   
ref|XP_009388348.1|  PREDICTED: germin-like protein 3-8                 178   5e-51   
ref|XP_004144736.1|  PREDICTED: germin-like protein 5-1-like            178   5e-51   
gb|ACU19639.1|  unknown                                                 178   5e-51   
gb|AAB97470.1|  germin-like protein 16                                  178   5e-51   
gb|AAM76227.1|  putative germin E protein precursor                     177   5e-51   
ref|XP_007205879.1|  hypothetical protein PRUPE_ppa011263mg             178   5e-51   
ref|XP_004293720.1|  PREDICTED: putative germin-like protein 2-2-...    178   6e-51   
ref|XP_002443971.1|  hypothetical protein SORBIDRAFT_07g005250          178   6e-51   
ref|NP_193199.1|  germin-like protein 9                                 178   6e-51   
ref|XP_004972677.1|  PREDICTED: germin-like protein 12-2-like iso...    178   6e-51   
gb|AAM76225.1|  putative germin E protein precursor                     177   6e-51   
ref|XP_007209604.1|  hypothetical protein PRUPE_ppa011491mg             178   6e-51   
ref|XP_009623991.1|  PREDICTED: nectarin-1-like                         178   6e-51   
ref|NP_001055081.1|  Os05g0277500                                       178   6e-51   
ref|XP_003536019.1|  PREDICTED: rhicadhesin receptor-like               178   6e-51   
ref|NP_001046874.1|  Os02g0491600                                       178   6e-51   
ref|XP_002443983.1|  hypothetical protein SORBIDRAFT_07g005350          178   6e-51   
ref|XP_009612543.1|  PREDICTED: germin-like protein subfamily 1 m...    178   7e-51   
ref|XP_008678213.1|  PREDICTED: putative germin-like protein 12-4       178   7e-51   
ref|XP_011037736.1|  PREDICTED: putative germin-like protein 2-1        178   7e-51   
ref|NP_001237300.1|  uncharacterized protein LOC100527781 precursor     178   7e-51   
ref|XP_004972682.1|  PREDICTED: putative germin-like protein 12-4...    179   7e-51   
gb|EMS48366.1|  Germin-like protein 1-3                                 182   7e-51   
ref|XP_006345178.1|  PREDICTED: germin-like protein subfamily T m...    178   8e-51   
ref|XP_011075127.1|  PREDICTED: putative germin-like protein 2-1 ...    177   8e-51   
ref|XP_010911182.1|  PREDICTED: putative germin-like protein 2-1        178   8e-51   
gb|EMT01968.1|  Germin-like protein 8-11                                178   8e-51   
ref|XP_008225649.1|  PREDICTED: putative germin-like protein 2-1        177   9e-51   
ref|XP_008678209.1|  PREDICTED: putative germin-like protein 12-4       178   9e-51   
ref|XP_006643995.1|  PREDICTED: germin-like protein 5-1-like            178   9e-51   
ref|XP_007030280.1|  RmlC-like cupins superfamily protein isoform 1     178   9e-51   
ref|NP_001061158.1|  Os08g0189300                                       178   9e-51   
ref|XP_008807195.1|  PREDICTED: putative germin-like protein 2-1        182   1e-50   
ref|XP_007030281.1|  RmlC-like cupins superfamily protein isoform 2     178   1e-50   
ref|XP_006468339.1|  PREDICTED: putative germin-like protein 2-3-...    177   1e-50   
ref|XP_002276926.2|  PREDICTED: uncharacterized protein LOC100251187    184   1e-50   
ref|XP_010512583.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    177   1e-50   
gb|AAD43972.1|AF141879_1  germin-like protein 2 precursor               177   1e-50   
ref|XP_007030270.1|  Germin-like protein subfamily 1 member 18          181   1e-50   
ref|XP_009612541.1|  PREDICTED: germin-like protein subfamily 1 m...    177   1e-50   
ref|XP_006358463.1|  PREDICTED: germin-like protein subfamily 1 m...    177   1e-50   
gb|EMT14063.1|  Putative germin-like protein 2-1                        177   1e-50   
ref|XP_002443973.1|  hypothetical protein SORBIDRAFT_07g005270          177   1e-50   
ref|XP_011037778.1|  PREDICTED: putative germin-like protein 2-1        177   1e-50   
ref|XP_008453674.1|  PREDICTED: germin-like protein subfamily T m...    177   1e-50   
gb|EAZ05849.1|  hypothetical protein OsI_28084                          177   1e-50   
ref|XP_010247869.1|  PREDICTED: germin-like protein 5-1                 177   1e-50   
ref|XP_006659193.1|  PREDICTED: germin-like protein 8-11-like           177   1e-50   
emb|CBI31051.3|  unnamed protein product                                176   1e-50   
ref|XP_011037744.1|  PREDICTED: putative germin-like protein 2-1        177   2e-50   
gb|AJA71633.1|  germin-like protein                                     177   2e-50   
ref|XP_009620917.1|  PREDICTED: germin-like protein subfamily 1 m...    177   2e-50   
ref|XP_009362198.1|  PREDICTED: putative germin-like protein 2-3        177   2e-50   
ref|XP_004134897.1|  PREDICTED: putative germin-like protein 2-1-...    177   2e-50   
ref|XP_009385876.1|  PREDICTED: germin-like protein 12-2                177   2e-50   
ref|XP_009110818.1|  PREDICTED: germin-like protein subfamily 2 m...    177   2e-50   
gb|EAZ05842.1|  hypothetical protein OsI_28079                          177   2e-50   
ref|XP_002319671.1|  hypothetical protein POPTR_0013s04840g             177   2e-50   
gb|KDP23764.1|  hypothetical protein JCGZ_23597                         177   2e-50   
ref|XP_008345579.1|  PREDICTED: germin-like protein 5-1                 177   2e-50   
ref|NP_001267943.1|  germin-like protein 4 precursor                    177   2e-50   
ref|XP_010468994.1|  PREDICTED: germin-like protein subfamily 2 m...    177   2e-50   
ref|XP_002319672.1|  hypothetical protein POPTR_0013s04850g             177   2e-50   
ref|XP_010094924.1|  hypothetical protein L484_022674                   177   2e-50   
ref|XP_008663081.1|  PREDICTED: germin-like protein 8-4                 177   2e-50   
ref|XP_009601550.1|  PREDICTED: nectarin-1-like                         177   2e-50   
ref|XP_006444653.1|  hypothetical protein CICLE_v10022159mg             176   2e-50   
ref|XP_002892101.1|  hypothetical protein ARALYDRAFT_470194             176   3e-50   
ref|XP_006299201.1|  hypothetical protein CARUB_v10015347mg             177   3e-50   
ref|XP_006468338.1|  PREDICTED: putative germin-like protein 2-3-...    176   3e-50   
gb|AAD00509.1|  germin-like protein                                     176   3e-50   
ref|XP_004972687.1|  PREDICTED: germin-like protein 12-2-like           177   3e-50   
gb|KDO75202.1|  hypothetical protein CISIN_1g047141mg                   176   3e-50   
ref|XP_011039061.1|  PREDICTED: germin-like protein 5-1                 176   3e-50   
ref|XP_011099650.1|  PREDICTED: germin-like protein subfamily 1 m...    177   3e-50   
ref|XP_008778853.1|  PREDICTED: putative germin-like protein 2-1        176   3e-50   
ref|XP_011039785.1|  PREDICTED: putative germin-like protein 2-1        176   3e-50   
gb|EYU43220.1|  hypothetical protein MIMGU_mgv11b017722mg               176   3e-50   
ref|NP_001141258.1|  germin-like protein subfamily 1 member 17 pr...    176   3e-50   
ref|XP_002457300.1|  hypothetical protein SORBIDRAFT_03g005150          176   3e-50   
gb|KHN04965.1|  Germin-like protein subfamily 1 member 7                177   3e-50   
ref|XP_004962598.1|  PREDICTED: germin-like protein 5-1-like            176   3e-50   
ref|XP_008678223.1|  PREDICTED: putative germin-like protein 12-4       176   3e-50   
ref|XP_011037723.1|  PREDICTED: putative germin-like protein 2-3        176   3e-50   
ref|XP_004230403.1|  PREDICTED: putative germin-like protein 2-1        176   3e-50   
gb|ABG46238.1|  germin-like protein 6a                                  176   3e-50   
ref|XP_006349261.1|  PREDICTED: putative germin-like protein 2-1-...    176   3e-50   
ref|XP_004962506.1|  PREDICTED: germin-like protein 5-1-like            176   4e-50   
ref|XP_002447481.1|  hypothetical protein SORBIDRAFT_06g001690          176   4e-50   
ref|XP_002284624.1|  PREDICTED: germin-like protein subfamily 1 m...    176   4e-50   
gb|ACG41245.1|  germin-like protein subfamily 1 member 17 precursor     176   4e-50   
emb|CBI36811.3|  unnamed protein product                                176   4e-50   
ref|XP_006358459.1|  PREDICTED: germin-like protein subfamily 1 m...    176   4e-50   
ref|XP_002512594.1|  Rhicadhesin receptor precursor, putative           176   4e-50   
ref|XP_008678210.1|  PREDICTED: putative germin-like protein 12-4       176   4e-50   
ref|XP_008363952.1|  PREDICTED: germin-like protein 5-1                 176   4e-50   
gb|EMS53398.1|  Putative germin-like protein 2-1                        176   4e-50   
gb|EYU20541.1|  hypothetical protein MIMGU_mgv1a018988mg                176   4e-50   
ref|XP_008372247.1|  PREDICTED: putative germin-like protein 2-1 ...    176   4e-50   
ref|XP_006371120.1|  hypothetical protein POPTR_0019s04280g             176   4e-50   
gb|KDP34916.1|  hypothetical protein JCGZ_09204                         176   5e-50   
ref|XP_006377938.1|  germin-like protein 1                              176   5e-50   
ref|NP_001061157.1|  Os08g0189200                                       176   5e-50   
ref|XP_006377949.1|  germin-like protein 1                              176   5e-50   
ref|XP_009414929.1|  PREDICTED: germin-like protein 5-1                 176   5e-50   
ref|XP_002276445.2|  PREDICTED: uncharacterized protein LOC100254460    184   5e-50   
ref|XP_009402554.1|  PREDICTED: germin-like protein 12-2 isoform X2     176   5e-50   
emb|CAN63434.1|  hypothetical protein VITISV_033830                     175   5e-50   
emb|CDP16786.1|  unnamed protein product                                185   5e-50   
ref|XP_006358511.1|  PREDICTED: nectarin-1-like                         176   6e-50   
ref|XP_009402552.1|  PREDICTED: germin-like protein 12-2 isoform X1     176   6e-50   
gb|EMT10776.1|  Putative germin-like protein 2-1                        176   6e-50   
ref|XP_007030284.1|  RmlC-like cupins superfamily protein               176   6e-50   
ref|XP_009778962.1|  PREDICTED: nectarin-1-like                         176   6e-50   
ref|XP_008678216.1|  PREDICTED: putative germin-like protein 12-4       176   6e-50   
ref|XP_004971281.1|  PREDICTED: germin-like protein 1-3-like            176   6e-50   
gb|EYU40210.1|  hypothetical protein MIMGU_mgv1a022317mg                176   7e-50   
gb|EMS67055.1|  Germin-like protein 8-9                                 176   7e-50   
ref|XP_008678221.1|  PREDICTED: putative germin-like protein 12-4       176   7e-50   
ref|XP_011092215.1|  PREDICTED: germin-like protein 5-1                 175   7e-50   
emb|CDY31080.1|  BnaA08g26300D                                          175   7e-50   
ref|XP_006468336.1|  PREDICTED: putative germin-like protein 2-2-...    175   8e-50   
ref|XP_008678211.1|  PREDICTED: putative germin-like protein 12-4       176   8e-50   
ref|XP_006382248.1|  rhicadhesin receptor family protein                175   8e-50   
ref|XP_008225644.1|  PREDICTED: putative germin-like protein 2-1        175   8e-50   
ref|XP_002456940.1|  hypothetical protein SORBIDRAFT_03g045980          175   8e-50   
ref|XP_006659191.1|  PREDICTED: germin-like protein 8-5-like            175   8e-50   
ref|XP_008678222.1|  PREDICTED: putative germin-like protein 12-4       175   9e-50   
emb|CBI36815.3|  unnamed protein product                                175   9e-50   
ref|XP_003626120.1|  Rhicadhesin receptor                               175   9e-50   
emb|CDX99669.1|  BnaC04g34260D                                          175   9e-50   
gb|KFK35387.1|  hypothetical protein AALP_AA5G278600                    175   9e-50   
emb|CDP16789.1|  unnamed protein product                                182   9e-50   
ref|XP_010522863.1|  PREDICTED: germin-like protein subfamily 2 m...    175   9e-50   
ref|NP_001045416.1|  Os01g0952000                                       175   1e-49   
ref|XP_003573513.1|  PREDICTED: germin-like protein 8-11                175   1e-49   
ref|NP_001240963.1|  germin-like protein subfamily 1 member 7-lik...    175   1e-49   
emb|CAN70904.1|  hypothetical protein VITISV_032927                     174   1e-49   
emb|CDP12575.1|  unnamed protein product                                181   1e-49   
gb|AFK48662.1|  unknown                                                 175   1e-49   
ref|XP_010024918.1|  PREDICTED: germin-like protein subfamily 1 m...    175   1e-49   
ref|XP_006468354.1|  PREDICTED: putative germin-like protein 2-1-...    175   1e-49   
ref|XP_009784933.1|  PREDICTED: germin-like protein subfamily 1 m...    175   1e-49   
ref|XP_002299047.1|  germin-like protein 1                              175   1e-49   
ref|XP_006448869.1|  hypothetical protein CICLE_v10017587mg             175   1e-49   
ref|XP_006448874.1|  hypothetical protein CICLE_v10018003mg             175   1e-49   
ref|XP_008678214.1|  PREDICTED: putative germin-like protein 12-4       175   1e-49   
ref|XP_009107789.1|  PREDICTED: germin-like protein subfamily 1 m...    175   1e-49   
gb|EMS53400.1|  Putative germin-like protein 2-1                        174   1e-49   
ref|XP_004171130.1|  PREDICTED: germin-like protein 5-1-like            175   1e-49   
ref|XP_008656864.1|  PREDICTED: putative germin-like protein 3-2        175   1e-49   
ref|XP_007030289.1|  RmlC-like cupins superfamily protein               175   1e-49   
ref|NP_198729.1|  germin-like protein subfamily 1 member 16             175   1e-49   
gb|EMT11294.1|  Putative germin-like protein 2-1                        174   1e-49   
ref|XP_010045486.1|  PREDICTED: germin-like protein subfamily 2 m...    174   1e-49   
ref|XP_010497434.1|  PREDICTED: germin-like protein subfamily 2 m...    174   1e-49   
ref|XP_004952512.1|  PREDICTED: putative germin-like protein 2-2-...    174   1e-49   
gb|AEO00531.1|  PR16-1                                                  175   1e-49   
ref|XP_006659190.1|  PREDICTED: germin-like protein 8-5-like            175   1e-49   
ref|XP_009795503.1|  PREDICTED: germin-like protein subfamily 1 m...    175   1e-49   
ref|XP_004230405.1|  PREDICTED: germin-like protein subfamily 1 m...    175   1e-49   
ref|XP_009129904.1|  PREDICTED: germin-like protein subfamily 1 m...    174   1e-49   
ref|NP_187246.1|  germin-like protein subfamily 1 member 7              175   1e-49   
emb|CDY15957.1|  BnaA04g11540D                                          174   1e-49   
ref|XP_006659897.1|  PREDICTED: germin-like protein 8-11-like           175   1e-49   
ref|XP_004249176.1|  PREDICTED: putative germin-like protein 2-3 ...    174   2e-49   
ref|XP_010070111.1|  PREDICTED: nectarin-1                              174   2e-49   
ref|XP_003590904.1|  Germin-like protein subfamily 1 member             174   2e-49   
ref|XP_009597339.1|  PREDICTED: nectarin-1                              175   2e-49   
ref|XP_003573394.1|  PREDICTED: germin-like protein 8-11                174   2e-49   
sp|Q6K5P9.1|GL22_ORYSJ  RecName: Full=Putative germin-like protei...    174   2e-49   
ref|XP_009631982.1|  PREDICTED: germin-like protein subfamily T m...    174   2e-49   
ref|XP_008372246.1|  PREDICTED: putative germin-like protein 2-3 ...    174   2e-49   
sp|Q2QXJ0.2|GL124_ORYSJ  RecName: Full=Putative germin-like prote...    174   2e-49   
emb|CDY69099.1|  BnaA07g37570D                                          174   2e-49   
ref|NP_187070.1|  RmlC-like cupins superfamily protein                  174   2e-49   
ref|XP_010941249.1|  PREDICTED: germin-like protein 5-1                 176   2e-49   
ref|XP_011099652.1|  PREDICTED: putative germin-like protein 2-1        174   2e-49   
ref|XP_006659186.1|  PREDICTED: germin-like protein 12-2-like           174   2e-49   
ref|XP_008439538.1|  PREDICTED: putative germin-like protein 2-1        174   2e-49   
ref|XP_002457564.1|  hypothetical protein SORBIDRAFT_03g009430          174   2e-49   



>gb|KDO82649.1| hypothetical protein CISIN_1g027536mg [Citrus sinensis]
Length=222

 Score =   296 bits (758),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 167/200 (84%), Gaps = 1/200 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNVT  537
            K+DP PLQD+C+ADT +  + + NGV C+NP+ AV+S+F TSALAKPG T  N FGFN T
Sbjct  23   KTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNAT  82

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
             TN   LPGVNT GLT+AR+D+A  G+VPPHTHPRASEVTI LKGA+LVGFVDT  RLFT
Sbjct  83   LTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFT  142

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            QQLR GDSFVFPK LIHFL+NMD+ KPALA+SGLSSQNPG Q+TS+ATFA+KP +PDEVL
Sbjct  143  QQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVL  202

Query  176  KKAFQINGIDVAKIRKNLGG  117
            KKAFQI   DV+ IRKNLGG
Sbjct  203  KKAFQITRQDVSIIRKNLGG  222



>emb|CBI32073.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   296 bits (757),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 173/215 (80%), Gaps = 1/215 (0%)
 Frame = -1

Query  758  LKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALA  579
            L  + + ++ +  LVK DPDPLQDYC+ADTK +K  F+NGV CI+P LA  S+F TSAL+
Sbjct  7    LPKLFIAIALLSGLVKPDPDPLQDYCIADTKASKAFFINGVPCIDPQLAQVSHFTTSALS  66

Query  578  KPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
            KPGNT  N FGF++T TN   LPG NT GLT+AR D+A  GLVP H+HPRASEV  +LKG
Sbjct  67   KPGNTSANPFGFSITLTNTMNLPGFNTMGLTMARADIAANGLVPLHSHPRASEVATLLKG  126

Query  401  AVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTS  222
            A+LVGF+DTSNRLFTQ LR GDSFVFPK +IHFL+N+D++ PA+ ++GL+SQNPG QLTS
Sbjct  127  ALLVGFIDTSNRLFTQLLRPGDSFVFPKGMIHFLYNLDSLAPAVVLAGLNSQNPGTQLTS  186

Query  221  LATFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
             A FAT P +PDEVLKKAFQI+G DVA+IR+NLGG
Sbjct  187  TAAFATNPRLPDEVLKKAFQISGQDVARIRRNLGG  221



>ref|XP_002271090.2| PREDICTED: germin-like protein subfamily 1 member 1 [Vitis vinifera]
Length=248

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 173/215 (80%), Gaps = 1/215 (0%)
 Frame = -1

Query  758  LKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALA  579
            L  + + ++ +  LVK DPDPLQDYC+ADTK +K  F+NGV CI+P LA  S+F TSAL+
Sbjct  34   LPKLFIAIALLSGLVKPDPDPLQDYCIADTKASKAFFINGVPCIDPQLAQVSHFTTSALS  93

Query  578  KPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
            KPGNT  N FGF++T TN   LPG NT GLT+AR D+A  GLVP H+HPRASEV  +LKG
Sbjct  94   KPGNTSANPFGFSITLTNTMNLPGFNTMGLTMARADIAANGLVPLHSHPRASEVATLLKG  153

Query  401  AVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTS  222
            A+LVGF+DTSNRLFTQ LR GDSFVFPK +IHFL+N+D++ PA+ ++GL+SQNPG QLTS
Sbjct  154  ALLVGFIDTSNRLFTQLLRPGDSFVFPKGMIHFLYNLDSLAPAVVLAGLNSQNPGTQLTS  213

Query  221  LATFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
             A FAT P +PDEVLKKAFQI+G DVA+IR+NLGG
Sbjct  214  TAAFATNPRLPDEVLKKAFQISGQDVARIRRNLGG  248



>ref|XP_006483755.1| PREDICTED: germin-like protein subfamily 1 member 1-like [Citrus 
sinensis]
Length=222

 Score =   295 bits (754),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 166/200 (83%), Gaps = 1/200 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNVT  537
            K+DP PLQD+C+ADT +    + NGV C+NP+ AV+S+F TSALAKPG T  N FGFN T
Sbjct  23   KTDPPPLQDFCIADTASPSLFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNAT  82

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
             TN   LPGVNT GLT+AR+D+A  G+VPPHTHPRASEVTI LKGA+LVGFVDT  RLFT
Sbjct  83   LTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFT  142

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            QQLR GDSFVFPK LIHFL+NMD+ KPALA+SGLSSQNPG Q+TS+ATFA+KP +PDEVL
Sbjct  143  QQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVL  202

Query  176  KKAFQINGIDVAKIRKNLGG  117
            KKAFQI   D++ IRKNLGG
Sbjct  203  KKAFQITSQDISIIRKNLGG  222



>ref|XP_006438507.1| hypothetical protein CICLE_v10033943mg [Citrus clementina]
 gb|ESR51747.1| hypothetical protein CICLE_v10033943mg [Citrus clementina]
Length=222

 Score =   294 bits (752),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 177/222 (80%), Gaps = 1/222 (0%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M+I   +++  +  L+ ++ L K+DP PLQD+C+ADT +    + NGV C+NP+ AV+S+
Sbjct  1    MKISSKMIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSLFYNNGVPCLNPNSAVSSH  60

Query  599  FATSALAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            F TSALAKPG T  N FGFN T TN   LPGVNT GLT+AR+D+   G+VPPHTHPRASE
Sbjct  61   FVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDITANGIVPPHTHPRASE  120

Query  422  VTIVLKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQN  243
            VTI LKGA+LVGFVDT  RLFTQQLR GDSFVFPK LIHFL+NMD+ KPALA+SGLSSQN
Sbjct  121  VTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQN  180

Query  242  PGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
            PG Q+TS+ATFA+KP +PDEVLKKAFQI   D++ IRKNLGG
Sbjct  181  PGLQMTSMATFASKPPIPDEVLKKAFQITSQDISIIRKNLGG  222



>ref|XP_010044669.1| PREDICTED: germin-like protein subfamily 1 member 1 [Eucalyptus 
grandis]
Length=224

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 175/222 (79%), Gaps = 2/222 (1%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            +++ P  L+ ++V L+ ++   ++DPDPLQDYC+AD +N     +NG  CINP+LA  S+
Sbjct  4    IKVTPSPLRTLVV-LALILSHARADPDPLQDYCIADMRNQSPYSVNGAPCINPNLASISH  62

Query  599  FATSALAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            F TSAL++ GNTK N FGFNVT TN A LPG+NT GLT+AR+D+A  GLVPPH+HPRASE
Sbjct  63   FTTSALSRRGNTKANQFGFNVTLTNTANLPGLNTMGLTMARIDMAGNGLVPPHSHPRASE  122

Query  422  VTIVLKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQN  243
            VTI L+G + VGFVDTS RLFTQ LR G+SFVFPK LIH+L+N D   PALA+SGLSSQN
Sbjct  123  VTICLEGVIGVGFVDTSYRLFTQILRPGESFVFPKGLIHYLYNYDLKNPALAISGLSSQN  182

Query  242  PGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
            PGAQ+ S+A F +KP +PDEVL KAFQI G D+AKIRKNLGG
Sbjct  183  PGAQIASVAAFMSKPWIPDEVLGKAFQITGQDIAKIRKNLGG  224



>ref|XP_002520204.1| Nectarin-1 precursor, putative [Ricinus communis]
 gb|EEF42259.1| Nectarin-1 precursor, putative [Ricinus communis]
Length=218

 Score =   291 bits (745),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 166/200 (83%), Gaps = 3/200 (2%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNVT  537
            K DPDPLQDYC+AD+K   + +LNGV CINP+LA  + F TSALAK GNT+ N FGFNVT
Sbjct  21   KPDPDPLQDYCIADSK--ASFYLNGVPCINPNLATTAYFTTSALAKAGNTRANPFGFNVT  78

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
             TN A+LPG+NT GLTLARVDL P G+VPPH+HPRASEVTI LKG++LVGFVD+SN L+T
Sbjct  79   LTNTAILPGINTLGLTLARVDLDPSGIVPPHSHPRASEVTICLKGSILVGFVDSSNNLYT  138

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            QQLR G+SFVFPK LIHFL N D M+PALA+SGLSSQNPGAQ+ SL+ F + P +PD+V+
Sbjct  139  QQLRDGESFVFPKGLIHFLSNNDPMRPALAISGLSSQNPGAQIASLSVFRSNPFIPDDVV  198

Query  176  KKAFQINGIDVAKIRKNLGG  117
            KKAFQI   DV +IR+NLGG
Sbjct  199  KKAFQITSQDVMRIRRNLGG  218



>ref|NP_001237622.1| uncharacterized protein LOC100500154 precursor [Glycine max]
 gb|ACU15085.1| unknown [Glycine max]
 gb|KHN28685.1| Germin-like protein subfamily 1 member 1 [Glycine soja]
Length=220

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = -1

Query  737  LSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKN  558
            LS ++   + DPDPLQDYCVAD+K+  N F+NGV CINPD   +S+F TSAL+K GNT N
Sbjct  16   LSLILGQTRPDPDPLQDYCVADSKS--NFFINGVPCINPDKVSSSHFVTSALSKTGNTSN  73

Query  557  TFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVD  378
             FGF+VTAT  A LPG+NT GL L RVD+A  G+VPPH+HPRASEVT  LKG +LVGFVD
Sbjct  74   QFGFSVTATTTANLPGLNTLGLVLVRVDIAGNGIVPPHSHPRASEVTTCLKGLLLVGFVD  133

Query  377  TSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKP  198
            TSNR+FTQ LR G+SFVFPK L+HFLFN D+ +PA+A+SGL+SQNPGAQ+ SLATFA+KP
Sbjct  134  TSNRVFTQNLRPGESFVFPKGLVHFLFNSDSREPAIAISGLNSQNPGAQIASLATFASKP  193

Query  197  AVPDEVLKKAFQINGIDVAKIRKNLGG  117
             +PD++LKKAFQI+  +V  IR+NLGG
Sbjct  194  PIPDDILKKAFQISKGEVETIRRNLGG  220



>ref|XP_011087075.1| PREDICTED: germin-like protein subfamily 1 member 1 [Sesamum 
indicum]
Length=221

 Score =   286 bits (731),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFN  543
             L ++DP+PL DYCVADTK+ ++ F NGV CINPD A+AS+FATSAL++PGN  N F FN
Sbjct  20   SLGRADPEPLNDYCVADTKHPRDFFSNGVPCINPDHALASHFATSALSEPGNM-NQFNFN  78

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRL  363
            VT TN   LPG+NT GL LAR+D+A  GLVPPH HPRASEVTI+L+G++LVGFVDTSNRL
Sbjct  79   VTLTNTNNLPGLNTLGLVLARIDIAVNGLVPPHAHPRASEVTILLEGSLLVGFVDTSNRL  138

Query  362  FTQQLRA-GDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPD  186
             TQQLR  GD FVFPK LIHFL+N D M+PALAVSGLSSQNPGAQ++S+ATF + P +PD
Sbjct  139  HTQQLRRPGDCFVFPKGLIHFLYNTDFMRPALAVSGLSSQNPGAQISSVATFTSNPPMPD  198

Query  185  EVLKKAFQINGIDVAKIRKNLGG  117
            +VLKK F++ G DV KIR+NLGG
Sbjct  199  DVLKKGFKVTGQDVIKIRRNLGG  221



>ref|XP_003613431.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES96389.1| germin family 1 protein [Medicago truncatula]
Length=221

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 164/198 (83%), Gaps = 2/198 (1%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDPDPLQDYC+AD KNT   FLNG+ CI+P  A +S+FATS+L+KPGNT N FGF+VT T
Sbjct  26   SDPDPLQDYCIADNKNT--FFLNGLPCIDPKQATSSHFATSSLSKPGNTTNMFGFSVTPT  83

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQ  351
            N   LPG+NT GL L RVD+A  G+VPPH+HPRASEVT  +KG +LVGFVDTSNR FTQ 
Sbjct  84   NTINLPGLNTLGLVLVRVDIAGNGIVPPHSHPRASEVTTCIKGLLLVGFVDTSNRAFTQN  143

Query  350  LRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKK  171
            L  G+SFVFPK L+HFL+N D+ +PA+A+SGL+SQNPGAQ+ S+ATFA+KP++PDEVLKK
Sbjct  144  LSPGESFVFPKGLVHFLYNRDSKQPAIAISGLNSQNPGAQIASIATFASKPSIPDEVLKK  203

Query  170  AFQINGIDVAKIRKNLGG  117
            AFQING +V  IRK LGG
Sbjct  204  AFQINGQEVDIIRKKLGG  221



>gb|AFK46631.1| unknown [Medicago truncatula]
Length=221

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 164/198 (83%), Gaps = 2/198 (1%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDPDPLQDYC+AD KNT   FLNG+ CI+P  A +S+FATS+L+KPGNT N FGF+VT T
Sbjct  26   SDPDPLQDYCIADNKNT--FFLNGLPCIDPKQATSSHFATSSLSKPGNTTNMFGFSVTPT  83

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQ  351
            N   LPG+NT GL L RVD+A  G+VPPH+HPRASEVT  +KG +LVGFVDTSNR FTQ 
Sbjct  84   NTIDLPGLNTLGLVLVRVDIAGNGIVPPHSHPRASEVTTCIKGLLLVGFVDTSNRAFTQN  143

Query  350  LRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKK  171
            L  G+SFVFPK L+HFL+N D+ +PA+A+SGL+SQNPGAQ+ S+ATFA+KP++PDEVLKK
Sbjct  144  LSPGESFVFPKGLVHFLYNRDSKQPAIAISGLNSQNPGAQIASIATFASKPSIPDEVLKK  203

Query  170  AFQINGIDVAKIRKNLGG  117
            AFQING +V  IRK LGG
Sbjct  204  AFQINGQEVDIIRKKLGG  221



>ref|XP_008221479.1| PREDICTED: germin-like protein subfamily 1 member 1 [Prunus mume]
Length=221

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 174/222 (78%), Gaps = 2/222 (1%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            MRI    ++ + V L+ ++   K DPDPLQDYCVADTK  ++ +LNG  CINP LA +S+
Sbjct  1    MRINSSFVQ-LFVTLALLLGQAKPDPDPLQDYCVADTKIPQSFYLNGAPCINPKLANSSH  59

Query  599  FATSALAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            F TS L+KPGN K N FGFN T TN   LPGVNT GLT+ARVD+A  G+VPPH HPRASE
Sbjct  60   FTTSVLSKPGNPKANPFGFNATLTNTLNLPGVNTLGLTMARVDIAANGMVPPHLHPRASE  119

Query  422  VTIVLKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQN  243
            V I LKG +LVGFVDTSNR+FTQQL+ G+SFVFPK+L+HFL+N D++  AL ++G SSQN
Sbjct  120  VAICLKGLLLVGFVDTSNRVFTQQLKPGESFVFPKSLVHFLYNYDSVNQALVLAGFSSQN  179

Query  242  PGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
            PGAQ+ SLATF +KP++P  +LK AFQI+ +DVA+IRKNLGG
Sbjct  180  PGAQIVSLATFTSKPSIPVAILKNAFQISDLDVARIRKNLGG  221



>ref|NP_001241459.1| germin-like protein subfamily 1 member 1-like precursor [Glycine 
max]
 gb|ACG69481.1| germin-like protein 5 [Glycine max]
 gb|KHN01131.1| Germin-like protein subfamily 1 member 1 [Glycine soja]
Length=220

 Score =   283 bits (725),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 169/211 (80%), Gaps = 2/211 (1%)
 Frame = -1

Query  749  IIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPG  570
             +  LS ++   + DPDPLQDYCVAD+K+    F+NGV CI+PD   +S+F TSAL+K G
Sbjct  12   FLFTLSLLLGKTRPDPDPLQDYCVADSKS--EFFINGVPCIDPDKVSSSHFVTSALSKTG  69

Query  569  NTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLV  390
            NT N FGF+VTAT  A LPG+NT GL L RVD+A  G+VPPH+HPRASEVT  LKG +LV
Sbjct  70   NTSNQFGFSVTATTTANLPGLNTLGLVLVRVDIAGNGIVPPHSHPRASEVTTCLKGMLLV  129

Query  389  GFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATF  210
            GFVDTSNR+FTQ LR G+SFVFPK L+HFLFN D+ +PA+A+SGL+SQNPGAQ+ SLATF
Sbjct  130  GFVDTSNRVFTQNLRPGESFVFPKGLVHFLFNSDSREPAIAISGLNSQNPGAQIASLATF  189

Query  209  ATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
            A+KP +PD++LKKAFQI+  +V  IR+NLGG
Sbjct  190  ASKPPIPDDILKKAFQISKGEVETIRRNLGG  220



>ref|XP_006829478.1| hypothetical protein AMTR_s00074p00061830 [Amborella trichopoda]
 gb|ERM96894.1| hypothetical protein AMTR_s00074p00061830 [Amborella trichopoda]
Length=218

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 169/213 (79%), Gaps = 3/213 (1%)
 Frame = -1

Query  749  IIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKP  573
            +++ L+      K SDPDPLQD+C+ADT N   LFLNG  CINP  A  S+F TSALA P
Sbjct  7    LLIFLAMATRRAKCSDPDPLQDFCIADTANPYGLFLNGQPCINPARAEPSHFKTSALASP  66

Query  572  GNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            GNT+ N FGFNVT T+   LPG +TQ L LAR+D+  GG VPPH HPRASEVT +++G +
Sbjct  67   GNTRANPFGFNVTLTSTKNLPGCHTQSLALARIDIDVGGTVPPHAHPRASEVTFIVRGVL  126

Query  395  LVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLA  216
            LVGFVDTSNRL+TQQL  GD+F+FP+AL+HFL+N+ +  PALA+SGLSSQNPGAQL+SLA
Sbjct  127  LVGFVDTSNRLYTQQLLPGDTFMFPRALVHFLYNIGS-TPALAISGLSSQNPGAQLSSLA  185

Query  215  TFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
            TF TKPA+PDEVLKKAFQI G DV ++RKNLGG
Sbjct  186  TFTTKPAMPDEVLKKAFQITGQDVQRMRKNLGG  218



>gb|KDP21281.1| hypothetical protein JCGZ_21752 [Jatropha curcas]
Length=219

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 159/200 (80%), Gaps = 3/200 (2%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNT-KNTFGFNVT  537
            K DPDPLQDYC+ADTK    L LNGV CINP LA + +F TS LAK GNT   TFGFNVT
Sbjct  21   KQDPDPLQDYCIADTK--APLSLNGVPCINPKLASSVHFTTSVLAKSGNTGATTFGFNVT  78

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
             TNV  LPG+NT GL+LAR+DLA  GLVPPH HPRASEVT  +KG +LVGFVDTSNRL+T
Sbjct  79   LTNVINLPGINTLGLSLARIDLAANGLVPPHVHPRASEVTTCIKGLLLVGFVDTSNRLYT  138

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            QQLRAG+SFVFPK L+HFL+N+D   PALA SGLSSQNPG Q+ SLA F + P +PDEV+
Sbjct  139  QQLRAGESFVFPKGLVHFLYNIDGRGPALAFSGLSSQNPGTQIGSLAAFVSHPLIPDEVV  198

Query  176  KKAFQINGIDVAKIRKNLGG  117
            KKA+QI   DV KIRKNLGG
Sbjct  199  KKAYQITTQDVMKIRKNLGG  218



>gb|EYU28657.1| hypothetical protein MIMGU_mgv1a023310mg [Erythranthe guttata]
Length=220

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M I   L   +   + +      SDP+P+ DYCVADTK  ++ FLNGV CINP+  + S+
Sbjct  1    MVINHVLWLQLFTVIIYFPSFSNSDPEPIHDYCVADTKTPRDFFLNGVPCINPNQTMVSH  60

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            FATSAL+KPG+  N F FNVT T+   LPGVNT GLT+AR+D+A  GLVPPH+HPRASEV
Sbjct  61   FATSALSKPGDM-NRFKFNVTLTDTNNLPGVNTLGLTMARIDIAVNGLVPPHSHPRASEV  119

Query  419  TIVLKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNP  240
            T++L+G++LVGFVDTSNRL TQ+LR GDSFVFPK LIHFL+N     PALAVSGLSSQNP
Sbjct  120  TMLLEGSLLVGFVDTSNRLHTQRLRPGDSFVFPKGLIHFLYNTHVKIPALAVSGLSSQNP  179

Query  239  GAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
            GAQ++S+A F + P +PDEVL K F+I+G DV +IR NLGG
Sbjct  180  GAQISSVAAFTSNPLIPDEVLTKGFKISGQDVVRIRSNLGG  220



>ref|XP_011006614.1| PREDICTED: germin-like protein subfamily 1 member 1 [Populus 
euphratica]
Length=220

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 167/200 (84%), Gaps = 3/200 (2%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNT-FGFNVT  537
            K+DP PLQDYC+ADT  +K  +LNG  CI+P LA +S+F T+AL+KPGNTK T FGF+V 
Sbjct  23   KADPHPLQDYCIADT--SKPFYLNGAPCIDPKLAASSHFTTAALSKPGNTKATPFGFSVK  80

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
             TNV  LPG+NT GLT+AR+DL P GLVP H+HPRASEVTI +KG++LVGF+DTSN +FT
Sbjct  81   LTNVTNLPGLNTMGLTMARIDLDPNGLVPLHSHPRASEVTICIKGSLLVGFIDTSNYVFT  140

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            Q LR G+SFVFP+ LIHFL+NM+TM  ALAVSGLSSQNPGAQ+ ++A F +KP++P+EVL
Sbjct  141  QLLRPGESFVFPRGLIHFLYNMETMGSALAVSGLSSQNPGAQIAAVAAFTSKPSMPEEVL  200

Query  176  KKAFQINGIDVAKIRKNLGG  117
            KK+FQI+  DV +IR+NLGG
Sbjct  201  KKSFQISNQDVTRIRRNLGG  220



>ref|XP_004298594.1| PREDICTED: germin-like protein subfamily 1 member 1-like [Fragaria 
vesca subsp. vesca]
Length=221

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 159/200 (80%), Gaps = 1/200 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNVT  537
            K DPDPLQDYC+ADT    + + NG  CINP  A+ S+F TS L+KPGNTK N FGFNVT
Sbjct  22   KPDPDPLQDYCIADTITPGSFYFNGAPCINPKHALPSHFTTSVLSKPGNTKANPFGFNVT  81

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
             TN   LPG+NT GLT+ARVD+A  GLVPPH HPRASEVT  LKG +LVGFVDTSNR+FT
Sbjct  82   LTNTLNLPGLNTLGLTMARVDIAANGLVPPHLHPRASEVTTCLKGLLLVGFVDTSNRVFT  141

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            QQLR G+SFVFPK+LIHFL+N D+  PA+A+SGLSSQNPGAQ+ SLATF + P + +E+L
Sbjct  142  QQLRPGESFVFPKSLIHFLYNYDSRAPAVALSGLSSQNPGAQIVSLATFTSNPPIDNEIL  201

Query  176  KKAFQINGIDVAKIRKNLGG  117
             K FQI   DVA+IRKNLGG
Sbjct  202  MKGFQITDRDVARIRKNLGG  221



>ref|XP_004504494.1| PREDICTED: germin-like protein subfamily 1 member 1-like [Cicer 
arietinum]
Length=222

 Score =   278 bits (712),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 163/199 (82%), Gaps = 2/199 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            K DPDPLQDYC+AD K+T   F+NGV CI+P  A +S+F TS+L+KP NT N FGF+VT 
Sbjct  26   KPDPDPLQDYCIADNKST--FFINGVPCIDPKQATSSHFVTSSLSKPANTTNMFGFSVTP  83

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
            TN   LPG+NT GL L R+D+   G+VPPH+HPRASEVT  LKG +LVGF+DT+NR+FTQ
Sbjct  84   TNTNNLPGLNTLGLVLVRIDIERNGIVPPHSHPRASEVTTCLKGLLLVGFIDTNNRVFTQ  143

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L  G+SFVFPK L+HFL+N D+ +PALA+SGL+SQNPG+Q+ S+ATFA+KP++PDE+LK
Sbjct  144  NLNPGESFVFPKGLVHFLYNRDSKEPALAISGLNSQNPGSQIASIATFASKPSIPDEILK  203

Query  173  KAFQINGIDVAKIRKNLGG  117
            KAFQI+G DV  IR+NLGG
Sbjct  204  KAFQISGKDVKIIRENLGG  222



>ref|XP_010100533.1| Germin-like protein subfamily 1 member 1 [Morus notabilis]
 gb|EXB82667.1| Germin-like protein subfamily 1 member 1 [Morus notabilis]
Length=204

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNVT  537
            KSDPDP+QDYC+AD ++ +  F+NG  CI+P+ A +S+F TSAL+KPGNTK N +G+N T
Sbjct  5    KSDPDPIQDYCIADNRSPQPFFINGKPCIDPNQASSSHFVTSALSKPGNTKTNRYGYNAT  64

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
             TN   LPG+NT GLTLAR+D+A  GL PPH+HPRASEVT  LKG +LVGFVDTSNRLFT
Sbjct  65   LTNTVNLPGLNTLGLTLARIDIAGNGLYPPHSHPRASEVTTCLKGILLVGFVDTSNRLFT  124

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            QQL+ G+SFVFP+ LIHF++N+D++ PA+ +SGLSSQNPG Q+ SLATF + P +PD ++
Sbjct  125  QQLKPGESFVFPRGLIHFIYNIDSLGPAMTLSGLSSQNPGTQIASLATFTSNPPIPDFIM  184

Query  176  KKAFQINGIDVAKIRKNL  123
            KKAFQI+  D+AKIRKNL
Sbjct  185  KKAFQISDSDLAKIRKNL  202



>ref|XP_007157527.1| hypothetical protein PHAVU_002G077300g [Phaseolus vulgaris]
 gb|ESW29521.1| hypothetical protein PHAVU_002G077300g [Phaseolus vulgaris]
Length=216

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 160/199 (80%), Gaps = 2/199 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            + DPDPLQDYCVAD K     F+NGV CINPD    S+F TSAL+K GNT N FGF+VTA
Sbjct  20   RPDPDPLQDYCVADNKGE--FFINGVPCINPDKVSPSHFVTSALSKNGNTSNPFGFSVTA  77

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
            TN   LPG+NT GL L RVD+A  G+VPPH+HPRASEVT  LKG +LVGFVDT+NR+FTQ
Sbjct  78   TNTVNLPGLNTLGLVLVRVDIAGNGIVPPHSHPRASEVTTCLKGQLLVGFVDTNNRVFTQ  137

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L+ G+SFVFPK L+HFLFN ++ +PALA+SGL+SQNPGAQ+ SLATFA+KP++ DE+LK
Sbjct  138  NLKPGESFVFPKGLVHFLFNSNSREPALALSGLNSQNPGAQIASLATFASKPSINDEILK  197

Query  173  KAFQINGIDVAKIRKNLGG  117
            K FQI G +V  IR+NLGG
Sbjct  198  KGFQITGREVETIRRNLGG  216



>ref|XP_006378204.1| Germin-like protein subfamily 1 member 1 precursor [Populus trichocarpa]
 gb|ERP56001.1| Germin-like protein subfamily 1 member 1 precursor [Populus trichocarpa]
Length=220

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNT-FGFNVT  537
            K+DP PLQDYC+ADT  +K  +LNG  CI+P L+ +S+F T+AL+KPGNTK T +GF+V 
Sbjct  23   KADPHPLQDYCIADT--SKPFYLNGAPCIDPKLSASSHFTTAALSKPGNTKATPYGFSVK  80

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
             TNV  LPG+NT GLT+ARVDL P GLVP H+HPRASEVTI +KG++LVGFV+TSN +FT
Sbjct  81   VTNVTNLPGLNTMGLTMARVDLDPNGLVPLHSHPRASEVTICIKGSLLVGFVNTSNYVFT  140

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            Q LR G+SFVFP+ LIHFL+NM+TM  ALAVSGLSSQ+PG Q+ + A F +KP++PDEVL
Sbjct  141  QLLRPGESFVFPRGLIHFLYNMETMDSALAVSGLSSQSPGTQIAAFAAFTSKPSMPDEVL  200

Query  176  KKAFQINGIDVAKIRKNLGG  117
            KK+FQI+  DV +IR+NLGG
Sbjct  201  KKSFQISNQDVTRIRRNLGG  220



>ref|XP_010543966.1| PREDICTED: germin-like protein subfamily 1 member 1 [Tarenaya 
hassleriana]
Length=239

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 162/201 (81%), Gaps = 1/201 (0%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNV  540
            VKSDPDPLQDYCVADTK+   +FLNG  C +P LA  ++F TSAL++ G+T+ N  G NV
Sbjct  39   VKSDPDPLQDYCVADTKSPHPIFLNGAPCKDPTLATVADFTTSALSESGDTRTNQLGINV  98

Query  539  TATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLF  360
            T T    LPG+NT GL +AR+D A  G+VPPH HPRASEVTI L+G +LVGFVDTS R+F
Sbjct  99   TLTTTTNLPGLNTMGLAMARIDFAGRGVVPPHAHPRASEVTICLEGVLLVGFVDTSGRVF  158

Query  359  TQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEV  180
            TQ+L AG+SFVFPK LIHFL+N+D+   A+AVSGLSSQNPG Q+ SLA+FA+KP +P+EV
Sbjct  159  TQELHAGESFVFPKGLIHFLYNIDSESSAMAVSGLSSQNPGTQIASLASFASKPPIPEEV  218

Query  179  LKKAFQINGIDVAKIRKNLGG  117
            L++AF+IN  DVA+IRKNLGG
Sbjct  219  LERAFRINAQDVARIRKNLGG  239



>ref|XP_010255423.1| PREDICTED: germin-like protein subfamily 1 member 1 [Nelumbo 
nucifera]
Length=240

 Score =   271 bits (692),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 166/204 (81%), Gaps = 5/204 (2%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNT---KNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFG  549
            +++DPDPLQD+CVA T  +   +  F+NG  CINP  A+  +F TS L+KPGNT  N FG
Sbjct  38   IRADPDPLQDFCVASTSTSTTSQPFFVNGAPCINPAQALPVHFMTSVLSKPGNTSANPFG  97

Query  548  FNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSN  369
            FNVT TN   LPG+NTQGLT+AR+D+A  GLVPPH+HPRASEVT +LKG +LVGFVDTSN
Sbjct  98   FNVTLTNTRNLPGMNTQGLTMARIDIAANGLVPPHSHPRASEVTFLLKGNLLVGFVDTSN  157

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
            RLFTQQLR GDSFVFP+ LIHFL+N+ +  PAL VSGL+SQNPGAQL ++ATFAT P++ 
Sbjct  158  RLFTQQLREGDSFVFPRGLIHFLYNLQS-SPALCVSGLNSQNPGAQLAAIATFATNPSIL  216

Query  188  DEVLKKAFQINGIDVAKIRKNLGG  117
            ++VLKKAFQ++  DVA+IRKNLGG
Sbjct  217  NDVLKKAFQVSEKDVARIRKNLGG  240



>ref|XP_004146743.1| PREDICTED: germin-like protein subfamily 1 member 1-like [Cucumis 
sativus]
 gb|KGN47812.1| hypothetical protein Csa_6G404270 [Cucumis sativus]
Length=224

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGF  546
            E  +SDPDPLQD+CVAD K + + F NG+ CINP+LA   +F TSAL+ PGNTK N FGF
Sbjct  22   EFGRSDPDPLQDFCVADPKASTSSFFNGIPCINPNLATVDHFKTSALSLPGNTKSNRFGF  81

Query  545  NVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNR  366
            +VT TN   LPG+NT GLTLAR+DL P GLVP H+HPRASEVTI L G ++VGFVDTSNR
Sbjct  82   SVTVTNPQNLPGINTLGLTLARIDLDPRGLVPLHSHPRASEVTICLIGQMVVGFVDTSNR  141

Query  365  LFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPD  186
            +FT+++  G+SFVFPK L+HF++N D  K A+AVSGL+SQNPGAQL +LA F +KP +P+
Sbjct  142  VFTKKIGPGESFVFPKGLLHFMYNEDFKKSAVAVSGLNSQNPGAQLLALAVFTSKPEIPE  201

Query  185  EVLKKAFQINGIDVAKIRKNLGG  117
            EVLKK+FQI+  ++A IRK+LGG
Sbjct  202  EVLKKSFQISECEIAHIRKSLGG  224



>ref|XP_007044465.1| Germin-like protein subfamily 1 member 1 [Theobroma cacao]
 gb|EOY00297.1| Germin-like protein subfamily 1 member 1 [Theobroma cacao]
Length=218

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 162/200 (81%), Gaps = 4/200 (2%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNVT  537
            + DPDPLQD+CVAD K+    FLNG  C+NP LA++S+F TSAL KPGNTK N FG+NVT
Sbjct  22   EPDPDPLQDFCVADAKSP--FFLNGAPCLNPSLALSSHFTTSALTKPGNTKANPFGYNVT  79

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
               +A LPG+NT GLT++R DLAP GL P H+HPRASEVTI L+GA+LVGFVDTSNRLFT
Sbjct  80   YLTLANLPGINTMGLTMSRQDLAPNGLNPLHSHPRASEVTICLQGALLVGFVDTSNRLFT  139

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            QQL  GD+FVFP+ L+H+++N+D+ + ALA+SG SSQNPG Q+ S A F + P +PDEVL
Sbjct  140  QQLGPGDAFVFPRGLVHYVYNLDS-RNALAISGFSSQNPGTQIASRAAFVSNPLIPDEVL  198

Query  176  KKAFQINGIDVAKIRKNLGG  117
            +KAFQI+  DVAKIRKNLGG
Sbjct  199  EKAFQISKNDVAKIRKNLGG  218



>ref|XP_008456470.1| PREDICTED: germin-like protein subfamily 1 member 1 [Cucumis 
melo]
Length=222

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGF  546
            +  +SDPDPLQD+CVAD K + + F NG+ CINP+LA   +F TSAL+ PGNTK N FGF
Sbjct  20   DFARSDPDPLQDFCVADQKASTSSFFNGIPCINPNLATVDHFKTSALSLPGNTKSNRFGF  79

Query  545  NVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNR  366
            +VT TN   LPG+NT GLTLAR+DL P GLVP H+HPRASEVTI L G ++VGFVDTSNR
Sbjct  80   SVTLTNPQNLPGINTLGLTLARIDLDPRGLVPLHSHPRASEVTICLIGQMVVGFVDTSNR  139

Query  365  LFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPD  186
            +FT+++  G+SFVFPK L+HF++N D  K A+AVSGL+SQNPGAQL++LA F +KP +P 
Sbjct  140  VFTKKIGPGESFVFPKGLLHFMYNEDFKKSAVAVSGLNSQNPGAQLSALAAFTSKPEIPQ  199

Query  185  EVLKKAFQINGIDVAKIRKNLGG  117
            EVLKK+FQI+  ++A IRK+LGG
Sbjct  200  EVLKKSFQISECEIAHIRKSLGG  222



>ref|XP_009799046.1| PREDICTED: germin-like protein subfamily 1 member 1 [Nicotiana 
sylvestris]
Length=221

 Score =   268 bits (685),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 159/212 (75%), Gaps = 3/212 (1%)
 Frame = -1

Query  743  VCLSFVVELVKSDPDPLQDYCVADTKNT--KNLFLNGVACINPDLAVASNFATSALAKPG  570
            + L  V+ LV SDPDPLQDYCVADTK    +N + NGV CINPD    S+FATSAL+KPG
Sbjct  10   MSLLIVLGLVGSDPDPLQDYCVADTKKVTKENFYCNGVPCINPDHVETSHFATSALSKPG  69

Query  569  NTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLV  390
                 FGFNVT T +  LPG+NTQGLT+AR+D+    LVPPH+HPRASEV I++KG++LV
Sbjct  70   KISIMFGFNVTLTTIFNLPGLNTQGLTMARIDIDANSLVPPHSHPRASEVAILIKGSLLV  129

Query  389  GFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATF  210
            GF++TSN LFTQ ++ GD FVFPK LIHFL+N D+ + AL VSGLSSQNPG Q+ S A F
Sbjct  130  GFINTSNHLFTQNMQPGDCFVFPKGLIHFLYNTDSNEQALVVSGLSSQNPGVQMASPAAF  189

Query  209  ATKPAVPDEVLKKAFQINGI-DVAKIRKNLGG  117
             TK  +PDEV KK FQIN   D+ +IR NLGG
Sbjct  190  GTKQNMPDEVFKKVFQINNQEDITRIRTNLGG  221



>ref|XP_004162541.1| PREDICTED: germin-like protein subfamily 1 member 1-like [Cucumis 
sativus]
Length=224

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 162/200 (81%), Gaps = 1/200 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNVT  537
            +SDPDPLQD+CVAD K + + F NG+ CINP+LA   +F TSAL+ PGNTK N FGF+VT
Sbjct  25   RSDPDPLQDFCVADPKASTSSFFNGIPCINPNLATVDHFKTSALSLPGNTKSNRFGFSVT  84

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
             TN   LPG+NT GLTLAR+DL P GLVP H+HPRASEVTI L G ++VGFVDTSNR+FT
Sbjct  85   VTNPQNLPGINTLGLTLARIDLDPRGLVPLHSHPRASEVTICLIGQMVVGFVDTSNRVFT  144

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            +++  G+SFVFPK L+HF++N D  K A+AVSGL+SQNPGAQL +LA F +KP +P+EVL
Sbjct  145  KKIGPGESFVFPKGLLHFMYNEDFKKSAVAVSGLNSQNPGAQLLALAVFTSKPEIPEEVL  204

Query  176  KKAFQINGIDVAKIRKNLGG  117
            KK+FQI+  ++A IRK+LGG
Sbjct  205  KKSFQISECEIAHIRKSLGG  224



>ref|XP_006357214.1| PREDICTED: germin-like protein subfamily 1 member 1-like [Solanum 
tuberosum]
Length=220

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 154/199 (77%), Gaps = 1/199 (1%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKN-TKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            SDPDPLQDYCVADTK  T+  F NGV CINP     S+FATS L+K G     FGFNVT 
Sbjct  22   SDPDPLQDYCVADTKKGTRENFYNGVPCINPQNVDISHFATSTLSKAGKIGIVFGFNVTL  81

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
            T++  LPG+NTQGLT+AR+D+ P  LV PH+HPRASEV I+LKG++LVGF++TSN LFTQ
Sbjct  82   TSIFNLPGMNTQGLTMARIDIGPNSLVSPHSHPRASEVAILLKGSLLVGFINTSNHLFTQ  141

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
            +LR GDSFVFPK +IHFL+N D+   ALA+SGLSSQNPG Q+ S A FAT P +PDE+ K
Sbjct  142  KLRPGDSFVFPKGMIHFLYNTDSKVQALALSGLSSQNPGVQMASPAAFATGPTLPDEISK  201

Query  173  KAFQINGIDVAKIRKNLGG  117
            K FQIN  DV +IR +LGG
Sbjct  202  KLFQINDQDVTRIRTSLGG  220



>ref|XP_008339987.1| PREDICTED: germin-like protein subfamily 1 member 1 [Malus domestica]
Length=219

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            KSDPDPLQDYCVAD +  +   LNG  CI+P+LA++S+F TS L+KPG+TK   GFNVT 
Sbjct  22   KSDPDPLQDYCVADPETPQTFSLNGAPCIDPNLAISSHFTTSVLSKPGDTKAN-GFNVTJ  80

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
            TN   LPG+NT GLT+AR+D+   G+VPPH HPRASEVTI L G +LVGFVDTSNR+FTQ
Sbjct  81   TNPFNLPGLNTLGLTMARIDIDANGIVPPHLHPRASEVTICLTGFLLVGFVDTSNRVFTQ  140

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
            QLR G+SFVFPK L+HFL+N D+ +PA+A++GL SQNPGAQ+ S+A+F ++P+ P  +LK
Sbjct  141  QLRPGESFVFPKGLVHFLYNYDSEEPAVALAGLGSQNPGAQIVSMASFTSEPSNPVXILK  200

Query  173  KAFQINGIDVAKIRKNLGG  117
            K FQI+ ++ A IR+NLGG
Sbjct  201  KGFQISDLNAAWIRRNLGG  219



>gb|AFK38629.1| unknown [Lotus japonicus]
Length=213

 Score =   263 bits (672),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 153/186 (82%), Gaps = 2/186 (1%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
             + DPDPLQDYC+AD KNT   F+NGV CI+P  A +S+F TS+L+KPGNT N+FGF+VT
Sbjct  22   CRPDPDPLQDYCIADNKNT--FFINGVPCIDPKQASSSHFVTSSLSKPGNTTNSFGFSVT  79

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
            ATN   LPG+NT GL LARVD+A  G+VPPH+HPRASEV   LKG +LVGF DTSNR FT
Sbjct  80   ATNTVNLPGLNTLGLILARVDIAANGIVPPHSHPRASEVITCLKGLLLVGFTDTSNRAFT  139

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            Q L  G+SFVFPK LIH+++N D+ +PALA+SGL+SQNPGAQ+ SLATFA+KPA+PDE+L
Sbjct  140  QNLNPGESFVFPKGLIHYIYNRDSKQPALALSGLNSQNPGAQIASLATFASKPAIPDEIL  199

Query  176  KKAFQI  159
            K+ F++
Sbjct  200  KRLFKL  205



>ref|XP_004238732.1| PREDICTED: germin-like protein subfamily 1 member 1 isoform X1 
[Solanum lycopersicum]
Length=220

 Score =   263 bits (672),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 153/199 (77%), Gaps = 1/199 (1%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKN-TKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            SDPDPLQDYCVADTK  T+  F NGV CINP     S+FATSAL+K G     FGFNVT 
Sbjct  22   SDPDPLQDYCVADTKKATRENFYNGVPCINPQNVDISHFATSALSKAGKIGLVFGFNVTL  81

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
            T +  LPG+NTQGLT+AR+D+ P  LV PH+HPRASEV I+LKG++LVGF++TSN LFTQ
Sbjct  82   TTIFNLPGMNTQGLTMARIDIGPNSLVSPHSHPRASEVAILLKGSLLVGFINTSNHLFTQ  141

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L  GDSFVFPK +IHFL+N D+   ALA+SGLSSQNPG Q+ S A FAT+P +PDEV +
Sbjct  142  NLSPGDSFVFPKGMIHFLYNTDSKVQALALSGLSSQNPGLQMASPAAFATEPTLPDEVSQ  201

Query  173  KAFQINGIDVAKIRKNLGG  117
            K FQIN  DV KIR +LGG
Sbjct  202  KLFQINDQDVTKIRTSLGG  220



>ref|XP_008665879.1| PREDICTED: germin-like protein 3-1 [Zea mays]
 tpg|DAA43686.1| TPA: hypothetical protein ZEAMMB73_719904 [Zea mays]
Length=230

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 161/212 (76%), Gaps = 2/212 (1%)
 Frame = -1

Query  749  IIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPG  570
            IIV L     L + DPD L DYCVADT +++ L LNG+ACI+P  A A +FATSAL++  
Sbjct  18   IIVALFLSAALCRCDPDLLLDYCVADTSSSQ-LHLNGLACIDPASARAEHFATSALSRAS  76

Query  569  NTKNTFGFNVTATNVAV-LPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVL  393
             T+  +GF+VT T+ A  LPG N QGL +AR DLAPGGL PPHTHPRASEV +VL G+VL
Sbjct  77   ETETAYGFSVTVTSPASSLPGANAQGLAMARTDLAPGGLAPPHTHPRASEVALVLAGSVL  136

Query  392  VGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLAT  213
            VGF DTS RL+TQ LRAG++FV P+ ++HF++N+D   PA+ +SGL+SQ+PGAQL   + 
Sbjct  137  VGFADTSYRLYTQLLRAGEAFVVPRGMVHFMYNVDVAAPAVVLSGLNSQSPGAQLVPFSA  196

Query  212  FATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
            F T+P VPDEVLK AF+ING DV +I++NLGG
Sbjct  197  FRTEPRVPDEVLKMAFRINGQDVQRIQRNLGG  228



>ref|XP_002468403.1| hypothetical protein SORBIDRAFT_01g045270 [Sorghum bicolor]
 gb|EER95401.1| hypothetical protein SORBIDRAFT_01g045270 [Sorghum bicolor]
Length=241

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 161/222 (73%), Gaps = 11/222 (5%)
 Frame = -1

Query  749  IIVCLSFVVELVKSDPDPLQDYCVADTKN--TKNLFLNGVACINPDLAVASNFATSALAK  576
            I++ L     +  SDPD L DYCVADT    +    LNG+ACI+P  A A +FATSAL+ 
Sbjct  18   ILLSLFLFAAVCMSDPDLLLDYCVADTATPPSSQFHLNGLACIDPASARAEHFATSALSS  77

Query  575  PGNTKNT--------FGFNVTATNVAV-LPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            P  T++         FGFNVT T+ A  LPG N QGL +AR DLAPGGL PPHTHPRASE
Sbjct  78   PATTEHRSATATAALFGFNVTVTSPASSLPGANAQGLAMARTDLAPGGLAPPHTHPRASE  137

Query  422  VTIVLKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQN  243
            V +VL G+VLVGF DTS RL+TQ LRAG++FVFP+ ++HFL+NMD   PA+ +SGL+SQ+
Sbjct  138  VALVLAGSVLVGFADTSYRLYTQLLRAGEAFVFPRGMVHFLYNMDVAAPAVVLSGLNSQS  197

Query  242  PGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
            PGAQL   ++F T+P VPDEVLK AF+ING DV +I++NLGG
Sbjct  198  PGAQLVPFSSFRTEPPVPDEVLKIAFKINGQDVHRIQRNLGG  239



>ref|XP_009598940.1| PREDICTED: germin-like protein subfamily 1 member 1 [Nicotiana 
tomentosiformis]
Length=208

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 148/191 (77%), Gaps = 3/191 (2%)
 Frame = -1

Query  728  VVELVKSDPDPLQDYCVADTKNT--KNLFLNGVACINPDLAVASNFATSALAKPGNTKNT  555
            V+ LV SDPDPLQDYCVADTK    +N + NGV CINPD    S+FATSAL+KPG     
Sbjct  15   VLGLVGSDPDPLQDYCVADTKKATKENFYCNGVPCINPDHVETSHFATSALSKPGKISIM  74

Query  554  FGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT  375
            FGFNVT T +  LPG+NTQGLT+AR+D+    LVPPH+HPRASEV I+LKG++LVGF+DT
Sbjct  75   FGFNVTLTTILNLPGLNTQGLTMARIDIGANSLVPPHSHPRASEVAILLKGSLLVGFIDT  134

Query  374  SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPA  195
            SN LFTQ L+ GD FVFPK LIHFL+N D+ + ALAVSGLSSQNPG Q+ S A FATK  
Sbjct  135  SNHLFTQNLQPGDCFVFPKGLIHFLYNTDSNEQALAVSGLSSQNPGLQMASPAAFATKQN  194

Query  194  VPD-EVLKKAF  165
            +PD EVLKK F
Sbjct  195  MPDEEVLKKVF  205



>ref|XP_004985498.1| PREDICTED: germin-like protein 3-1-like [Setaria italica]
Length=228

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 157/202 (78%), Gaps = 3/202 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNT--FGFNV  540
            +SDPD L DYCVADT    +L LNG+ CI+P  A A +FATSAL++  N  +   FGFN 
Sbjct  27   ESDPDLLLDYCVADTAAAASLHLNGLPCIDPARARAEHFATSALSRATNPSSATPFGFNA  86

Query  539  TATN-VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRL  363
            T T+  A LPG N QGL +ARVDLAPGG+ PPH+HPRASEV +VL G+VLVGF DTS RL
Sbjct  87   TVTSPAASLPGANAQGLAMARVDLAPGGVAPPHSHPRASEVALVLAGSVLVGFADTSYRL  146

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
            +TQ LRAG++FVFP+ ++HF++N+D   PA+ +SGL+SQ+PGAQL  L+ F T+P +P+E
Sbjct  147  YTQLLRAGEAFVFPRGMVHFMYNVDVAAPAVVLSGLNSQSPGAQLVPLSAFRTEPRMPEE  206

Query  182  VLKKAFQINGIDVAKIRKNLGG  117
            +L+KAF+ING DV +I++NLGG
Sbjct  207  ILEKAFKINGQDVHRIQRNLGG  228



>ref|NP_563870.2| germin-like protein 7 [Arabidopsis thaliana]
 sp|P92998.2|GL11_ARATH RecName: Full=Germin-like protein subfamily 1 member 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD39567.1|AC007067_7 T10O24.7 [Arabidopsis thaliana]
 gb|AAD46923.1|AF170550_1 germin-like protein 7 [Arabidopsis thaliana]
 gb|ABK59678.1| At1g10460 [Arabidopsis thaliana]
 gb|AEE28582.1| germin-like protein 7 [Arabidopsis thaliana]
Length=217

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 155/202 (77%), Gaps = 2/202 (1%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNT-KNLFLNGVACINPDLAVASNFATSALAKPGNTKNT-FGFN  543
            VKSDPDPLQDYCV+   ++ + +FLNG  C +P  A  S+F+TSAL++PGNTK   F  N
Sbjct  16   VKSDPDPLQDYCVSPPPSSHQQIFLNGKLCKDPTQASVSDFSTSALSRPGNTKTKPFMIN  75

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRL  363
            VT T  A LPG+NT GLT+AR+D    G+VPPH HPRASEVT+ L G +LVGFVDTS R+
Sbjct  76   VTVTTTANLPGLNTVGLTMARLDFGGSGVVPPHVHPRASEVTVCLDGVLLVGFVDTSGRV  135

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
            FTQ+L  G++FVFPK LIHFL+N+DT+  ALAVSGLSSQNPG Q+ SL++F +KP    E
Sbjct  136  FTQELHPGETFVFPKGLIHFLYNIDTVSSALAVSGLSSQNPGTQIVSLSSFISKPPFLVE  195

Query  182  VLKKAFQINGIDVAKIRKNLGG  117
            VLK A+ ING DVA+IRK+L G
Sbjct  196  VLKSAYDINGQDVARIRKSLEG  217



>sp|Q8H021.1|GL31_ORYSJ RecName: Full=Germin-like protein 3-1; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|AAO13469.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF94290.1| Cupin family protein, expressed [Oryza sativa Japonica Group]
 gb|EAZ25801.1| hypothetical protein OsJ_09643 [Oryza sativa Japonica Group]
Length=225

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 161/216 (75%), Gaps = 5/216 (2%)
 Frame = -1

Query  749  IIVCLSFVVELVKSDPDPLQDYCVADTKNTKN---LFLNGVACINPDLAVASNFATSALA  579
            I++ L+    L + DPD L DYCVADT          LNG+ACI+P LA A +FATSAL+
Sbjct  9    ILLSLALFAVLCRCDPDLLFDYCVADTAAATAAGAFHLNGLACIDPALARADHFATSALS  68

Query  578  KPGNTKNT-FGFNVTATN-VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLK  405
            +  N   T +GFN T T+  A LPG N QGL +AR+DLAPGG+ PPH+HPRASE  +VL 
Sbjct  69   RATNPAATLYGFNATLTSPAASLPGANAQGLAMARIDLAPGGMAPPHSHPRASEAALVLS  128

Query  404  GAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLT  225
            G+VLVGF DTS RL+TQ LRAG++FVFP+A++HFL+NMDT  PA+ +SGL+SQ+PGAQL 
Sbjct  129  GSVLVGFADTSYRLYTQLLRAGEAFVFPRAMVHFLYNMDTAAPAVVLSGLNSQSPGAQLV  188

Query  224  SLATFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
              + F T+P +PDEVLKKAF+I G DV +I+K+LGG
Sbjct  189  PFSAFRTEPRLPDEVLKKAFKITGQDVQRIQKHLGG  224



>ref|XP_008786884.1| PREDICTED: germin-like protein 3-1 [Phoenix dactylifera]
Length=224

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 153/199 (77%), Gaps = 2/199 (1%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNT-KNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNVTA  534
            DPD L DYCVADT    ++L LNG+ C++P LA  S+FATS L+KPGNT  N FGFNVT 
Sbjct  26   DPDLLLDYCVADTSPAGRSLHLNGLPCLDPALARPSHFATSILSKPGNTAANPFGFNVTL  85

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
            T  A LPG N QGL LAR+DLA GGLVPPH HPRASEV ++L G +LVGFVDTS RLFTQ
Sbjct  86   TTAAALPGANAQGLALARIDLAAGGLVPPHAHPRASEVALLLHGDLLVGFVDTSYRLFTQ  145

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
            +LR GD+FVFP+ L+HFL N++   PA AVSGL+SQNPG Q+  LA F + P +P EVL+
Sbjct  146  RLRPGDAFVFPRGLVHFLHNLNPAAPAAAVSGLNSQNPGVQMIPLAAFRSDPGIPQEVLE  205

Query  173  KAFQINGIDVAKIRKNLGG  117
            K F+I+G D+ +I+KNLGG
Sbjct  206  KTFKISGQDIRRIQKNLGG  224



>gb|ABK26250.1| unknown [Picea sitchensis]
Length=226

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 147/199 (74%), Gaps = 4/199 (2%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNVTA  534
            SDPDPLQD+CVADT +T   FLNG  CINP    AS F T AL  PGNT  N FGFNVT 
Sbjct  30   SDPDPLQDFCVADTNSTS--FLNGFPCINPSTVNASQFKTPALGVPGNTSANPFGFNVTL  87

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
            T V  LPG+NTQGL LAR D A GGLVPPH HPRASE+  V+KG VLVGFVDTSN+LFTQ
Sbjct  88   TTVQNLPGLNTQGLALARTDFAKGGLVPPHIHPRASEIAFVVKGVVLVGFVDTSNKLFTQ  147

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L+AGD FVFP+A +HFL N+     A+ +SGL+SQ+PGAQ+  LA F + P +P  VL+
Sbjct  148  NLKAGDVFVFPRAQLHFLLNLGNST-AITISGLNSQSPGAQIVPLAAFGSNPEIPPAVLE  206

Query  173  KAFQINGIDVAKIRKNLGG  117
            KAFQI+  +V KIRKNL G
Sbjct  207  KAFQISSEEVKKIRKNLIG  225



>gb|EAY88774.1| hypothetical protein OsI_10250 [Oryza sativa Indica Group]
Length=225

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 155/204 (76%), Gaps = 5/204 (2%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKN---LFLNGVACINPDLAVASNFATSALAKPGNTKNT-FGF  546
            + DPD L DYCVADT          LNG+ACI+P LA A +FATSAL++  N   T +GF
Sbjct  21   RCDPDLLFDYCVADTAAATAAGAFHLNGLACIDPALARADHFATSALSRATNPAATLYGF  80

Query  545  NVTATN-VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSN  369
            N T T+  A LPG N QGL +AR+DLAPGG+ PPH+HPRASE  +VL G+VLVGF DTS 
Sbjct  81   NATLTSPAASLPGANAQGLAMARIDLAPGGMAPPHSHPRASEAALVLSGSVLVGFADTSY  140

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
            RL+TQ LRAG++FVFP+A++HFL+NMDT  PA+ +SGL+SQ+PGAQL   + F T+P +P
Sbjct  141  RLYTQLLRAGEAFVFPRAMVHFLYNMDTAAPAVVLSGLNSQSPGAQLVPFSAFRTEPRLP  200

Query  188  DEVLKKAFQINGIDVAKIRKNLGG  117
            DEVLKKAF+I G DV +I+K+LGG
Sbjct  201  DEVLKKAFKITGQDVQRIQKHLGG  224



>ref|XP_010491268.1| PREDICTED: germin-like protein subfamily 1 member 1 [Camelina 
sativa]
Length=208

 Score =   242 bits (618),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 144/193 (75%), Gaps = 1/193 (1%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNV  540
            VKSDPD LQDYCV+     + +FLNGV C +P  A  S+F TSAL++PGNT+   F  NV
Sbjct  16   VKSDPDSLQDYCVSPPSTHQQIFLNGVLCKDPTQATVSDFKTSALSRPGNTQVKPFMINV  75

Query  539  TATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLF  360
            T T  A LPG+NT GLT+AR+D    G+VP H HPRASEVT+ L G +LVGFVDTS R+F
Sbjct  76   TVTTTANLPGINTMGLTMARLDFGASGIVPLHVHPRASEVTVCLDGVLLVGFVDTSGRVF  135

Query  359  TQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEV  180
            TQ+L  G++FVFPK LIHFL+N+DT+  ALAVSGLSSQNPG Q+ SL++F +K  +P EV
Sbjct  136  TQELHPGETFVFPKGLIHFLYNIDTVSSALAVSGLSSQNPGTQIVSLSSFISKSPIPKEV  195

Query  179  LKKAFQINGIDVA  141
            LK A+ ING DV 
Sbjct  196  LKSAYDINGQDVC  208



>ref|XP_009408777.1| PREDICTED: germin-like protein 3-1 [Musa acuminata subsp. malaccensis]
Length=238

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 149/201 (74%), Gaps = 3/201 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNT--FGFNV  540
            + DPD L DYCVAD    +   LNG  CI+P LA +++FATSAL++P     T  FGF+V
Sbjct  39   RPDPDLLLDYCVADVA-AQTFHLNGRPCIDPTLARSAHFATSALSQPNGAAATALFGFSV  97

Query  539  TATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLF  360
            T TN   LPG N QGL +ARVD+  GGLVPPH HPRASE  ++L+G +LVGFVDTS+RL+
Sbjct  98   TTTNATTLPGANAQGLAMARVDIVGGGLVPPHAHPRASEAALLLRGTLLVGFVDTSHRLY  157

Query  359  TQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEV  180
            TQQLR GD+F+F + L+HFL+N+D   PA+ +SG +SQNPGAQL S   F + P  P+EV
Sbjct  158  TQQLRPGDTFLFSRGLVHFLYNLDPTTPAVVLSGFNSQNPGAQLASTTLFRSDPRFPEEV  217

Query  179  LKKAFQINGIDVAKIRKNLGG  117
            LKKAF+I+G DV +I++NLGG
Sbjct  218  LKKAFKISGQDVQRIQRNLGG  238



>dbj|BAK02988.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89106.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=233

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 155/215 (72%), Gaps = 5/215 (2%)
 Frame = -1

Query  746  IVCLSFVVELVKSDPDPLQDYCVADTKNTK---NLFLNGVACINPDLAVASNFATSALAK  576
            +V + F   +  SDPD L DYCVADT+      +   NG+ CI+P  A A +FATSAL+ 
Sbjct  18   LVTIIFFSAVCDSDPDLLVDYCVADTRAAAGALDFHFNGLPCIDPATARAGHFATSALSA  77

Query  575  PGNTKNT-FGFNVTATN-VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
            P +   T FGFN T T+  A LPG N QGL +ARVDLAPGG+ P H+HPRASEV +VL G
Sbjct  78   PTDPSATLFGFNATVTSPAASLPGANAQGLAMARVDLAPGGMAPLHSHPRASEVALVLSG  137

Query  401  AVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTS  222
             VLVGF DTS RL+TQ+LRAG++FVFP+ ++HF+ N DT  PA+ +SGL+SQ+PGAQL  
Sbjct  138  GVLVGFADTSYRLYTQRLRAGEAFVFPRGMVHFMRNEDTSSPAVVLSGLNSQSPGAQLLP  197

Query  221  LATFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
             + F T+P +PDEV+KK F+I G DV +I+++LGG
Sbjct  198  FSAFRTEPRLPDEVVKKTFRITGQDVQRIQRSLGG  232



>ref|XP_010937018.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein 3-1 [Elaeis 
guineensis]
Length=237

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 151/197 (77%), Gaps = 3/197 (2%)
 Frame = -1

Query  701  DPLQDYCVADTKNT-KNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNVTATN  528
            D L DYCVADT    ++L LNG+ C++P LA  S+FATS L+ PGNT  N  GFNVT T 
Sbjct  36   DLLVDYCVADTSPAGQSLHLNGLPCLDPALARPSHFATSILSMPGNTAANPLGFNVTLTT  95

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQL  348
             A LPG N QGL+LARVDLA GGLVPPH HPRASEV ++L G +LVGFVDTS R FTQ+L
Sbjct  96   AAALPGANAQGLSLARVDLAGGGLVPPHAHPRASEVALLLHGDLLVGFVDTSYRFFTQRL  155

Query  347  RAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKKA  168
            R GD+FVFP+ L+HFL+N++ + PA+AVSGL+SQNPG Q+  LA F + P +P EVLKK 
Sbjct  156  RPGDAFVFPRGLVHFLYNLNPVAPAVAVSGLNSQNPGVQMMPLAAFRSDPRIP-EVLKKT  214

Query  167  FQINGIDVAKIRKNLGG  117
            F+I+  D+ +I+KNLGG
Sbjct  215  FKISAQDMHRIQKNLGG  231



>ref|XP_007223443.1| hypothetical protein PRUPE_ppa011533mg [Prunus persica]
 gb|EMJ24642.1| hypothetical protein PRUPE_ppa011533mg [Prunus persica]
Length=207

 Score =   239 bits (611),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = -1

Query  623  PDLAVASNFATSALAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPP  447
            P LA +S+F TS L+KPGN K N FGFN T TN   LPGVNT GLT+ARVD+A  G+VPP
Sbjct  38   PRLAASSHFTTSVLSKPGNPKANPFGFNATLTNTLNLPGVNTLGLTMARVDIAANGIVPP  97

Query  446  HTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALA  267
            H HPRASEV I LKG +LVGFVDTSNR+FTQQL+ G+SFVFPKAL+HFL+N D+  PA+A
Sbjct  98   HLHPRASEVAICLKGLLLVGFVDTSNRVFTQQLKPGESFVFPKALVHFLYNYDSANPAVA  157

Query  266  VSGLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
            ++G SSQNPG ++ SLATF +KP++P E+LKKAFQ++ +DVA++RKNLGG
Sbjct  158  LAGFSSQNPGVEIVSLATFTSKPSIPVEILKKAFQVSDLDVARMRKNLGG  207



>ref|XP_002892572.1| hypothetical protein ARALYDRAFT_888315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68831.1| hypothetical protein ARALYDRAFT_888315 [Arabidopsis lyrata subsp. 
lyrata]
Length=205

 Score =   239 bits (609),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 152/200 (76%), Gaps = 2/200 (1%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNT-KNLFLNGVACINPDLAVASNFATSALAKPGNTKNT-FGFN  543
            VKSDPDPLQDYCV+   ++ + +FLNGV C +P  A  S+F TSAL++PGNT+      N
Sbjct  4    VKSDPDPLQDYCVSPCHSSHQQIFLNGVLCKDPTEATVSDFTTSALSRPGNTQTKPLMTN  63

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRL  363
            VT T  A LPG+NT GLT+AR+D    G+VPPH HPRASEVT+ L G +LVGFVDTS R+
Sbjct  64   VTVTTTANLPGLNTMGLTMARLDFGGSGVVPPHVHPRASEVTVCLDGVLLVGFVDTSGRV  123

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
            FTQ+L  G++FVFPK LIHFL+N+DT+  ALAVSGL+SQNPG Q+ SL++F  KP    E
Sbjct  124  FTQELHPGETFVFPKGLIHFLYNIDTVSSALAVSGLNSQNPGTQIVSLSSFIPKPPFLQE  183

Query  182  VLKKAFQINGIDVAKIRKNL  123
            VLK AF ING DVA+IRK+L
Sbjct  184  VLKSAFDINGQDVARIRKSL  203



>ref|XP_010320636.1| PREDICTED: germin-like protein subfamily 1 member 1 isoform X2 
[Solanum lycopersicum]
Length=191

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 142/199 (71%), Gaps = 21/199 (11%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKN-TKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            SDPDPLQDYCVADTK  T+  F NGV CINP     S+FATSAL+K G            
Sbjct  13   SDPDPLQDYCVADTKKATRENFYNGVPCINPQNVDISHFATSALSKAG------------  60

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
                    +NTQGLT+AR+D+ P  LV PH+HPRASEV I+LKG++LVGF++TSN LFTQ
Sbjct  61   --------MNTQGLTMARIDIGPNSLVSPHSHPRASEVAILLKGSLLVGFINTSNHLFTQ  112

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L  GDSFVFPK +IHFL+N D+   ALA+SGLSSQNPG Q+ S A FAT+P +PDEV +
Sbjct  113  NLSPGDSFVFPKGMIHFLYNTDSKVQALALSGLSSQNPGLQMASPAAFATEPTLPDEVSQ  172

Query  173  KAFQINGIDVAKIRKNLGG  117
            K FQIN  DV KIR +LGG
Sbjct  173  KLFQINDQDVTKIRTSLGG  191



>ref|XP_010458392.1| PREDICTED: germin-like protein subfamily 1 member 1 [Camelina 
sativa]
Length=209

 Score =   232 bits (591),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = -1

Query  716  VKSDPDPLQDYCV-ADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFN  543
            VKSDPD LQDYCV     + + +F+NGV C +P  A  S+F TSAL++PGNT    F  N
Sbjct  16   VKSDPDSLQDYCVFLPPLSHQQIFINGVLCKDPTQATVSDFKTSALSRPGNTHVKPFMIN  75

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRL  363
            VT T  A LPG+NT GLT+AR+D    G VPPH HPRASEVT+ L G +LVGFVDTS R+
Sbjct  76   VTVTTTANLPGLNTMGLTMARLDFGASGTVPPHVHPRASEVTVCLDGVLLVGFVDTSGRV  135

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
            FTQ+L  G++FVFPK LIHFL+N+DT+  ALAVSGLSSQNPG Q+ SL++F  K  +P+E
Sbjct  136  FTQELHPGETFVFPKGLIHFLYNIDTVCSALAVSGLSSQNPGTQIVSLSSFIPKSPIPEE  195

Query  182  VLKKAFQINGIDVA  141
            VLK A+ ING  V 
Sbjct  196  VLKSAYDINGHKVC  209



>ref|XP_009118253.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 1 [Brassica rapa]
Length=219

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 148/204 (73%), Gaps = 4/204 (2%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKN-TKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFN  543
            V SDPDPLQDYCV+   +  +++FLNG  C +P     S+F TSAL+KPG+T+ N F  N
Sbjct  16   VSSDPDPLQDYCVSPPLSPHQHIFLNGNLCKDPTKVTVSHFTTSALSKPGDTRANPFMTN  75

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRL  363
            VT +  A LPG+NT GLT+ R+D    G+VPPH HPRASEVT+ L G +LVGFVDTS R+
Sbjct  76   VTLSTTANLPGLNTMGLTMGRIDFGASGVVPPHVHPRASEVTVCLDGVLLVGFVDTSGRV  135

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
            F Q+L  G++FVFPK LIHFL+N+DT+  ALAVSGL+SQNPG Q  S+ +  +K  +P +
Sbjct  136  FXQELHPGETFVFPKGLIHFLYNIDTVSSALAVSGLTSQNPGTQFVSMVSLDSKLQIPQD  195

Query  182  VLKKAFQINGID--VAKIRKNLGG  117
            VLK+ + IN  +  VA IRKNLGG
Sbjct  196  VLKRLYHINDQEGYVASIRKNLGG  219



>ref|XP_010475908.1| PREDICTED: germin-like protein subfamily 1 member 1 [Camelina 
sativa]
Length=203

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKN-TKNLFLNGVACINPDLAVASNFATSA  585
            +L  +++  +F++  VKSDPD LQDYCV+   +  + +FLNGV C +P  A  S+F TSA
Sbjct  1    MLFNLLLTFTFLMVGVKSDPDSLQDYCVSPPPSPHQQIFLNGVLCKDPTQATVSDFKTSA  60

Query  584  LAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVL  408
            L++ GNT+   F  NVT T  A LPG+NT GLT+AR+D    G+VPPH HPRASEVT+ L
Sbjct  61   LSRRGNTQVKPFMINVTVTTTANLPGLNTMGLTMARLDFGASGIVPPHMHPRASEVTVCL  120

Query  407  KGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQL  228
             G +LVGFVDTS R+FTQ+L  G++FVFPK L+HFL+N+DT+  ALAVSGLSSQNPG Q+
Sbjct  121  DGVLLVGFVDTSGRVFTQELHPGETFVFPKGLVHFLYNIDTVSSALAVSGLSSQNPGTQI  180

Query  227  TSLATFATKPAVPDEVLKKAFQ  162
             SL++F +K  +P+EVLK A +
Sbjct  181  VSLSSFISKSPIPEEVLKSALR  202



>gb|AAC99473.1| germin-like protein [Pinus caribaea]
Length=220

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 146/205 (71%), Gaps = 4/205 (2%)
 Frame = -1

Query  728  VVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGN-TKNTF  552
            V+  V +DP+ LQD+CVADTK+T  +F+NG  C+NP  A   +F TSAL KPGN + N  
Sbjct  18   VMNSVHADPEALQDFCVADTKST--IFMNGRPCLNPMEASPEHFITSALRKPGNLSANPL  75

Query  551  GFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS  372
            GF+V  T  A +PG+NT GL++ R+D+APG  +PPH HPR SE   V++GA+ VGFVDTS
Sbjct  76   GFSVIVTTPANMPGLNTLGLSMGRIDMAPGSAIPPHIHPRGSETIFVVRGALNVGFVDTS  135

Query  371  NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAV  192
            NRLF+ +L AGD F+FPK  +H+L N   +  A  VS  +SQNPG  + S+ATFA+ PA+
Sbjct  136  NRLFSHKLVAGDVFIFPKGTVHYLQNTGKIT-AFTVSAFNSQNPGTVIVSMATFASTPAI  194

Query  191  PDEVLKKAFQINGIDVAKIRKNLGG  117
            P EVL KAF I+  +V++IRK+ GG
Sbjct  195  PYEVLSKAFAISVQEVSQIRKSFGG  219



>gb|AAT09853.1| germin-like protein [Pinus taeda]
Length=228

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 146/206 (71%), Gaps = 4/206 (2%)
 Frame = -1

Query  731  FVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGN-TKNT  555
             V+  V +DP+ LQD CVADTK++  +F+NG  C+NP  A   +F TSAL KPGN + N 
Sbjct  25   MVINSVHADPEALQDLCVADTKSS--IFMNGSPCLNPMEASPEHFMTSALRKPGNLSDNP  82

Query  554  FGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT  375
             GF+V  T  A LPG+NT GL++ R+D+APG  +PPH HPR SE   V++GA+ VGFVDT
Sbjct  83   LGFSVIVTTPANLPGLNTLGLSMGRIDMAPGSAIPPHIHPRGSETVFVVRGALNVGFVDT  142

Query  374  SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPA  195
            SNRLF+ +L  GD FVFPK  +H+L N+  +  A  VS  +SQNPG  + SLATFA+ PA
Sbjct  143  SNRLFSHKLVTGDVFVFPKGAVHYLQNIGKIT-AFIVSAFNSQNPGTVIVSLATFASTPA  201

Query  194  VPDEVLKKAFQINGIDVAKIRKNLGG  117
            +P EVL KAF I+  +V++IRK+LGG
Sbjct  202  IPYEVLSKAFVISVQEVSQIRKSLGG  227



>gb|AAL79929.1| germin-like protein [Pinus sylvestris]
Length=220

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 150/213 (70%), Gaps = 4/213 (2%)
 Frame = -1

Query  752  AIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKP  573
             I++    V+  V +DP+ LQD+CVADTK+T  +FLNG  C+NP  A   +F TSAL KP
Sbjct  10   GILLVSLMVMNSVHADPEALQDFCVADTKST--IFLNGRPCLNPMEASPEHFMTSALRKP  67

Query  572  GN-TKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            GN + N  GF+V  T  A +PG+NT GL++ R+D+APG  +PPH HPR SE   V++GA+
Sbjct  68   GNLSANPLGFSVIVTTPANMPGLNTLGLSMGRIDMAPGSAIPPHIHPRGSETIFVVRGAL  127

Query  395  LVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLA  216
             VGFVDTS+RLF+ +L AGD FVFPK  +H+L N   +  A  VS  +SQNPG  + S+A
Sbjct  128  NVGFVDTSSRLFSHKLVAGDVFVFPKGTVHYLQNTGKIT-AFIVSAFNSQNPGTVIVSMA  186

Query  215  TFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
            TFA+ PA+P EVL KAF I+  ++++IRK+LGG
Sbjct  187  TFASTPAIPYEVLSKAFAISVQELSQIRKSLGG  219



>gb|AAC05146.1| germin-like protein [Pinus radiata]
Length=228

 Score =   217 bits (552),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 146/205 (71%), Gaps = 4/205 (2%)
 Frame = -1

Query  728  VVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGN-TKNTF  552
            V+  V +DP+ LQD+CVADTK++  +F+NG  C+NP  A   +F TSAL K GN + N  
Sbjct  26   VMNSVHADPEALQDFCVADTKSS--IFMNGRPCLNPMEASPEHFMTSALRKAGNLSANPL  83

Query  551  GFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS  372
            GF+V  T  A +PG+NT GL++ R+D+APG  +PPH HPR SE   V++GA+ VGFVDTS
Sbjct  84   GFSVIVTTPANMPGLNTLGLSMGRIDMAPGSAIPPHIHPRGSETIFVVRGALNVGFVDTS  143

Query  371  NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAV  192
            NRLF+ +L  GD FVFPK  +H+L N+  +  A  VS  +SQNPG  + SLATFA+ PA+
Sbjct  144  NRLFSHKLVTGDVFVFPKGAVHYLQNIGKIT-AFIVSAFNSQNPGTAIVSLATFASTPAI  202

Query  191  PDEVLKKAFQINGIDVAKIRKNLGG  117
            P EVL KAF I+  +V++IRK+LGG
Sbjct  203  PYEVLSKAFAISVQEVSQIRKSLGG  227



>gb|AAY57280.1| germin-like protein [Larix x marschlinsii]
Length=220

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 145/205 (71%), Gaps = 4/205 (2%)
 Frame = -1

Query  728  VVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGN-TKNTF  552
            V+  V +DP+ LQD+CVADTK+T  +F+NG  C+NP  A   +F TSAL KPGN + N  
Sbjct  18   VMNSVHADPEALQDFCVADTKST--IFMNGGPCLNPMEASPEHFITSALRKPGNLSANPL  75

Query  551  GFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS  372
            GF+V  T  A +PG+NT GL++ R+D+APG  +PPH HPR SE   V++GA+ VGFVD S
Sbjct  76   GFSVIVTTPANMPGLNTLGLSMGRIDMAPGSAIPPHIHPRGSETIFVVRGALNVGFVDAS  135

Query  371  NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAV  192
            +RLF+ +L AGD FV PK  +H+L N   +  A  VS  +SQNPG  + S+ATFA+ PA+
Sbjct  136  SRLFSHKLVAGDVFVLPKGTVHYLQNTGKIT-AFIVSAFNSQNPGTVIVSMATFASTPAI  194

Query  191  PDEVLKKAFQINGIDVAKIRKNLGG  117
            P EVL KAF I+  ++++IRK+LGG
Sbjct  195  PYEVLSKAFAISVQELSQIRKSLGG  219



>gb|KCW86768.1| hypothetical protein EUGRSUZ_B03378 [Eucalyptus grandis]
Length=171

 Score =   197 bits (500),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 125/167 (75%), Gaps = 2/167 (1%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            +++ P  L+ ++V L+ ++   ++DPDPLQDYC+AD +N     +NG  CINP+LA  S+
Sbjct  4    IKVTPSPLRTLVV-LALILSHARADPDPLQDYCIADMRNQSPYSVNGAPCINPNLASISH  62

Query  599  FATSALAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            F TSAL++ GNTK N FGFNVT TN A LPG+NT GLT+AR+D+A  GLVPPH+HPRASE
Sbjct  63   FTTSALSRRGNTKANQFGFNVTLTNTANLPGLNTMGLTMARIDMAGNGLVPPHSHPRASE  122

Query  422  VTIVLKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTM  282
            VTI L+G + VGFVDTS RLFTQ LR G+SFVFPK       +++TM
Sbjct  123  VTICLEGVIGVGFVDTSYRLFTQILRPGESFVFPKDCFSCCVHVETM  169



>ref|XP_010251869.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Nelumbo 
nucifera]
Length=222

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 134/201 (67%), Gaps = 3/201 (1%)
 Frame = -1

Query  752  AIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKP  573
            A++V L+   + + SDP PLQD+CVA       +F+NG  C NP+   A +F  S L KP
Sbjct  7    AVLVLLAJCSQALASDPSPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKP  66

Query  572  GNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVL  393
            GNT N  G  VT  NV  LPG+NT G++L R+D AP GL PPHTHPRA+EV +VL+G + 
Sbjct  67   GNTSNPVGSKVTPVNVMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLY  126

Query  392  VGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSL  219
            VGFV ++  NRLFT+ L  GD FVFP+ LIHF FN+     A+A +GLSSQNPG    + 
Sbjct  127  VGFVTSNPDNRLFTKVLNKGDVFVFPEGLIHFQFNVGHTN-AVAFAGLSSQNPGTITIAN  185

Query  218  ATFATKPAVPDEVLKKAFQIN  156
            A F +KP + D+VL KAFQ++
Sbjct  186  AVFGSKPPIKDDVLAKAFQVD  206



>ref|XP_010251871.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 133/201 (66%), Gaps = 3/201 (1%)
 Frame = -1

Query  752  AIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKP  573
            A++V L+   + + SDP PLQD+CVA       +F+NG  C NP+   A +F  S L KP
Sbjct  7    AVLVLLAJCSQALASDPSPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKP  66

Query  572  GNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVL  393
            GNT N  G  VT  NV  LPG+NT G++L R+D AP GL PPHTHPRA+EV +VL+G + 
Sbjct  67   GNTSNPVGSKVTPVNVMQLPGLNTLGVSLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLY  126

Query  392  VGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSL  219
            VGFV +   NRLFT+ L  GD FVFP+ LIHF FN+     A+A +GLSSQNPG    + 
Sbjct  127  VGFVTSNPENRLFTKVLNKGDVFVFPEGLIHFQFNVGHTN-AVAFAGLSSQNPGTITIAN  185

Query  218  ATFATKPAVPDEVLKKAFQIN  156
            A F +KP + D+VL KAFQ++
Sbjct  186  AVFGSKPPIKDDVLAKAFQVD  206



>gb|AAB51580.1| germin-like protein, partial [Arabidopsis thaliana]
Length=147

 Score =   194 bits (492),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -1

Query  554  FGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT  375
            F  NVT T  A LPG+NT GLT+AR+D    G+VPPH HPRASEVT+ L G +LVGFVDT
Sbjct  2    FMINVTVTTTANLPGLNTVGLTMARLDFGGSGVVPPHVHPRASEVTVCLDGVLLVGFVDT  61

Query  374  SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPA  195
            S R+FTQ+L  G++FVFPK LIHFL+N+DT+  ALAVSGLSSQNPG Q+ SL++F +KP 
Sbjct  62   SGRVFTQELHPGETFVFPKGLIHFLYNIDTVSSALAVSGLSSQNPGTQIVSLSSFISKPP  121

Query  194  VPDEVLKKAFQINGIDVAKIRKNLGG  117
               EVLK A+ ING DVA+IRK+L G
Sbjct  122  FLVEVLKSAYDINGQDVARIRKSLEG  147



>ref|XP_010251870.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Nelumbo 
nucifera]
Length=222

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 132/201 (66%), Gaps = 3/201 (1%)
 Frame = -1

Query  752  AIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKP  573
            A +  L+   + + SDP PLQD+CVA       +F+NG  C NP+   A +F  S L KP
Sbjct  7    AFLAILALCSQALASDPSPLQDFCVAINDTESPVFVNGKFCKNPNYTTADDFFFSGLDKP  66

Query  572  GNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVL  393
            GNT N  G  VT  NV  LPG+NT G++L R+D AP GL PPHTHPRA+EV +VL+G + 
Sbjct  67   GNTSNPVGSKVTPVNVMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLY  126

Query  392  VGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSL  219
            VGFV ++  NRLFT+ L  GD FVFP+ LIHF FN+     A+A +GLSSQNPG    + 
Sbjct  127  VGFVTSNPDNRLFTKVLNKGDVFVFPEGLIHFQFNVGHTN-AVAFAGLSSQNPGTITIAN  185

Query  218  ATFATKPAVPDEVLKKAFQIN  156
            A F +KP + D+VL KAFQ++
Sbjct  186  AVFGSKPPIKDDVLAKAFQVD  206



>ref|XP_004155681.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 7-like [Cucumis sativus]
Length=223

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 135/198 (68%), Gaps = 3/198 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD+CVA       +FLNG  C +P  AV ++F    L  PGNT+N  G NVT  N
Sbjct  22   DPSPLQDFCVAINDARSPVFLNGKFCKDPKYAVVNDFXFQGLNIPGNTENPNGSNVTLVN  81

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
            V  LPG+NT G++LAR+D AP GL PPHTHPRA+E+ +V++G++LVGFV ++  N+LF++
Sbjct  82   VDKLPGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVMEGSLLVGFVTSNPDNKLFSK  141

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L  GD FVFP  LIHF FN+    PALA +GL SQNPG    + A F +KP +P +VL+
Sbjct  142  VLYKGDVFVFPVGLIHFQFNVGR-TPALAFAGLGSQNPGVITIANAVFGSKPLIPVDVLE  200

Query  173  KAFQINGIDVAKIRKNLG  120
            KAFQ++   VA +++  G
Sbjct  201  KAFQLDANIVAYLQRRFG  218



>ref|XP_004142551.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Cucumis 
sativus]
 gb|KGN66717.1| hypothetical protein Csa_1G662810 [Cucumis sativus]
Length=223

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 135/198 (68%), Gaps = 3/198 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD+CVA       +FLNG  C +P  AV ++F    L  PGNT+N  G NVT  N
Sbjct  22   DPSPLQDFCVAINDARSPVFLNGKFCKDPKYAVVNDFLFQGLNIPGNTENPNGSNVTLVN  81

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
            V  LPG+NT G++LAR+D AP GL PPHTHPRA+E+ +V++G++LVGFV ++  N+LF++
Sbjct  82   VDKLPGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVMEGSLLVGFVTSNPDNKLFSK  141

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L  GD FVFP  LIHF FN+    PALA +GL SQNPG    + A F +KP +P +VL+
Sbjct  142  VLYKGDVFVFPVGLIHFQFNVGR-TPALAFAGLGSQNPGVITIANAVFGSKPLIPVDVLE  200

Query  173  KAFQINGIDVAKIRKNLG  120
            KAFQ++   VA +++  G
Sbjct  201  KAFQLDANIVAYLQRRFG  218



>ref|XP_009414512.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=217

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 135/194 (70%), Gaps = 5/194 (3%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP  LQD+CVAD  NT ++F+NG+AC +P L    +F  S L KP NT N  G NVT  N
Sbjct  24   DPSALQDFCVAD--NTSDVFVNGLACKDPKLVKVEDFFFSGLDKPRNTTNKVGSNVTLVN  81

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
            V  +PG+NT G+++ARVD AP GL PPH HPRA+E+  VL+G++ VGFV ++  N+LFT+
Sbjct  82   VNRIPGLNTLGISMARVDFAPYGLNPPHIHPRATEILTVLEGSLYVGFVTSNPDNKLFTK  141

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L  GD FVFP+ LIHF FN  T K A+A++ LSSQNPG    + A F +KPA+ D+VL 
Sbjct  142  MLTKGDVFVFPQGLIHFQFNHGT-KNAVALAALSSQNPGLITIANAVFGSKPAISDDVLA  200

Query  173  KAFQINGIDVAKIR  132
            KAFQ++   V +I+
Sbjct  201  KAFQVDEKTVHRIQ  214



>ref|XP_009396913.1| PREDICTED: germin-like protein 3-8 [Musa acuminata subsp. malaccensis]
Length=219

 Score =   193 bits (491),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 143/221 (65%), Gaps = 6/221 (3%)
 Frame = -1

Query  785  SKMRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVA  606
            S    +PFLL    +  + ++ L+++DPDPLQD+CVAD   T  + +NG  C       +
Sbjct  3    SHYTKRPFLL---FLSFTVLLVLIRADPDPLQDFCVADLGAT--VVVNGFPCKPASGVTS  57

Query  605  SNFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRAS  426
             +F  + L++ GNT N FG NVT  NV   PG+NT G+++ RVD+APGG  PPH+HPRA+
Sbjct  58   DDFFFAGLSREGNTSNIFGSNVTNANVLSFPGLNTLGVSMNRVDVAPGGTNPPHSHPRAT  117

Query  425  EVTIVLKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQ  246
            E+ I+LKG +LVGF+ TSN+ F++ L  G+ FV PK LIHF +N+   K ALA++   SQ
Sbjct  118  ELIILLKGRLLVGFISTSNQFFSKVLNPGEMFVVPKGLIHFQYNVGKEK-ALAITTFDSQ  176

Query  245  NPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
             PG  + S   FA+ PA+PD+VL KAFQ++   VA I+   
Sbjct  177  LPGVVIASTTLFASNPAIPDDVLAKAFQVDAKVVALIKSKF  217



>ref|XP_009414514.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=217

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 135/197 (69%), Gaps = 5/197 (3%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP  LQD CVAD  NT N+F+NG  C +P L  A +F  S L +P +T N  G NVT  N
Sbjct  24   DPGALQDLCVAD--NTSNVFVNGFVCKDPKLVKAEDFFFSGLDEPRDTTNKVGSNVTLLN  81

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
            V  +PG+NT G+++ARVD AP GL PPH HPRA+E+  VL+G++ VGFV ++  NRL T+
Sbjct  82   VNRIPGLNTLGISMARVDYAPFGLNPPHIHPRATEIQTVLEGSLYVGFVTSNPDNRLVTK  141

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             LR GD FVFP+ LIHF FN  T K A+A+SGLSSQNPG    + + F +KPA+ D++L 
Sbjct  142  VLRKGDVFVFPQGLIHFQFNYGTSK-AVALSGLSSQNPGVITIANSVFGSKPAISDDILA  200

Query  173  KAFQINGIDVAKIRKNL  123
            KAFQ++   + +I+ + 
Sbjct  201  KAFQVDKKIIDRIQAHF  217



>ref|XP_009360505.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 1 [Pyrus x bretschneideri]
Length=190

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 117/159 (74%), Gaps = 6/159 (4%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTK-NTFGFNVT  537
            KSDPD +QDYCV D K  +  FLNG  CI+P+LA +S+F TS L KPG+TK N FGFNVT
Sbjct  20   KSDPDQVQDYCVDDPKTPRTFFLNGAPCIDPNLATSSHFTTSVLTKPGSTKANPFGFNVT  79

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
             TN       N  GLT    D+A  G+VPPH HP  SEVTI LKG +LVGFVDTSNR+FT
Sbjct  80   LTN-----RFNLLGLTPWAXDIAAYGIVPPHLHPGDSEVTICLKGLLLVGFVDTSNRVFT  134

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNP  240
             QL+ G+SFVFPK LIHFL+N D++ P +A++GLSSQNP
Sbjct  135  PQLKPGESFVFPKGLIHFLYNXDSVAPPVALAGLSSQNP  173



>ref|XP_004158659.1| PREDICTED: putative germin-like protein 2-1-like [Cucumis sativus]
Length=218

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 138/215 (64%), Gaps = 7/215 (3%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSAL  582
            L+ A+ V  S +V    SDP PLQD+CVAD   T  +  NGV C +P      +F  + L
Sbjct  9    LILAVFVATSSLV--FASDPSPLQDFCVADPNCTVKV--NGVVCKDPKAVTVEDFFFTGL  64

Query  581  AKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
             K GNT N  G  VTA NVA +PG+NT G++LAR+D AP G+ PPHTHPRASE+  VL+G
Sbjct  65   DKAGNTSNAVGSKVTAANVAQIPGLNTLGISLARIDYAPWGINPPHTHPRASEILTVLEG  124

Query  401  AVLVGFV--DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQL  228
             +LVGFV  +T NRLFT+ L  GD+FVFP  LIHF  N+    PA+A++ LSSQNPG   
Sbjct  125  TLLVGFVTSNTENRLFTKVLYKGDAFVFPVGLIHFQQNIG-YGPAVALAALSSQNPGVIT  183

Query  227  TSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            T+ A F + P +P  +L KAFQ++   + KI+   
Sbjct  184  TANAVFGSNPDIPANILAKAFQVDVATITKIQSKF  218



>ref|XP_008808516.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=215

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 131/184 (71%), Gaps = 4/184 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD+CVAD K+   +F+NG+ C +P LA+  +F  S L KPGNT N  G NVT  N
Sbjct  22   DPKPLQDFCVADLKSP--VFVNGLVCKDPKLAMPEDFFFSGLDKPGNTNNRVGSNVTLVN  79

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS-NRLFTQQ  351
             A+LPG+NT G+++AR+D AP GL PPHTHPRA+E+  V++G++ VGFV ++ N+ F + 
Sbjct  80   AAMLPGLNTLGVSIARIDYAPYGLNPPHTHPRATEILTVIEGSLYVGFVTSNPNKFFAKT  139

Query  350  LRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKK  171
            L  GD FVFP+ LIHF FN+  +  A+A+SG +SQNPG    + A F +KP + D+VL K
Sbjct  140  LHKGDVFVFPQGLIHFQFNVGDIN-AVAMSGFNSQNPGVITIADAVFGSKPPISDDVLMK  198

Query  170  AFQI  159
            AFQ+
Sbjct  199  AFQV  202



>ref|XP_002453357.1| hypothetical protein SORBIDRAFT_04g004510 [Sorghum bicolor]
 gb|EES06333.1| hypothetical protein SORBIDRAFT_04g004510 [Sorghum bicolor]
Length=224

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 129/195 (66%), Gaps = 3/195 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD+CVADT    ++F+NG+ C +P    A +FA S L   G+T N FG  VT  +
Sbjct  29   DPSPLQDFCVADT--VSSVFVNGLVCKDPAQVSAGDFAFSGLHNAGDTSNAFGSKVTLVD  86

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQL  348
            V  LPG+N+ G+++AR+D+APGGL PPHTHPRA+EV  V++G + VGF+ T   LF + +
Sbjct  87   VRALPGLNSLGISMARLDIAPGGLNPPHTHPRATEVLTVVQGQMYVGFLATDGTLFAKVM  146

Query  347  RAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKKA  168
              GD FVFPK L+HF FN     PA+ ++GLSSQNPG    + + F   PA+ DEVL KA
Sbjct  147  SKGDVFVFPKGLLHFEFNCGA-SPAVGIAGLSSQNPGLIRAADSLFGATPAITDEVLAKA  205

Query  167  FQINGIDVAKIRKNL  123
            F+I+   V +I+   
Sbjct  206  FRIDAATVQRIKAQF  220



>ref|XP_006857270.1| hypothetical protein AMTR_s00067p00014150 [Amborella trichopoda]
 gb|ERN18737.1| hypothetical protein AMTR_s00067p00014150 [Amborella trichopoda]
Length=218

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 139/212 (66%), Gaps = 6/212 (3%)
 Frame = -1

Query  749  IIVCLSFVVELV-KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKP  573
            ++V LS    L   SDP PLQD+CVAD  N   LF+NG  C +P LA A++F  + L KP
Sbjct  5    LVVFLSLTASLTYASDPSPLQDFCVAD--NASQLFVNGKVCKDPQLAQANDFFFAGLDKP  62

Query  572  GNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVL  393
            GNT N  G  VT  NVA + G+NT G+++ R+D APGG  PPHTHPRA+E+  VL+G++ 
Sbjct  63   GNTANALGSRVTQVNVAQIAGLNTLGISMVRIDYAPGGQNPPHTHPRATEILTVLEGSLY  122

Query  392  VGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSL  219
            VGFV ++  NRL T+ L+ GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + 
Sbjct  123  VGFVTSNPDNRLITKTLQKGDVFVFPEGLIHFQQNVG-YKNAVAIAALSSQNPGVITIAN  181

Query  218  ATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            A F +KPA+   VL KAFQ++   V +++   
Sbjct  182  AVFGSKPAINSNVLAKAFQVDNKVVNQLQSQF  213



>ref|XP_008645277.1| PREDICTED: putative germin-like protein 2-1 [Zea mays]
 gb|AFW70246.1| hypothetical protein ZEAMMB73_532857 [Zea mays]
Length=224

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 130/195 (67%), Gaps = 3/195 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD+CVADT +  N+F+NG AC +P    A++FA S L   G+T N FG  VT  +
Sbjct  30   DPSPLQDFCVADTAS--NVFVNGQACKDPAQVTAADFAFSGLQDAGDTGNAFGSKVTLVD  87

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQL  348
               LPG+N+ G+ +AR+D+APGG+ PPHTHPRA+EV  V++G +  GF+ T  +LF + L
Sbjct  88   ARALPGLNSLGVAMARLDIAPGGVNPPHTHPRATEVLTVVEGQMYAGFLATDGKLFARVL  147

Query  347  RAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKKA  168
              GD+FVFP+ L+HF FN     PA+ ++GLSSQNPG    + + F   PAV DEVL KA
Sbjct  148  NRGDAFVFPRGLVHFEFNCGA-GPAVGLAGLSSQNPGLVRVADSLFGAAPAVTDEVLAKA  206

Query  167  FQINGIDVAKIRKNL  123
            F+I+   V +I+   
Sbjct  207  FRIDAATVQRIKAQF  221



>ref|XP_008237524.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X2 [Prunus mume]
Length=228

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 145/222 (65%), Gaps = 6/222 (3%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVA  606
            M+   FL+  + +  S    +  SDP PLQD+CVA  DTK+ + +F+NG  C +P LA A
Sbjct  1    MKGVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAEAVFVNGKFCKDPKLANA  60

Query  605  SNFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRAS  426
            ++F  S L  P NT+N  G NVTA NV  L G+NT G++LAR+D AP GL PPHTHPRA+
Sbjct  61   NDFFFSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRAT  120

Query  425  EVTIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGL  255
            E+ +VL+G + VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+  +  A+A +GL
Sbjct  121  EILVVLEGTLYVGFVTSNGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVN-AVAFAGL  179

Query  254  SSQNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRK  129
            SSQNPG    + A F +KP +  +VL KAFQ++   V  ++K
Sbjct  180  SSQNPGVITIANAVFGSKPLINPDVLAKAFQVDDKVVDNLQK  221



>ref|XP_008237526.1| PREDICTED: germin-like protein subfamily 1 member 11 [Prunus 
mume]
Length=228

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 145/222 (65%), Gaps = 6/222 (3%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVA  606
            M+   FL+  + +  S    +  SDP PLQD+CVA  DTK+ + +F+NG  C +P LA A
Sbjct  1    MKGVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAEAVFVNGKFCKDPKLANA  60

Query  605  SNFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRAS  426
            ++F  S L  P NT+N  G NVTA NV  L G+NT G++LAR+D AP GL PPHTHPRA+
Sbjct  61   NDFFFSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRAT  120

Query  425  EVTIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGL  255
            E+ +VL+G + VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+  +  A+A +GL
Sbjct  121  EILVVLEGTLYVGFVTSNGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVN-AVAFAGL  179

Query  254  SSQNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRK  129
            SSQNPG    + A F +KP +  +VL KAFQ++   V  ++K
Sbjct  180  SSQNPGVITIANAVFGSKPLINPDVLAKAFQVDNNVVDYLQK  221



>ref|XP_004134617.1| PREDICTED: putative germin-like protein 2-1-like [Cucumis sativus]
 gb|KGN49476.1| hypothetical protein Csa_6G525610 [Cucumis sativus]
Length=218

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 137/215 (64%), Gaps = 7/215 (3%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSAL  582
            L+ A+ V  S +V    SDP PLQD+CVAD   T  +  NGV C +P      +F  + L
Sbjct  9    LILAVFVATSSLV--FASDPSPLQDFCVADPNCTVKV--NGVVCKDPKAVTVEDFFFTGL  64

Query  581  AKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
             K GNT N  G  VTA NVA +PG+NT G++LAR+D AP G+ PPHTHPRASE+  VL+G
Sbjct  65   DKAGNTSNAVGSKVTAANVAQIPGLNTLGISLARIDYAPWGINPPHTHPRASEILTVLEG  124

Query  401  AVLVGFV--DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQL  228
             +LVGFV  +T NRLFT+ L  GD+FVFP  LIHF  N+    PA+A++ LSSQNPG   
Sbjct  125  TLLVGFVTSNTENRLFTKVLYKGDAFVFPVGLIHFQQNIG-YGPAVALAALSSQNPGVIT  183

Query  227  TSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
             + A F + P +P  +L KAFQ++   + KI+   
Sbjct  184  IANAVFGSNPDIPANILAKAFQVDVATITKIQSKF  218



>ref|XP_006845051.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
 gb|ERN06726.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
Length=220

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 144/218 (66%), Gaps = 9/218 (4%)
 Frame = -1

Query  758  LKAIIVCLSFVVEL----VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFAT  591
            +K+  + LSF   +    + SDP PLQD+CVAD  N   +F+NG  C +P LA A++F  
Sbjct  1    MKSFFLVLSFFALVASFALASDPSPLQDFCVAD--NASKVFVNGKVCKDPKLAQANDFFF  58

Query  590  SALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
              L KPGNT N  G  VT  NVA +PG+NT G++L R+D A GG  PPHTHPRA+E+  V
Sbjct  59   CGLNKPGNTANPLGSRVTPVNVAQIPGLNTLGISLVRIDYARGGQNPPHTHPRATEILTV  118

Query  410  LKGAVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPG  237
            L+G++ VGFV ++  NRL T+ ++ GD FVFP+ LIHF  N+ + K A+A++ LSSQNPG
Sbjct  119  LEGSLYVGFVTSNPDNRLITKTIQKGDVFVFPEGLIHFQQNVGS-KNAVAIAALSSQNPG  177

Query  236  AQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
                + A F +KPA+ ++VL KAFQ++   V +++   
Sbjct  178  VITIANAVFGSKPAISNDVLAKAFQVDKKVVNRLQSQF  215



>ref|XP_003573399.1| PREDICTED: germin-like protein 8-11 isoform X2 [Brachypodium 
distachyon]
Length=225

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 138/211 (65%), Gaps = 6/211 (3%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M I  + L A ++ L F  + + SDP PLQD+CVAD  N+  + +NG  C +P    A +
Sbjct  1    MAISSYSLLAAVLAL-FSWQAIASDPSPLQDFCVAD--NSSRVLVNGFVCKDPKDVKAED  57

Query  599  FATSALAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            F  + L  P +TK N  GFNVT  NV  +PG+NT G++LAR+D  P G  PPHTHPRA+E
Sbjct  58   FLGAKLDMPRDTKANMVGFNVTLINVMWIPGLNTLGISLARIDYTPLGENPPHTHPRATE  117

Query  422  VTIVLKGAVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSS  249
            +  VL+G + VGFV ++  N+  ++ L  GD F+FP+ LIHF FN +  KPA+A++ LSS
Sbjct  118  ILTVLEGTLYVGFVTSNPENKFLSKVLNKGDVFIFPQGLIHFQFNPNPYKPAVAIAALSS  177

Query  248  QNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            QNPGA   + A F +KP + D+VL KAFQ++
Sbjct  178  QNPGAITIANAVFGSKPMISDDVLAKAFQVD  208



>ref|XP_008443751.1| PREDICTED: germin-like protein subfamily 1 member 7 [Cucumis 
melo]
Length=223

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 133/198 (67%), Gaps = 3/198 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD+CVA       +FLNG  C +P  AVA++F    L   GNT N  G NVT  N
Sbjct  22   DPSPLQDFCVAINDARSPVFLNGKFCKDPKYAVANDFLFQGLNIAGNTDNPNGSNVTLVN  81

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
            V  LPG+NT G++LAR+D AP GL PPHTHPRA+E+ +V++G++LVGFV ++  N+ F++
Sbjct  82   VDKLPGLNTLGVSLARIDYAPYGLNPPHTHPRATEILVVVEGSLLVGFVTSNPDNKFFSK  141

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L  GD FVFP  LIHF FN+    PALA +GL SQNPG    + A F +KP +P +VL+
Sbjct  142  VLYKGDVFVFPVGLIHFQFNVGR-TPALAFAGLGSQNPGVITIANAVFGSKPLIPVDVLE  200

Query  173  KAFQINGIDVAKIRKNLG  120
            KAFQ++   VA +++  G
Sbjct  201  KAFQLDADIVAYLQRRFG  218



>ref|XP_010251867.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 124/186 (67%), Gaps = 3/186 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD+CVA       +F+NG  C NP+   A +F  S L KPGNT N  G  VT  N
Sbjct  22   DPSPLQDFCVAIKDTDYPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVN  81

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
            V  LPG+NT G++L R+D AP GL PPHTHPRA+EV +VL+G + VGFV ++  NRLFT+
Sbjct  82   VMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNPDNRLFTK  141

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L  GD FVFP+ LIHF FN+     A+A +GLSSQNPG    + A F  KP + D+VL 
Sbjct  142  VLNKGDVFVFPEGLIHFQFNVGHTN-AVAFAGLSSQNPGTITIANAVFGAKPPIKDDVLA  200

Query  173  KAFQIN  156
            KAFQ++
Sbjct  201  KAFQVD  206



>ref|XP_008375054.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=226

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 131/199 (66%), Gaps = 4/199 (2%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDP PLQD+CVA       +F+NG  C NP LA A++F +  L  PGNT N  G  VTA 
Sbjct  24   SDPSPLQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAA  83

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS---NRLF  360
            NV  +PG+NT G++ ARVD AP GL PPHTHPRA+E+ IVL+G++ VGFV ++   NRLF
Sbjct  84   NVDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSNGDGNRLF  143

Query  359  TQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEV  180
            T+ L  GD FVFP  LIHF  N+     ALA++GLSSQNPG    + A F + P +  +V
Sbjct  144  TKVLYKGDVFVFPVGLIHFQLNVGKTN-ALAIAGLSSQNPGVITIANAVFGSNPPINPDV  202

Query  179  LKKAFQINGIDVAKIRKNL  123
            L KAFQ++  +V  ++K  
Sbjct  203  LAKAFQVDEKEVDYLQKQF  221



>ref|XP_010234323.1| PREDICTED: germin-like protein 8-11 isoform X1 [Brachypodium 
distachyon]
Length=252

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 136/206 (66%), Gaps = 6/206 (3%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            FLL A ++ L F  + + SDP PLQD+CVAD  N+  + +NG  C +P    A +F  + 
Sbjct  33   FLLFAAVLAL-FSWQAIASDPSPLQDFCVAD--NSSRVLVNGFVCKDPKDVKAEDFLGAK  89

Query  584  LAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVL  408
            L  P +TK N  GFNVT  NV  +PG+NT G++LAR+D  P G  PPHTHPRA+E+  VL
Sbjct  90   LDMPRDTKANMVGFNVTLINVMWIPGLNTLGISLARIDYTPLGENPPHTHPRATEILTVL  149

Query  407  KGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGA  234
            +G + VGFV +   N+  ++ L  GD F+FP+ LIHF FN +  KPA+A++ LSSQNPGA
Sbjct  150  EGTLYVGFVTSNPENKFLSKVLNKGDVFIFPQGLIHFQFNPNPYKPAVAIAALSSQNPGA  209

Query  233  QLTSLATFATKPAVPDEVLKKAFQIN  156
               + A F +KP + D+VL KAFQ++
Sbjct  210  ITIANAVFGSKPMISDDVLAKAFQVD  235



>ref|XP_010241946.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=223

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 136/207 (66%), Gaps = 6/207 (3%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKN--LFLNGVACINPDLAVASNFAT  591
            + + A +  L    + + SDP PLQD+CVA  K+T++  +F+NG  C NP+   A +F  
Sbjct  3    YRMLAFLAILVLGSQALASDPSPLQDFCVA-IKDTESPAVFVNGKFCKNPNYTTADDFFF  61

Query  590  SALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
            S L KPGNT N  G  VT  NV  LPG+NT G++L R+D AP GL PPHTHPRA+EV +V
Sbjct  62   SGLDKPGNTSNPVGSKVTPVNVMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVV  121

Query  410  LKGAVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPG  237
            L+G + VGFV ++  NRLFT+ L  GD FVFP+ L HF FN+     A+A +GLSSQNPG
Sbjct  122  LEGRLYVGFVTSNPDNRLFTKVLNKGDVFVFPQGLTHFQFNVGHTN-AVAFAGLSSQNPG  180

Query  236  AQLTSLATFATKPAVPDEVLKKAFQIN  156
                + A F  KP + D+VL KAFQ++
Sbjct  181  TITIANAVFGPKPPIKDDVLAKAFQVD  207



>ref|XP_002266983.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=216

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 141/223 (63%), Gaps = 11/223 (5%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M I  F+   +++C S +   + SDP PLQD+CVAD  +T  + LNG+AC +P LA AS+
Sbjct  1    MAIPIFVSGLLVLCFSIIA--IASDPSPLQDFCVADANST--VLLNGLACKDPKLAQASD  56

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F+ S L   GNT N  G  VT   V  LPG+NT G++ ARVD AP G+ PPHTHPRASE+
Sbjct  57   FSFSGLQMAGNTSNAVGSRVTPVTVTQLPGLNTLGISFARVDYAPWGINPPHTHPRASEI  116

Query  419  TIVLKGAVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKP--ALAVSGLS  252
              VLKG + VGFV ++  NRL T+ L+ GD FVFP  LIHF  N   ++P  A+A++ LS
Sbjct  117  LTVLKGCLEVGFVTSNPDNRLITKILQKGDVFVFPIGLIHFQRN---VRPGSAIALAALS  173

Query  251  SQNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            SQNPG    + A F +KP +  ++L KAFQ +   V  I+   
Sbjct  174  SQNPGVITIANAVFGSKPDISSDILAKAFQTDEAIVKDIQSKF  216



>ref|XP_008779054.1| PREDICTED: oxalate oxidase 1-like [Phoenix dactylifera]
Length=220

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 136/198 (69%), Gaps = 2/198 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            +SDPDPLQD+CVA+ + T ++ ++G  C      V+ +F ++AL+K GNT N F  NVT+
Sbjct  24   RSDPDPLQDFCVANLQ-TSDVTVDGFPCKQTSSVVSDDFFSTALSKAGNTDNIFSSNVTS  82

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
             +V   PG+NT GL++ RVD APGGL PPH+HPRA+E+ +VL G +LVGF+ TSN  +++
Sbjct  83   ADVRSFPGLNTLGLSMNRVDFAPGGLNPPHSHPRATELGLVLHGQLLVGFISTSNVFYSK  142

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             +  G++FV P+ L+HF +N+   K ALA++  +SQ PG  +  L  F +KPA+P EVL 
Sbjct  143  IVNEGENFVIPRGLVHFQYNVGKEK-ALAITTFNSQLPGVVVAPLTLFGSKPAIPSEVLA  201

Query  173  KAFQINGIDVAKIRKNLG  120
            KAFQ++   V +I+   G
Sbjct  202  KAFQVDQQVVNQIKSKFG  219



>emb|CDP22064.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   189 bits (480),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 135/209 (65%), Gaps = 8/209 (4%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            F + A I+ L F + +  SDP PLQD+CVA       +F+NG  C +P L  A +F    
Sbjct  5    FHIAAAILALVFTI-VHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVEAKDFFFPG  63

Query  584  LAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLK  405
            L +PG+T N  G NVTA NV  +PG+NT G++LAR+D AP GL PPHTHPRA+E+ +VL+
Sbjct  64   LKEPGSTSNPLGSNVTAVNVNQIPGLNTLGVSLARIDFAPYGLNPPHTHPRATEILVVLE  123

Query  404  GAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQN  243
            G +LVGFV      +  N+LFT+ L  GD FVFP+ LIHF FN      A+A +GLSSQN
Sbjct  124  GTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFN-KGHSSAVAFAGLSSQN  182

Query  242  PGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            PG    + A F +KP +  +VL KAFQ++
Sbjct  183  PGVITIANAVFGSKPPISRDVLTKAFQVD  211



>gb|EMT01744.1| Germin-like protein 8-5 [Aegilops tauschii]
Length=226

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 140/207 (68%), Gaps = 8/207 (4%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            FLL A+I   S+  + + SDP PLQD+CVAD  N+ ++F+NG  C +P    A +F  +A
Sbjct  7    FLLVALIALASW--QAMASDPSPLQDFCVAD--NSSHVFVNGFVCKDPKEVTAEDFFLAA  62

Query  584  -LAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
             L  P +TK +  G  VT  NV  +PG+NT G++LAR+D AP G  PPHTHPRASE+  V
Sbjct  63   KLDMPRDTKMSKVGSIVTLLNVMRIPGLNTLGISLARIDYAPLGENPPHTHPRASEILTV  122

Query  410  LKGAVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPG  237
            L+G + VGFV ++  N+LF + L  GD FVFP+ LIHF FN +  KPA+A++GLSSQNPG
Sbjct  123  LEGTLYVGFVTSNPDNKLFWKVLNKGDVFVFPQGLIHFQFNPNPYKPAVAIAGLSSQNPG  182

Query  236  AQLTSLATFATKPAVPDEVLKKAFQIN  156
            A   + A F +KP + D+VL KAFQ+ 
Sbjct  183  AITIANAVFGSKPPISDDVLAKAFQVE  209



>gb|KDP23769.1| hypothetical protein JCGZ_23602 [Jatropha curcas]
Length=223

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 145/224 (65%), Gaps = 6/224 (3%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M+   FL    ++ L+F       DP PLQD+CVA  +    +F+NG  C +P+LA A++
Sbjct  1    MKGTIFLFSFTVLALAFSFA-SAYDPSPLQDFCVAVEEPKNAIFVNGKFCKDPNLAKAND  59

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAP-GGLVPPHTHPRASE  423
            F+ S L  PGNT N  G NVT  NV +LPG+NT G++LAR+D AP GGL PPH HPRA+E
Sbjct  60   FSFSGLNIPGNTNNGVGSNVTLVNVDLLPGLNTLGISLARLDYAPYGGLNPPHIHPRATE  119

Query  422  VTIVLKGAVLVGFVDTSN--RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSS  249
            + +VLKG + VGFV TSN  RLF + L  GD FVFP  LIHF  N+   + A+A +GLSS
Sbjct  120  ILVVLKGTLYVGFV-TSNPSRLFAKVLYPGDVFVFPIGLIHFQLNVAKTE-AVAFAGLSS  177

Query  248  QNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNLGG  117
            QNPG    + ATF + P +  +VL KAFQ++   VA ++K  GG
Sbjct  178  QNPGVITIANATFGSDPPINPDVLAKAFQLDEDVVAYLQKLFGG  221



>emb|CBI33612.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 131/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A++F  S L  PGNT N  G  VT
Sbjct  25   SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVT  82

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  83   PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  142

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             ++ L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  143  ISKVLYKGDVFVFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  201

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  202  VLTKAFQVD  210



>gb|KDP32127.1| hypothetical protein JCGZ_12588 [Jatropha curcas]
Length=223

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 141/223 (63%), Gaps = 6/223 (3%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M+   FLL  ++V LS+       DP PLQD+CVA  K T  +F+NG  C++P  A A++
Sbjct  1    MKGTHFLLAFVLVVLSYSFAFA-FDPSPLQDFCVAIKKPTDGIFVNGKFCMDPMRATAND  59

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAP-GGLVPPHTHPRASE  423
            F    L  P NTKN  G NVT  +V  LPG+NT G++LAR+D AP GGLVPPH HPRA+E
Sbjct  60   FFFPGLNIPANTKNQLGSNVTLVSVDTLPGLNTLGISLARLDFAPYGGLVPPHYHPRATE  119

Query  422  VTIVLKGAVLVGFVDTSN--RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSS  249
            +  +LKG + VGFV TSN  RL ++ L  GD FVFP  LIHF FN+     A+A+SGLSS
Sbjct  120  ILTLLKGKLYVGFV-TSNPSRLISKVLNPGDVFVFPIGLIHFQFNIGETD-AVAISGLSS  177

Query  248  QNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNLG  120
            QNPG  L + A F + P +  +VL K FQ+    +  ++K  G
Sbjct  178  QNPGVVLIANAVFGSNPPINPDVLTKGFQLEMNVINYLQKQFG  220



>ref|XP_007031299.1| Germin-like protein 10 [Theobroma cacao]
 gb|EOY11801.1| Germin-like protein 10 [Theobroma cacao]
Length=217

 Score =   188 bits (477),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 131/208 (63%), Gaps = 3/208 (1%)
 Frame = -1

Query  746  IVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGN  567
            +   + V+    +DPD LQD CVAD   +  + +NG  C NP    A +F  + LAKPG 
Sbjct  9    LTTFALVLGAAVADPDLLQDICVADL--SSGVKVNGFPCKNPSSVGADDFFFAGLAKPGF  66

Query  566  TKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVG  387
            T NT G  VT  NV  +PG+NT G++L+R+D APGGL PPHTHPRA+EV  VL+G + VG
Sbjct  67   TNNTMGSLVTGANVEKIPGLNTLGVSLSRIDYAPGGLNPPHTHPRATEVVFVLEGELEVG  126

Query  386  FVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFA  207
            F+ TSN L ++ +R G+ FVFPK L+HF  N+  M PA  ++  +SQ PG Q  +   FA
Sbjct  127  FITTSNVLISKSIRKGEIFVFPKGLVHFQKNIGMM-PASVIAAFNSQLPGTQSLAATLFA  185

Query  206  TKPAVPDEVLKKAFQINGIDVAKIRKNL  123
              P VPD+VL KAFQI    V KI+  L
Sbjct  186  ATPTVPDDVLSKAFQIGTKQVQKIKSRL  213



>ref|XP_008360941.1| PREDICTED: germin-like protein subfamily 1 member 17 [Malus domestica]
Length=228

 Score =   188 bits (478),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 131/198 (66%), Gaps = 4/198 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DPDPLQD+CVA       +F+NG  C +P LA A++F +  L  PGNT N  G  VTA N
Sbjct  27   DPDPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPGNTSNPVGSIVTAAN  86

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS---NRLFT  357
            V V+PG+NT G++ ARVD AP GL PPHTHPRA+E+ IV++G++ VGFV ++   NRLFT
Sbjct  87   VDVIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYVGFVTSNGDGNRLFT  146

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            + L  GD FVFP  LIHF  N+     ALA++GLSSQNPG    + A F + P +  +VL
Sbjct  147  KVLYKGDVFVFPIGLIHFQLNVGKTN-ALAIAGLSSQNPGVITIANAVFGSNPPINPDVL  205

Query  176  KKAFQINGIDVAKIRKNL  123
             KAFQ++   V  ++K  
Sbjct  206  AKAFQVDDNVVDYLQKQF  223



>ref|XP_003633724.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 131/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A++F  S L  PGNT N  G  VT
Sbjct  25   SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVT  82

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  83   PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  142

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             ++ L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  143  ISKVLYKGDVFVFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  201

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  202  VLTKAFQVD  210



>ref|XP_008439537.1| PREDICTED: putative germin-like protein 2-1 [Cucumis melo]
Length=217

 Score =   188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 135/215 (63%), Gaps = 7/215 (3%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSAL  582
            L+ A+ V  S +V    SDP PLQD+CVAD   T  +  NGV C +P +    +F  S L
Sbjct  8    LILAVFVATSSLV--FASDPSPLQDFCVADPNCTVKV--NGVVCKDPKVVTVDDFFFSGL  63

Query  581  AKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
             K GNT N  G  VTA NV  +PG+NT G++LAR+D AP G+ PPHTHPRASE+  VL+G
Sbjct  64   DKAGNTSNAVGSKVTAANVVQIPGLNTLGISLARIDYAPWGINPPHTHPRASEILTVLEG  123

Query  401  AVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQL  228
             +LVGFV +   NRLFT+ L  GD+FVFP  LIHF  N+    P +A++ LSSQNPG   
Sbjct  124  TLLVGFVSSNPENRLFTKVLYKGDAFVFPVGLIHFQQNIG-YGPVVALAALSSQNPGVIT  182

Query  227  TSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
             + A F + P +P  +L KAFQ++   + KI+   
Sbjct  183  IANAVFGSNPDIPANILAKAFQVDEATITKIQSKF  217



>ref|XP_009357348.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 130/199 (65%), Gaps = 4/199 (2%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDP PLQD+CVA       +F+NG  C NP LA A++F +  L  PGNT N  G  VTA 
Sbjct  24   SDPSPLQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAA  83

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS---NRLF  360
            NV  +PG+NT G++ AR+D AP GL PPHTHPRA+E+ IVL+G++ VGFV ++   NRLF
Sbjct  84   NVDDIPGLNTLGISFARLDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSNADGNRLF  143

Query  359  TQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEV  180
            T+ L  GD FVFP  LIHF  N+     ALA+ GLSSQNPG    + A F + P +  +V
Sbjct  144  TKVLYKGDVFVFPVGLIHFQLNVGKTN-ALAIGGLSSQNPGVITIANAVFGSNPHINPDV  202

Query  179  LKKAFQINGIDVAKIRKNL  123
            L KAFQ++  +V  ++K  
Sbjct  203  LAKAFQVDEKEVDYLQKQF  221



>ref|XP_009415610.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=218

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 132/197 (67%), Gaps = 5/197 (3%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP  LQD CVAD  NT N+F+NG  C +P L  A +F  S L +P NT N  G NVT  N
Sbjct  25   DPGALQDLCVAD--NTSNVFVNGFVCKDPKLVKAEDFFFSGLDQPRNTSNKVGSNVTLLN  82

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
               +PG+NT G+++ARVD AP GL PPH HPRA+E+  VL+G++ VGFV ++  NRL T+
Sbjct  83   ANRIPGLNTLGISMARVDYAPFGLNPPHIHPRATEIQTVLEGSLYVGFVTSNPDNRLVTK  142

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             LR GD FVFP+ LIHF FN  T K A+A+SGLSSQNPG    + + F +KPA+ D++L 
Sbjct  143  VLRKGDVFVFPQGLIHFQFNYGTNK-AVALSGLSSQNPGVITIANSVFGSKPAISDDILA  201

Query  173  KAFQINGIDVAKIRKNL  123
            KA  ++   V +I+ + 
Sbjct  202  KALGVDKKIVDRIQAHF  218



>ref|XP_009414511.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=218

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 137/205 (67%), Gaps = 6/205 (3%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            FLL A +V L+    + + DP PLQD+CVAD  NT ++++NG  C +P L  A +F  S 
Sbjct  7    FLLVASLVALASSPAMAR-DPGPLQDFCVAD--NTSDVYVNGFVCKDPKLVKAEDFFFSG  63

Query  584  LAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLK  405
            L +P NT N  G NVT  N   +PG+NT G+++ARVD AP GL PPH HPRA+E+  VL+
Sbjct  64   LDQPRNTTNKVGSNVTLLNANRIPGLNTLGISMARVDYAPFGLNPPHIHPRATEIQTVLE  123

Query  404  GAVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQ  231
            G++ VGFV ++  NRL T+ LR GD FVFP+ LIHF FN    K A+A+S LSSQNPG  
Sbjct  124  GSLYVGFVTSNPDNRLITKVLRKGDVFVFPQGLIHFQFNYGINK-AVALSSLSSQNPGVI  182

Query  230  LTSLATFATKPAVPDEVLKKAFQIN  156
              + + F +KPA+ D++L KA  ++
Sbjct  183  TIANSVFGSKPAISDDILAKALGVD  207



>ref|XP_002265608.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 131/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A++F  S L  PGNT N  G  VT
Sbjct  25   SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVT  82

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  83   PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  142

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             ++ L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  143  ISKVLYKGDVFVFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  201

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  202  VLTKAFQVD  210



>ref|XP_006840206.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
 gb|ERN01881.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
Length=219

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 136/212 (64%), Gaps = 6/212 (3%)
 Frame = -1

Query  758  LKAIIVCLSFVVEL-VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSAL  582
            L  + + LS +  L + SDP PLQD+CVAD  N   +F+NG  C +P LA A++F    L
Sbjct  3    LTIVFLTLSMIASLGLASDPSPLQDFCVAD--NYSKVFVNGKVCKDPMLATANDFFYDGL  60

Query  581  AKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
             KPGNT N  G  VT  NV  +PG+NT G++LAR+D APGG  PPHTHPR +E+  VL+G
Sbjct  61   NKPGNTSNPLGSMVTPVNVMQIPGLNTLGISLARIDFAPGGQNPPHTHPRGTEILTVLEG  120

Query  401  AVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQL  228
             + VGFV ++  NRL ++ L+ GD FVFP+ LIHF  N+      +A++GLSSQNPG   
Sbjct  121  TLYVGFVTSNPENRLISKTLKKGDVFVFPEGLIHFQQNVGYGN-TVAIAGLSSQNPGVIT  179

Query  227  TSLATFATKPAVPDEVLKKAFQINGIDVAKIR  132
             + A F   P + D VL KAFQI+   V K++
Sbjct  180  IANAVFGADPPISDVVLAKAFQIDKKLVDKLQ  211



>ref|XP_007200157.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
 gb|EMJ01356.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
Length=226

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 140/220 (64%), Gaps = 4/220 (2%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M+   FL+  + +  S    +  SDP PLQD+CVA       +F+NG  C +P LA A++
Sbjct  1    MKAVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANAND  60

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F  S L  P NT+N  G NVTA NV  L G+NT G++LAR+D AP GL PPHTHPRA+E+
Sbjct  61   FFFSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEI  120

Query  419  TIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSS  249
             +VL+G + VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+  +  A+A +GLSS
Sbjct  121  LVVLEGTLYVGFVTSNGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVN-AVAFAGLSS  179

Query  248  QNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRK  129
            QNPG    + A F ++P +  +VL KAFQ++   V  ++K
Sbjct  180  QNPGVITIAKAVFGSQPPINPDVLAKAFQVDDNVVDNLQK  219



>gb|EYU20539.1| hypothetical protein MIMGU_mgv1a013072mg [Erythranthe guttata]
Length=231

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 129/207 (62%), Gaps = 8/207 (4%)
 Frame = -1

Query  758  LKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALA  579
            L  I+V  SF      SDP PLQD+CVA       +F+NG  C NP++ VA +F    L 
Sbjct  9    LTTILVVASFATLGFASDPSPLQDFCVAVNDAKSAVFVNGKVCKNPNMVVAKDFLFRGLN  68

Query  578  KPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGA  399
            KPGNT N  G  VT  NV  LPG+NT G++  R+D AP GL PPHTHPRA+E+ +V++G 
Sbjct  69   KPGNTSNPLGSRVTPVNVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVIEGT  128

Query  398  VLVGFVDTS-------NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNP  240
            + VGFV ++       N+LFT+ L  GD FVFP+ LIHF FN+     A+A +GLSSQNP
Sbjct  129  LYVGFVTSNPADPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTN-AVAFAGLSSQNP  187

Query  239  GAQLTSLATFATKPAVPDEVLKKAFQI  159
            G    + A F + P++   VL KAFQ+
Sbjct  188  GVITIANAVFGSDPSINPAVLTKAFQV  214



>ref|XP_003633711.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 130/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A++F  S L  PGNT N  G  VT
Sbjct  25   SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVT  82

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  83   PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  142

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
              + L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  143  IAKVLYKGDVFVFPEGLIHFHLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  201

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  202  VLTKAFQVD  210



>emb|CAN72994.1| hypothetical protein VITISV_000563 [Vitis vinifera]
Length=205

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 130/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A++F  S L  PGNT N  G  VT
Sbjct  9    SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVT  66

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  67   PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  126

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
              + L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  127  IAKVLYKGDVFVFPEGLIHFHLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  185

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  186  VLTKAFQVD  194



>ref|XP_010251872.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 126/191 (66%), Gaps = 3/191 (2%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFN  543
            + + SDP+PLQD+CVA       +F+NG  C NP+   A +F  S L KPGNT N  G  
Sbjct  17   QALASDPNPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSK  76

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--N  369
            VT  NV  LPG+NT G++L R+D AP GL PPHTHPRA+EV +VL+G + VGFV ++  N
Sbjct  77   VTPVNVMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVTSNPEN  136

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
            RL T+ L  GD FVFP  LIHF FN+     A+A +GLSSQNPG    + A F + P + 
Sbjct  137  RLITKTLNKGDVFVFPVGLIHFQFNVGHTN-AVAFAGLSSQNPGTITIANAVFGSXPPIK  195

Query  188  DEVLKKAFQIN  156
            D+VL KAFQ++
Sbjct  196  DDVLAKAFQVD  206



>gb|AGZ13502.1| germin-like protein 2 [Lilium regale]
Length=217

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 139/210 (66%), Gaps = 6/210 (3%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M    F   AI+   S     + SDPD LQD+CVAD +N++ + +NG+ C +P  A  ++
Sbjct  1    MATHYFFWLAILALAS--SHSMASDPDSLQDFCVAD-RNSQ-VIVNGLVCKDPKQAQPAD  56

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F    L +PG+T N  G NVT  + A LPG+NT G+++AR+D AP GL+PPH HPRA+E+
Sbjct  57   FFFPGLNQPGSTTNQLGSNVTLVSAANLPGLNTLGISVARLDFAPYGLIPPHYHPRATEI  116

Query  419  TIVLKGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQ  246
              +L+G + VGFV +    RL ++ L+AGD FVFPK L+HF FN D  KPA+++SGLSSQ
Sbjct  117  LTLLEGTLYVGFVTSFPDFRLISKILKAGDVFVFPKGLVHFQFNQDGTKPAVSLSGLSSQ  176

Query  245  NPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            NPG    + A F + P + D+VL KAFQ++
Sbjct  177  NPGLVTVANAVFGSNPPIWDDVLAKAFQLD  206



>emb|CDP16787.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 134/209 (64%), Gaps = 8/209 (4%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            F + A I+ L F + +  SDP PLQD+CVA       +F+NG  C +P L  A +F    
Sbjct  5    FHIAAAILALVFTI-VHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVEAEDFFFPG  63

Query  584  LAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLK  405
            L +PG+T N  G NVT  NV  +PG+NT G++LAR+D AP GL PPHTHPRA+E+ +VL+
Sbjct  64   LNEPGSTSNPLGSNVTTVNVNQIPGLNTLGVSLARIDFAPYGLNPPHTHPRATEILVVLE  123

Query  404  GAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQN  243
            G +LVGFV      +  N+LFT+ L  GD FVFP+ LIHF FN      A+A +GLSSQN
Sbjct  124  GTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNKGHSN-AVAFAGLSSQN  182

Query  242  PGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            PG    + A F +KP +  +VL KAFQ++
Sbjct  183  PGVITIANAVFGSKPPISRDVLTKAFQVD  211



>ref|XP_009355938.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 130/198 (66%), Gaps = 4/198 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD+CVA       +F+NG  C NP LA A++F +  L  PGNT N  G  VTA N
Sbjct  25   DPSPLQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAAN  84

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS---NRLFT  357
            V  +PG+NT G++ AR+D AP GL PPHTHPRA+E+ IVL+G++ VGFV ++   NRLFT
Sbjct  85   VDDIPGLNTLGISFARLDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSNADGNRLFT  144

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            + L  GD FVFP  LIHF  N+     ALA++GLSSQNPG    + A F + P +  +VL
Sbjct  145  KVLYKGDVFVFPVGLIHFQLNVGKTN-ALAIAGLSSQNPGVITIANAVFGSNPHINPDVL  203

Query  176  KKAFQINGIDVAKIRKNL  123
             KAFQ++  +V  ++K  
Sbjct  204  AKAFQVDEKEVDYLQKQF  221



>ref|XP_009795501.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 137/215 (64%), Gaps = 10/215 (5%)
 Frame = -1

Query  779  MRIKPFLLK-AIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M +K F+L  AI+  +S +     SDP PLQD+CVA   +   +F+NG  C +P +  A 
Sbjct  1    MALKSFVLTIAILAVVSSISH--ASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNAD  58

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L  PGNT N  G  VTA NV  LPG+NT G++L R+D AP GL PPHTHPRA+E
Sbjct  59   DFFKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATE  118

Query  422  VTIVLKGAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
            V  VL+G + VGFV      +  N+LFT+ L+ GD FVFP  LIHF FN+   K A+A +
Sbjct  119  VLAVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKNK-AVAFA  177

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            GLSSQNPG    + A F + P + D+VL KAFQ++
Sbjct  178  GLSSQNPGVITIANAVFGSDPPINDDVLAKAFQVD  212



>ref|XP_010257844.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=224

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 125/187 (67%), Gaps = 3/187 (2%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDP PLQD+CVA       + +NG  C NP LA A +F  S L KPGNT N  G  VTA 
Sbjct  23   SDPSPLQDFCVAIKDPKAAVLVNGKFCKNPKLAKAKDFFFSGLHKPGNTSNPVGSKVTAV  82

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFT  357
            NV  +PG+NT G++LAR+D AP GL PPHTHPRA+E+ +VL+G + VGF  ++  NRL T
Sbjct  83   NVEQIPGLNTLGISLARIDFAPYGLNPPHTHPRATEILVVLEGTLYVGFATSNPDNRLIT  142

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            + L  GD FVFP  LIHF FN      A+A++GLSSQNPG    + A F +KP + D+VL
Sbjct  143  KTLNKGDVFVFPVGLIHFQFNTGETN-AVALAGLSSQNPGVITIANAVFGSKPPIRDDVL  201

Query  176  KKAFQIN  156
             +AF+++
Sbjct  202  ARAFRVD  208



>ref|XP_008237522.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X1 [Prunus mume]
Length=229

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 145/223 (65%), Gaps = 7/223 (3%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVA--DTKN-TKNLFLNGVACINPDLAV  609
            M+   FL+  + +  S    +  SDP PLQD+CVA  DTK+  + +F+NG  C +P LA 
Sbjct  1    MKGVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVEAVFVNGKFCKDPKLAN  60

Query  608  ASNFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRA  429
            A++F  S L  P NT+N  G NVTA NV  L G+NT G++LAR+D AP GL PPHTHPRA
Sbjct  61   ANDFFFSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRA  120

Query  428  SEVTIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSG  258
            +E+ +VL+G + VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+  +  A+A +G
Sbjct  121  TEILVVLEGTLYVGFVTSNGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVN-AVAFAG  179

Query  257  LSSQNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRK  129
            LSSQNPG    + A F +KP +  +VL KAFQ++   V  ++K
Sbjct  180  LSSQNPGVITIANAVFGSKPLINPDVLAKAFQVDDKVVDNLQK  222



>ref|XP_010934325.1| PREDICTED: oxalate oxidase 1-like [Elaeis guineensis]
Length=238

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 137/204 (67%), Gaps = 2/204 (1%)
 Frame = -1

Query  731  FVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTF  552
            F +   +SDPDPLQD+CVA+ +   ++ ++G  C       A +F ++ L+K GNT N F
Sbjct  35   FFLSPCRSDPDPLQDFCVANLR-ASDITVDGFPCKPTSGVAADDFFSTVLSKEGNTNNVF  93

Query  551  GFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS  372
              N+T+ NV   PG+NT GL++ RVD APGG+ PPH+HPR++E+ +V KG +LVGFV TS
Sbjct  94   SSNLTSANVLSFPGLNTLGLSMNRVDFAPGGVNPPHSHPRSAELVLVTKGRLLVGFVSTS  153

Query  371  NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAV  192
            N  +++ ++AG+ FV P+ L+HF +N+   K ALA++  +SQ PGA +  LA F +KPA+
Sbjct  154  NVFYSRVVKAGEIFVIPRGLVHFQYNVGKKK-ALAITVFNSQLPGAVVAPLALFGSKPAI  212

Query  191  PDEVLKKAFQINGIDVAKIRKNLG  120
            P EVL KAFQ++   V  I+   G
Sbjct  213  PSEVLAKAFQVDQQVVKLIKSKFG  236



>emb|CBI33611.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 131/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A++F  S L  PGNT N  G  VT
Sbjct  83   SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVT  140

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  141  PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  200

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             ++ L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  201  ISKVLYKGDVFVFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  259

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  260  VLTKAFQVD  268



>gb|EYU40211.1| hypothetical protein MIMGU_mgv1a013108mg [Erythranthe guttata]
Length=230

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 129/214 (60%), Gaps = 8/214 (4%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M++    L  I V  SF      SDP PLQD+CVA       +F+NG  C NP++ VA +
Sbjct  1    MKMTLVSLATIFVVASFATFAYASDPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAED  60

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F    L KPGNT N  G  VT   V  LPG+NT G++  R+D AP GL PPHTHPRA+E+
Sbjct  61   FLFRGLNKPGNTSNPLGSRVTPVTVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEI  120

Query  419  TIVLKGAVLVGFVDTS-------NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
             I+LKG + VGFV ++       N+LFT+ L  GD FVFP+ LIHF FN+     A+A +
Sbjct  121  LILLKGTLYVGFVTSNPADPALKNKLFTKYLHPGDVFVFPQGLIHFQFNVGKTN-AVAFA  179

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQI  159
            GLSSQNPG    + A F + P +   VL KAFQ+
Sbjct  180  GLSSQNPGVITIANAVFGSDPPIDPAVLTKAFQV  213



>ref|XP_008393482.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
 ref|XP_008351930.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=230

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 137/216 (63%), Gaps = 7/216 (3%)
 Frame = -1

Query  752  AIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAK  576
            A +  L+F   L   SDP PLQD+CVA       +F+NG  C +P+LA A++F T  L  
Sbjct  11   AALSVLAFATLLASASDPGPLQDFCVAINNTDYAVFVNGKFCKDPNLASANDFFTDKLRY  70

Query  575  PGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            PGNT N  G  VTA NV V+PG+NT G++ ARVD AP GL PPHTHPRA+E+ IVL+G++
Sbjct  71   PGNTSNPVGSIVTAANVDVIPGLNTLGISFARVDFAPNGLNPPHTHPRATEIFIVLEGSL  130

Query  395  LVGFVDTS-----NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQ  231
             VGFV ++     NRLFT+ L  GD FVFP  LIHF  N+     A+A++  SSQNPG  
Sbjct  131  YVGFVTSNIEGDGNRLFTKVLYKGDVFVFPFGLIHFQLNVGKTN-AVAIAAFSSQNPGVI  189

Query  230  LTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
              + A F +KP +  +VL KAFQ++   V  ++K  
Sbjct  190  TVANAVFGSKPPINPDVLTKAFQVDNNVVDYLQKQF  225



>ref|XP_008778966.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=221

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 135/203 (67%), Gaps = 9/203 (4%)
 Frame = -1

Query  746  IVCLSFVV----ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALA  579
            I+ L+F+       + SDP PLQD+CVAD   T ++F+NG+ C NP+   A +F  S L 
Sbjct  5    ILLLAFLALVSSHAIASDPSPLQDFCVADK--TSHVFVNGLVCKNPNDVKADDFFFSGLD  62

Query  578  KPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGA  399
            +PG+  N  G NVT  NV  + G+NT G++LAR+D AP GL PPH HPRA+E+  VL+G+
Sbjct  63   RPGDAANKLGSNVTLVNVEKIAGLNTLGISLARIDFAPYGLNPPHIHPRATEILTVLEGS  122

Query  398  VLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLT  225
            + VGFV ++  NRLF + +  GD FVFP+ LIHF FN  T K A+A++ LSSQNPG    
Sbjct  123  LYVGFVTSNPDNRLFAKVINKGDVFVFPQGLIHFQFNYGT-KNAVAIAALSSQNPGVITV  181

Query  224  SLATFATKPAVPDEVLKKAFQIN  156
            + A F +KP +  +VL KAFQ++
Sbjct  182  ANAVFGSKPPISRDVLAKAFQVD  204



>ref|XP_003633723.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=226

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 130/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A++F  S L  PGNT N  G  VT
Sbjct  30   SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVT  87

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  88   PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  147

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
              + L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  148  ICKVLYKGDVFVFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  206

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  207  VLTKAFQVD  215



>ref|XP_006362219.1| PREDICTED: putative germin-like protein 2-3-like [Solanum tuberosum]
Length=217

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 139/218 (64%), Gaps = 5/218 (2%)
 Frame = -1

Query  770  KPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFAT  591
            K FLL  +I  LSF   ++  +P PLQD+CVAD   T  +  NG+AC +P    A +F  
Sbjct  3    KHFLLLNLIAVLSFCCVVLAFEPSPLQDFCVADPAGTAKV--NGLACKDPKSVGAEDFFF  60

Query  590  SALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
            S L   GNT NTFG  VT  NVA +PG+NT G++LARVD AP G+ PPHTHPRA+E+  V
Sbjct  61   SGLHLAGNTSNTFGSKVTPANVAQIPGLNTLGISLARVDYAPWGINPPHTHPRATEIVTV  120

Query  410  LKGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPG  237
            L+G + VGFV +   NR  T+ L+ GD FVFP  L+H+  N+     A+A++ LSSQNPG
Sbjct  121  LEGFLQVGFVTSNPENRHITKVLKKGDVFVFPIGLVHYQRNVGKGN-AVAIAALSSQNPG  179

Query  236  AQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
                + A F ++PA+  ++L KAFQ++   VA+I+   
Sbjct  180  VISIANAVFGSEPAIATDILAKAFQVDATVVAQIQSKF  217



>ref|XP_011099651.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=229

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 126/191 (66%), Gaps = 8/191 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDP PLQD+CVA   +   +F+NG  C NP++ VA +F    L KPGNT N  G  VT  
Sbjct  23   SDPSPLQDFCVAVNDSVAAVFVNGKICKNPNMVVAEDFFFPGLNKPGNTSNQVGSMVTPV  82

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS-------  372
            NV  LPG+NT G++LAR+D AP G+ PPHTHPRASE+ +V++G + VGFV ++       
Sbjct  83   NVNQLPGLNTLGISLARIDFAPYGINPPHTHPRASEILLVVEGTLYVGFVTSNPANPTMK  142

Query  371  NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAV  192
            N+LFT+ L  GD FVFP+ LIHF FN+     ALA +GLSSQNPG    + A F + P +
Sbjct  143  NKLFTKYLYPGDVFVFPQGLIHFQFNVGKTN-ALAFAGLSSQNPGVITIANAVFGSNPPI  201

Query  191  PDEVLKKAFQI  159
              +VL KAFQ+
Sbjct  202  NPDVLAKAFQV  212



>ref|XP_007201862.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
 gb|EMJ03061.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
Length=226

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 140/220 (64%), Gaps = 4/220 (2%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M+   FL+  + +  S    +  SDP PLQD+CVA       +F+NG  C +P LA A++
Sbjct  1    MKGVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANAND  60

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F  S L  P NT+N  G NVTA NV  L G+NT G++LAR+D AP GL PPHTHPRA+E+
Sbjct  61   FFFSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEI  120

Query  419  TIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSS  249
             +VL+G + VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+  +  A+A +GLSS
Sbjct  121  LVVLEGTLYVGFVTSNGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVN-AVAFAGLSS  179

Query  248  QNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRK  129
            QNPG    + A F ++P +  +VL KAFQ++   V  ++K
Sbjct  180  QNPGVITIAKAVFGSQPPINPDVLAKAFQVDDNVVDNLQK  219



>ref|XP_009414513.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=218

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 127/186 (68%), Gaps = 5/186 (3%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP  LQD CVAD  NT N+F+NG  C +P L  A +F  S L +P NT N  G NVT  N
Sbjct  25   DPGALQDLCVAD--NTSNVFVNGFVCKDPKLVKAEDFFFSGLDQPRNTTNKVGSNVTLLN  82

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
               +PG+NT G+++ARVD AP GL PPH HPRA+E+  VL+G++ VGFV ++  NRL T+
Sbjct  83   ANRIPGLNTLGISMARVDYAPFGLNPPHIHPRATEIQTVLEGSLYVGFVTSNPDNRLVTK  142

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             LR GD FVFP+ LIHF FN  T K A+A+SGLSSQNPG    + + F +KPA+ D++L 
Sbjct  143  VLRKGDVFVFPQGLIHFQFNYGTNK-AVALSGLSSQNPGVITIANSVFGSKPAISDDILA  201

Query  173  KAFQIN  156
            KA  ++
Sbjct  202  KALGVD  207



>ref|XP_009402558.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=219

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 133/201 (66%), Gaps = 6/201 (3%)
 Frame = -1

Query  749  IIVCLSFVVEL-VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKP  573
            ++V L+    L + SDP  LQD+CVAD K++K + +NG  C +P +  A +F+ S L  P
Sbjct  7    LLVLLAMASSLAMASDPSQLQDFCVAD-KDSK-VRVNGFVCKDPMVVKADDFSLSGLDMP  64

Query  572  GNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVL  393
            G+T N FGFNVT  NV  +PG+NT G+++ R+D  P GL PPHTHPRA+E+  V++G +L
Sbjct  65   GDTGNKFGFNVTPANVMQIPGLNTLGISMVRIDYIPKGLNPPHTHPRATEILTVIEGQLL  124

Query  392  VGFV--DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSL  219
            VGFV  +T NRLFT+ L+ GD FVFP+ LIHF FN        A+  LSSQNPG    + 
Sbjct  125  VGFVTSNTDNRLFTKMLKKGDVFVFPQGLIHFQFNPGYTN-TFAIGALSSQNPGTITIAD  183

Query  218  ATFATKPAVPDEVLKKAFQIN  156
            A F   P + DE+L KAFQ++
Sbjct  184  AVFGANPPISDEILAKAFQVD  204



>ref|XP_007201148.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
 gb|EMJ02347.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
Length=226

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 138/222 (62%), Gaps = 4/222 (2%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M+   FL+  + +  S    +  SDP PLQD+CVA   N   +F+NG  C +P L  A++
Sbjct  1    MKGVHFLISTLAILASATFLVSASDPSPLQDFCVALNDNKSAVFVNGKFCKDPKLVNAND  60

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F  S L  P NT+N  G NVT  NV  + G+NT G++L R+D AP GL PPHTHPRASE 
Sbjct  61   FFFSGLQNPRNTQNPLGSNVTTVNVDQIAGLNTLGISLTRIDFAPNGLNPPHTHPRASEF  120

Query  419  TIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSS  249
             +VL+G + VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+  +  A+A +GLSS
Sbjct  121  LVVLEGTLYVGFVTSNGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVN-AVAFAGLSS  179

Query  248  QNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            QNPG    + A F +KP +  +VL KAFQ++   V  ++K L
Sbjct  180  QNPGVITIANAVFGSKPPINPDVLAKAFQVDDNVVDYLQKQL  221



>ref|XP_007200183.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
 gb|EMJ01382.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
Length=226

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 139/220 (63%), Gaps = 4/220 (2%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M+   FL+  + +  S    +  SDP PLQD+CVA       +F+NG  C +P L  A++
Sbjct  1    MKGVHFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLVNAND  60

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F  S L  P NT+N  G NVTA NV  L G+NT G++LAR+D AP GL PPHTHPRA+E+
Sbjct  61   FFFSGLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEI  120

Query  419  TIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSS  249
             +VL+G + VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+  +  A+A +GLSS
Sbjct  121  LVVLEGTLYVGFVTSNGDGNRLFTKVLNEGDVFVFPIGLIHFQLNVGHVN-AVAFAGLSS  179

Query  248  QNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRK  129
            QNPG    + A F +KP +  +VL KAFQ++   V  ++K
Sbjct  180  QNPGVITIANAVFGSKPPINPDVLAKAFQVDNNLVDYLQK  219



>ref|XP_009786127.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=229

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 136/215 (63%), Gaps = 10/215 (5%)
 Frame = -1

Query  779  MRIKPFLLK-AIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M +K F+L  AI+  +S +     SDP PLQD+CVA   +   +F+NG  C +P +  A 
Sbjct  1    MALKSFVLTIAILAIVSSISH--ASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNAD  58

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L  PGNT N  G  VTA NV  LPG+NT G++L R+D AP GL PPHTHPRA+E
Sbjct  59   DFFKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATE  118

Query  422  VTIVLKGAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
            V  VL+G + VGFV      +  N+LFT+ L+ GD FVFP  LIHF FN+   K A+A +
Sbjct  119  VLAVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNVGKTK-AVAFA  177

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            GLSSQNPG    +   F + P + D+VL KAFQ++
Sbjct  178  GLSSQNPGVITIANTVFGSDPQINDDVLAKAFQVD  212



>ref|XP_008777189.1| PREDICTED: germin-like protein 3-8 [Phoenix dactylifera]
Length=220

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 135/198 (68%), Gaps = 2/198 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            +SDPDPLQD+CVA+ + T ++ ++G  C      V+ +F ++AL+  GNT N F  NVT+
Sbjct  24   RSDPDPLQDFCVANLQ-TSDVTVDGFPCKQTSSVVSDDFFSTALSIAGNTDNIFSSNVTS  82

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
             +V   PG+NT GL++ RVD APGGL PPH+HPRA+E+ +VL G +LVGF+ TSN  +++
Sbjct  83   ADVRSFPGLNTLGLSMNRVDFAPGGLNPPHSHPRATELGLVLHGQLLVGFISTSNVFYSK  142

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             +  G++FV P+ L+HF +N+   K ALA++  +SQ PG  +  L  F +KPA+P EVL 
Sbjct  143  IVNEGENFVIPRGLVHFQYNVGKEK-ALAITTFNSQLPGVVVAPLTLFGSKPAIPSEVLA  201

Query  173  KAFQINGIDVAKIRKNLG  120
            KAFQ++   V +I+   G
Sbjct  202  KAFQVDQQVVNQIKSKFG  219



>ref|XP_009349816.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=228

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 137/214 (64%), Gaps = 5/214 (2%)
 Frame = -1

Query  752  AIIVCLSFVVELV-KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAK  576
            A +  L+F   L   SDPDPLQD+CVA       +F+NG  C +P LA A++F +  L  
Sbjct  11   AALSVLAFATLLAFASDPDPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRY  70

Query  575  PGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            PGNT N  G  VTA NV  +PG+NT G++ ARVD AP GL PPHTHPRA+E+ IV++G++
Sbjct  71   PGNTLNPVGSIVTAANVDNIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSL  130

Query  395  LVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLT  225
             VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+     ALA++GLSSQNPG    
Sbjct  131  YVGFVTSNGDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTN-ALAIAGLSSQNPGVITI  189

Query  224  SLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            + A F + P +  +VL KAFQ++   V  ++K  
Sbjct  190  ANAVFGSNPPINPDVLAKAFQVDDNVVDYLQKQF  223



>ref|XP_010544125.1| PREDICTED: germin-like protein subfamily 2 member 1 [Tarenaya 
hassleriana]
Length=217

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 130/209 (62%), Gaps = 3/209 (1%)
 Frame = -1

Query  749  IIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPG  570
             ++C +  +    SDPD LQD CVAD  +   +  NG AC NP+    S+F    LA PG
Sbjct  9    FLLCFTLFIISSTSDPDMLQDLCVADLSSGTRV--NGFACKNPNNVTESDFFFGGLANPG  66

Query  569  NTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLV  390
             T NT G  VT  NV  +PG+NT G++L+R+D APGGL PPHTHPRA+E+  +L+G + V
Sbjct  67   LTNNTMGSLVTGANVEKIPGLNTLGVSLSRIDYAPGGLNPPHTHPRATEIIFLLEGTLEV  126

Query  389  GFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATF  210
            GF+ T N+L ++ L+ GD FVFPK L+HF  N   + PA  ++  +SQ PG Q      F
Sbjct  127  GFITTGNKLISKSLKKGDVFVFPKGLVHFQKNNGDV-PASVIAAFNSQLPGTQSLGATLF  185

Query  209  ATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
             + P+VPD VL +AFQI+  ++ KI+   
Sbjct  186  GSTPSVPDNVLSRAFQISTKEIKKIKSRF  214



>ref|XP_006346966.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 135/214 (63%), Gaps = 10/214 (5%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M +K F+L  II  L+ V  +   SDP PLQD+CVA   +   +F+NG  C +P +  A 
Sbjct  1    MALKSFVL--IIAILAVVTSISHASDPSPLQDFCVAINDSMTTVFVNGKVCKDPKVVTAD  58

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L   GNT N  G  VTA NV  LPG+NT G++LAR+D AP GL PPHTHPR +E
Sbjct  59   DFFKSGLNIAGNTSNNVGSAVTAVNVNNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTE  118

Query  422  VTIVLKGAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
            V  VL+G + VGFV      +  N+LFT+ L  GD FVFP  LIHF FN+   K A+A +
Sbjct  119  VLTVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTK-AVAFA  177

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQI  159
            GLSSQNPG    + A F + P++ ++VL KAFQ+
Sbjct  178  GLSSQNPGVITIANAVFGSDPSINNDVLAKAFQV  211



>gb|EMS67056.1| Germin-like protein 12-2 [Triticum urartu]
Length=229

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 137/206 (67%), Gaps = 8/206 (4%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA-  585
            L  AI+  +S   + + SDP PLQD+CVAD  N+  + +NG  C +P    A +F  +A 
Sbjct  11   LFTAILALVS--SQALASDPGPLQDFCVAD--NSSRVLVNGFVCKDPKAVTAEDFFLAAK  66

Query  584  LAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVL  408
            L  P +TK +  G NVT  NV  + G+NT G++LAR+D AP G  PPHTHPRA+E+  VL
Sbjct  67   LDMPRDTKMSKVGSNVTLINVMKIAGLNTLGISLARIDYAPLGENPPHTHPRATEILTVL  126

Query  407  KGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGA  234
            +G + VGFV +   N+LF+Q+LR GD FVFP+ LIHF FN +  KPA+A++ LSSQNPGA
Sbjct  127  EGTLYVGFVTSNPENKLFSQELRKGDVFVFPQGLIHFQFNPNPYKPAVAIAALSSQNPGA  186

Query  233  QLTSLATFATKPAVPDEVLKKAFQIN  156
               + A F +KP + D+VL KAFQ+ 
Sbjct  187  ITIANAVFGSKPMISDDVLAKAFQVE  212



>ref|XP_004249175.1| PREDICTED: putative germin-like protein 2-3 [Solanum lycopersicum]
Length=217

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 139/218 (64%), Gaps = 5/218 (2%)
 Frame = -1

Query  770  KPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFAT  591
            K FLL  +I  LSF   ++  +P PLQD+CVAD   T  +  NG+AC +P    A +F  
Sbjct  3    KHFLLLNLIAVLSFCCVVLAFEPSPLQDFCVADPAGTAKV--NGLACKDPKSVGADDFFF  60

Query  590  SALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
            S L   GNT NTFG  VT  NVA +PG+NT G++LARVD AP G+ PPHTHPRA+E+  V
Sbjct  61   SGLHLAGNTSNTFGSKVTPANVAQIPGLNTLGISLARVDYAPWGINPPHTHPRATEILTV  120

Query  410  LKGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPG  237
            L+G++ VGFV +   NR  T+ L+ GD FVFP  L+H+  N+     A+A++ LSSQNPG
Sbjct  121  LEGSLQVGFVTSNPENRHITKVLKKGDVFVFPVGLVHYQRNVGNGN-AVAIAALSSQNPG  179

Query  236  AQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
                + A F ++PA+  ++L KAFQ++    A+I+   
Sbjct  180  VISIANAIFGSEPAIATDILAKAFQVDATVAAQIQSKF  217



>gb|EYU38444.1| hypothetical protein MIMGU_mgv1a013102mg [Erythranthe guttata]
Length=230

 Score =   186 bits (472),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 129/214 (60%), Gaps = 8/214 (4%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M++    L  + V  SF      SDP PLQD+CVA       +F+NG  C NP+L VA +
Sbjct  1    MKMTLVSLTVVFVLASFATLGYASDPSPLQDFCVAVKDADAAVFVNGKICKNPELVVAED  60

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F    L KPGNT N  G  VT  NV  LPG+NT G++  R+D AP GL PPHTHPRA+E+
Sbjct  61   FIYRGLNKPGNTSNPIGSRVTPVNVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEI  120

Query  419  TIVLKGAVLVGFVDTS-------NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
             +VL+G + VGFV ++       N+LF + L  GD FVFP+ LIHF FN+     A+A +
Sbjct  121  LVVLEGTLYVGFVTSNPANPAIKNKLFAKYLYPGDVFVFPEGLIHFQFNVGKTN-AVAFA  179

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQI  159
            GLSSQNPG    + A F + P +   VL KAFQ+
Sbjct  180  GLSSQNPGVITVANAVFGSDPPINPAVLTKAFQV  213



>ref|XP_002265857.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 136/201 (68%), Gaps = 8/201 (4%)
 Frame = -1

Query  746  IVCLSFVVELVKSDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKP  573
            ++ +SF +    SDP PLQD+CVA  DTK T  +F+NG  C +P +A  ++F  S L  P
Sbjct  14   LLAMSFFLAFA-SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATPNDFFFSGLRVP  70

Query  572  GNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVL  393
            GNT N  G  VT  NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + 
Sbjct  71   GNTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLY  130

Query  392  VGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSL  219
            VGFV ++  NRL ++ L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + 
Sbjct  131  VGFVTSNPDNRLISKVLYKGDVFVFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIAN  189

Query  218  ATFATKPAVPDEVLKKAFQIN  156
            A F +KPA+  +VL KAFQ++
Sbjct  190  AVFGSKPAISADVLTKAFQVD  210



>gb|EMS52045.1| Germin-like protein 12-2 [Triticum urartu]
Length=226

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 137/207 (66%), Gaps = 8/207 (4%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            FLL A+I   S+  + + SDP PLQD+CVAD  N+  +F+NG  C +P    A +F  +A
Sbjct  7    FLLVALIALASW--QAMASDPSPLQDFCVAD--NSSRVFVNGFVCKDPKEVTAEDFFLAA  62

Query  584  -LAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
             L  P +TK +  G  VT  NV  +PG+NT G++LAR+D AP G  PPHTHPRASE+  V
Sbjct  63   KLDMPRDTKMSKVGSIVTLLNVMRIPGLNTLGISLARIDYAPLGENPPHTHPRASEILTV  122

Query  410  LKGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPG  237
            L+G + VGFV +   N+L  + L  GD FVFP+ LIHF FN +  KPA+A++GLSSQNPG
Sbjct  123  LEGTLYVGFVTSNPENKLIWKVLNKGDVFVFPQGLIHFQFNPNPYKPAVAIAGLSSQNPG  182

Query  236  AQLTSLATFATKPAVPDEVLKKAFQIN  156
            A   + A F +KP + D+VL KAFQ+ 
Sbjct  183  AITIANAVFGSKPPISDDVLAKAFQVE  209



>ref|XP_008777190.1| PREDICTED: germin-like protein subfamily T member 1 [Phoenix 
dactylifera]
Length=218

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 136/198 (69%), Gaps = 2/198 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            +SDPDPLQD+CVA+ + T ++ ++G  C      V+ +F ++AL+K  +T N   FNVT+
Sbjct  22   RSDPDPLQDFCVANLQ-TSDVTVDGFPCKQISSVVSDDFFSTALSKGRSTDNILSFNVTS  80

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
             NV   PG+NT GL++ RVD APGGL PPH+HPRA+E+ +V++G +LVGF+ TSN  +++
Sbjct  81   ANVLSFPGLNTLGLSMNRVDFAPGGLNPPHSHPRATELGLVVQGQLLVGFISTSNVFYSK  140

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             +  G++FV P+ L+HF +N+   K ALA++  +SQ PG  + SL  F +KPA+P EVL 
Sbjct  141  IVNEGENFVIPRGLVHFQYNVGKEK-ALAITTFNSQLPGVVVASLTLFGSKPAIPSEVLA  199

Query  173  KAFQINGIDVAKIRKNLG  120
            KAFQ++   V +I    G
Sbjct  200  KAFQVDQQVVNQITSKFG  217



>ref|XP_010911724.1| PREDICTED: putative germin-like protein 2-1 [Elaeis guineensis]
Length=221

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 130/189 (69%), Gaps = 5/189 (3%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            + SDP  LQD+CVAD  +  ++F+NG  C +P +A A +F  S L KPG+T N  G NVT
Sbjct  19   IASDPSQLQDFCVADLHS--DVFVNGFVCKDPKMAKAEDFFFSGLDKPGDTGNKLGSNVT  76

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--SNRL  363
              +V  L G+NT G++LAR+D AP GL PPHTHPR +E+ +VL+G + VGFV +  +N+L
Sbjct  77   LVDVNKLAGLNTLGISLARLDFAPYGLNPPHTHPRGTEILVVLEGTLYVGFVTSNPNNQL  136

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
            F++ L  GD FVFP+ LIHF FN +    A+A++GLSSQNPG    + A F  KP + DE
Sbjct  137  FSKVLHEGDVFVFPQGLIHFQFN-NGKTSAVALAGLSSQNPGVITIANAVFGAKPPISDE  195

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  196  VLAKAFQLD  204



>gb|ABS86851.1| oxalate oxidase [Arachis hypogaea]
 gb|ADD71876.1| germin-like protein subfamily 2 member 1 precursor [Arachis hypogaea]
Length=219

 Score =   185 bits (470),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 138/216 (64%), Gaps = 5/216 (2%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATS  588
            F+   ++V  + V+     SDPD LQD CVADTK+   + +NG  C +     AS+F+++
Sbjct  3    FIGSVLVVTFALVLASTSASDPDALQDLCVADTKS--GVKVNGFTCKDAAKVNASDFSSN  60

Query  587  ALAKPGNTKNT-FGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
             LAKPG   NT FG  VT  NV  +PG+NT G++LAR+D APGGL PPHTHPRA+E+  V
Sbjct  61   ILAKPGVAANTTFGSIVTGANVEKIPGLNTLGVSLARIDYAPGGLNPPHTHPRATEIVFV  120

Query  410  LKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQ  231
            L+G + VGF+ TSN L ++ +  G+ FVFPK L+HF  N +  +PA  +S  +SQ PG Q
Sbjct  121  LEGQLDVGFITTSNVLISKTIYKGEIFVFPKGLVHFQKN-NANEPAAVISAFNSQLPGTQ  179

Query  230  LTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
               L  FA  P VPD VL KAFQ+   ++ KI+  L
Sbjct  180  SIPLTLFAATPPVPDNVLTKAFQVGTKEIEKIKSRL  215



>ref|XP_008393483.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 136/214 (64%), Gaps = 5/214 (2%)
 Frame = -1

Query  752  AIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAK  576
            A +  L+F   L   SDPDPLQD+CVA       +F+NG  C +P LA A++F +  L  
Sbjct  11   AALSVLAFATLLASASDPDPLQDFCVAINNTDSAVFVNGKFCKDPKLASANBFFSDKLRY  70

Query  575  PGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            P NT N  G  VTA NV  +PG+NT G++ ARVD AP GL PPHTHPRA+E+ IV++G++
Sbjct  71   PRNTSNPVGSIVTAANVDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSL  130

Query  395  LVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLT  225
             VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+     ALA++GLSSQNPG    
Sbjct  131  YVGFVTSNGDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTN-ALAIAGLSSQNPGVITI  189

Query  224  SLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            + A F + P +  +VL KAFQ++   V  ++K  
Sbjct  190  ANAVFGSNPPINPDVLAKAFQVDBNVVDYLQKQF  223



>ref|XP_008777188.1| PREDICTED: germin-like protein 3-7 [Phoenix dactylifera]
Length=265

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 136/198 (69%), Gaps = 2/198 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            +SDPDPLQD+CVA+ +   ++ ++G  C      VA +F ++ L+K GNT N+F  N+T+
Sbjct  69   RSDPDPLQDFCVANLR-ASDVAVDGFPCKPTSSVVADDFFSTVLSKEGNTNNSFSSNLTS  127

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
             NV   PG+NT GL++ RVD APGG+ PPH+HPRA+E+  V KG +LVGF+ TSN  +++
Sbjct  128  GNVLSFPGLNTLGLSMNRVDFAPGGVNPPHSHPRAAELVFVAKGRLLVGFISTSNVFYSK  187

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             ++AG+ FV PK L+HF +NM   K ALA++  +SQ PGA +  L+ F +KPA+P +VL 
Sbjct  188  VVKAGEIFVIPKGLMHFQYNMGKKK-ALAITVFNSQLPGAVVAPLSLFGSKPAIPSQVLA  246

Query  173  KAFQINGIDVAKIRKNLG  120
            KAFQ++   V  ++   G
Sbjct  247  KAFQVDQQFVDLVKSKFG  264



>emb|CBI33610.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 131/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A++F  S L  PGNT N  G  VT
Sbjct  119  SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVT  176

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  177  PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  236

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             ++ L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  237  ISKVLYKGDVFVFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  295

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  296  VLTKAFQVD  304



>ref|XP_009388248.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=218

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 131/197 (66%), Gaps = 5/197 (3%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP  LQD CVAD  NT N+F+NG  C +P L  A +F  S L +P NT N  G NVT  N
Sbjct  25   DPGALQDLCVAD--NTSNVFVNGFVCKDPKLVKAEDFFFSGLDQPRNTSNKVGSNVTLLN  82

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
               +PG+NT  +++ARVD AP GL PPH HPRA+E+  VL+G++ VGFV ++  NRL T+
Sbjct  83   ANRIPGLNTLDISMARVDYAPFGLNPPHIHPRATEIQTVLEGSLYVGFVTSNPDNRLVTK  142

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             LR GD FVFP+ LIHF FN  T K A+A+SGLSSQNPG    + + F +KPA+ D++L 
Sbjct  143  VLRKGDVFVFPQGLIHFQFNYGTNK-AVALSGLSSQNPGVITIANSVFGSKPAISDDILA  201

Query  173  KAFQINGIDVAKIRKNL  123
            KA  ++   V +I+ + 
Sbjct  202  KALGVDKKIVDRIQAHF  218



>emb|CAN66771.1| hypothetical protein VITISV_022559 [Vitis vinifera]
Length=205

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 130/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A  ++F  S L  PGNT N  G  VT
Sbjct  9    SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATPNDFFFSGLRVPGNTSNKVGSMVT  66

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  67   PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  126

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             ++ L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  127  ISKVLYKGDVFVFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  185

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  186  VLTKAFQVD  194



>dbj|BAK01981.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 138/206 (67%), Gaps = 8/206 (4%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA-  585
            L  AI+  +S+  +   SDP PLQD+CVAD  NT  + +NG  C +P    A +F  +A 
Sbjct  11   LFAAILALVSW--QAAASDPGPLQDFCVAD--NTSPVVVNGFVCKDPKAVTAEDFFLAAK  66

Query  584  LAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVL  408
            L  P +TK +  G NVT  NV  + G+NT G++LAR+D AP G  PPHTHPRA+E+  VL
Sbjct  67   LDMPRDTKMSKVGSNVTLINVMKIAGLNTLGISLARIDYAPLGENPPHTHPRATEILTVL  126

Query  407  KGAVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGA  234
            +G + VGFV ++  N+LF+++LR GD FVFP+ LIHF FN +  KPA+A++ LSSQNPGA
Sbjct  127  EGTLYVGFVTSNPKNKLFSKELRKGDVFVFPQGLIHFQFNPNPYKPAVAIAALSSQNPGA  186

Query  233  QLTSLATFATKPAVPDEVLKKAFQIN  156
               + A F +KP + D+VL KAFQ+ 
Sbjct  187  ITIANAVFGSKPMISDDVLAKAFQVE  212



>ref|XP_006362217.1| PREDICTED: putative germin-like protein 2-3-like [Solanum tuberosum]
Length=217

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 139/218 (64%), Gaps = 5/218 (2%)
 Frame = -1

Query  770  KPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFAT  591
            K FLL  +I  +SF   ++  +P P+QD+CVAD  +T  +  NG++C +P   +A +F  
Sbjct  3    KHFLLLNLIAVVSFCCVVIAFEPSPMQDFCVADPTSTVKV--NGLSCKDPKSVIAEDFFF  60

Query  590  SALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
            S L   GNT NTFG  VT  NVA +PGVNT G++LARVD AP G+ PPHTHPRA+E+  V
Sbjct  61   SGLHLSGNTSNTFGSKVTPANVAQIPGVNTLGISLARVDYAPWGINPPHTHPRATEILTV  120

Query  410  LKGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPG  237
            L+G + VGFV +   NR  T+ L+ GD FVFP  L+H+  N+     A+A + LSSQNPG
Sbjct  121  LEGFLQVGFVTSNPENRHITKVLKKGDVFVFPIGLVHYQRNVGNGN-AVAFAALSSQNPG  179

Query  236  AQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
                + A F ++P +  ++L KAFQ++   VA+I+   
Sbjct  180  VISVANAVFGSEPTIATDILAKAFQVDATVVAQIQSKF  217



>gb|EYU28622.1| hypothetical protein MIMGU_mgv1a018753mg [Erythranthe guttata]
Length=230

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 128/214 (60%), Gaps = 8/214 (4%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M++    L  + V   F      SDP PLQD+CVA       +F+NG  C NPDL VA +
Sbjct  1    MKMTLVSLTVVFVLAYFATLGYASDPSPLQDFCVAVKDADAAVFVNGKICKNPDLVVAED  60

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F    L KPGNT N  G  VT  NV  LPG+NT G++  R+D AP GL PPHTHPRA+E+
Sbjct  61   FIYRGLNKPGNTSNPIGSRVTPVNVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEI  120

Query  419  TIVLKGAVLVGFVDTS-------NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
             +VL+G + VGFV ++       N+LFT+ L  GD FVFP+ LIHF FN+     A+A +
Sbjct  121  LVVLEGTLYVGFVTSNPANPAIKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTN-AVAFA  179

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQI  159
             LSSQNPG    + A F + P +   VL KAFQ+
Sbjct  180  ALSSQNPGVITVANAVFGSDPPINPAVLTKAFQV  213



>ref|XP_006290312.1| hypothetical protein CARUB_v10019262mg [Capsella rubella]
 gb|EOA23210.1| hypothetical protein CARUB_v10019262mg [Capsella rubella]
Length=220

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 126/202 (62%), Gaps = 2/202 (1%)
 Frame = -1

Query  737  LSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKN  558
            LSF V  +  DPD LQD CVAD+  T  + +NG  C       AS+F  + + KP    N
Sbjct  13   LSFTVIALAYDPDTLQDLCVADS--TSGIKVNGFTCKPESNITASDFFYAGIGKPAVVSN  70

Query  557  TFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVD  378
            T G  VT  NV  + G+NT G++LAR+D APGGL PPHTHPRA+EV  VL+G + VGF+ 
Sbjct  71   TVGSAVTGANVEKIAGLNTLGVSLARIDYAPGGLNPPHTHPRATEVIFVLEGELDVGFIT  130

Query  377  TSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKP  198
            T+N+LF + ++ G+ FVFP+ L+H+  N D  KPA  +S  +SQ PG Q  +   F   P
Sbjct  131  TANKLFAKTVKKGEVFVFPRGLVHYQKNNDKAKPASVISAFNSQLPGTQSIAATLFTATP  190

Query  197  AVPDEVLKKAFQINGIDVAKIR  132
            A+PD VL  AFQI   ++ KI+
Sbjct  191  AIPDHVLTTAFQIGTKEIEKIK  212



>ref|XP_002276644.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 132/202 (65%), Gaps = 4/202 (2%)
 Frame = -1

Query  752  AIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAK  576
            A IV L+    +   SDP PLQD+CVA      ++F+NG  C +P LA  ++F  S L  
Sbjct  10   AYIVLLAMAFSVASASDPSPLQDFCVAVNDTNDSVFVNGKFCKDPKLATPNDFFFSGLRV  69

Query  575  PGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            PGNT N  G  VT  NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G +
Sbjct  70   PGNTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTL  129

Query  395  LVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTS  222
             VGFV ++  NRL ++ L  GD FVFP+ LIHF  N+     A+A++ LSSQNPG    +
Sbjct  130  YVGFVTSNPDNRLISKVLYKGDVFVFPQGLIHFQLNVGKTN-AVAIASLSSQNPGVITIA  188

Query  221  LATFATKPAVPDEVLKKAFQIN  156
             A F +KPA+  +VL KAFQ++
Sbjct  189  NAVFGSKPAISADVLTKAFQVD  210



>ref|XP_008240380.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=227

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 134/214 (63%), Gaps = 5/214 (2%)
 Frame = -1

Query  752  AIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAK  576
            +I+  L+    LV  SDP PLQD+CVA       +F+NG  C +P L  A++F  S L  
Sbjct  10   SIVATLALATFLVSASDPSPLQDFCVAINNTESAVFVNGKFCKDPKLVTANDFFFSGLRI  69

Query  575  PGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            PGNT N  G  VT  NV  + G+NT G++LAR+D AP GL PPHTHPR +E  IVL+G +
Sbjct  70   PGNTSNPVGSFVTPANVEQIAGLNTLGISLARIDFAPNGLNPPHTHPRGTEFLIVLEGTL  129

Query  395  LVGFVDT---SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLT  225
             VGFV +   +NRLFT+ L  GD FVFP  LIHF  N+  +  ALAV+GLSSQNPG    
Sbjct  130  YVGFVSSNGDNNRLFTKVLNKGDVFVFPVGLIHFQLNVGHVN-ALAVAGLSSQNPGVITI  188

Query  224  SLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            + A F + P +  +VL KAFQI+  +V  ++K  
Sbjct  189  ANAVFGSNPPINPDVLAKAFQIDDKEVEYLQKQF  222



>ref|XP_010463900.1| PREDICTED: germin-like protein subfamily 1 member 6 [Camelina 
sativa]
Length=227

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 132/205 (64%), Gaps = 6/205 (3%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKS-DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            LL A ++ L+     V   DP PLQD+CVA  + T  +F+NG  C +P    A++F+ S 
Sbjct  7    LLAAHVILLALSYSFVYCYDPSPLQDFCVAANE-TNRVFVNGKVCKDPKSVTANDFSYSG  65

Query  584  LAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLK  405
            L  PGNT +  G NVT  NV  +PG+NT G++ AR+D A  GL+PPH HPRASE+ +V K
Sbjct  66   LNIPGNTTSFMGSNVTTVNVNKIPGLNTLGVSFARLDFAREGLIPPHIHPRASEILMVTK  125

Query  404  GAVLVGFVDT---SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGA  234
            G +LVGFV +   +NRLF++ LR GD FVFP  LIHF  N+   + A+A +G  SQNPG 
Sbjct  126  GTLLVGFVSSNQDNNRLFSKVLRTGDVFVFPIGLIHFQMNIGRTR-AVAFAGFGSQNPGT  184

Query  233  QLTSLATFATKPAVPDEVLKKAFQI  159
               + A F + P++P EVL KAFQ+
Sbjct  185  ITIADAVFGSSPSIPREVLAKAFQL  209



>ref|XP_007200176.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
 gb|EMJ01375.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
Length=226

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 142/223 (64%), Gaps = 6/223 (3%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKS-DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M+   FL+  + + L+F   L  + DP PLQD+CVA       +F+NG  C +P LA A+
Sbjct  1    MKGDHFLIITLAI-LAFATFLASAYDPSPLQDFCVAVKDIKSGVFVNGKFCKDPKLANAN  59

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L  P NTKN  G NVTA NV  L G+NT G++LAR+D AP GL PPHTHPRA+E
Sbjct  60   DFFFSGLQNPRNTKNPVGSNVTAVNVDNLEGLNTLGISLARIDFAPNGLNPPHTHPRATE  119

Query  422  VTIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLS  252
            + +VL+G + VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+  +  A+A +GLS
Sbjct  120  ILVVLEGTLYVGFVTSNGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVN-AVAFAGLS  178

Query  251  SQNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            SQNPG    + A F +KP +  +VL KAFQ++   V  ++K  
Sbjct  179  SQNPGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQF  221



>ref|XP_002276315.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 137/215 (64%), Gaps = 4/215 (2%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSAL  582
            L   +++ ++F V    SDP PLQD+CVA       +F+NG  C +P LA  ++F  S L
Sbjct  9    LSYVVLLAMAFSVA-SASDPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLATPNDFFFSGL  67

Query  581  AKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
              PGNT N  G  VT  NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G
Sbjct  68   RVPGNTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEG  127

Query  401  AVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQL  228
             + VGFV ++  NRL ++ L  GD FVFP+ LIHF  N+     A+A++ LSSQNPG   
Sbjct  128  TLYVGFVTSNPDNRLISKVLYKGDVFVFPQGLIHFQLNVGKTN-AVAIASLSSQNPGVIT  186

Query  227  TSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
             + A F +KPA+  +VL KAFQ++  +V  ++   
Sbjct  187  IANAVFGSKPAISADVLTKAFQVDKNEVNYLQSQF  221



>ref|XP_006349267.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 134/215 (62%), Gaps = 10/215 (5%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M +K F+L  II  L+ V  +   SDP PLQD+CVA   +   +F+NG  C +P +  A 
Sbjct  1    MALKSFVL--IIAILAVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDPRVVTAD  58

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L   GNT N  G  VTA NV  LPG+NT G++L R+D AP GL PPHTHPR +E
Sbjct  59   DFFKSGLNVAGNTSNNVGSAVTAVNVNNLPGLNTLGISLVRIDYAPYGLNPPHTHPRGTE  118

Query  422  VTIVLKGAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
            V  VL+G + VGFV      +  N+LFT+ L  GD FVFP  LIHF FN+   K A+A +
Sbjct  119  VLTVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTK-AVAFA  177

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            GLSSQNPG    + A F + P + D++L KAFQ++
Sbjct  178  GLSSQNPGVITIANAVFGSDPPINDDILAKAFQVD  212



>ref|XP_002277055.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
 emb|CBI38542.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 131/198 (66%), Gaps = 3/198 (2%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDP PLQD+CVA       +F+NG  C +P LA  ++F+ S L  PGNT N  G  VT  
Sbjct  25   SDPSPLQDFCVAVNDTNAAVFVNGKFCQDPKLATPNDFSFSGLRLPGNTSNQLGSMVTPA  84

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFT  357
            +VA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL +
Sbjct  85   SVAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRLIS  144

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            + L  GD FVFP+ LIHF  N+ T   A+A++ LSSQNPG    + A F +KPA+  +VL
Sbjct  145  KVLYKGDVFVFPQGLIHFQLNVGTTN-AVAIASLSSQNPGVITIARAVFGSKPAISVDVL  203

Query  176  KKAFQINGIDVAKIRKNL  123
             KAFQ++   VA ++   
Sbjct  204  TKAFQLDKDVVANLQSKF  221



>ref|XP_006362216.1| PREDICTED: putative germin-like protein 2-3-like [Solanum tuberosum]
Length=217

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/218 (45%), Positives = 140/218 (64%), Gaps = 5/218 (2%)
 Frame = -1

Query  770  KPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFAT  591
            K FLL  +I  LSF   ++  +P P+QD+CVAD  +T  +  NG++C +P   +A +F  
Sbjct  3    KHFLLLNLIAVLSFCCVVLAFEPSPMQDFCVADPISTVKV--NGLSCKDPKSVIAEDFFF  60

Query  590  SALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
            S L   GNT NTFG  VT  NVA +PG+NT G++LARVD AP G+ PPHTHPRA+E+  V
Sbjct  61   SGLHLAGNTSNTFGSKVTPANVAQIPGLNTLGISLARVDYAPWGINPPHTHPRATEIVTV  120

Query  410  LKGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPG  237
            L+G++ VGFV +   N   T+ L+ GD FVFP  L+H+  N+     A+A++ LSSQNPG
Sbjct  121  LEGSLQVGFVTSNPENHHITKVLKKGDVFVFPIGLVHYQRNVGNGN-AVAIAALSSQNPG  179

Query  236  AQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
                + A F ++PA+  ++L KAFQ++   V +I+   
Sbjct  180  VISIANAVFGSEPAIATDILAKAFQVDATVVGQIQSKF  217



>gb|EMS45228.1| Germin-like protein 8-9 [Triticum urartu]
Length=226

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 137/207 (66%), Gaps = 8/207 (4%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            FLL A+I   S+  + + SDP PLQD+CVAD  N+ ++ +NG  C +P    A +F  +A
Sbjct  7    FLLVALIALASW--QAMASDPSPLQDFCVAD--NSSHVLVNGFVCKDPKEVTAEDFFLAA  62

Query  584  -LAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
             L  P +TK +  G  VT  NV  +PG+NT G++LAR+D AP G  PPHTHPRASE+  V
Sbjct  63   KLDMPRDTKMSKVGSIVTLLNVMRIPGLNTLGISLARIDYAPLGENPPHTHPRASEILTV  122

Query  410  LKGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPG  237
            L+G + VGFV +   N+L  + L  GD FVFP+ LIHF FN +  KPA+A++GLSSQNPG
Sbjct  123  LEGTLYVGFVTSNPENKLIWKVLNKGDVFVFPQGLIHFQFNPNPYKPAVAIAGLSSQNPG  182

Query  236  AQLTSLATFATKPAVPDEVLKKAFQIN  156
            A   + A F +KP + D+VL KAFQ+ 
Sbjct  183  AITIANAVFGSKPPISDDVLAKAFQVE  209



>ref|XP_009116872.1| PREDICTED: germin-like protein subfamily 2 member 4 [Brassica 
rapa]
Length=220

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 127/207 (61%), Gaps = 2/207 (1%)
 Frame = -1

Query  743  VCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNT  564
            V LS  V  +  DPD LQD CVAD   T  + +NG  C       AS+F  + ++KP   
Sbjct  11   VLLSLAVISLAYDPDTLQDLCVAD--RTSGIKVNGFICKPESNITASDFFFAGISKPAVV  68

Query  563  KNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGF  384
             NT G  VT  NV  + G+NT G++LAR+D APGGL PPHTHPRA+EV  VL+G + VGF
Sbjct  69   NNTVGSAVTGANVEKIAGLNTLGVSLARIDYAPGGLNPPHTHPRATEVIFVLEGELDVGF  128

Query  383  VDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFAT  204
            + T+N+LF + ++ G+ FVFP+ LIH+  N D  KPA  +S  +SQ PG Q  +   F  
Sbjct  129  ITTANKLFAKTVKKGEVFVFPRGLIHYQKNNDKAKPASVISAFNSQLPGTQSMAATLFTA  188

Query  203  KPAVPDEVLKKAFQINGIDVAKIRKNL  123
             PA+PD VL  AFQI   ++ KI+  L
Sbjct  189  SPAIPDHVLTTAFQIGTKEIEKIKSKL  215



>emb|CDY11392.1| BnaA09g39580D [Brassica napus]
Length=220

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 127/207 (61%), Gaps = 2/207 (1%)
 Frame = -1

Query  743  VCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNT  564
            V LS  V  +  DPD LQD CVAD   T  + +NG  C       AS+F  + ++KP   
Sbjct  11   VLLSLAVISLAYDPDTLQDLCVAD--RTSGIKVNGFICKPESNITASDFFFAGISKPAVV  68

Query  563  KNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGF  384
             NT G  VT  NV  + G+NT G++LAR+D APGGL PPHTHPRA+EV  VL+G + VGF
Sbjct  69   NNTVGSAVTGANVEKIAGLNTLGVSLARIDYAPGGLNPPHTHPRATEVIFVLEGELDVGF  128

Query  383  VDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFAT  204
            + T+N+LF + ++ G+ FVFP+ LIH+  N D  KPA  +S  +SQ PG Q  +   F  
Sbjct  129  ITTANKLFAKTVKKGEVFVFPRGLIHYQKNNDKEKPASVISAFNSQLPGTQSMAATLFTA  188

Query  203  KPAVPDEVLKKAFQINGIDVAKIRKNL  123
             PA+PD VL  AFQI   ++ KI+  L
Sbjct  189  SPAIPDHVLTTAFQIGTKEIEKIKSKL  215



>ref|XP_002270404.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 128/201 (64%), Gaps = 4/201 (2%)
 Frame = -1

Query  752  AIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAK  576
            A +V L+        SDP PLQD+CVA       +F+NG  C +P LA  ++F  S L  
Sbjct  10   AYVVLLAMAFSFASASDPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLATPNDFFFSGLRL  69

Query  575  PGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            PGNT N  G  VT  NVA +PG+NT G++LARVD AP GL PPH HPRA+E+  VL+G +
Sbjct  70   PGNTSNKLGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHIHPRATEILTVLEGTL  129

Query  395  LVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTS  222
             VGFV +   NRL ++ L  GD FVFP+ LIHF  N+ T   A+A++ LSSQNPG    +
Sbjct  130  YVGFVTSNPENRLISKVLYKGDVFVFPQGLIHFQLNVGTTN-AVAIASLSSQNPGVITIA  188

Query  221  LATFATKPAVPDEVLKKAFQI  159
             A F +KPA+  +VL KAFQ+
Sbjct  189  KAVFGSKPAISADVLTKAFQV  209



>ref|XP_006402421.1| hypothetical protein EUTSA_v10006227mg [Eutrema salsugineum]
 gb|ESQ43874.1| hypothetical protein EUTSA_v10006227mg [Eutrema salsugineum]
Length=220

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 125/205 (61%), Gaps = 2/205 (1%)
 Frame = -1

Query  737  LSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKN  558
            LS  V  +  DPD LQD CVAD   T  L +NG  C       AS+F  + + KP    N
Sbjct  13   LSLTVVALAYDPDTLQDLCVAD--RTSGLKVNGFTCKPESNITASDFFFAGIGKPAVVNN  70

Query  557  TFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVD  378
            T G  VT  NV  + G+NT G++LAR+D APGGL PPHTHPRA+EV  VL+G + VGF+ 
Sbjct  71   TVGSAVTGANVEKIAGLNTLGVSLARIDYAPGGLNPPHTHPRATEVIFVLEGELDVGFIT  130

Query  377  TSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKP  198
            T+N+LF + ++ G+ FVFP+ L+H+  N D  KPA  +S  +SQ PG Q  +   F   P
Sbjct  131  TANKLFAKTVKKGEVFVFPRGLVHYQKNNDKAKPASVISAFNSQLPGTQSIAATLFTANP  190

Query  197  AVPDEVLKKAFQINGIDVAKIRKNL  123
            A+PD VL  AFQI   +V KI+  L
Sbjct  191  AIPDHVLTTAFQIGTKEVEKIKSKL  215



>gb|KHN26213.1| Germin-like protein 5-1 [Glycine soja]
Length=224

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 128/198 (65%), Gaps = 3/198 (2%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            + SDPD LQD CVAD  +   + +NG  C       AS+F ++ LAKPG T NTFG  VT
Sbjct  26   ISSDPDLLQDLCVADLAS--GVKVNGFTCKEASKVNASDFFSNILAKPGATNNTFGSLVT  83

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
              NV  +PG+NT G++L+R+D APGG+ PPHTHPRA+E+  VL+G + VGF+ TSN L +
Sbjct  84   GANVQKVPGLNTLGVSLSRIDYAPGGINPPHTHPRATELVFVLEGQLYVGFITTSNVLIS  143

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            + +  GD FVFPK L+HF  N +   PA  +S  +SQ PG Q T+   FA  P+VPD VL
Sbjct  144  KTINKGDVFVFPKGLLHFQKN-NAKVPAAVISAFNSQLPGTQSTATTLFAATPSVPDHVL  202

Query  176  KKAFQINGIDVAKIRKNL  123
             + FQ+   +V KI+  L
Sbjct  203  TQTFQVGTKEVQKIKSRL  220



>gb|EYU20535.1| hypothetical protein MIMGU_mgv1a013054mg [Erythranthe guttata]
Length=231

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 131/219 (60%), Gaps = 8/219 (4%)
 Frame = -1

Query  758  LKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALA  579
            L  I+V  SF      SDP PLQD+CVA       +F+NG  C NP++ VA +F    L 
Sbjct  9    LTTILVVASFATLGFASDPSPLQDFCVAVNDAQSAVFVNGKVCKNPNMVVAEDFLFRGLN  68

Query  578  KPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGA  399
            KPGNT N  G  VT  NV  LPG+NT G++  R+D AP GL PPHTHPRA+E+ +V++G 
Sbjct  69   KPGNTSNPLGSRVTPVNVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVIEGT  128

Query  398  VLVGFVDTS-------NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNP  240
            + VGFV ++       N+LFT+ L  GD FVFP+ LIHF FN+     A+A +GLSSQNP
Sbjct  129  LYVGFVTSNPANPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTN-AVAFAGLSSQNP  187

Query  239  GAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
                 + A F + P +   VL KAFQ+    +  ++K  
Sbjct  188  SVITIANAVFGSDPPINPAVLTKAFQVEKNVIDYLQKQF  226



>ref|XP_002276756.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 132/202 (65%), Gaps = 4/202 (2%)
 Frame = -1

Query  752  AIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAK  576
            A IV L+    +   SDP PLQD+CVA      ++F+NG  C +P LA  ++F  S L  
Sbjct  10   AYIVLLAMAFSVASASDPSPLQDFCVAVNDTNDSVFVNGKFCKDPKLATPNDFFFSGLRV  69

Query  575  PGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            PGNT N  G  VT  NVA +PG+NT G++LARVD AP GL PPH+HPRA+E+  VL+G +
Sbjct  70   PGNTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHSHPRATEILTVLEGTL  129

Query  395  LVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTS  222
             VGFV ++  NRL ++ L  GD FVFP+ LIHF  N+     A+A++ LSSQNPG    +
Sbjct  130  YVGFVTSNPDNRLISKVLHKGDVFVFPQGLIHFQLNVGKTN-AVAIASLSSQNPGVITIA  188

Query  221  LATFATKPAVPDEVLKKAFQIN  156
             A F +KPA+  +VL KAFQ++
Sbjct  189  NAVFGSKPAISADVLTKAFQVD  210



>ref|NP_001239734.1| germin-like protein 5-1-like precursor [Glycine max]
 gb|ACG69495.1| germin-like protein 19 [Glycine max]
Length=218

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 128/198 (65%), Gaps = 3/198 (2%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            + SDPD LQD CVAD  +   + +NG  C       AS+F ++ LAKPG T NTFG  VT
Sbjct  20   ISSDPDLLQDLCVADLAS--GVKVNGFTCKEASKVNASDFFSNILAKPGATNNTFGSLVT  77

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFT  357
              NV  +PG+NT G++L+R+D APGG+ PPHTHPRA+E+  VL+G + VGF+ TSN L +
Sbjct  78   GANVQKVPGLNTLGVSLSRIDYAPGGINPPHTHPRATELVFVLEGQLYVGFITTSNVLIS  137

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            + +  GD FVFPK L+HF  N +   PA  +S  +SQ PG Q T+   FA  P+VPD VL
Sbjct  138  KTINKGDIFVFPKGLLHFQKN-NAKVPAAVISAFNSQLPGTQSTATTLFAATPSVPDHVL  196

Query  176  KKAFQINGIDVAKIRKNL  123
             + FQ+   +V KI+  L
Sbjct  197  TQTFQVGTKEVQKIKSRL  214



>ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 134/216 (62%), Gaps = 14/216 (6%)
 Frame = -1

Query  779  MRIKPFLLK-AIIVCLSFVVELVKSDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAV  609
            M  K  +L  AI+  LS +     SDP PLQD+CVA  DTKN   +F+NG  C +P L V
Sbjct  1    MAFKSLILAIAIMAVLSSMSH--ASDPSPLQDFCVAVDDTKNA--VFVNGKFCKDPKLVV  56

Query  608  ASNFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRA  429
            A +F  S L  PGNT N  G  VT  NV  LPG+NT G++LAR+D AP GL PPHTHPR 
Sbjct  57   AEDFFKSGLNMPGNTSNNVGSAVTPVNVNNLPGLNTLGISLARIDYAPYGLNPPHTHPRG  116

Query  428  SEVTIVLKGAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALA  267
            +E  +VL+G + VGFV      +  N+LFT+ L  GD FVFP  LIHF FN    K  +A
Sbjct  117  TEFLVVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNPGKTK-TVA  175

Query  266  VSGLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQI  159
             +GLSSQNPG    + A F + P + D+VL KAFQI
Sbjct  176  FAGLSSQNPGVITIANAVFGSDPPINDDVLAKAFQI  211



>ref|XP_002267617.1| PREDICTED: putative germin-like protein 2-2 [Vitis vinifera]
Length=215

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 128/186 (69%), Gaps = 5/186 (3%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            +P PLQD+CVAD  ++  +  NG+AC++  LA A +F+ + L  PGNT N  G  VT   
Sbjct  22   EPSPLQDFCVADPASSARV--NGLACMDSKLAQAGHFSFAGLHVPGNTSNPLGSRVTPVT  79

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
            V  LPG+NT G+++AR+D AP G++PPHTHPRASE+  VL+G++ VGFV ++  NRL T+
Sbjct  80   VGQLPGLNTLGISIARIDYAPQGVIPPHTHPRASEILTVLEGSLQVGFVTSNPDNRLITK  139

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             LR GD FVFP  L HF +NM   K A+++S LSSQNPG    + A F + P + D+VL 
Sbjct  140  DLRKGDVFVFPVGLPHFQWNMAGGK-AVSLSALSSQNPGVNTIANAVFGSNPGIADDVLA  198

Query  173  KAFQIN  156
            KAFQ++
Sbjct  199  KAFQVD  204



>ref|XP_007163279.1| hypothetical protein PHAVU_001G221200g [Phaseolus vulgaris]
 gb|ESW35273.1| hypothetical protein PHAVU_001G221200g [Phaseolus vulgaris]
Length=217

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 129/196 (66%), Gaps = 3/196 (2%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDPDPLQD CVAD  +   + +NG  C +     AS+F +  LAKPG T NT+G  VT  
Sbjct  22   SDPDPLQDLCVADLASA--VKVNGFTCKDAAKVNASDFFSDILAKPGATNNTYGSLVTGA  79

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQ  351
            NV  +PG+NT G++L+RVD APGG+ PPHTHPRA+E+  VL+G + VGF+ T+N L ++ 
Sbjct  80   NVQKIPGLNTLGVSLSRVDYAPGGINPPHTHPRATEIVFVLEGTLDVGFITTANVLISKT  139

Query  350  LRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKK  171
            +  G+ FVFPK L+HF  N +  +PA  ++  +SQ PG Q  +L  FA  P VPD VL K
Sbjct  140  IYKGEIFVFPKGLVHFQKN-NAKEPASVLAAFNSQLPGTQSIALTLFAATPPVPDNVLTK  198

Query  170  AFQINGIDVAKIRKNL  123
            AFQ+   +V KI+  L
Sbjct  199  AFQVGTKEVQKIKSRL  214



>gb|AAM28275.1| germin-like protein [Ananas comosus]
Length=222

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 138/217 (64%), Gaps = 2/217 (1%)
 Frame = -1

Query  770  KPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFAT  591
            KP  L  +   +  ++   ++DPDPLQD+CVA+ + T ++ ++G  C      V+ +F  
Sbjct  7    KPRSLLILFATIFLIISSCRADPDPLQDFCVANLQAT-DITVDGFPCKPTSSVVSDDFFF  65

Query  590  SALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
            S L+ PGNT N FG N+T  NVA  PG+NT GL++ RVDL PGG+ P H+HPRA+E+  +
Sbjct  66   SGLSAPGNTNNMFGSNITQANVANFPGLNTLGLSMNRVDLVPGGINPLHSHPRATELGFI  125

Query  410  LKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQ  231
            L+G VLVGFV T+N  +++ ++AG+SFV P+ L+HF FN+ T   A+ ++   SQ PG  
Sbjct  126  LQGEVLVGFVSTANAFYSKTVKAGESFVIPRGLVHFQFNVGTGN-AVVITAFDSQLPGVV  184

Query  230  LTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNLG  120
            L     F + PA+P++VL K FQ++   +  ++   G
Sbjct  185  LAPFTLFGSTPAIPNDVLTKTFQVDQSVINLLKSKFG  221



>gb|AJA71634.1| germin-like protein [Triticum aestivum]
Length=229

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 137/206 (67%), Gaps = 8/206 (4%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA-  585
            L  AI+  +S+  + + SDP PLQD+CVAD  N+  + +NG  C +P    A +F  +A 
Sbjct  11   LFTAILALVSW--QALASDPGPLQDFCVAD--NSSRVLVNGFVCKDPKAVTAEDFFLAAK  66

Query  584  LAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVL  408
            L  P +T+ +  G NVT  NV  + G+NT G++LAR+D AP G  PPHTHPRA E+  VL
Sbjct  67   LDMPRDTQMSKVGSNVTLINVMKIAGLNTLGISLARIDYAPLGENPPHTHPRAIEILTVL  126

Query  407  KGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGA  234
            +G + VGFV +   N+LF+++LR GD FVFP+ LIHF FN +  KPA+A++ LSSQNPGA
Sbjct  127  EGTLYVGFVTSNPENKLFSKELRKGDVFVFPQGLIHFQFNPNPYKPAVAIAALSSQNPGA  186

Query  233  QLTSLATFATKPAVPDEVLKKAFQIN  156
               + A F +KP + D+VL KAFQ+ 
Sbjct  187  ITIANAVFGSKPMISDDVLAKAFQVE  212



>ref|XP_007199217.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
 gb|EMJ00416.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
Length=226

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 142/223 (64%), Gaps = 6/223 (3%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKS-DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M+   FL+ + +  L+F   L  + DP PLQD+CVA       +F+NG  C +P LA A+
Sbjct  1    MKGDHFLI-STLAFLAFATFLASAYDPSPLQDFCVALKDIKDGVFVNGKFCKDPKLANAN  59

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L  P NT+N  G NVTA NV  L G+NT G++LAR+D AP GL PPHTHPRA+E
Sbjct  60   DFFFSGLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATE  119

Query  422  VTIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLS  252
            + +VL+G + VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+  +  A+A +GLS
Sbjct  120  ILVVLEGTLYVGFVTSNGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVN-AVAFAGLS  178

Query  251  SQNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            SQNPG    + A F +KP +  +VL KAFQ++   V  ++K  
Sbjct  179  SQNPGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQF  221



>ref|XP_011034445.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
 ref|XP_011038441.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 130/200 (65%), Gaps = 7/200 (4%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD+CVA    T  +F+NG  C +P    A +F +S L  PG+T    G NVTA N
Sbjct  24   DPSPLQDFCVA-VDETDGVFVNGKFCKDPKDVTAKDFFSSGLNIPGDTSGRVGSNVTAVN  82

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS-----NRL  363
            V  +PG+NT G++LAR+D AP GL PPHTHPRA+E+ +V++G + VGFV ++     NRL
Sbjct  83   VEKIPGLNTLGISLARIDFAPYGLNPPHTHPRATEIIVVVEGTLYVGFVTSNLANGDNRL  142

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             T+ L+ GD FVFP  LIHF FNM   K ALA +GLSSQNPG    + A F + P +  +
Sbjct  143  ITKALKPGDVFVFPIGLIHFQFNMGQTK-ALAFAGLSSQNPGVITIANAVFGSDPPINPD  201

Query  182  VLKKAFQINGIDVAKIRKNL  123
            VL KAFQ++   V  ++K+ 
Sbjct  202  VLAKAFQLDKKVVEYLQKSF  221



>ref|XP_008237521.1| PREDICTED: germin-like protein subfamily 1 member 16 [Prunus 
mume]
Length=234

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 143/228 (63%), Gaps = 12/228 (5%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVA--DTKNTKN------LFLNGVACIN  624
            M+   FL+  + +  S    +  SDP PLQD+CVA  DTK+         +F+NG  C +
Sbjct  1    MKGVHFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAGGYFGAGAVFVNGKFCKD  60

Query  623  PDLAVASNFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPH  444
            P L  A++F  S L  P NT+N  G NVTA NV  L G+NT G++LAR+D AP GL PPH
Sbjct  61   PKLVNANDFFFSGLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPH  120

Query  443  THPRASEVTIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPA  273
            THPRA+E+ +VL+G + VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+  +  A
Sbjct  121  THPRATEILVVLEGTLYVGFVTSNGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGYVN-A  179

Query  272  LAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRK  129
            +A +GLSSQNPG    + A F +KP +  +VL KAFQ++   V  ++K
Sbjct  180  VAFAGLSSQNPGVITIANAVFGSKPPINPDVLAKAFQVDNNVVDYLQK  227



>ref|XP_010251866.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 3/191 (2%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFN  543
            + + SDP PLQD+CVA       +F+NG  C NP    A +F  S L KPGNT N+ G  
Sbjct  17   QALASDPSPLQDFCVAIKDTDSRVFVNGKFCKNPYYTTADDFFFSGLDKPGNTSNSVGSK  76

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--N  369
            VT  NV  LPG+NT G+++AR+D AP GL P H HPRA++V +VL+G + V FV ++  N
Sbjct  77   VTPVNVMQLPGLNTLGISMARIDYAPYGLNPLHMHPRATKVLVVLEGTLYVSFVTSNLDN  136

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
            RLFT+ L  GD FVFPK LIHF FN+     A+A +GLSSQNPG    + A F  KP + 
Sbjct  137  RLFTKVLNKGDVFVFPKGLIHFQFNVGHTN-AVAFAGLSSQNPGTITIANAVFEAKPPIK  195

Query  188  DEVLKKAFQIN  156
            ++VL KAFQ++
Sbjct  196  NDVLAKAFQVD  206



>ref|XP_007210592.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
 gb|EMJ11791.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
Length=227

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 133/214 (62%), Gaps = 5/214 (2%)
 Frame = -1

Query  752  AIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAK  576
            +I+  L+    LV  SDP PLQD+CVA       +F+NG  C +P    A++F  S L  
Sbjct  10   SIVATLALATFLVSASDPSPLQDFCVAINNTESAVFVNGKFCKDPKFVTANDFFFSGLRI  69

Query  575  PGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            PGNT N  G  VT  NV  + G+NT G++LAR+D AP GL PPHTHPR +E  IVL+G +
Sbjct  70   PGNTSNPVGSFVTPANVEQIAGLNTLGISLARIDFAPNGLNPPHTHPRGTEFLIVLEGTL  129

Query  395  LVGFVDT---SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLT  225
             VGFV +   +NRLFT+ L  GD FVFP  LIHF  N+  +  ALAV+GLSSQNPG    
Sbjct  130  YVGFVTSNGDNNRLFTKVLNKGDVFVFPVGLIHFQLNVGHVN-ALAVAGLSSQNPGVITI  188

Query  224  SLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            + A F + P +  +VL KAFQI+  +V  ++K  
Sbjct  189  ANAVFGSNPPINPDVLAKAFQIDDKEVEYLQKQF  222



>ref|XP_006576138.1| PREDICTED: germin-like protein 21 isoform X1 [Glycine max]
 gb|ACG69497.1| germin-like protein 1 [Glycine max]
 gb|KHN14199.1| Germin-like protein 5-1 [Glycine soja]
Length=218

 Score =   183 bits (464),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 139/220 (63%), Gaps = 7/220 (3%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M++  FL     V L+ V+  V  SDPDPLQD CVAD  +   + +NG  C +     AS
Sbjct  1    MKLTGFLQA---VTLALVLATVSASDPDPLQDLCVADLASA--VKVNGFTCKDAAKVNAS  55

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F +  LAKPG T NT+G  VT  NV  +PG+NT G++L+R+D APGG+ PPHTHPRA+E
Sbjct  56   DFFSDILAKPGATNNTYGSLVTGANVQKIPGLNTLGVSLSRIDYAPGGINPPHTHPRATE  115

Query  422  VTIVLKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQN  243
            V  VL+G + VGF+ T+N L ++ +  G+ FVFPK L+HF  N +  + A  ++  +SQ 
Sbjct  116  VVFVLEGTLDVGFITTANVLISKSISKGEIFVFPKGLVHFQKN-NGKEQASVIAAFNSQL  174

Query  242  PGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            PG Q  +L  FA  P VPD VL KAFQ+   +V KI+  L
Sbjct  175  PGTQSIALTLFAATPPVPDNVLTKAFQVGTKEVEKIKSRL  214



>ref|XP_004142552.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 ref|XP_004155680.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 gb|KGN66715.1| Rhicadhesin receptor [Cucumis sativus]
Length=224

 Score =   183 bits (464),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 124/185 (67%), Gaps = 2/185 (1%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD+CVA  +    +F+NG  C NP L  A +F    L   GNT N  G NVT  N
Sbjct  28   DPSPLQDFCVAADEPNSAVFVNGKFCKNPKLVRAEDFLFRGLNIAGNTMNKQGSNVTLVN  87

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS-NRLFTQQ  351
            V  LPG+NT G++LAR+D AP GL PPHTHPRA+E+ +V++G +LVGFV ++ N+LFT+ 
Sbjct  88   VDRLPGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVVEGTLLVGFVTSNPNKLFTKV  147

Query  350  LRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKK  171
            L  GD FVFP  LIHF FN+    PALA +GLSSQNPG    + A F + P +  +VL K
Sbjct  148  LNKGDVFVFPIGLIHFQFNVG-HSPALAFAGLSSQNPGVITIANAVFGSDPPISIDVLTK  206

Query  170  AFQIN  156
            AFQ++
Sbjct  207  AFQVD  211



>gb|EYU40209.1| hypothetical protein MIMGU_mgv1a013129mg [Erythranthe guttata]
Length=230

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 127/214 (59%), Gaps = 8/214 (4%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M++    L  I V  SF      SDP PLQD+CVA       +F+NG  C NP++ VA +
Sbjct  1    MKMALVSLATIFVVASFATFAYASDPSPLQDFCVAVNDTKAFVFVNGKICKNPNMVVAED  60

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F    L KPGNT N  G  VT   V  LPG+NT G++  R+D AP GL PPHTHPRA+E+
Sbjct  61   FLFRGLNKPGNTSNPLGSRVTPVTVNQLPGLNTLGISAVRIDYAPKGLNPPHTHPRATEI  120

Query  419  TIVLKGAVLVGFVDTS-------NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
             I+LKG + VGFV ++       N+LF   L  GD FVFP+ LIHF FN+     A+A +
Sbjct  121  LILLKGTLYVGFVTSNPADPALKNKLFATYLHPGDVFVFPQGLIHFQFNVGKTN-AVAFA  179

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQI  159
            GLSSQNPG    + A F + P +   VL KAFQ+
Sbjct  180  GLSSQNPGVITIANAVFGSDPPIDPVVLTKAFQV  213



>gb|EYU20545.1| hypothetical protein MIMGU_mgv1a020779mg [Erythranthe guttata]
Length=231

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 131/215 (61%), Gaps = 9/215 (4%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVEL-VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M+I   L    I  +S +  L   SDP PLQD+CVA       +F+NG  C NPD+ VA 
Sbjct  1    MKIVVLLSVTTIFVVSCLATLAYASDPSPLQDFCVAVKDEDAAVFVNGKVCKNPDMVVAE  60

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F    L KPGNT N  G  VT  NV  +PG+NT G++  R+D AP GL PPHTHPRA+E
Sbjct  61   DFFFPGLNKPGNTSNLVGSRVTPVNVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATE  120

Query  422  VTIVLKGAVLVGFVDTS-------NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAV  264
            + +V++G + VGFV ++       N+LFT+ L  GD FVFP+ LIHF FN+     A+A 
Sbjct  121  ILVVMEGTLYVGFVTSNPADPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTN-AVAF  179

Query  263  SGLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQI  159
            +GLSSQNPG    + A F + P +   VL KAFQ+
Sbjct  180  AGLSSQNPGVITVANAVFGSDPKINPAVLTKAFQV  214



>gb|EMT29286.1| Germin-like protein 1-3 [Aegilops tauschii]
Length=225

 Score =   183 bits (464),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 130/196 (66%), Gaps = 2/196 (1%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKN-LFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            DPD LQD+CVAD K+    L LNG  C  P+   A +F +SALA PGNT N  G  VTA 
Sbjct  28   DPDMLQDFCVADYKSLDGPLRLNGFPCKRPENVTADDFFSSALALPGNTGNPVGSAVTAA  87

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQ  351
            NV  LPG+NT G++++RVD AP G+ PPHTHPRA+E+  VL+G++ VGFV T+ +LF + 
Sbjct  88   NVEKLPGLNTLGVSMSRVDYAPWGVNPPHTHPRATEIIYVLEGSLDVGFVTTAGKLFART  147

Query  350  LRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKK  171
            +  G+ FVFP+ L+H+  N +   PA+A+S  +SQ PG Q  +LA FA  P VP +VL +
Sbjct  148  VCKGELFVFPRGLLHYQKN-NGDAPAVAISAFNSQLPGTQSLALALFAASPPVPTDVLAR  206

Query  170  AFQINGIDVAKIRKNL  123
            A QI+G  V  I+   
Sbjct  207  ALQIDGSLVEAIKSKF  222



>emb|CBI36790.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 125/186 (67%), Gaps = 3/186 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD CVA  +    +F+NG  C NP+L VA +F +  L  PGNT N  G +VT  N
Sbjct  12   DPSPLQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFSKGLNIPGNTSNLVGSSVTTVN  71

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
            V V+PG+NT G++L R+D AP G  PPHTHPRA+E+  VL+G +LVGFV ++  NRLF++
Sbjct  72   VDVIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNPQNRLFSK  131

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L  GD FVFP  LIHF FN+  M  A+A++GLSSQNPG    + A F + P +  + L 
Sbjct  132  VLNKGDVFVFPIGLIHFQFNIGHMN-AVAIAGLSSQNPGVITIANAVFGSNPPINPDFLA  190

Query  173  KAFQIN  156
            KAFQ++
Sbjct  191  KAFQLD  196



>ref|NP_001267940.1| germin-like protein 1 [Vitis vinifera]
 gb|ABL60872.1| germin-like protein 1 [Vitis vinifera]
Length=207

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 125/186 (67%), Gaps = 3/186 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD CVA  +    +F+NG  C NP+L VA +F +  L  PGNT N  G +VT  N
Sbjct  12   DPSPLQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFSKGLNIPGNTSNLVGSSVTTVN  71

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
            V V+PG+NT G++L R+D AP G  PPHTHPRA+E+  VL+G +LVGFV ++  NRLF++
Sbjct  72   VDVIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNPQNRLFSK  131

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L  GD FVFP  LIHF FN+  M  A+A++GLSSQNPG    + A F + P +  + L 
Sbjct  132  VLNKGDVFVFPIGLIHFQFNIGHMN-AVAIAGLSSQNPGVITIANAVFGSNPPINPDFLA  190

Query  173  KAFQIN  156
            KAFQ++
Sbjct  191  KAFQLD  196



>gb|AFW90592.1| germin-like protein subfamily 1 member 20 precursor [Solanum 
tuberosum]
Length=228

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 133/215 (62%), Gaps = 10/215 (5%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M +K F+L  II  L+ V  +   SDP PLQD+CVA   +   +F+NG  C +P +  A 
Sbjct  1    MALKSFVL--IIAILAVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDPRVVTAD  58

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L   GNT N  G  VTA NV  LPG+N  G++L R+D AP GL PPHTHPR +E
Sbjct  59   DFFKSGLNVAGNTSNNVGSAVTAVNVNNLPGLNALGISLVRIDYAPYGLNPPHTHPRGTE  118

Query  422  VTIVLKGAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
            V  VL+G + VGFV      +  N+LFT+ L  GD FVFP  LIHF FN+   K A+A +
Sbjct  119  VLTVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTK-AVAFA  177

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            GLSSQNPG    + A F + P + D++L KAFQ++
Sbjct  178  GLSSQNPGVITIANAVFGSDPPINDDILAKAFQVD  212



>ref|XP_009341765.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
 ref|XP_009349818.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
Length=230

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 136/216 (63%), Gaps = 7/216 (3%)
 Frame = -1

Query  752  AIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAK  576
            A +  L+F   L   SDPDPLQD+CVA       +F+NG  C +P+LA A++F +  L  
Sbjct  11   AALSVLAFATLLASASDPDPLQDFCVAINNTDYAVFVNGKFCKDPNLASANDFFSDKLRY  70

Query  575  PGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
             GNT N  G  VTA NV V+PG+NT G++ ARVD AP G+ PPHTHPRA+E+ IVL+G++
Sbjct  71   AGNTSNPVGSIVTAANVDVIPGLNTLGISFARVDFAPNGVNPPHTHPRATEIFIVLEGSL  130

Query  395  LVGFVDTS-----NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQ  231
             VGFV ++     NRLFT+ L  GD FVFP  LIHF  N+     ALA++   SQNPG  
Sbjct  131  YVGFVTSNINGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGKTN-ALAIAAFGSQNPGVI  189

Query  230  LTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
              + A F +KP +  +VL KAFQ++   V  ++K  
Sbjct  190  TIANAVFGSKPPINPDVLTKAFQLDNNVVDYLQKQF  225



>ref|XP_009402557.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=222

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 130/204 (64%), Gaps = 9/204 (4%)
 Frame = -1

Query  749  IIVCLSFVVEL-VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKP  573
            ++V L+    L + SDP  LQD+CVAD      + +NG  C +P +  A +F+ S L  P
Sbjct  7    LLVLLAMASSLAMASDPSQLQDFCVADM--MSKVRVNGFVCKDPMVVKADDFSLSGLDMP  64

Query  572  GNT-KNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            G+T KN FGFNVT  NV  +PG+NT G+++ R+D  P GL PPHTHPRA+E+  V++G +
Sbjct  65   GDTGKNNFGFNVTPANVIQIPGLNTLGISMVRIDYIPNGLNPPHTHPRATEILTVIEGQL  124

Query  395  LVGFV----DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQL  228
            LVGFV    D  NRLFT+ L+ GD FVFP+ LIHF FN        A+  LSSQNPG   
Sbjct  125  LVGFVTSNSDDGNRLFTKMLKKGDVFVFPQGLIHFQFNPGHTN-TFAIGALSSQNPGTIT  183

Query  227  TSLATFATKPAVPDEVLKKAFQIN  156
             + A F + P + DE+L KAFQ++
Sbjct  184  IADAVFGSNPPISDEILAKAFQVD  207



>gb|KHG29875.1| Germin-like protein subfamily 2 member 4 [Gossypium arboreum]
Length=216

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 133/210 (63%), Gaps = 3/210 (1%)
 Frame = -1

Query  752  AIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKP  573
            A  V L  V  + KSDPD LQD CVADT  +  + +NG AC        ++F  S LAKP
Sbjct  7    AYFVALVAVFSVAKSDPDLLQDICVADT--SSGVKVNGFACKKDADVTENDFFFSGLAKP  64

Query  572  GNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVL  393
                N+ G  VT  NV  +PG+NT G++L+R+D  PGGL PPHTHPRA+E+  VL G + 
Sbjct  65   AVVNNSVGSVVTGANVEKIPGLNTLGVSLSRIDYQPGGLNPPHTHPRATEIIFVLDGELD  124

Query  392  VGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLAT  213
            VGF+ T+N+L ++ L+ GD FVFPK L+HF  N +  +PA  +SG +SQ PG Q  ++  
Sbjct  125  VGFITTANKLISKSLKKGDIFVFPKGLVHFQQN-NGKEPASVISGFNSQLPGTQSIAVTL  183

Query  212  FATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            F + PAVPD VL KAFQI   +V KI+  L
Sbjct  184  FGSTPAVPDHVLTKAFQIGTKEVNKIKSRL  213



>ref|XP_006358464.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 123/191 (64%), Gaps = 7/191 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDP PLQD+CVA   +   +F+NG  C  P L  A +F  S L KPGNT N  G  VTA 
Sbjct  25   SDPSPLQDFCVAVNDSKTTVFVNGKVCKYPKLVTADDFFRSGLNKPGNTSNQLGSIVTAV  84

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFV------DTSN  369
            NV  LPG+NT G++LAR+D A  GL PPHTHPR +EV +VLKG + VGFV      +  N
Sbjct  85   NVNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTEVLVVLKGRLYVGFVLSNPGPNMKN  144

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
            +LFT+ L +GD FVFP+ LIHF  N+     A+A +GLSSQN G    + A F + P + 
Sbjct  145  KLFTKILNSGDVFVFPEGLIHFQLNVGKTN-AIAFAGLSSQNAGVITVANAVFGSDPPIN  203

Query  188  DEVLKKAFQIN  156
            D+VL KAFQ++
Sbjct  204  DDVLAKAFQVD  214



>ref|XP_011038440.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 130/200 (65%), Gaps = 7/200 (4%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD+CVA    T  +F+NG  C +P    A +F +S L  PG+T    G NVTA N
Sbjct  24   DPSPLQDFCVA-VDETDGVFVNGKFCKDPKDVTAKDFFSSGLNIPGDTSGRVGSNVTAVN  82

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS-----NRL  363
            V  +PG+NT G++LAR+D AP GL PPHTHPRA+E+ +V++G + VGFV ++     NRL
Sbjct  83   VEKIPGLNTLGISLARIDFAPYGLNPPHTHPRATEIIVVVEGTLYVGFVTSNLANGDNRL  142

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             T+ L+ GD FVFP  LIHF FNM   K ALA +GLSSQNPG    + A F + P +  +
Sbjct  143  ITKALKPGDVFVFPIGLIHFQFNMGKTK-ALAFAGLSSQNPGVITIANAVFGSDPPINPD  201

Query  182  VLKKAFQINGIDVAKIRKNL  123
            VL KAFQ++   V  ++K+ 
Sbjct  202  VLAKAFQLDKKVVDYLQKSF  221



>gb|KHN43382.1| Germin-like protein 5-1 [Glycine soja]
Length=219

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/219 (45%), Positives = 136/219 (62%), Gaps = 4/219 (2%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M++  FL    +  L   +    SDPD LQD CVAD  +   + +NG  C +     AS+
Sbjct  1    MKLTGFLQAVTLTALVLSI-FTASDPDSLQDLCVADLASA--VKVNGFTCKDAGKVNASD  57

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F +  LAKPG T NT+G  VT  NV  +PG+NT G++L+R+D APGG+ PPHTHPRA+EV
Sbjct  58   FFSDILAKPGATNNTYGSLVTGANVQKIPGLNTLGVSLSRIDYAPGGINPPHTHPRATEV  117

Query  419  TIVLKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNP  240
              VL+G + VGF+ T+N L ++ +  G+ FVFPK L+HF  N +  +PA  ++  +SQ P
Sbjct  118  VFVLEGTLDVGFITTANVLISKAINKGEIFVFPKGLVHFQKN-NGKEPASVIAAFNSQLP  176

Query  239  GAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            G Q  +L  FA  P +PD VL KAFQ+   +V KI+  L
Sbjct  177  GTQSIALTLFAATPPLPDNVLTKAFQVGTKEVQKIKSRL  215



>ref|XP_009620404.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 136/215 (63%), Gaps = 10/215 (5%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKS-DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M +K F+L   I  L+ V  +  + DP PLQD+CVA   +   +F+NG  C +P +  A 
Sbjct  1    MALKLFVLT--IGILAIVSSISHAYDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNAD  58

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L  PGNT N  G  VTA NV  LPG+NT G++L R+D AP GL PPHTHPRA+E
Sbjct  59   DFFKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATE  118

Query  422  VTIVLKGAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
            + +VL+G + VGFV      +  N+LFT+ L+ GD FVFP  LIHF FN+     A+A +
Sbjct  119  ILVVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKTT-AVAFA  177

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            GLSSQNPG    + A F + P + D+VL KAFQ++
Sbjct  178  GLSSQNPGVITIANAVFGSDPPINDDVLAKAFQVD  212



>ref|XP_009625530.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 136/215 (63%), Gaps = 10/215 (5%)
 Frame = -1

Query  779  MRIKPFLLK-AIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M +K  +L  AI+  +S +     SDP PLQD+CVA   +   +F+NG  C +P +  A 
Sbjct  1    MALKSLVLTIAILAVVSSISH--ASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNAD  58

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L  PGNT N  G  VTA NV  LPG+NT G++L R+D AP GL PPHTHPRA+E
Sbjct  59   DFFKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATE  118

Query  422  VTIVLKGAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
            V +VL+G + VGFV      +  N+LFT+ L+ GD FVFP  LIHF FN+     A+A +
Sbjct  119  VLVVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKTT-AVAFA  177

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            GLSSQNPG    + A F + P++  +VL KAFQ++
Sbjct  178  GLSSQNPGVITIANAVFGSDPSINADVLAKAFQVD  212



>ref|XP_009385875.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=223

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 131/203 (65%), Gaps = 8/203 (4%)
 Frame = -1

Query  749  IIVCLSFVVEL-VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKP  573
            +I  L+ V  L + SDP PLQD+CVAD K++K + +NG  C +P    A +F    L K 
Sbjct  7    LIALLAMVSSLAMASDPSPLQDFCVAD-KDSK-VLVNGFVCKDPKHVTAEDFFFMGLDKA  64

Query  572  GNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVL  393
            GNT N  G  VTA NV  L G+NT G+++ R+D  P GL PPHTHPRA+E+  V++G +L
Sbjct  65   GNTVNKLGSMVTAVNVNKLVGLNTLGISMVRIDYGPKGLNPPHTHPRATEILTVIEGQLL  124

Query  392  VGFV----DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLT  225
            VGFV    D  NRLFT+ L+ GD FVFP+ LIHF FN    K  +A+  LSSQNPG    
Sbjct  125  VGFVTSNTDDGNRLFTKMLKKGDVFVFPEGLIHFQFNPGHTK-TIAIGALSSQNPGTITI  183

Query  224  SLATFATKPAVPDEVLKKAFQIN  156
            + A F +KP + D+VL KAFQ++
Sbjct  184  ANAVFGSKPPISDDVLAKAFQVD  206



>ref|XP_004236166.1| PREDICTED: germin-like protein subfamily T member 2 [Solanum 
lycopersicum]
Length=220

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 126/197 (64%), Gaps = 2/197 (1%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            +DPDPLQD+CVA   +T    LNG  C       +++F    L   GNTKN FGF+ T  
Sbjct  22   ADPDPLQDFCVAILNDTSTS-LNGFPCKPASQVTSNDFFFDGLTIEGNTKNAFGFSATVG  80

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQ  351
            NV   PG+NTQGL++ RVD APGGL PPH+HPRA+E  +V+KG + VGFV T N L+++ 
Sbjct  81   NVLSFPGLNTQGLSMNRVDFAPGGLNPPHSHPRATESGVVIKGKIYVGFVTTKNVLYSKV  140

Query  350  LRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKK  171
            L AG+ FV P+ L+HF  N+   K A+ ++  +S  PGA +     F +KP++PDEVL K
Sbjct  141  LTAGEMFVVPRGLVHFQMNVGKEK-AMTITAFNSHLPGAVVLPTTLFTSKPSIPDEVLTK  199

Query  170  AFQINGIDVAKIRKNLG  120
            AF+I+   +  I+  LG
Sbjct  200  AFKIDATVIDDIKAKLG  216



>ref|XP_006659194.1| PREDICTED: germin-like protein 8-5-like [Oryza brachyantha]
Length=225

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 129/190 (68%), Gaps = 4/190 (2%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFN  543
            + + SDP+PLQD+CVAD  +   + +NG AC+NP    A +F  +A+       N  G N
Sbjct  20   QAIASDPNPLQDFCVADMHSP--VRVNGFACLNPMDVNADHFFKAAMLDTPRKTNKVGSN  77

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--SN  369
            VT  NV  +PG+NT G+++AR+D AP G  PPHTHPRA+E+  VL+G + VGFV +  +N
Sbjct  78   VTLINVMQIPGLNTLGISIARIDYAPLGQNPPHTHPRATEILTVLEGTLYVGFVTSNPNN  137

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
             LFT++L  GD FVFP+ LIHF FN +  +PA+A++ LSSQNPGA   + A F +KP + 
Sbjct  138  TLFTKELNKGDVFVFPEGLIHFQFNPNPHQPAVAIAALSSQNPGAITIANAVFGSKPPIS  197

Query  188  DEVLKKAFQI  159
            D+VL KAFQ+
Sbjct  198  DKVLAKAFQV  207



>ref|XP_008237525.1| PREDICTED: germin-like protein subfamily 1 member 18 [Prunus 
mume]
Length=234

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 142/230 (62%), Gaps = 12/230 (5%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVA--DTKNTKN------LFLNGVACIN  624
            M+   FL+  + +  S    +  SDP PLQD+CVA  DTK+         +F+NG  C +
Sbjct  1    MKGVHFLISTLAILASATFLVSASDPSPLQDFCVALDDTKSAGGYFGAGAVFVNGKFCKD  60

Query  623  PDLAVASNFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPH  444
            P L  A++F  S L  P NT+N  G NVT  NV  + G+NT G++L R+D AP GL PPH
Sbjct  61   PKLVNANDFFFSGLQNPRNTQNPLGSNVTTVNVDQIAGLNTLGISLTRIDFAPNGLNPPH  120

Query  443  THPRASEVTIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPA  273
            THPRASE  +VL+G++ VGFV ++   NRLFT+ L  GD FVFP  LIHF FN+  +  A
Sbjct  121  THPRASEFLVVLEGSLYVGFVTSNGDGNRLFTKVLNKGDVFVFPIGLIHFQFNVGHVN-A  179

Query  272  LAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            +A +GLSSQNPG    + A F +KP +  +VL KAFQ++   V  ++K  
Sbjct  180  VAFAGLSSQNPGVITIANAVFGSKPLINPDVLAKAFQVDNNVVDYLQKQF  229



>ref|XP_006840196.1| hypothetical protein AMTR_s00089p00119480 [Amborella trichopoda]
 gb|ERN01871.1| hypothetical protein AMTR_s00089p00119480 [Amborella trichopoda]
Length=219

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 133/212 (63%), Gaps = 6/212 (3%)
 Frame = -1

Query  758  LKAIIVCLSFVVEL-VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSAL  582
            L  + V LS +  L + SDP PLQD+CVAD  N   +F+NG  C +P L  A +F    L
Sbjct  3    LIIVFVALSMIASLGLASDPSPLQDFCVAD--NYSKVFVNGKVCKDPMLVTAKDFFYDGL  60

Query  581  AKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
             KPGNT N  G  VT  NV  + G+NT G++L R+D APGG  PPHTHPRA+E+  VL+G
Sbjct  61   DKPGNTSNPLGSMVTQVNVMQILGLNTLGISLVRIDFAPGGQNPPHTHPRATEILTVLEG  120

Query  401  AVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQL  228
             + VGFV ++  NRL ++ L  GD FVFP+ LIHF  N+     ++A++GLSSQNPG   
Sbjct  121  TLYVGFVTSNPENRLISKTLNKGDVFVFPQGLIHFQQNVGYGN-SVAIAGLSSQNPGVIT  179

Query  227  TSLATFATKPAVPDEVLKKAFQINGIDVAKIR  132
             + A F   P + D VL KAFQI+   V K++
Sbjct  180  IAKAVFGANPPISDVVLAKAFQIDKQLVDKLQ  211



>ref|XP_010544902.1| PREDICTED: germin-like protein subfamily 2 member 4 [Tarenaya 
hassleriana]
Length=219

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 129/213 (61%), Gaps = 4/213 (2%)
 Frame = -1

Query  758  LKAIIVCLSFVVELVKSDPDPLQDYCVAD-TKNTKNLFLNGVACINPDLAVASNFATSAL  582
            + A +V LS  V  V  DPD LQD CVAD +  TK   +NG  C     A AS+F  + +
Sbjct  5    VSAFMVLLSLAVAAVAYDPDMLQDLCVADPSSGTK---VNGFPCKPETNATASDFFFAGI  61

Query  581  AKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
            AK     NT G  VT  NV  +PG+NT G++LAR+D APGGL PPHTHPRA+EV  V++G
Sbjct  62   AKAAVVNNTMGSAVTGANVEKIPGLNTLGVSLARIDYAPGGLNPPHTHPRATEVIFVVEG  121

Query  401  AVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTS  222
             + VGF+ T N+LF + ++ G+ FVFP+ L+HF  N D   PA  +S  +SQ PG Q  +
Sbjct  122  ELDVGFITTGNKLFAKTVKKGEVFVFPRGLVHFQKNNDLKNPASVISAFNSQLPGTQSIA  181

Query  221  LATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
               F   P VP+ VL  AFQI   +V KI+  L
Sbjct  182  ATLFTATPPVPENVLTTAFQIGNKEVEKIKSKL  214



>ref|XP_003554594.1| PREDICTED: rhicadhesin receptor-like [Glycine max]
Length=219

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/219 (45%), Positives = 138/219 (63%), Gaps = 4/219 (2%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M++  FL +A+ +    +     SDPD LQD CVAD  +   + +NG  C +     AS+
Sbjct  1    MKLTGFL-QAVTLTALVLSTFTASDPDSLQDLCVADLASA--VKVNGFTCKDAGKVNASD  57

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F +  LAKPG T NT+G  VT  NV  +PG+NT G++L+R+D APGG+ PPHTHPRA+EV
Sbjct  58   FFSDILAKPGATNNTYGSLVTGANVQKIPGLNTLGVSLSRIDYAPGGINPPHTHPRATEV  117

Query  419  TIVLKGAVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNP  240
              VL+G + VGF+ T+N L ++ +  G+ FVFPK L+HF  N +  +PA  ++  +SQ P
Sbjct  118  VFVLEGTLDVGFITTANVLISKAINKGEIFVFPKGLVHFQKN-NGKEPASVIAAFNSQLP  176

Query  239  GAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            G Q  +L  FA  P +PD VL KAFQ+   +V KI+  L
Sbjct  177  GTQSIALTLFAATPPLPDNVLTKAFQVGTKEVQKIKSRL  215



>ref|XP_006358462.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 123/191 (64%), Gaps = 7/191 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDP PLQD+CVA   +   +F+NG  C +P L  A +F  S L KPGNT N  G  VTA 
Sbjct  25   SDPSPLQDFCVAVNDSKTTVFVNGKVCKDPKLVTADDFFRSGLNKPGNTSNQLGSIVTAV  84

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFV------DTSN  369
            NV  LPG+NT G++LAR+D A  GL PPHTHPR +EV +VLKG + VGFV      +  N
Sbjct  85   NVNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTEVLVVLKGRLYVGFVLSNPGPNMKN  144

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
            +LFT+ L  GD FVFP+ LIHF  N+     A+A +GLSSQN G    + A F + P + 
Sbjct  145  KLFTKILNPGDVFVFPEGLIHFQLNVGKTN-AIAFAGLSSQNAGVITVANAVFGSDPPIN  203

Query  188  DEVLKKAFQIN  156
            D+VL KAFQ++
Sbjct  204  DDVLAKAFQVD  214



>gb|AJA71638.1| germin-like protein [Triticum aestivum]
Length=229

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 138/206 (67%), Gaps = 8/206 (4%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA-  585
            L  AI+  +S  ++ + S P PLQD+CVAD  N+  + +NG  C +P    A +F  +A 
Sbjct  11   LFTAILALVS--LQALASHPGPLQDFCVAD--NSSRVLVNGFVCKDPKAVTAEDFFLAAK  66

Query  584  LAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVL  408
            L  P +TK +  G NVT  NV  + G+NT G++LAR+D AP G  PPHTHPRA+E+  VL
Sbjct  67   LDMPRDTKMSKVGSNVTLINVMKIAGLNTLGISLARIDYAPLGENPPHTHPRATEILTVL  126

Query  407  KGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGA  234
            +G + VGFV +   N+LF+++LR GD FVFP+ LIHF FN +  KPA+A++ LSSQNPGA
Sbjct  127  EGTLYVGFVTSNPENKLFSKELRKGDVFVFPQGLIHFQFNPNPYKPAVAIAALSSQNPGA  186

Query  233  QLTSLATFATKPAVPDEVLKKAFQIN  156
               + A F +KP + D+VL KAFQ++
Sbjct  187  ITIANAVFGSKPMISDDVLAKAFQVD  212



>ref|XP_009786129.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 135/214 (63%), Gaps = 8/214 (4%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M  K F+L   I+ + F +     DP PLQD+CVA   +   +F+NG  C +P++  A +
Sbjct  1    MARKLFVLTVAILAVVFSISHAY-DPSPLQDFCVAVNDSMAAVFVNGKICKDPNVVNADD  59

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F  S L  PGNT N  G  VTA NV  L G+NT G++L R+D AP GL PPHTHPRA+EV
Sbjct  60   FFKSGLNIPGNTSNQVGSAVTAVNVINLHGLNTLGISLVRIDYAPYGLNPPHTHPRAAEV  119

Query  419  TIVLKGAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSG  258
             +VL+G + VGFV      +  N+LFT+ L+ GD FVFP  LIHF FN+   K A+A +G
Sbjct  120  LVVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNVGKTK-AVAFAG  178

Query  257  LSSQNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            LSSQNPG    + A F + P + ++VL KAFQ++
Sbjct  179  LSSQNPGVITIANAIFGSDPPINEDVLTKAFQVD  212



>ref|XP_009366009.1| PREDICTED: germin-like protein 5-1 [Pyrus x bretschneideri]
Length=217

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 133/208 (64%), Gaps = 3/208 (1%)
 Frame = -1

Query  746  IVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGN  567
            +V  + V+    +DPD LQD CVAD   T  + +NG  C N   A A +F  + LAKPG 
Sbjct  9    LVAFATVLGSSAADPDMLQDICVADL--TAAVKVNGFVCKNAANATAEDFFFTGLAKPGL  66

Query  566  TKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVG  387
            T NTFG  VT  NV  +PG+NT G++LAR+D APGG+ PPHTHPRA+E+  VL+G + VG
Sbjct  67   TNNTFGSLVTLANVEKIPGLNTLGISLARIDYAPGGINPPHTHPRATEIVYVLEGVLDVG  126

Query  386  FVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFA  207
            F+ T+N+L ++ ++ G+ FVFPK L+HF  N +   PA  +S  +SQ  G Q  +L  FA
Sbjct  127  FITTANKLISKTIKQGEVFVFPKGLVHFQ-NNNGKSPASVISAFNSQLQGTQNIALTLFA  185

Query  206  TKPAVPDEVLKKAFQINGIDVAKIRKNL  123
              P VPD+VL K F++   +V KI+  L
Sbjct  186  ATPEVPDDVLTKTFKVGTKEVNKIKSKL  213



>ref|XP_003573398.1| PREDICTED: germin-like protein 8-11 [Brachypodium distachyon]
Length=228

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 129/193 (67%), Gaps = 6/193 (3%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA-LAKPGNTK-NTFG  549
            + V SDP PLQD+CVAD  N+  + +NG  C +P    A +F  SA L  P +TK +  G
Sbjct  21   QAVASDPSPLQDFCVAD--NSSQVLVNGFVCKDPKDVTAEDFFLSAKLDMPRDTKMSKVG  78

Query  548  FNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--  375
             NVT  NV  +PG+NT G++LAR+D AP G  PPHTHPRA+E+  VL+G + VGFV +  
Sbjct  79   SNVTLINVMKIPGLNTLGISLARIDYAPLGENPPHTHPRATEILTVLEGTLYVGFVTSNP  138

Query  374  SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPA  195
             N+  +++L+ GD FVFP+ LIHF FN +  KPA+A++ LSSQNPGA   +   F +KP 
Sbjct  139  ENKFLSKELKKGDVFVFPQGLIHFQFNPNPYKPAVAIAALSSQNPGAITIANVVFGSKPM  198

Query  194  VPDEVLKKAFQIN  156
            + D+VL KAFQ+ 
Sbjct  199  ISDDVLAKAFQVE  211



>ref|XP_009612542.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 136/215 (63%), Gaps = 10/215 (5%)
 Frame = -1

Query  779  MRIKPFLLK-AIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M +K F+L  AI+  +S +     SDP PLQD+CVA   +   +F+NG  C +P +  A 
Sbjct  1    MALKLFVLTIAILAVVSSISH--ASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNAD  58

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L  PGNT N  G  VTA NV  LPG+NT G++L R+D AP GL PPHTHPRA+E
Sbjct  59   DFFKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATE  118

Query  422  VTIVLKGAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
            V +VL+G + VGFV      +  N+LFT+ L+ GD FVFP  LIHF FN+     A+A +
Sbjct  119  VLVVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKTT-AVAFA  177

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            GLSSQNPG    + A F + P +  +VL KAFQ++
Sbjct  178  GLSSQNPGVITIANAVFGSDPPINVDVLAKAFQVD  212



>ref|XP_008443754.1| PREDICTED: germin-like protein subfamily 1 member 17 [Cucumis 
melo]
Length=223

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKS-DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATS  588
            FL  A ++ L   + +  + DP PLQD+CVA  +    +F+NG  C NP    A +F   
Sbjct  7    FLSAAFLLVLQETIFVASAFDPSPLQDFCVAVDEPKSAVFVNGKFCKNPKFVRAEDFLFR  66

Query  587  ALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVL  408
             L   GNT N  G NVT  NV  LPG+NT G++LAR+D AP GL PPHTHPRA+E+ +V+
Sbjct  67   GLNIAGNTMNKQGSNVTLVNVDRLPGLNTLGISLARIDYAPNGLNPPHTHPRATEILVVV  126

Query  407  KGAVLVGFVDTS-NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQ  231
            +G +LVGFV ++ N+LFT+ L  GD FVFP  LIHF FN+    PALA +GLSSQNPG  
Sbjct  127  EGTLLVGFVTSNPNKLFTKVLNKGDVFVFPVGLIHFQFNVGHY-PALAFAGLSSQNPGVI  185

Query  230  LTSLATFATKPAVPDEVLKKAFQIN  156
              + A F + P +  +VL KAFQ++
Sbjct  186  TIANAVFGSDPPISIDVLTKAFQVD  210



>ref|XP_004134614.1| PREDICTED: putative germin-like protein 2-3-like [Cucumis sativus]
 ref|XP_004158655.1| PREDICTED: putative germin-like protein 2-3-like [Cucumis sativus]
 gb|KGN49470.1| hypothetical protein Csa_6G525550 [Cucumis sativus]
Length=216

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 136/213 (64%), Gaps = 8/213 (4%)
 Frame = -1

Query  755  KAII---VCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            KAII   + +++ V +  SDP  LQD+CVAD  NT  +  NGV C   ++  A +F  S 
Sbjct  4    KAIIFGFLIVTYAVAVFASDPSHLQDFCVADPTNTVKV--NGVVCKESEVVTADDFFFSG  61

Query  584  LAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLK  405
            L K GNT N  G  VT  NV  +PG+NT G++LAR+D AP G+ PPHTHPRA+E+  VL+
Sbjct  62   LHKVGNTSNPVGSKVTPVNVVQIPGLNTLGISLARIDYAPLGINPPHTHPRATEILTVLE  121

Query  404  GAVLVGFV--DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQ  231
            G + VGFV  +T NRLFT+ L+ GD FVFP  L+HF  N+    PA+A++ LSSQNPG  
Sbjct  122  GTLHVGFVTSNTENRLFTKVLQKGDVFVFPVGLVHFQHNIG-HGPAVALAALSSQNPGVI  180

Query  230  LTSLATFATKPAVPDEVLKKAFQINGIDVAKIR  132
                A F +KP +  ++L KAFQ +   +A I+
Sbjct  181  TIGNAVFGSKPDISTDILSKAFQTDKSIIAGIQ  213



>ref|XP_010528770.1| PREDICTED: germin-like protein subfamily 1 member 18 [Tarenaya 
hassleriana]
Length=252

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 133/212 (63%), Gaps = 6/212 (3%)
 Frame = -1

Query  782  KMRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            KM+    LL AI+   S        DP PLQD+CVA       +F+NG  C +P LA A+
Sbjct  31   KMKFSWSLLVAILATASSFASAY--DPSPLQDFCVAINDLKSGVFVNGRFCKDPQLANAN  88

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L KPGNT N  G NVT  NV  +PG+NT G++L R+D AP G  PPHTHPRASE
Sbjct  89   DFFFSGLNKPGNTNNQVGSNVTTVNVDQIPGLNTLGVSLVRIDYAPYGQNPPHTHPRASE  148

Query  422  VTIVLKGAVLVGFVDT---SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLS  252
            + +V++G +LVGFV +   +NR F++ L  GD FVFP  +IHF  N+  + PA+A +GL 
Sbjct  149  ILVVIEGTLLVGFVSSNQDNNRFFSKVLYPGDVFVFPIGMIHFQANIGKV-PAVAFAGLG  207

Query  251  SQNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            SQNPG    + A F + P +  E+L +AFQ++
Sbjct  208  SQNPGVITIANAVFGSNPPINPEILARAFQLD  239



>ref|XP_008678208.1| PREDICTED: putative germin-like protein 12-4 [Zea mays]
 gb|AFW61062.1| hypothetical protein ZEAMMB73_378483 [Zea mays]
Length=228

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 137/208 (66%), Gaps = 10/208 (5%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            FLL A +  ++   + + SDP PLQD+CVAD  +   + +NG  C +P    A +F  +A
Sbjct  7    FLLVAFLALVT--SQSIASDPSPLQDFCVADKYSP--VKVNGFVCKDPMAVNADDFFKAA  62

Query  584  -LAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVL  408
             L +P +TKN  G NVT  NV  LPG+NT G++LAR+D AP G  PPHTHPRA+E+  VL
Sbjct  63   KLDQPRDTKNKVGSNVTLINVMQLPGLNTLGISLARIDYAPLGQNPPHTHPRATEILTVL  122

Query  407  KGAVLVGFV-----DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQN  243
            +G + VGFV     +++N+LFT+ L  GD FVFP+ LIHF FN    KPA+A++ LSSQN
Sbjct  123  EGKLYVGFVTSNQANSNNKLFTKVLNKGDVFVFPQGLIHFQFNPVHDKPAVAIAALSSQN  182

Query  242  PGAQLTSLATFATKPAVPDEVLKKAFQI  159
            PG    + A F +KP + D+VL KAFQ+
Sbjct  183  PGVITIANAVFGSKPPISDDVLAKAFQV  210



>ref|XP_002281186.2| PREDICTED: uncharacterized protein LOC100244552 [Vitis vinifera]
Length=478

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 131/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A++F  S L  PGNT N  G  VT
Sbjct  282  SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVT  339

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  340  PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  399

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             ++ L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  400  ISKVLYKGDVFVFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  458

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  459  VLTKAFQVD  467


 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 129/198 (65%), Gaps = 8/198 (4%)
 Frame = -1

Query  737  LSFVVELVKSDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNT  564
            +SF +  V SDP PLQ++CVA  DTK T  +F+NG  C +  +A A++   S L   G+T
Sbjct  1    MSFFLASV-SDPSPLQEFCVAVNDTKTT--VFVNGKVCKDLKVATANDLFFSRLQVLGHT  57

Query  563  KNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGF  384
             N     VT  NVA +P +NT G++LARVD AP GL PPHT+PRA+E+  VL+G + VGF
Sbjct  58   SNKLESMVTQANVAQIPELNTLGISLARVDYAPYGLNPPHTYPRATEILTVLEGTLYVGF  117

Query  383  VDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATF  210
            V ++  NRL ++ L  GD F+F + LIHF  N+   K A+A++ LSSQN G    + A F
Sbjct  118  VTSNPDNRLISKVLYKGDVFIFLEGLIHFQLNVRKTK-AVAIAALSSQNLGVITIANAVF  176

Query  209  ATKPAVPDEVLKKAFQIN  156
             +KPA+  +VL KAFQ++
Sbjct  177  GSKPAISADVLTKAFQVD  194



>ref|XP_010412923.1| PREDICTED: germin-like protein subfamily 1 member 6 [Camelina 
sativa]
Length=227

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 132/206 (64%), Gaps = 6/206 (3%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKS-DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            LL A ++ L+     V   DP PLQD+CVA    T  +F+NG  C +P    A++F+ S 
Sbjct  7    LLVAHVILLALSYSFVYCYDPSPLQDFCVA-ANETNGVFVNGKVCKDPKSVTANDFSYSG  65

Query  584  LAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLK  405
            L  PGNT +  G NVT  +V  +PG+NT G++LAR+D A GG  PPH HPRASE+ +V K
Sbjct  66   LNIPGNTTSFIGSNVTTVDVNKIPGLNTLGVSLARLDFARGGQNPPHIHPRASEILMVTK  125

Query  404  GAVLVGFVDT---SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGA  234
            G +LVGFV +   +NRLF++ LR GD FVFP  LIHF  N+   + A+A +G  SQNPG 
Sbjct  126  GTLLVGFVSSNQDNNRLFSKVLRTGDVFVFPIGLIHFQMNVGRTR-AVAFAGFGSQNPGT  184

Query  233  QLTSLATFATKPAVPDEVLKKAFQIN  156
               + A F + P++P EVL KAFQ++
Sbjct  185  ITIADAVFGSSPSIPREVLAKAFQLD  210



>ref|XP_010485791.1| PREDICTED: germin-like protein subfamily 1 member 6 [Camelina 
sativa]
 ref|XP_010485792.1| PREDICTED: germin-like protein subfamily 1 member 6 [Camelina 
sativa]
Length=226

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 131/205 (64%), Gaps = 5/205 (2%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSAL  582
            LL A ++ L+     V   P P QD+CVA  + T  +F+NG  C +P    A++F+ S L
Sbjct  7    LLVAHVILLALSYSFVYCYPSPFQDFCVAANE-TNGVFVNGKVCKDPKSVTANDFSYSGL  65

Query  581  AKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
              PGNT +  G NVT  +V  +PG+NT G++LAR+D A GG  PPH HPRASE+ +V KG
Sbjct  66   NIPGNTTSFIGSNVTTVDVNKIPGLNTLGVSLARLDFARGGQNPPHIHPRASEILMVTKG  125

Query  401  AVLVGFVDT---SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQ  231
             +LVGFV +   +NRLF++ LR GD FVFP  LIHF  N+   + A+A +G  SQNPG  
Sbjct  126  TLLVGFVSSNQDNNRLFSKVLRTGDVFVFPIGLIHFQMNVGRTR-AVAFAGFGSQNPGTI  184

Query  230  LTSLATFATKPAVPDEVLKKAFQIN  156
              + A F + P++P EVL KAFQ++
Sbjct  185  TIADAVFGSNPSIPREVLAKAFQLD  209



>ref|NP_001061156.1| Os08g0189100 [Oryza sativa Japonica Group]
 sp|Q6YZA9.1|GL82_ORYSJ RecName: Full=Germin-like protein 8-2; AltName: Full=Germin-like 
protein 16; AltName: Full=Germin-like protein 3; Short=OsGER3; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD05768.1| putative germin A [Oryza sativa Japonica Group]
 dbj|BAF23070.1| Os08g0189100 [Oryza sativa Japonica Group]
 gb|ABL74571.1| germin-like protein [Oryza sativa Japonica Group]
 gb|EAZ05844.1| hypothetical protein OsI_28081 [Oryza sativa Indica Group]
 gb|EAZ41753.1| hypothetical protein OsJ_26293 [Oryza sativa Japonica Group]
 dbj|BAG88472.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA-LAKPGNTKNTFGFNV  540
            + SDP PLQD+CVAD  +   + +NG  C NP  A A +F  +A L KP +T N  G NV
Sbjct  23   IASDPSPLQDFCVADLNSP--VRVNGFVCKNPMNASADDFFKAAMLDKPRDTNNKVGSNV  80

Query  539  TATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NR  366
            T  NV  LPG+NT G+++AR+D AP GL PPHTHPRA+E+  VL+G + VGFV ++  NR
Sbjct  81   TLVNVLQLPGLNTLGISIARLDFAPLGLNPPHTHPRATEIFTVLEGTLYVGFVTSNPDNR  140

Query  365  LFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPD  186
            L ++ L  GD FVFP+ LIHF FN +  KPA+A++ LSSQNPG    + A F + P + D
Sbjct  141  LLSKVLNKGDVFVFPEGLIHFQFNPNPHKPAVAIAALSSQNPGVITIANAVFGSNPPISD  200

Query  185  EVLKKAFQIN  156
            ++L KAFQ++
Sbjct  201  DILMKAFQVD  210



>ref|XP_008243694.1| PREDICTED: germin-like protein 9-1 [Prunus mume]
Length=456

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 146/225 (65%), Gaps = 6/225 (3%)
 Frame = -1

Query  785  SKMRIKPFLLKAIIVCLSFVVELVKS-DPDPLQDYCVADTKNTKNLFLNGVACINPDLAV  609
            + M+   FL+ +I+  L+F + L  + DP PLQD+CVA       +F+NG  C +P LA 
Sbjct  229  TAMKGDHFLI-SILAILAFSMFLASAYDPSPLQDFCVAIKDIKDGVFVNGKFCKDPKLAN  287

Query  608  ASNFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRA  429
            A++F  S L  P NT+N  G NVTA NV  L G+NT G++LAR+D AP GL PPHTHPRA
Sbjct  288  ANDFFFSGLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRA  347

Query  428  SEVTIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSG  258
            +E+ +VL+G + VGFV ++   NRLFT++L  GD FVFP  LIHF  N+  +  A+A +G
Sbjct  348  TEILVVLEGTLYVGFVTSNGDGNRLFTKELNKGDVFVFPIGLIHFQLNVGHVN-AVAFAG  406

Query  257  LSSQNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            LSSQNPG    + A F +KP +  +VL KAFQ++   V  ++K  
Sbjct  407  LSSQNPGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQF  451


 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 143/223 (64%), Gaps = 6/223 (3%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSD-PDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M+   FL+  + + L+F   L  +D P PLQD+CVA       +F+NG  C +P LA A+
Sbjct  1    MKGDHFLISTLAI-LAFATFLASADDPSPLQDFCVALKDIKDGVFVNGKFCKDPKLANAN  59

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L  P NT+N  G NVTA NV  L G+NT G++LAR+D AP GL PPHTHPRA+E
Sbjct  60   DFFFSGLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATE  119

Query  422  VTIVLKGAVLVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLS  252
            + +VL+G + VGFV ++   NRLFT++L  GD FVFP  LIHF  N+  +  A+A +GLS
Sbjct  120  ILVVLEGTLYVGFVTSNGDGNRLFTKELNKGDVFVFPIGLIHFQLNVGHVN-AVAFAGLS  178

Query  251  SQNPGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            SQNPG    + A F +KP +  +VL KAFQ++   V  ++K  
Sbjct  179  SQNPGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQF  221



>emb|CDP16790.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 131/209 (63%), Gaps = 8/209 (4%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            F + A I+ L F   +  SDP PLQD+CVA       +F+NG  C +P L    +F    
Sbjct  7    FHIAAAILALVFT-SVHASDPSPLQDFCVAVPDANAGVFVNGKICQDPKLVKPEDFFFQG  65

Query  584  LAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLK  405
            L KPG+T N  G NVTA NV  +PG+NT G++LAR+D AP GL PPHTHPRA+E+ +VL+
Sbjct  66   LNKPGSTSNPLGSNVTAVNVNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEILVVLE  125

Query  404  GAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQN  243
            G +LVGFV      +  N+LFT+ L  GD FVFP+ LIHF FN      A+A + LSSQN
Sbjct  126  GTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNQGHSN-AVAFAALSSQN  184

Query  242  PGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            PG    + A F + P +  +VL KAFQ++
Sbjct  185  PGVITIANAVFGSNPPIYPDVLTKAFQVD  213



>gb|EYU20548.1| hypothetical protein MIMGU_mgv1a013109mg [Erythranthe guttata]
Length=230

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 128/204 (63%), Gaps = 10/204 (5%)
 Frame = -1

Query  749  IIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPG  570
            I+ CL+ +     SDP PLQD+CVA       +F+NG  C NP++ VA +F  S L KPG
Sbjct  13   IVSCLATLA--YASDPSPLQDFCVAVKDADAAVFVNGKVCKNPNMVVAEDFFLSGLNKPG  70

Query  569  NTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLV  390
            NT N  G  VT  NV  +PG+NT G++  R+D AP GL PPHTHPRA+E+ +VL+G + V
Sbjct  71   NTSNPVGSRVTPANVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYV  130

Query  389  GFVDTS-------NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQ  231
            GFV ++       N+LFT+ L  GD FVFP+ LIHF FN+     A+A + LSSQNPG  
Sbjct  131  GFVTSNPADPTLKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTN-AVAFAALSSQNPGVI  189

Query  230  LTSLATFATKPAVPDEVLKKAFQI  159
              + A F + P +   VL KAFQ+
Sbjct  190  TIANAVFGSDPTINTAVLTKAFQV  213



>ref|XP_008246341.1| PREDICTED: germin-like protein subfamily 2 member 1 [Prunus mume]
Length=217

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 129/196 (66%), Gaps = 3/196 (2%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            +DPD LQD CVAD   T  + +NG  C +   A A +F T+ LAKPG T NTFG  VTA 
Sbjct  21   ADPDLLQDICVADL--TAGVKVNGFVCKDAANATAEDFFTAGLAKPGLTNNTFGSLVTAA  78

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQ  351
            NV  +PG+NT G++LAR+D APGG+ PPHTHPRA+E+  VL+G + VGF+ T+N+L ++ 
Sbjct  79   NVLKVPGLNTLGVSLARIDYAPGGINPPHTHPRATEIVFVLEGELDVGFITTANKLISKT  138

Query  350  LRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKK  171
            ++ G+ FVFPK L+HF  N   + PA  ++G +SQ  G    +L  FA  P VPD VL +
Sbjct  139  IKKGEVFVFPKGLVHFQKNNGKV-PAAVIAGFNSQLQGTANIALTLFAATPEVPDHVLTQ  197

Query  170  AFQINGIDVAKIRKNL  123
             F++   D+ KI+  L
Sbjct  198  TFRVGTKDIEKIKSRL  213



>emb|CDM86515.1| unnamed protein product [Triticum aestivum]
Length=224

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 130/196 (66%), Gaps = 2/196 (1%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKN-LFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            DPD LQD+CVAD K+    L +NG  C  P+   A +F ++ALA PGNT N  G  VTA 
Sbjct  27   DPDMLQDFCVADYKSLDGPLRMNGFPCKRPENVTADDFFSTALALPGNTGNPVGSAVTAA  86

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQ  351
            NV  LPG+NT G++++RVD AP GL PPHTHPRA+E+  VL+G++ VGFV T+ +LF + 
Sbjct  87   NVEKLPGLNTLGVSMSRVDYAPWGLNPPHTHPRATEIIYVLEGSLDVGFVTTAGKLFART  146

Query  350  LRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKK  171
            +  G+ FVFP+ L+H+  N   + PA+A+S  +SQ PG Q  ++A F + P VP +VL +
Sbjct  147  VCKGELFVFPRGLVHYQKNNGGV-PAMAISAFNSQLPGTQSLAMAMFGSSPPVPTDVLAR  205

Query  170  AFQINGIDVAKIRKNL  123
            A QI+G  V  I+   
Sbjct  206  ALQIDGGLVEAIKSKF  221



>ref|XP_002265447.3| PREDICTED: uncharacterized protein LOC100242782 [Vitis vinifera]
Length=450

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 131/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A++F  S L  PGNT N  G  VT
Sbjct  254  SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVT  311

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  312  PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  371

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             ++ L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  372  ISKVLYKGDVFVFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  430

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  431  VLTKAFQVD  439


 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 114/170 (67%), Gaps = 3/170 (2%)
 Frame = -1

Query  659  KNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLAR  480
            + +F+NG  C +P +A A++F  S L  PGNT N  G  VT  NVA +P + T G++LAR
Sbjct  5    ERVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVTPANVAQIPDLKTLGISLAR  64

Query  479  VDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIH  306
            VD AP GL PPHTHPR +E+   L+G + VGFV ++  NRL ++ L  GD FVFP+ LIH
Sbjct  65   VDYAPYGLNPPHTHPRDTEILTFLEGTLYVGFVTSNPDNRLISKVLYKGDVFVFPEDLIH  124

Query  305  FLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            F  N++  K A+A++ LSSQNPG    + A F +KPA+  +VL KAFQ++
Sbjct  125  FQLNVEKTK-AVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAFQVD  173



>ref|XP_006358461.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 124/191 (65%), Gaps = 7/191 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDP PLQD+CVA  ++ + +F+NG  C +P L  A +F    L KPGNT N  G  VTA 
Sbjct  25   SDPSPLQDFCVAVNESKETVFVNGKVCKDPKLVTADDFFRPGLNKPGNTSNQLGSIVTAV  84

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFV------DTSN  369
            NV  LPG+NT G++LAR+D A  GL PPHTHPR +EV +VLKG + VGFV      +  N
Sbjct  85   NVNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTEVLVVLKGRLYVGFVLSNPGPNMKN  144

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
            +LFT+ L  GD FVFP+ L+HF  N+     A+A +GLSSQN G    + A F + P + 
Sbjct  145  KLFTKILNPGDVFVFPEGLVHFQLNVGKTN-AIAFAGLSSQNAGVITVANAVFGSDPPIN  203

Query  188  DEVLKKAFQIN  156
            D+VL KAFQ++
Sbjct  204  DDVLAKAFQVD  214



>gb|EYU20542.1| hypothetical protein MIMGU_mgv1a020630mg [Erythranthe guttata]
Length=231

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 128/214 (60%), Gaps = 8/214 (4%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M+I    +  I V   +      SDP PLQD+CVA       +F+NG  C NPD+ VA +
Sbjct  2    MKIVILSVTTIFVISCWATFAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNPDMVVAED  61

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F    L KPGNT N  G  VT  NV  +PG+NT G++  R+D AP G  PPHTHPRA+E+
Sbjct  62   FFFPGLNKPGNTSNLVGSRVTPVNVNQIPGLNTLGISAVRIDYAPNGSNPPHTHPRATEI  121

Query  419  TIVLKGAVLVGFVDTS-------NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
             +V++G + VGFV ++       N+LFT+ L  GD FVFP+ LIHF FN+     A+A +
Sbjct  122  LVVMEGTLYVGFVTSNPANPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTN-AVAFA  180

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQI  159
            GLSSQNPG    + A F + P +   VL KAFQ+
Sbjct  181  GLSSQNPGVITVANAVFGSDPKINPAVLTKAFQV  214



>gb|EYU20540.1| hypothetical protein MIMGU_mgv1a013117mg [Erythranthe guttata]
Length=230

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 126/214 (59%), Gaps = 8/214 (4%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M++    L  I    SF      SDP PLQD+CVA       +F+NG  C NP++ VA +
Sbjct  1    MKMALVSLATIFAIASFATFGYASDPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAED  60

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F    L KPGNT N  G  VT   V  LPG+NT G++  R+D AP GL PPHTHPRA+E+
Sbjct  61   FLFRGLNKPGNTSNPLGSRVTPVTVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEI  120

Query  419  TIVLKGAVLVGFVDTS-------NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
             I+LKG + VGFV ++       N+LF   L  GD FVFP+ LIHF FN+     A+A +
Sbjct  121  LILLKGTLYVGFVTSNPADPALKNKLFATYLHPGDVFVFPQGLIHFQFNVGKTN-AVAFA  179

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQI  159
            GLSSQNPG    + A F + P +   VL KAFQ+
Sbjct  180  GLSSQNPGVITIANAVFGSDPPIDPAVLTKAFQV  213



>ref|XP_006659192.1| PREDICTED: germin-like protein 8-5-like [Oryza brachyantha]
Length=225

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFN  543
            + + SDP PLQD+CVAD  +   + +NG AC+NP    A +F  +A+       N  G N
Sbjct  20   QAIASDPSPLQDFCVADMHSP--VRVNGFACLNPMDVNADHFFKAAMLDTPRKTNKVGSN  77

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--SN  369
            VT  NV  +PG+NT G+++AR+D AP G  PPHTHPRA+E+  VL+G + VGFV +  +N
Sbjct  78   VTLINVMQIPGLNTLGVSIARIDYAPLGQNPPHTHPRATEILTVLEGTLYVGFVTSNPNN  137

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
             LFT++L  GD FVFP+ LIHF FN +  +PA+A++ LSSQNPGA   + A F +KP + 
Sbjct  138  TLFTKELNKGDVFVFPEGLIHFQFNPNPHQPAVAIAALSSQNPGAITIANAVFGSKPPIS  197

Query  188  DEVLKKAFQI  159
            D+VL KAFQ+
Sbjct  198  DKVLAKAFQV  207



>ref|XP_002878427.1| hypothetical protein ARALYDRAFT_486710 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54686.1| hypothetical protein ARALYDRAFT_486710 [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 124/205 (60%), Gaps = 2/205 (1%)
 Frame = -1

Query  737  LSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKN  558
             S  V  +  DPD LQD CVAD  +T  + +NG  C       AS+F  + + KP    N
Sbjct  13   FSLTVVALAYDPDTLQDLCVAD--HTSGIKVNGFTCKPESNITASDFFFAGIGKPAVVNN  70

Query  557  TFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVD  378
            T G  VT  NV  + G+NT G++LAR+D APGGL PPHTHPRA+EV  VL+G + VGF+ 
Sbjct  71   TVGSAVTGANVEKIAGLNTLGVSLARIDYAPGGLNPPHTHPRATEVIFVLEGELDVGFIT  130

Query  377  TSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKP  198
            T+N+LF + ++ G+ FVFP+ LIH+  N D  KPA  +S  +SQ PG Q  +   F   P
Sbjct  131  TANKLFAKTVKKGEVFVFPRGLIHYQKNNDKAKPASVISAFNSQLPGTQSIAATLFTATP  190

Query  197  AVPDEVLKKAFQINGIDVAKIRKNL  123
            A+PD VL  AFQI   ++ KI+   
Sbjct  191  AIPDHVLTTAFQIGTKEIEKIKSKF  215



>ref|XP_003574983.1| PREDICTED: putative germin-like protein 2-1 [Brachypodium distachyon]
Length=215

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 130/195 (67%), Gaps = 5/195 (3%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDP  LQD+CVAD   T  +F+NG AC +P +AV+ +F  S L   GNT N     VTA 
Sbjct  21   SDPSQLQDFCVAD--RTSPVFVNGFACQDPKIAVSEDFFFSGLHMAGNTSNKQSSAVTAV  78

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--SNRLFT  357
            NVA + G+NT G++L RVD AP G  PPH HPRA+E+  VL+G++ VGF+ +   N+LF 
Sbjct  79   NVAQIAGLNTLGISLVRVDYAPFGQNPPHIHPRATEILTVLEGSLYVGFMTSNPENKLFA  138

Query  356  QQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVL  177
            + L  GD FVFP+ LIHF FN  T K A+A++ LSS+NPG      A F +KP++ D++L
Sbjct  139  KVLNKGDVFVFPQGLIHFQFNYGTNK-AVAIAALSSKNPGVITIGNAVFGSKPSISDDIL  197

Query  176  KKAFQINGIDVAKIR  132
             KAFQ++ + V +I+
Sbjct  198  AKAFQVDKMTVDRIQ  212



>ref|XP_008351931.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 135/214 (63%), Gaps = 5/214 (2%)
 Frame = -1

Query  752  AIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAK  576
            A +  L+F   L   SDP PLQD+CVA       +F+NG  C +P LA A++F +  L  
Sbjct  11   AALSVLAFATLLASASDPXPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRY  70

Query  575  PGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            P NT N  G  VTA NV  +PG+NT G++ ARVD AP GL PPHTHPRA+E+ IV++G++
Sbjct  71   PRNTSNPVGSIVTAANVDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSL  130

Query  395  LVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLT  225
             VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+     ALA++GLSSQNPG    
Sbjct  131  YVGFVTSNGDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTN-ALAIAGLSSQNPGVITI  189

Query  224  SLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            + A F + P +  +VL KAFQ++   V  ++K  
Sbjct  190  ANAVFGSNPPINPDVLAKAFQVDBNVVDYLQKQF  223



>ref|XP_002531992.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30391.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=223

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 138/220 (63%), Gaps = 3/220 (1%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M+   FL   +I+ LS    L   DP PLQD+CVA       +F+NG  C +P LA A++
Sbjct  1    MKGVHFLAAFVILALSSSFALA-FDPSPLQDFCVATDDPKDAVFVNGKLCKDPKLATAND  59

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F+ S L  P +T N  G NVT  N   +PG+NT G++LAR+D AP GL PPHTHPRA+E+
Sbjct  60   FSFSGLNVPRDTSNPVGSNVTLLNADRIPGLNTLGISLARIDYAPYGLNPPHTHPRATEI  119

Query  419  TIVLKGAVLVGFVDTS-NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQN  243
             +VL+G + VGFV ++ NRL T+ L+ GD FVFP  +IHF FN      A+A +GLSSQN
Sbjct  120  LVVLEGTLYVGFVTSNPNRLITKTLKPGDVFVFPIGMIHFQFNTGNTN-AVAFAGLSSQN  178

Query  242  PGAQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            PGA   + A F + P +  +VL KAFQ++   V  ++K  
Sbjct  179  PGAITIANAVFGSNPPINADVLTKAFQVDKNVVKYLQKQF  218



>emb|CAN71140.1| hypothetical protein VITISV_005471 [Vitis vinifera]
Length=220

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 124/186 (67%), Gaps = 3/186 (2%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTATN  528
            DP PLQD CVA  +    +F+NG  C NP+L VA +F +  L  PGNT N  G +VT  N
Sbjct  25   DPSPLQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFSKGLNIPGNTSNLVGSSVTTVN  84

Query  527  VAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRLFTQ  354
            V V+PG+NT G++L R+D AP G  PPHTHPRA+E+  VL+G +LVGFV ++  NRLF++
Sbjct  85   VDVIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNPQNRLFSK  144

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L  GD FVFP  LIHF FN+     A+A++GLSSQNPG    + A F + P +  + L 
Sbjct  145  VLNKGDVFVFPIGLIHFQFNIGHFN-AVAIAGLSSQNPGVITIANAVFGSNPPINSDFLA  203

Query  173  KAFQIN  156
            KAFQ++
Sbjct  204  KAFQLD  209



>ref|NP_001061160.1| Os08g0189500 [Oryza sativa Japonica Group]
 sp|Q6YZA4.1|GL86_ORYSJ RecName: Full=Germin-like protein 8-6; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAD05734.1| putative germin A [Oryza sativa Japonica Group]
 dbj|BAD05773.1| putative germin A [Oryza sativa Japonica Group]
 dbj|BAF23074.1| Os08g0189500 [Oryza sativa Japonica Group]
 gb|EAZ41762.1| hypothetical protein OsJ_26300 [Oryza sativa Japonica Group]
 dbj|BAH01463.1| unnamed protein product [Oryza sativa Japonica Group]
Length=225

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFN  543
            + + SDP PLQD+CVAD  +   + +NG AC++P    A +F  +A+       N  G N
Sbjct  20   QTIASDPSPLQDFCVADEHSP--VLVNGFACLDPKHVNADHFFKAAMLDTPRKTNKVGSN  77

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--SN  369
            VT  NV  +PG+NT G+++AR+D AP G  PPHTHPRA+E+  VL+G + VGFV +  +N
Sbjct  78   VTLINVMQIPGLNTLGISIARIDYAPLGQNPPHTHPRATEILTVLEGTLYVGFVTSNPNN  137

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
             LF++ L+ GD FVFP  LIHF FN +  +PA+A++ LSSQNPGA   + A F +KP + 
Sbjct  138  TLFSKVLKKGDVFVFPVGLIHFQFNPNPHQPAVAIAALSSQNPGAITIANAVFGSKPPIS  197

Query  188  DEVLKKAFQI  159
            DEVL KAFQ+
Sbjct  198  DEVLAKAFQV  207



>gb|EAZ05851.1| hypothetical protein OsI_28086 [Oryza sativa Indica Group]
Length=225

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFN  543
            + + SDP PLQD+CVAD  +   + +NG AC++P    A +F  +A+       N  G N
Sbjct  20   QTIASDPSPLQDFCVADEHSP--VLVNGFACLDPKHVNADHFFKAAMLDTPRKTNKVGSN  77

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--SN  369
            VT  NV  +PG+NT G+++AR+D AP G  PPHTHPRA+E+  VL+G + VGFV +  +N
Sbjct  78   VTLINVMQIPGLNTLGISIARIDYAPLGQNPPHTHPRATEILTVLEGTLYVGFVTSNPNN  137

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
             LF++ L+ GD FVFP  LIHF FN +  +PA+A++ LSSQNPGA   + A F +KP + 
Sbjct  138  TLFSKVLKKGDVFVFPVGLIHFQFNPNPHQPAVAIAALSSQNPGAITIANAVFGSKPPIS  197

Query  188  DEVLKKAFQI  159
            DEVL KAFQ+
Sbjct  198  DEVLAKAFQV  207



>ref|XP_008775504.1| PREDICTED: germin-like protein 3-8 [Phoenix dactylifera]
Length=219

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 130/198 (66%), Gaps = 2/198 (1%)
 Frame = -1

Query  713  KSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            +SDPDPLQD+CV + + T ++ +NG  C      V+ +F ++AL+K GNT N F  NVTA
Sbjct  23   RSDPDPLQDFCVGNPQ-TSDVTVNGFPCKPTSSVVSDDFFSTALSKAGNTDNIFSSNVTA  81

Query  533  TNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQ  354
             +V   PG+NT GL++ RVD+APGG+ PPHTHPRA+++ +VL G VLVG + TSN  +++
Sbjct  82   ADVLSFPGLNTLGLSMNRVDIAPGGVNPPHTHPRATQLGLVLHGQVLVGIISTSNVFYSK  141

Query  353  QLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLK  174
             L AG+SFV P+ L+HF +NM   + AL ++  +SQ PG  +     F + P +P EVL 
Sbjct  142  ILNAGESFVIPRGLVHFEYNMGK-EAALEITAFNSQLPGVLIAPRTLFGSMPGIPSEVLA  200

Query  173  KAFQINGIDVAKIRKNLG  120
            K FQ++   V  I+   G
Sbjct  201  KTFQVDQQVVNLIKSKFG  218



>ref|NP_001061155.1| Os08g0188900 [Oryza sativa Japonica Group]
 sp|Q6YZB2.1|GL81_ORYSJ RecName: Full=Putative germin-like protein 8-1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD03336.1| putative germin A [Oryza sativa Japonica Group]
 dbj|BAD05765.1| putative germin A [Oryza sativa Japonica Group]
 dbj|BAF23069.1| Os08g0188900 [Oryza sativa Japonica Group]
Length=219

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 137/207 (66%), Gaps = 8/207 (4%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
             LL A+I   S+  + + ++P PLQD+CVAD  +   + +NG AC NP    A +F  +A
Sbjct  8    LLLAALIGMASW--QAIAAEPSPLQDFCVADLNSA--VRVNGFACKNPTNVSADDFFKAA  63

Query  584  -LAKPGNTK-NTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
             L KP +T  N  G N+T  NV  +PG+NT G+++ RVD AP GL PPHTHPRA+E+  V
Sbjct  64   MLDKPRDTAVNKVGSNITLINVMEIPGLNTLGISIVRVDYAPLGLNPPHTHPRATEIFTV  123

Query  410  LKGAVLVGFVDTS--NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPG  237
            L+G + VGFV ++  N+LF++ L  GD FVFPK LIHF FN+D  KPA+A S +SSQNPG
Sbjct  124  LEGTLYVGFVTSNPDNKLFSKVLNKGDVFVFPKGLIHFQFNLDPHKPAIATSAISSQNPG  183

Query  236  AQLTSLATFATKPAVPDEVLKKAFQIN  156
                + A F + P + D++L KAFQ++
Sbjct  184  IITIANAVFRSNPPISDDILAKAFQVD  210



>ref|NP_001061162.2| Os08g0189700 [Oryza sativa Japonica Group]
 sp|Q6YZA1.1|GL88_ORYSJ RecName: Full=Germin-like protein 8-8; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAD05737.1| putative germin A [Oryza sativa Japonica Group]
 dbj|BAD05776.1| putative germin A [Oryza sativa Japonica Group]
 gb|EAZ05853.1| hypothetical protein OsI_28088 [Oryza sativa Indica Group]
 gb|EAZ41764.1| hypothetical protein OsJ_26302 [Oryza sativa Japonica Group]
 dbj|BAH00937.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF23076.2| Os08g0189700 [Oryza sativa Japonica Group]
Length=224

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFN  543
            + + SDP PLQD+CVAD  +   + +NG AC++P    A +F  +A+       N  G N
Sbjct  19   QAIASDPSPLQDFCVADKHSP--VLVNGFACLDPKYVTADHFFKAAMLDTPRKTNKVGSN  76

Query  542  VTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--SN  369
            VT  NV  +PG+NT G+++AR+D AP G  PPHTHPRA+E+  VL+G + VGFV +  +N
Sbjct  77   VTLINVMQIPGLNTLGISIARIDYAPLGENPPHTHPRATEILTVLEGTLYVGFVTSNPNN  136

Query  368  RLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVP  189
             LF++ L  GD FVFP+ LIHF FN +  +PA+A++ LSSQNPGA   + A F +KP + 
Sbjct  137  TLFSKVLNKGDVFVFPEGLIHFQFNPNPHQPAVAIAALSSQNPGAITIANAVFGSKPPIS  196

Query  188  DEVLKKAFQI  159
            D+VL KAFQ+
Sbjct  197  DKVLAKAFQV  206



>ref|XP_010528694.1| PREDICTED: germin-like protein subfamily 1 member 8 isoform X1 
[Tarenaya hassleriana]
Length=219

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 127/196 (65%), Gaps = 5/196 (3%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            + SDP PLQD+CVA       LF+NG  C +P L  A +F  S   K GNT N  G +VT
Sbjct  20   MASDPSPLQDFCVAVNNPANALFVNGKFCKDPKLVTADDFFKSGFDKAGNTTNRIGSSVT  79

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS---NR  366
            A NV  LPG+NT G++L R+D AP G  PPHTHPRA+EV +V +G + VGFV ++   NR
Sbjct  80   AFNVDTLPGLNTLGISLVRIDYAPFGQNPPHTHPRATEVLVVQEGTLYVGFVSSNADGNR  139

Query  365  LFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPD  186
            LFT+ L  GD FVFP+ LIHF FN  T   A+A + LSSQNPG    + + F +KPA+  
Sbjct  140  LFTKTLNTGDVFVFPEGLIHFQFN-PTRSKAVAFAALSSQNPGVITIANSVFGSKPAIDP  198

Query  185  EVLKKAFQINGIDVAK  138
             VL KAFQ++ ++V K
Sbjct  199  IVLSKAFQLD-VNVVK  213



>ref|XP_006349263.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 133/215 (62%), Gaps = 10/215 (5%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVAS  603
            M +K F+L  II  LS V  +   SDP PLQD+CVA   +   +F+NG  C +P +  A 
Sbjct  1    MALKSFVL--IIAILSVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDPKIVTAD  58

Query  602  NFATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASE  423
            +F  S L   GNT N  G  VTA NV  LPG+NT G++LAR+D AP G+ PPHTHPR +E
Sbjct  59   DFFKSGLNVAGNTSNNVGSAVTAVNVNNLPGLNTLGISLARIDYAPYGVNPPHTHPRGTE  118

Query  422  VTIVLKGAVLVGFV------DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVS  261
            V  VL+G + VGFV      +  N+LFT+ L  GD FVFP  LIHF FN+   K A+A +
Sbjct  119  VLTVLEGTLYVGFVLSNPGANMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTK-AVAFA  177

Query  260  GLSSQNPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            G +SQN G    + A F + P + D++L KAFQ++
Sbjct  178  GFNSQNQGVITIANAVFGSDPPINDDILAKAFQVD  212



>ref|XP_009402551.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=217

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 126/189 (67%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDP PLQD+CVAD K++K + +NG  C +P +  A +F    L K G+T N  G NVTA 
Sbjct  21   SDPSPLQDFCVAD-KDSK-VLVNGFVCKDPKVVKAEDFFFRGLDKAGDTVNKVGSNVTAV  78

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFV----DTSNRL  363
            NV  L G+NT G+++ R+D AP GL  PHTHPRA+E+  V++G +LVGFV    D  NRL
Sbjct  79   NVNQLVGLNTLGISMVRIDYAPRGLNAPHTHPRATEILTVIEGQLLVGFVTSNSDDGNRL  138

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
            FT+ L+ GD FVFP+ LIHF FN    K  +A+  LSSQNPG    + A F +KP + D+
Sbjct  139  FTKMLKKGDVFVFPQGLIHFQFNPGHTK-TIAIGALSSQNPGTITIANAVFGSKPPISDD  197

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  198  VLAKAFQVD  206



>gb|EMT02678.1| Putative germin-like protein 2-1 [Aegilops tauschii]
Length=215

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 133/210 (63%), Gaps = 8/210 (4%)
 Frame = -1

Query  779  MRIKPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN  600
            M  K FLL  + +  S     + SDP  LQD+CVAD   T  +F+NG AC +P   V  +
Sbjct  1    MATKFFLLAFLALWAS---RALASDPSQLQDFCVAD--RTSQVFVNGFACKDPKTVVVED  55

Query  599  FATSALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEV  420
            F  S L   GN  N  G  V+A NVA +PG+NT G++LARVD AP G  PPH HPRASE+
Sbjct  56   FLFSGLHMAGNMSNKQGSAVSAVNVAHIPGLNTLGISLARVDYAPYGQNPPHIHPRASEI  115

Query  419  TIVLKGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQ  246
              VL+G++ VGFV +   N+LF++ L  GD FVFP+ LIHF FN    K A+A++ LSS+
Sbjct  116  LTVLEGSLYVGFVTSNPENKLFSKVLNKGDVFVFPQGLIHFQFNTGD-KEAIAIAALSSK  174

Query  245  NPGAQLTSLATFATKPAVPDEVLKKAFQIN  156
            NPG    + A F + P++ D++L KAFQ++
Sbjct  175  NPGVITIANAVFGSVPSISDDILAKAFQVD  204



>gb|AJA71635.1| germin-like protein [Triticum aestivum]
Length=226

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINP-DLAVASNFATSALAKPGNTK-NTFGFNVT  537
            SDP PLQD+CVAD  N+  + +NG  C +P D+     F  + L  P +TK N  G NVT
Sbjct  23   SDPSPLQDFCVAD--NSSRVLVNGFVCKDPKDVKAEDFFLAAKLDMPRDTKTNKVGSNVT  80

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--SNRL  363
              NV  +PG+NT G++LAR+D AP G  PPHTHPRA+E+  VL+G + VGFV +   N+ 
Sbjct  81   LINVMQIPGLNTLGISLARIDYAPLGENPPHTHPRATEILTVLEGTLYVGFVTSNPENKF  140

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             ++ L  GD FVFP+ LIHF FN +  KPA+A++ LSSQNPGA   + A F +KPA+ D+
Sbjct  141  LSKVLNRGDVFVFPEGLIHFQFNPNPYKPAVAIAALSSQNPGAITIANAVFGSKPAISDD  200

Query  182  VLKKAFQI  159
            VL KAFQ+
Sbjct  201  VLAKAFQV  208



>ref|XP_006362279.1| PREDICTED: putative germin-like protein 2-3-like [Solanum tuberosum]
Length=216

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 141/218 (65%), Gaps = 6/218 (3%)
 Frame = -1

Query  770  KPFLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFAT  591
            K FLL  +IV +SF   ++  +  P+QD+CVAD  +T  +  NG+AC +P   ++ +F  
Sbjct  3    KHFLLLNLIV-VSFCCAVLAFESSPMQDFCVADPASTVKV--NGLACKDPKSVISEDFFF  59

Query  590  SALAKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
            S L   GNT NTFG  VT  N   +PG+NT G++LARVD AP G+ PPHTHPRA+E+  V
Sbjct  60   SGLHLAGNTSNTFGSKVTRVNATQIPGLNTLGISLARVDYAPWGVNPPHTHPRATEIFTV  119

Query  410  LKGAVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPG  237
            L+G++ VGFV +   NRL T+ L+ GD FVFP  L+H+  N+     A+AV+ LSSQNPG
Sbjct  120  LEGSLQVGFVTSNPENRLITKVLKKGDVFVFPIGLVHYQRNVGYGN-AVAVAALSSQNPG  178

Query  236  AQLTSLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
                + A F ++PA+  ++L KAFQ++   VA+I+   
Sbjct  179  VISIANAVFGSEPAIATDILAKAFQVDETVVAQIQSKF  216



>gb|EEC83018.1| hypothetical protein OsI_28085 [Oryza sativa Indica Group]
Length=204

 Score =   180 bits (457),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 126/188 (67%), Gaps = 4/188 (2%)
 Frame = -1

Query  716  VKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            + SDP PLQD+CVAD  +   + +NG AC+NP    A +F  +A        N  G NVT
Sbjct  1    MASDPSPLQDFCVADMHSP--VRVNGFACLNPMEVNADHFFKAAKLDTPRKTNKVGSNVT  58

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--SNRL  363
              NV  +PG+NT G+++AR+D AP GL PPHTHPRA+E+  VL+G + VGFV +  +N L
Sbjct  59   LINVMQIPGLNTLGISIARIDYAPLGLNPPHTHPRATEILTVLEGTLYVGFVTSNPNNTL  118

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
            F++ L  GD FVFP+ LIHF FN +  +PA+A++ LSSQNPGA   + A F +KP + DE
Sbjct  119  FSKVLNKGDVFVFPQGLIHFQFNPNPHQPAVAIAALSSQNPGAITIANAVFGSKPPISDE  178

Query  182  VLKKAFQI  159
            VL KAFQ+
Sbjct  179  VLAKAFQV  186



>ref|NP_001175415.1| Os08g0189850 [Oryza sativa Japonica Group]
 sp|Q6YZ99.1|GL89_ORYSJ RecName: Full=Germin-like protein 8-9; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAD05739.1| putative germin A [Oryza sativa Japonica Group]
 dbj|BAD05778.1| putative germin A [Oryza sativa Japonica Group]
 gb|EAZ05856.1| hypothetical protein OsI_28091 [Oryza sativa Indica Group]
 gb|EAZ41766.1| hypothetical protein OsJ_26304 [Oryza sativa Japonica Group]
 dbj|BAH94143.1| Os08g0189850 [Oryza sativa Japonica Group]
Length=224

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 132/203 (65%), Gaps = 6/203 (3%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSAL  582
            L  A++  +S+  + + SDP PLQD+CVAD  +   + +NG AC++P    A +F  +A+
Sbjct  8    LFAALLALVSW--QAIASDPSPLQDFCVADKHSP--VLVNGFACLDPKYVTADHFFKAAM  63

Query  581  AKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
                   N  G NVT  NV  +PG+NT G+++AR+D AP G  PPHTHPRA+E+  VL+G
Sbjct  64   LDTPRKTNKVGSNVTLINVMQIPGLNTLGISIARIDYAPLGQNPPHTHPRATEILTVLEG  123

Query  401  AVLVGFVDT--SNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQL  228
             + VGFV +  +N LF++ L  GD FVFP  LIHF FN +  +PA+A++ LSSQNPG   
Sbjct  124  TLHVGFVTSNPNNTLFSKVLNKGDVFVFPVGLIHFQFNPNPHQPAVAIAALSSQNPGVIT  183

Query  227  TSLATFATKPAVPDEVLKKAFQI  159
             + A F +KP + DEVL KAFQ+
Sbjct  184  IANAVFGSKPPISDEVLAKAFQV  206



>ref|NP_001267914.1| germin-like protein 2 precursor [Vitis vinifera]
 gb|ABH09468.1| germin-like protein 2 [Vitis vinifera]
 emb|CAN76588.1| hypothetical protein VITISV_020289 [Vitis vinifera]
 emb|CBI39687.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 133/208 (64%), Gaps = 3/208 (1%)
 Frame = -1

Query  746  IVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGN  567
            ++ L+     V +DPD LQD CVAD   T  + +NG +C +     A++F    LAKPG 
Sbjct  9    VITLAVFSGTVAADPDMLQDVCVADL--TSGVKVNGFSCKDATNITATDFFFDGLAKPGL  66

Query  566  TKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVG  387
            T N+ G  VT  NV  +PG+NT G++L+R+D APGGL PPHTHPRA+E+  VL+G + VG
Sbjct  67   TNNSMGSLVTGANVQKIPGLNTLGVSLSRIDYAPGGLNPPHTHPRATEMVFVLEGELDVG  126

Query  386  FVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFA  207
            F+ TSN L ++ ++ G+ FVFPK L+HF  N   + PA  +S  +SQ PG Q  +++ FA
Sbjct  127  FITTSNTLISKSIKKGEIFVFPKGLVHFQKNNGEV-PAAVISAFNSQLPGTQSIAVSLFA  185

Query  206  TKPAVPDEVLKKAFQINGIDVAKIRKNL  123
              P VP+ VL KAFQ+   +V KI+  L
Sbjct  186  ASPPVPNNVLTKAFQVGTKEVEKIKSRL  213



>ref|NP_001046876.1| Os02g0491800 [Oryza sativa Japonica Group]
 sp|Q6K5P8.1|GL23_ORYSJ RecName: Full=Putative germin-like protein 2-3; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD21900.1| putative germin-like protein [Oryza sativa Japonica Group]
 dbj|BAD22077.1| putative germin-like protein [Oryza sativa Japonica Group]
 dbj|BAF08790.1| Os02g0491800 [Oryza sativa Japonica Group]
 gb|EAZ23100.1| hypothetical protein OsJ_06794 [Oryza sativa Japonica Group]
Length=223

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 131/198 (66%), Gaps = 5/198 (3%)
 Frame = -1

Query  719  LVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNV  540
            +V SDP  LQD CVAD  +T  + +NGVAC + +   A +F  S L   GNT N  G  V
Sbjct  26   VVASDPSHLQDLCVADKAST--VRVNGVACKDGEDVAAEDFFFSGLHMAGNTTNKQGSAV  83

Query  539  TATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--SNR  366
            TA NVA +PG+NT G++LAR+D A  GL PPHTHPRA+E+  VL+G++ VGFV +   N+
Sbjct  84   TAVNVAQVPGLNTLGISLARIDYALHGLNPPHTHPRATEILTVLEGSLYVGFVTSNPENK  143

Query  365  LFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPD  186
            LFT+ +  GD FVFPK L+HF FN  T   A+A+  LSSQNPG    + A F +KP++ D
Sbjct  144  LFTKVINKGDVFVFPKGLVHFQFNYGTTD-AVAIVALSSQNPGVITVANAVFGSKPSITD  202

Query  185  EVLKKAFQINGIDVAKIR  132
            ++L KAFQ+    V +I+
Sbjct  203  DILAKAFQVEKTVVDQIQ  220



>gb|EYU20549.1| hypothetical protein MIMGU_mgv1a020596mg [Erythranthe guttata]
Length=231

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 128/204 (63%), Gaps = 10/204 (5%)
 Frame = -1

Query  749  IIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPG  570
            I+ CL+ +     SDP PLQD+CVA       +F+NG  C NP++ VA +F    L KPG
Sbjct  14   IVSCLATLA--YASDPSPLQDFCVAVKDADAAVFVNGKVCKNPNMVVAEDFFFPGLNKPG  71

Query  569  NTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLV  390
            NT N  G  VT  NV  +PG+NT G++  R+D AP GL PPHTHPRA+E+ +V++G + V
Sbjct  72   NTSNPVGSRVTPVNVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVMEGTLYV  131

Query  389  GFVDTS-------NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQ  231
            GFV ++       N+LFT+ L  GD FVFP+ LIHF FN+     A+A +GLSSQNPG  
Sbjct  132  GFVTSNPADPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTN-AVAFAGLSSQNPGVI  190

Query  230  LTSLATFATKPAVPDEVLKKAFQI  159
              + A F + P +   VL KAFQ+
Sbjct  191  TVANAVFGSDPQINPAVLTKAFQV  214



>ref|XP_004302315.1| PREDICTED: germin-like protein 5-1-like [Fragaria vesca subsp. 
vesca]
Length=217

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 134/213 (63%), Gaps = 3/213 (1%)
 Frame = -1

Query  761  LLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSAL  582
            +L   ++  + VV    +DPD LQD CVAD  +   +  NG AC +   A A +F  + L
Sbjct  5    ILAMFVMTFAVVVGNSAADPDMLQDICVADFTSAAKM--NGFACKDAANATAEDFFFAGL  62

Query  581  AKPGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKG  402
            AKPG T NTFG  VTA NV  +PG+NT G+++AR+D APGG+ PPHTHPRA+E+  VL+G
Sbjct  63   AKPGLTNNTFGSLVTAANVQKIPGLNTLGVSMARIDYAPGGINPPHTHPRATEIVYVLEG  122

Query  401  AVLVGFVDTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTS  222
            A+ VGF+ T+N+L ++ +  G+ FVFPK L+HF  N   + PA  ++G +SQ  G    +
Sbjct  123  ALNVGFITTANKLISKTIAKGEVFVFPKGLVHFQKNNGKV-PAAVIAGFNSQLQGTANIA  181

Query  221  LATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            L  FA  P V D+VL K FQ+    + KI+  L
Sbjct  182  LTLFAATPPVADDVLTKTFQVGTKQIEKIKSRL  214



>ref|XP_008367619.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 134/214 (63%), Gaps = 5/214 (2%)
 Frame = -1

Query  752  AIIVCLSFVVELVK-SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAK  576
            A +  L+F   L   SDP PLQD+CVA       +F+NG  C +P LA A++F +  L  
Sbjct  11   AALSVLAFATLLASASDPGPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRY  70

Query  575  PGNTKNTFGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAV  396
            P NT N  G  VTA NV  +PG+NT G++ ARVD AP GL PPHTHPRA+E+ IV +G++
Sbjct  71   PXNTSNPVGSIVTAANVDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVXEGSL  130

Query  395  LVGFVDTS---NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLT  225
             VGFV ++   NRLFT+ L  GD FVFP  LIHF  N+     ALA++GLSSQNPG    
Sbjct  131  YVGFVTSNGDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTN-ALAIAGLSSQNPGVITI  189

Query  224  SLATFATKPAVPDEVLKKAFQINGIDVAKIRKNL  123
            + A F + P +  +VL KAFQ++   V  ++K  
Sbjct  190  ANAVFGSNPPINPDVLAKAFQVDDNVVDYLQKQF  223



>ref|XP_007030273.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10775.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=224

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 132/200 (66%), Gaps = 8/200 (4%)
 Frame = -1

Query  707  DPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTA  534
            DP PLQD+CVA  DTKN   +F+NG  C +P LAVA +F  S L  PGNT N  G NVT 
Sbjct  25   DPSPLQDFCVAINDTKN--GVFVNGKFCKDPKLAVADDFFYSGLNMPGNTSNPVGSNVTT  82

Query  533  TNVAVLPGVNTQGLTLARVDLAP-GGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
             NV  +PG+NT G++L R+D AP GGL PPHTHPR +E+ +V++G + VGFV ++  NRL
Sbjct  83   VNVDQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRGTEILVVVEGTLYVGFVTSNPENRL  142

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
            FT+ L  GD FVFP  LIHF FN+   + A+A +GLSSQN G    + A F + P +  +
Sbjct  143  FTKVLYPGDVFVFPIGLIHFQFNIGKTE-AVAFAGLSSQNAGVITIANAVFGSDPPINPD  201

Query  182  VLKKAFQINGIDVAKIRKNL  123
            VL KAFQ++   VA ++   
Sbjct  202  VLTKAFQLDKNMVAYLQSRF  221



>ref|XP_004290344.1| PREDICTED: germin-like protein subfamily 1 member 18-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 128/190 (67%), Gaps = 8/190 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            SDP  LQD+CVA  KNT ++F+NG  C +P L    +F  S L  PGNT N  G  VT  
Sbjct  28   SDPSSLQDFCVA-LKNT-DVFVNGKFCKDPKLVTEDDFFFSGLRMPGNTSNAVGSKVTPA  85

Query  530  NVAVLPGVNTQGLTLARVDLAP-GGLVPPHTHPRASEVTIVLKGAVLVGFV----DTSNR  366
            NV  + G+NT G++LAR+D AP GGL PPHTHPRASE  +V++G + VGFV    D  N+
Sbjct  86   NVEQIAGLNTLGISLARIDYAPNGGLNPPHTHPRASEFLVVMEGTLYVGFVTSNTDNGNK  145

Query  365  LFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPD  186
            LFT+ L  GD FVFP  LIHF FN+  +K A+A++GLSSQNPGA   + A F +KP +  
Sbjct  146  LFTKVLYPGDVFVFPVGLIHFQFNIGKVK-AVAIAGLSSQNPGAITIANAVFGSKPPIKF  204

Query  185  EVLKKAFQIN  156
            +VL KAFQ++
Sbjct  205  DVLTKAFQVD  214



>gb|EAY85910.1| hypothetical protein OsI_07273 [Oryza sativa Indica Group]
Length=223

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 131/198 (66%), Gaps = 5/198 (3%)
 Frame = -1

Query  719  LVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNV  540
            +V SDP  LQD CVAD  +T  + +NGVAC + +   A +F  S L   GNT N  G  V
Sbjct  26   VVASDPSHLQDLCVADKAST--VRVNGVACKDGEDVAAEDFFFSGLHMAGNTTNKQGSAV  83

Query  539  TATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDT--SNR  366
            TA NVA +PG+NT G++LAR+D A  GL PPHTHPRA+E+  VL+G++ VGFV +   N+
Sbjct  84   TAVNVAQVPGLNTLGISLARIDYALHGLNPPHTHPRATEILTVLEGSLYVGFVTSNPENK  143

Query  365  LFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPD  186
            LFT+ +  GD FVFPK L+HF FN  T   A+A+  LSSQNPG    + A F +KP++ D
Sbjct  144  LFTKVINKGDVFVFPKGLVHFQFNYRTTD-AVAIVALSSQNPGMITVANAVFGSKPSITD  202

Query  185  EVLKKAFQINGIDVAKIR  132
            ++L KAFQ+    V +I+
Sbjct  203  DILAKAFQVEKTVVDQIQ  220



>gb|AJA71637.1| germin-like protein [Triticum aestivum]
Length=226

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 130/192 (68%), Gaps = 6/192 (3%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINP-DLAVASNFATSALAKPGNTK-NTFG  549
            + + SDP PLQD+CVA+  N+ ++ +NG  C +P D+     F  + L  P +TK N  G
Sbjct  19   QAIASDPSPLQDFCVAE--NSSHVRVNGFVCKDPKDMKAEDFFLAAKLDMPRDTKTNKVG  76

Query  548  FNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS-  372
             NVT  NV  +PG+NT G++LAR+D AP G  PPHTHPRA+E+  VL+G + VGFV ++ 
Sbjct  77   SNVTLINVMRIPGLNTLGISLARIDYAPLGENPPHTHPRATEILTVLEGTLYVGFVTSNP  136

Query  371  -NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPA  195
             N+  ++ L  GD FVFP+ LIHF FN +  KPA+A++ LSSQNPGA   + A F +KPA
Sbjct  137  DNKFLSKVLNKGDVFVFPEGLIHFQFNPNPYKPAVAIAALSSQNPGAITIANAVFGSKPA  196

Query  194  VPDEVLKKAFQI  159
            + D+VL KAFQ+
Sbjct  197  ISDDVLAKAFQV  208



>ref|XP_004972683.1| PREDICTED: germin-like protein 8-5-like [Setaria italica]
Length=224

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 137/205 (67%), Gaps = 7/205 (3%)
 Frame = -1

Query  764  FLLKAIIVCLSFVVELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASNFATSA  585
            FLL A +  ++   + + SDP PLQD+CVAD  +   + +NG  C +P    A +F  +A
Sbjct  6    FLLAAFLAMVT--SQAIASDPGPLQDFCVADIHSP--VKVNGFVCKDPMAVNADDFFKAA  61

Query  584  -LAKPGNTKNT-FGFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIV  411
             L KP +TK +  G NVT  NV  LPG+NT G++LAR+D AP G  PPHTHPRA+E+  V
Sbjct  62   NLDKPMDTKKSKVGSNVTLINVMQLPGLNTLGISLARIDYAPLGQNPPHTHPRATEILTV  121

Query  410  LKGAVLVGFVDTS-NRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGA  234
            L+G + VGFV ++ N+LF + L  GD FVFP+ LIHF FN +  KPA+A++ LSSQNPGA
Sbjct  122  LEGTLYVGFVTSNPNKLFAKVLNKGDVFVFPQGLIHFQFNPNPHKPAVAIAALSSQNPGA  181

Query  233  QLTSLATFATKPAVPDEVLKKAFQI  159
               + A F +KP + D+VL KAFQ+
Sbjct  182  ITIANAVFGSKPPISDDVLAKAFQV  206



>gb|EMT11886.1| Germin-like protein 1-3 [Aegilops tauschii]
Length=225

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 129/196 (66%), Gaps = 2/196 (1%)
 Frame = -1

Query  707  DPDPLQDYCVADTKNTKN-LFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVTAT  531
            DPD LQD+CVAD K+    L LNG  C  P+   A +F ++ALA PGNT N  G  VTA 
Sbjct  28   DPDMLQDFCVADYKSLDGPLRLNGFPCKRPENVTADDFFSAALAFPGNTGNPVGSAVTAA  87

Query  530  NVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTSNRLFTQQ  351
            NV  LPG+NT G++++RVD AP G+ PPHTHPRA+E+  VL+G++ VGFV T+ +LF + 
Sbjct  88   NVEKLPGLNTLGVSMSRVDYAPWGVNPPHTHPRATEIVYVLEGSLDVGFVTTAGKLFART  147

Query  350  LRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDEVLKK  171
            +  G+ FVFP+ L+H+  N +   PA A+S  +SQ PG Q  +LA FA  P VP +VL +
Sbjct  148  VCKGELFVFPRGLVHYQKN-NGGAPAAAISAFNSQLPGTQPLALAMFAASPPVPTDVLAR  206

Query  170  AFQINGIDVAKIRKNL  123
            A QI+G  V  I+   
Sbjct  207  ALQIDGGLVEAIKSKF  222



>ref|XP_002265297.3| PREDICTED: uncharacterized protein LOC100247931 [Vitis vinifera]
Length=490

 Score =   187 bits (476),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 131/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A++F  S L  PGNT N  G  VT
Sbjct  25   SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVT  82

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  83   PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  142

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
             ++ L  GD FVFP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  143  ISKVLYKGDVFVFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  201

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  202  VLTKAFQVD  210


 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 129/189 (68%), Gaps = 7/189 (4%)
 Frame = -1

Query  710  SDPDPLQDYCVA--DTKNTKNLFLNGVACINPDLAVASNFATSALAKPGNTKNTFGFNVT  537
            SDP PLQD+CVA  DTK T  +F+NG  C +P +A A +F  S L  PGNT N  G  VT
Sbjct  294  SDPSPLQDFCVAVNDTKTT--VFVNGKVCKDPKVATADDFFFSGLRVPGNTSNKVGSMVT  351

Query  536  ATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFVDTS--NRL  363
              NVA +PG+NT G++LARVD AP GL PPHTHPRA+E+  VL+G + VGFV ++  NRL
Sbjct  352  PANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRL  411

Query  362  FTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFATKPAVPDE  183
              + L  GD F+FP+ LIHF  N+   K A+A++ LSSQNPG    + A F +KPA+  +
Sbjct  412  ICKVLYKGDVFIFPEGLIHFQLNVGKTK-AVAIAALSSQNPGVITIANAVFGSKPAISAD  470

Query  182  VLKKAFQIN  156
            VL KAFQ++
Sbjct  471  VLTKAFQVD  479



>ref|XP_002443981.1| hypothetical protein SORBIDRAFT_07g005330 [Sorghum bicolor]
 gb|EES13476.1| hypothetical protein SORBIDRAFT_07g005330 [Sorghum bicolor]
Length=228

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 132/195 (68%), Gaps = 10/195 (5%)
 Frame = -1

Query  722  ELVKSDPDPLQDYCVADTKNTKNLFLNGVACINPDLAVASN--FATSALAKPGNT-KNTF  552
            + + SDP PLQD+CVAD  +   + +NG  C +P +AV +N  F  + L KP +T K+  
Sbjct  19   QAIASDPSPLQDFCVADIHSP--VKVNGFVCKDP-MAVNANDFFKEANLDKPRDTMKSKV  75

Query  551  GFNVTATNVAVLPGVNTQGLTLARVDLAPGGLVPPHTHPRASEVTIVLKGAVLVGFV---  381
            G NVT  NV  LPG+NT G++LAR+D AP G  PPHTHPRA+E+  VL+G + VGFV   
Sbjct  76   GSNVTLINVMQLPGLNTLGISLARIDYAPLGQNPPHTHPRATEILTVLEGTLYVGFVTSN  135

Query  380  -DTSNRLFTQQLRAGDSFVFPKALIHFLFNMDTMKPALAVSGLSSQNPGAQLTSLATFAT  204
             D  N+LFT+ L+ GD FVFP+ LIHF FN    KPA+A++ LSSQNPGA   + A F +
Sbjct  136  TDNGNKLFTKVLKKGDMFVFPQGLIHFQFNPVHDKPAVAIAALSSQNPGAITIANAVFGS  195

Query  203  KPAVPDEVLKKAFQI  159
            KP + D++L KAFQ+
Sbjct  196  KPPISDDILAKAFQV  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1688554632492