BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c94178_g1_i1 len=1370 path=[1:0-1369]

Length=1370
                                                                      Score     E

ref|XP_009616761.1|  PREDICTED: pollen-specific leucine-rich repe...    468   8e-156   
ref|XP_009606354.1|  PREDICTED: pollen-specific leucine-rich repe...    468   4e-155   
ref|XP_009800281.1|  PREDICTED: pollen-specific leucine-rich repe...    464   2e-154   
emb|CDO97126.1|  unnamed protein product                                461   2e-153   
ref|XP_009775306.1|  PREDICTED: pollen-specific leucine-rich repe...    463   2e-151   
ref|XP_006346494.1|  PREDICTED: pollen-specific leucine-rich repe...    452   4e-149   
ref|XP_004230831.1|  PREDICTED: pollen-specific leucine-rich repe...    450   1e-147   
gb|AAD55979.1|AF159296_1  extensin-like protein                         449   3e-147   Solanum lycopersicum
ref|XP_004248904.1|  PREDICTED: pollen-specific leucine-rich repe...    439   2e-143   
ref|XP_006356596.1|  PREDICTED: pollen-specific leucine-rich repe...    437   1e-142   
ref|XP_004173680.1|  PREDICTED: leucine-rich repeat extensin-like...    422   4e-140   
ref|XP_010251730.1|  PREDICTED: pollen-specific leucine-rich repe...    425   3e-139   
ref|XP_008371522.1|  PREDICTED: pollen-specific leucine-rich repe...    419   7e-139   
gb|AAM13864.1|  unknown protein                                         425   5e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006375015.1|  hypothetical protein POPTR_0014s03600g             417   5e-138   
ref|XP_009599187.1|  PREDICTED: pollen-specific leucine-rich repe...    420   9e-138   
ref|XP_004139428.1|  PREDICTED: leucine-rich repeat extensin-like...    421   1e-137   
ref|XP_006384469.1|  hypothetical protein POPTR_0004s153601g            418   2e-137   
ref|XP_009801066.1|  PREDICTED: pollen-specific leucine-rich repe...    416   3e-137   
ref|XP_003523588.1|  PREDICTED: pollen-specific leucine-rich repe...    416   6e-137   
ref|XP_010064140.1|  PREDICTED: pollen-specific leucine-rich repe...    417   1e-136   
ref|NP_188532.2|  pollen-specific leucine-rich repeat extensin-li...    427   7e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385321.1|  PREDICTED: pollen-specific leucine-rich repe...    415   9e-136   
gb|KGN60627.1|  hypothetical protein Csa_2G004760                       421   9e-136   
ref|XP_006300262.1|  hypothetical protein CARUB_v100151920mg            417   1e-135   
ref|XP_002885290.1|  hypothetical protein ARALYDRAFT_479420             425   1e-135   
ref|XP_011030760.1|  PREDICTED: pollen-specific leucine-rich repe...    416   1e-135   
ref|XP_008458246.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    417   2e-135   
ref|XP_010664614.1|  PREDICTED: pollen-specific leucine-rich repe...    412   2e-135   
ref|XP_009419628.1|  PREDICTED: pollen-specific leucine-rich repe...    416   4e-135   
ref|XP_011005677.1|  PREDICTED: pollen-specific leucine-rich repe...    420   5e-135   
ref|XP_011001177.1|  PREDICTED: pollen-specific leucine-rich repe...    419   2e-134   
ref|XP_010096273.1|  Pollen-specific leucine-rich repeat extensin...    420   2e-134   
ref|XP_007214112.1|  hypothetical protein PRUPE_ppa017121mg             417   3e-134   
ref|XP_009402787.1|  PREDICTED: pollen-specific leucine-rich repe...    418   4e-134   
gb|KFK39231.1|  hypothetical protein AALP_AA3G216900                    421   4e-134   
ref|XP_010254179.1|  PREDICTED: leucine-rich repeat extensin-like...    417   4e-134   
ref|XP_007136648.1|  hypothetical protein PHAVU_009G062000g             412   7e-134   
ref|XP_008225416.1|  PREDICTED: pollen-specific leucine-rich repe...    416   7e-134   
ref|XP_008225431.1|  PREDICTED: pollen-specific leucine-rich repe...    421   7e-134   
ref|XP_009405471.1|  PREDICTED: pollen-specific leucine-rich repe...    407   1e-133   
ref|XP_010251729.1|  PREDICTED: pollen-specific leucine-rich repe...    413   1e-133   
ref|XP_010647882.1|  PREDICTED: pollen-specific leucine-rich repe...    414   2e-133   
ref|XP_010104364.1|  Pollen-specific leucine-rich repeat extensin...    419   3e-133   
ref|XP_008775577.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    412   4e-133   
ref|XP_010932003.1|  PREDICTED: pollen-specific leucine-rich repe...    412   5e-133   
ref|XP_007013716.1|  Leucine-rich repeat family protein                 409   5e-133   
emb|CBI32495.3|  unnamed protein product                                414   6e-133   
ref|XP_008800833.1|  PREDICTED: pollen-specific leucine-rich repe...    413   1e-132   
ref|XP_010466040.1|  PREDICTED: pollen-specific leucine-rich repe...    417   1e-132   
gb|EPS66537.1|  extensin-like protein                                   400   2e-132   
gb|KHN04530.1|  Pollen-specific leucine-rich repeat extensin-like...    412   3e-132   
ref|XP_004173261.1|  PREDICTED: pollen-specific leucine-rich repe...    402   8e-132   
ref|XP_010525682.1|  PREDICTED: pollen-specific leucine-rich repe...    415   9e-132   
ref|XP_008344101.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    403   9e-132   
ref|XP_010914722.1|  PREDICTED: pollen-specific leucine-rich repe...    411   1e-131   
ref|XP_007042323.1|  Leucine-rich repeat family protein                 409   1e-131   
emb|CDY02276.1|  BnaA03g38910D                                          405   1e-131   
ref|XP_010251965.1|  PREDICTED: leucine-rich repeat extensin-like...    408   3e-131   
ref|XP_010487832.1|  PREDICTED: pollen-specific leucine-rich repe...    414   3e-131   
emb|CDX69018.1|  BnaC01g04350D                                          405   3e-131   
ref|XP_010249819.1|  PREDICTED: leucine-rich repeat extensin-like...    406   8e-131   
ref|XP_010507385.1|  PREDICTED: pollen-specific leucine-rich repe...    411   9e-131   
emb|CDO99097.1|  unnamed protein product                                397   1e-130   
ref|XP_004287084.1|  PREDICTED: leucine-rich repeat extensin-like...    406   1e-130   
ref|XP_010507380.1|  PREDICTED: pollen-specific leucine-rich repe...    412   1e-130   
ref|XP_006476103.1|  PREDICTED: leucine-rich repeat extensin-like...    405   2e-130   
ref|XP_006371912.1|  hypothetical protein POPTR_0018s06150g             399   2e-130   
ref|XP_006582471.1|  PREDICTED: pollen-specific leucine-rich repe...    398   4e-130   
ref|XP_007017392.1|  Leucine-rich repeat family protein                 410   4e-130   
ref|XP_006409498.1|  hypothetical protein EUTSA_v10023190mg             398   4e-130   
ref|XP_009351868.1|  PREDICTED: pollen-specific leucine-rich repe...    408   6e-130   
gb|EPS67596.1|  hypothetical protein M569_07180                         394   6e-130   
ref|XP_011092901.1|  PREDICTED: pollen-specific leucine-rich repe...    410   7e-130   
ref|XP_010527734.1|  PREDICTED: pollen-specific leucine-rich repe...    411   7e-130   
gb|AGT16383.1|  hypothetical protein SHCRBa_052_I12_F_230               402   7e-130   
emb|CDY53036.1|  BnaC03g73850D                                          414   8e-130   
ref|XP_010690992.1|  PREDICTED: pollen-specific leucine-rich repe...    400   1e-129   
ref|XP_002443305.1|  hypothetical protein SORBIDRAFT_08g017290          397   2e-129   Sorghum bicolor [broomcorn]
ref|XP_006393251.1|  hypothetical protein EUTSA_v10012214mg             406   2e-129   
emb|CDY51859.1|  BnaC03g77110D                                          401   2e-129   
ref|XP_009136040.1|  PREDICTED: pollen-specific leucine-rich repe...    411   2e-129   
ref|XP_006285576.1|  hypothetical protein CARUB_v10007020mg             402   2e-129   
gb|KGN45680.1|  hypothetical protein Csa_6G006180                       400   2e-129   
ref|XP_007013226.1|  Leucine-rich repeat family protein                 403   3e-129   
emb|CDY18563.1|  BnaA01g26320D                                          400   3e-129   
emb|CDX89681.1|  BnaC03g45950D                                          404   4e-129   
ref|XP_009336917.1|  PREDICTED: leucine-rich repeat extensin-like...    403   4e-129   
ref|XP_010479383.1|  PREDICTED: pollen-specific leucine-rich repe...    407   4e-129   
emb|CDY51948.1|  BnaA08g11700D                                          400   5e-129   
ref|XP_008366033.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    408   5e-129   
ref|XP_002281292.2|  PREDICTED: leucine-rich repeat extensin-like...    403   5e-129   Vitis vinifera
ref|XP_011043443.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    400   5e-129   
ref|XP_003602966.1|  Serine/threonine protein kinase BRI1-like pr...    401   5e-129   
gb|AID60115.1|  leucine-rich repeat (LRR) family protein                400   6e-129   
ref|XP_008219840.1|  PREDICTED: leucine-rich repeat extensin-like...    397   6e-129   
ref|XP_008242638.1|  PREDICTED: leucine-rich repeat extensin-like...    400   6e-129   
gb|AGT17388.1|  hypothetical protein SHCRBa_176_L06_F_110               398   6e-129   
ref|XP_006389464.1|  hypothetical protein POPTR_0024s00730g             397   7e-129   
ref|XP_008663867.1|  PREDICTED: pollen-specific leucine-rich repe...    402   7e-129   
ref|XP_004138582.1|  PREDICTED: pollen-specific leucine-rich repe...    398   9e-129   
ref|XP_010500490.1|  PREDICTED: pollen-specific leucine-rich repe...    406   9e-129   
ref|XP_009118084.1|  PREDICTED: pollen-specific leucine-rich repe...    400   1e-128   
ref|XP_010461787.1|  PREDICTED: pollen-specific leucine-rich repe...    406   2e-128   
ref|XP_007227690.1|  hypothetical protein PRUPE_ppa1027218m2g           390   2e-128   
gb|AGT16299.1|  hypothetical protein SHCRBa_026_P08_R_80                399   2e-128   
ref|XP_009136284.1|  PREDICTED: pollen-specific leucine-rich repe...    404   2e-128   
ref|XP_002885986.1|  predicted protein                                  401   3e-128   
emb|CDP07600.1|  unnamed protein product                                394   4e-128   
ref|XP_010925532.1|  PREDICTED: leucine-rich repeat extensin-like...    393   5e-128   
ref|XP_002875655.1|  hypothetical protein ARALYDRAFT_347509             392   5e-128   
ref|XP_006450582.1|  hypothetical protein CICLE_v10010264mg             392   5e-128   
ref|XP_009108764.1|  PREDICTED: pollen-specific leucine-rich repe...    398   6e-128   
ref|XP_008793507.1|  PREDICTED: leucine-rich repeat extensin-like...    396   9e-128   
ref|XP_006300291.1|  hypothetical protein CARUB_v100136950mg            388   1e-127   
ref|XP_010447169.1|  PREDICTED: pollen-specific leucine-rich repe...    399   1e-127   
ref|XP_008786172.1|  PREDICTED: leucine-rich repeat extensin-like...    397   1e-127   
ref|NP_195123.1|  pollen-specific leucine-rich repeat extensin-li...    397   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179188.1|  pollen-specific leucine-rich repeat extensin-li...    398   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010999749.1|  PREDICTED: pollen-specific leucine-rich repe...    405   2e-127   
gb|KDO79655.1|  hypothetical protein CISIN_1g041736mg                   391   2e-127   
ref|XP_006389336.1|  hypothetical protein POPTR_0028s00200g             390   2e-127   
ref|XP_002867142.1|  hypothetical protein ARALYDRAFT_491276             396   2e-127   
ref|XP_009408826.1|  PREDICTED: leucine-rich repeat extensin-like...    392   2e-127   
ref|NP_175372.1|  Leucine-rich repeat family protein                    401   3e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088311.1|  PREDICTED: pollen-specific leucine-rich repe...    393   4e-127   
gb|KFK30023.1|  hypothetical protein AALP_AA7G207900                    395   7e-127   
ref|XP_006476177.1|  PREDICTED: leucine-rich repeat extensin-like...    390   7e-127   
ref|XP_010437693.1|  PREDICTED: pollen-specific leucine-rich repe...    396   8e-127   
ref|XP_010437692.1|  PREDICTED: pollen-specific leucine-rich repe...    397   8e-127   
emb|CDY54073.1|  BnaA07g36350D                                          394   9e-127   
gb|KHN22289.1|  Pollen-specific leucine-rich repeat extensin-like...    397   1e-126   
ref|XP_006379216.1|  hypothetical protein POPTR_0009s11130g             406   1e-126   
ref|XP_004512856.1|  PREDICTED: leucine-rich repeat extensin-like...    393   1e-126   
ref|XP_009112175.1|  PREDICTED: pollen-specific leucine-rich repe...    399   2e-126   
ref|XP_011078360.1|  PREDICTED: leucine-rich repeat extensin-like...    388   2e-126   
ref|XP_010437689.1|  PREDICTED: pollen-specific leucine-rich repe...    397   2e-126   
ref|XP_009403414.1|  PREDICTED: leucine-rich repeat extensin-like...    390   2e-126   
ref|XP_010530870.1|  PREDICTED: pollen-specific leucine-rich repe...    393   2e-126   
ref|XP_010437688.1|  PREDICTED: pollen-specific leucine-rich repe...    397   2e-126   
ref|XP_010467332.1|  PREDICTED: pollen-specific leucine-rich repe...    395   2e-126   
ref|XP_006842252.1|  hypothetical protein AMTR_s00078p00197410          399   4e-126   
ref|XP_002519151.1|  protein binding protein, putative                  397   5e-126   Ricinus communis
gb|EPS57978.1|  hypothetical protein M569_16839                         387   5e-126   
ref|XP_009381253.1|  PREDICTED: leucine-rich repeat extensin-like...    389   5e-126   
ref|XP_008357497.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    389   5e-126   
ref|XP_006282938.1|  hypothetical protein CARUB_v100074500mg            387   5e-126   
ref|XP_006412291.1|  hypothetical protein EUTSA_v100245901mg            392   7e-126   
dbj|BAK06060.1|  predicted protein                                      394   8e-126   
ref|XP_010088853.1|  Leucine-rich repeat extensin-like protein 4        395   8e-126   
ref|XP_004138583.1|  PREDICTED: pollen-specific leucine-rich repe...    387   8e-126   
ref|XP_010252148.1|  PREDICTED: leucine-rich repeat extensin-like...    395   1e-125   
ref|XP_009119384.1|  PREDICTED: pollen-specific leucine-rich repe...    397   1e-125   
ref|XP_008378297.1|  PREDICTED: leucine-rich repeat extensin-like...    389   1e-125   
emb|CDY64248.1|  BnaCnng43540D                                          394   1e-125   
ref|XP_008337109.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    385   2e-125   
gb|KFK36007.1|  hypothetical protein AALP_AA4G065700                    396   2e-125   
emb|CDX95474.1|  BnaC01g33660D                                          392   2e-125   
gb|KFK40046.1|  hypothetical protein AALP_AA3G322800                    398   2e-125   
ref|XP_011019702.1|  PREDICTED: leucine-rich repeat extensin-like...    384   2e-125   
ref|XP_010489184.1|  PREDICTED: pollen-specific leucine-rich repe...    394   2e-125   
emb|CDY16503.1|  BnaA08g02640D                                          393   2e-125   
ref|XP_008463374.1|  PREDICTED: leucine-rich repeat extensin-like...    394   2e-125   
ref|XP_011019700.1|  PREDICTED: leucine-rich repeat extensin-like...    384   3e-125   
ref|XP_002885650.1|  predicted protein                                  385   4e-125   
ref|XP_004501605.1|  PREDICTED: pollen-specific leucine-rich repe...    397   4e-125   
ref|XP_008458201.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    389   4e-125   
ref|XP_009377376.1|  PREDICTED: leucine-rich repeat extensin-like...    390   4e-125   
ref|XP_011019699.1|  PREDICTED: leucine-rich repeat extensin-like...    384   4e-125   
gb|KDP32304.1|  hypothetical protein JCGZ_13229                         391   9e-125   
ref|XP_008458676.1|  PREDICTED: pollen-specific leucine-rich repe...    386   9e-125   
ref|XP_006303848.1|  hypothetical protein CARUB_v10012584mg             395   1e-124   
ref|XP_003575453.1|  PREDICTED: pollen-specific leucine-rich repe...    389   1e-124   
ref|XP_003630813.1|  Extensin-like protein                              390   2e-124   
gb|AGT16233.1|  hypothetical protein SHCRBa_161_O13_R_110               394   2e-124   
gb|AFW56506.1|  leucine-rich repeat (LRR) family protein                397   2e-124   
ref|XP_009348443.1|  PREDICTED: leucine-rich repeat extensin-like...    390   2e-124   
ref|XP_006342607.1|  PREDICTED: pollen-specific leucine-rich repe...    389   3e-124   
ref|XP_009352479.1|  PREDICTED: leucine-rich repeat extensin-like...    383   4e-124   
ref|XP_004512961.1|  PREDICTED: leucine-rich repeat extensin-like...    390   4e-124   
ref|XP_008365636.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    382   4e-124   
ref|XP_006414930.1|  hypothetical protein EUTSA_v100275740mg            379   5e-124   
ref|XP_004290381.1|  PREDICTED: pollen-specific leucine-rich repe...    384   5e-124   
gb|EPS61338.1|  hypothetical protein M569_13456                         378   5e-124   
emb|CDY49265.1|  BnaA03g50780D                                          385   5e-124   
ref|XP_006300268.1|  hypothetical protein CARUB_v100163570mg            380   6e-124   
ref|XP_009383792.1|  PREDICTED: pollen-specific leucine-rich repe...    394   6e-124   
ref|XP_009336235.1|  PREDICTED: leucine-rich repeat extensin-like...    379   7e-124   
ref|XP_004979883.1|  PREDICTED: pollen-specific leucine-rich repe...    399   9e-124   
ref|NP_189091.1|  leucine-rich repeat extensin-like protein 4           381   9e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107296.1|  PREDICTED: pollen-specific leucine-rich repe...    389   1e-123   
ref|XP_010527189.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    387   1e-123   
ref|XP_010925096.1|  PREDICTED: leucine-rich repeat extensin-like...    379   1e-123   
ref|XP_004148723.1|  PREDICTED: leucine-rich repeat extensin-like...    389   1e-123   
ref|XP_006286011.1|  hypothetical protein CARUB_v10007539mg             377   1e-123   
ref|XP_004964077.1|  PREDICTED: pollen-specific leucine-rich repe...    390   2e-123   
ref|XP_008342893.1|  PREDICTED: leucine-rich repeat extensin-like...    378   2e-123   
gb|KGN65364.1|  hypothetical protein Csa_1G383520                       389   3e-123   
ref|XP_002451219.1|  hypothetical protein SORBIDRAFT_05g025950          388   3e-123   Sorghum bicolor [broomcorn]
ref|XP_008347715.1|  PREDICTED: leucine-rich repeat extensin-like...    377   3e-123   
ref|XP_009345516.1|  PREDICTED: pollen-specific leucine-rich repe...    387   3e-123   
ref|XP_004170319.1|  PREDICTED: leucine-rich repeat extensin-like...    389   4e-123   
ref|XP_009350755.1|  PREDICTED: pollen-specific leucine-rich repe...    386   4e-123   
ref|XP_004252054.1|  PREDICTED: leucine-rich repeat extensin-like...    387   4e-123   
ref|XP_008458675.1|  PREDICTED: pollen-specific leucine-rich repe...    385   6e-123   
ref|XP_010532845.1|  PREDICTED: leucine-rich repeat extensin-like...    384   8e-123   
ref|XP_007152809.1|  hypothetical protein PHAVU_004G161500g             386   8e-123   
ref|XP_006353562.1|  PREDICTED: leucine-rich repeat extensin-like...    384   9e-123   
ref|XP_009627507.1|  PREDICTED: leucine-rich repeat extensin-like...    380   1e-122   
emb|CDY72552.1|  BnaCnng78240D                                          375   1e-122   
ref|XP_009138254.1|  PREDICTED: pollen-specific leucine-rich repe...    387   1e-122   
ref|XP_006366874.1|  PREDICTED: leucine-rich repeat extensin-like...    385   1e-122   
emb|CDX93014.1|  BnaA03g37360D                                          377   1e-122   
emb|CDY18974.1|  BnaC01g20940D                                          374   2e-122   
emb|CDY49264.1|  BnaA03g50770D                                          382   2e-122   
ref|XP_009627506.1|  PREDICTED: leucine-rich repeat extensin-like...    381   2e-122   
ref|XP_010447991.1|  PREDICTED: pollen-specific leucine-rich repe...    374   2e-122   
ref|XP_010256147.1|  PREDICTED: leucine-rich repeat extensin-like...    374   2e-122   
emb|CDX94809.1|  BnaC03g43790D                                          379   3e-122   
ref|XP_007160348.1|  hypothetical protein PHAVU_002G314200g             385   3e-122   
ref|XP_008776836.1|  PREDICTED: leucine-rich repeat extensin-like...    382   3e-122   
ref|XP_010488556.1|  PREDICTED: leucine-rich repeat extensin-like...    375   3e-122   
ref|XP_009132101.1|  PREDICTED: leucine-rich repeat extensin-like...    385   4e-122   
emb|CDY49661.1|  BnaC09g41390D                                          374   4e-122   
ref|XP_010438472.1|  PREDICTED: pollen-specific leucine-rich repe...    374   4e-122   
ref|XP_006406541.1|  hypothetical protein EUTSA_v10022433mg             372   4e-122   
ref|XP_010050506.1|  PREDICTED: leucine-rich repeat extensin-like...    374   6e-122   
ref|XP_006285388.1|  hypothetical protein CARUB_v10006785mg             384   8e-122   
ref|XP_010433232.1|  PREDICTED: pollen-specific leucine-rich repe...    372   9e-122   
gb|EYU25784.1|  hypothetical protein MIMGU_mgv1a026389mg                372   1e-121   
ref|XP_010040127.1|  PREDICTED: leucine-rich repeat extensin-like...    374   1e-121   
ref|XP_010432489.1|  PREDICTED: pollen-specific leucine-rich repe...    383   1e-121   
ref|XP_010049719.1|  PREDICTED: leucine-rich repeat extensin-like...    383   2e-121   
ref|XP_009144429.1|  PREDICTED: pollen-specific leucine-rich repe...    372   2e-121   
ref|XP_004292960.1|  PREDICTED: leucine-rich repeat extensin-like...    376   3e-121   
ref|XP_008229070.1|  PREDICTED: leucine-rich repeat extensin-like...    373   3e-121   
gb|KEH27082.1|  LRR extensin-like protein                               385   3e-121   
ref|XP_009613983.1|  PREDICTED: leucine-rich repeat extensin-like...    376   3e-121   
ref|XP_009351253.1|  PREDICTED: pollen-specific leucine-rich repe...    388   4e-121   
ref|XP_009760538.1|  PREDICTED: leucine-rich repeat extensin-like...    382   4e-121   
gb|AAD55980.2|AF159297_1  extensin-like protein                         389   4e-121   Zea mays [maize]
ref|NP_193070.1|  leucine-rich repeat extensin-like protein 3           382   5e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003620502.1|  Extensin-like protein                              384   6e-121   
ref|XP_002867981.1|  hypothetical protein ARALYDRAFT_492992             382   7e-121   
ref|XP_002310403.2|  hypothetical protein POPTR_0007s01000g             369   9e-121   Populus trichocarpa [western balsam poplar]
ref|XP_006412962.1|  hypothetical protein EUTSA_v10027136mg             370   1e-120   
ref|XP_002308630.2|  hypothetical protein POPTR_0006s26190g             373   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_006414071.1|  hypothetical protein EUTSA_v10024510mg             380   2e-120   
gb|KFK29358.1|  hypothetical protein AALP_AA7G123800                    369   2e-120   
ref|XP_010035772.1|  PREDICTED: leucine-rich repeat extensin-like...    370   2e-120   
ref|XP_010450227.1|  PREDICTED: leucine-rich repeat extensin-like...    379   2e-120   
gb|KDP24107.1|  hypothetical protein JCGZ_25764                         370   2e-120   
ref|XP_009342422.1|  PREDICTED: pollen-specific leucine-rich repe...    387   3e-120   
ref|XP_002888025.1|  hypothetical protein ARALYDRAFT_475099             379   3e-120   
ref|XP_010434501.1|  PREDICTED: leucine-rich repeat extensin-like...    380   4e-120   
ref|XP_010435287.1|  PREDICTED: leucine-rich repeat extensin-like...    379   5e-120   
ref|XP_010450228.1|  PREDICTED: leucine-rich repeat extensin-like...    379   6e-120   
gb|EPS58069.1|  hypothetical protein M569_16746                         365   7e-120   
ref|XP_002863246.1|  hypothetical protein ARALYDRAFT_497051             374   7e-120   
ref|XP_010434500.1|  PREDICTED: leucine-rich repeat extensin-like...    380   8e-120   
ref|XP_010440602.1|  PREDICTED: leucine-rich repeat extensin-like...    378   9e-120   
ref|XP_010450229.1|  PREDICTED: leucine-rich repeat extensin-like...    378   1e-119   
ref|XP_003524389.2|  PREDICTED: leucine-rich repeat extensin-like...    374   1e-119   
gb|KHN21547.1|  Leucine-rich repeat extensin-like protein 5             374   1e-119   
emb|CAB37452.1|  extensin-like protein                                  381   1e-119   Arabidopsis thaliana [mouse-ear cress]
emb|CDP14813.1|  unnamed protein product                                367   2e-119   
ref|NP_194567.1|  leucine-rich repeat (LRR) family protein              367   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010655031.1|  PREDICTED: leucine-rich repeat extensin-like...    378   2e-119   
ref|XP_010449482.1|  PREDICTED: leucine-rich repeat extensin-like...    380   2e-119   
ref|NP_193602.4|  leucine-rich repeat extensin-like protein 5           381   2e-119   Arabidopsis thaliana [mouse-ear cress]
gb|KDO52192.1|  hypothetical protein CISIN_1g035831mg                   368   2e-119   
ref|XP_010439825.1|  PREDICTED: leucine-rich repeat extensin-like...    381   2e-119   
ref|XP_010688564.1|  PREDICTED: leucine-rich repeat extensin-like...    373   4e-119   
gb|KFK36221.1|  hypothetical protein AALP_AA4G093700                    380   4e-119   
gb|KDO42769.1|  hypothetical protein CISIN_1g036320mg                   366   4e-119   
gb|ABA99464.2|  extensin-like domain containing protein, putative...    370   8e-119   Oryza sativa Japonica Group [Japonica rice]
gb|KEH30699.1|  LRR/extensin                                            366   8e-119   
ref|XP_009798822.1|  PREDICTED: leucine-rich repeat extensin-like...    370   1e-118   
ref|XP_007034837.1|  Leucine-rich repeat (LRR) family protein, pu...    364   1e-118   
ref|XP_004242113.1|  PREDICTED: leucine-rich repeat extensin-like...    368   1e-118   
ref|XP_002279192.1|  PREDICTED: leucine-rich repeat extensin-like...    364   1e-118   
ref|XP_009417528.1|  PREDICTED: leucine-rich repeat extensin-like...    373   2e-118   
ref|XP_011078162.1|  PREDICTED: leucine-rich repeat extensin-like...    375   2e-118   
ref|XP_008361641.1|  PREDICTED: pollen-specific leucine-rich repe...    382   2e-118   
ref|XP_008677910.1|  PREDICTED: pollen-specific leucine-rich repe...    387   2e-118   
gb|KDO74484.1|  hypothetical protein CISIN_1g045950mg                   364   2e-118   
ref|XP_010513507.1|  PREDICTED: leucine-rich repeat extensin-like...    375   2e-118   
gb|KFK28537.1|  hypothetical protein AALP_AA7G009800                    375   3e-118   
ref|XP_010107567.1|  Leucine-rich repeat extensin-like protein 2        376   3e-118   
gb|KDP27758.1|  hypothetical protein JCGZ_19787                         374   4e-118   
ref|XP_010669462.1|  PREDICTED: leucine-rich repeat extensin-like...    377   4e-118   
ref|XP_006447273.1|  hypothetical protein CICLE_v10018109mg             363   4e-118   
ref|XP_006372265.1|  hypothetical protein POPTR_0018s14790g             365   5e-118   
ref|XP_006469927.1|  PREDICTED: pollen-specific leucine-rich repe...    363   7e-118   
ref|XP_006394807.1|  hypothetical protein EUTSA_v10004209mg             365   7e-118   
gb|EEE53361.1|  hypothetical protein OsJ_36396                          372   8e-118   
ref|XP_003532491.1|  PREDICTED: leucine-rich repeat extensin-like...    374   8e-118   
ref|NP_001066960.1|  Os12g0542200                                       374   9e-118   
ref|XP_003556064.1|  PREDICTED: leucine-rich repeat extensin-like...    362   1e-117   
ref|XP_006361150.1|  PREDICTED: leucine-rich repeat extensin-like...    365   1e-117   
ref|XP_007143301.1|  hypothetical protein PHAVU_007G060800g             362   1e-117   
ref|XP_006420010.1|  hypothetical protein CICLE_v10005037mg             363   1e-117   
ref|XP_010921838.1|  PREDICTED: pollen-specific leucine-rich repe...    365   1e-117   
emb|CDP14269.1|  unnamed protein product                                373   2e-117   
emb|CDY19550.1|  BnaC09g13530D                                          374   2e-117   
ref|XP_007200697.1|  hypothetical protein PRUPE_ppa000722m2g            369   2e-117   
gb|KGN45681.1|  hypothetical protein Csa_6G006190                       373   2e-117   
ref|XP_006838987.1|  hypothetical protein AMTR_s00002p00271610          364   3e-117   
ref|XP_011030644.1|  PREDICTED: leucine-rich repeat extensin-like...    361   3e-117   
ref|XP_009135898.1|  PREDICTED: leucine-rich repeat extensin-like...    376   4e-117   
ref|XP_010520859.1|  PREDICTED: leucine-rich repeat extensin-like...    363   4e-117   
gb|KHN37158.1|  Pollen-specific leucine-rich repeat extensin-like...    374   5e-117   
ref|XP_002867451.1|  leucine-rich repeat family protein                 359   7e-117   
emb|CAA84230.1|  extensin-like protein                                  381   7e-117   
ref|XP_008670898.1|  PREDICTED: pollen-specific leucine-rich repe...    381   8e-117   
ref|XP_009113078.1|  PREDICTED: leucine-rich repeat extensin-like...    370   8e-117   
ref|XP_011081863.1|  PREDICTED: leucine-rich repeat extensin-like...    364   9e-117   
emb|CDY12948.1|  BnaA09g13260D                                          370   1e-116   
ref|XP_010473463.1|  PREDICTED: leucine-rich repeat extensin-like...    370   1e-116   
ref|XP_009113077.1|  PREDICTED: leucine-rich repeat extensin-like...    370   1e-116   
ref|XP_010473462.1|  PREDICTED: leucine-rich repeat extensin-like...    370   1e-116   
gb|KFK27830.1|  hypothetical protein AALP_AA8G435400                    361   1e-116   
gb|EYU21900.1|  hypothetical protein MIMGU_mgv1a006829mg                360   1e-116   
gb|EYU24926.1|  hypothetical protein MIMGU_mgv1a006719mg                360   2e-116   
ref|XP_006480071.1|  PREDICTED: pollen-specific leucine-rich repe...    376   2e-116   
ref|XP_006453735.1|  hypothetical protein CICLE_v10010678mg             369   2e-116   
ref|XP_006473926.1|  PREDICTED: leucine-rich repeat extensin-like...    369   2e-116   
gb|ABA95172.1|  transposon protein, putative, unclassified              375   2e-116   
ref|XP_010493816.1|  PREDICTED: leucine-rich repeat extensin-like...    360   3e-116   
ref|XP_008236716.1|  PREDICTED: pollen-specific leucine-rich repe...    378   3e-116   
ref|XP_010431693.1|  PREDICTED: leucine-rich repeat extensin-like...    370   3e-116   
ref|XP_010092426.1|  Leucine-rich repeat extensin-like protein 6        360   3e-116   
ref|XP_010454895.1|  PREDICTED: leucine-rich repeat extensin-like...    359   4e-116   
ref|XP_002324259.1|  hypothetical protein POPTR_0018s01010g             362   4e-116   
ref|XP_010239022.1|  PREDICTED: leucine-rich repeat extensin-like...    366   4e-116   
ref|XP_011019927.1|  PREDICTED: leucine-rich repeat extensin-like...    370   5e-116   
ref|XP_010424321.1|  PREDICTED: leucine-rich repeat extensin-like...    359   5e-116   
ref|XP_010259122.1|  PREDICTED: leucine-rich repeat extensin-like...    357   7e-116   
dbj|BAF48663.1|  leucine-rich repeat/extensin                           368   7e-116   
ref|XP_002314669.2|  hypothetical protein POPTR_0010s09310g             356   8e-116   
ref|XP_011093910.1|  PREDICTED: leucine-rich repeat extensin-like...    370   9e-116   
emb|CDP03355.1|  unnamed protein product                                369   9e-116   
ref|XP_006289956.1|  hypothetical protein CARUB_v10003584mg             358   1e-115   
ref|XP_004498175.1|  PREDICTED: pollen-specific leucine-rich repe...    370   1e-115   
ref|NP_001068397.2|  Os11g0657400                                       375   2e-115   
ref|XP_004496690.1|  PREDICTED: leucine-rich repeat extensin-like...    357   2e-115   
ref|XP_007014601.1|  Leucine-rich repeat/extensin 2                     368   2e-115   
ref|XP_009608702.1|  PREDICTED: leucine-rich repeat extensin-like...    367   2e-115   
dbj|BAF48665.1|  leucine-rich repeat/extensin 1                         367   2e-115   
ref|XP_002517082.1|  serine-threonine protein kinase, plant-type,...    355   2e-115   
sp|O48809.1|LRX2_ARATH  RecName: Full=Leucine-rich repeat extensi...    369   2e-115   
gb|KHN01115.1|  Pollen-specific leucine-rich repeat extensin-like...    357   3e-115   
ref|XP_007043626.1|  Leucine-rich repeat family protein                 356   3e-115   
ref|XP_003526272.1|  PREDICTED: leucine-rich repeat extensin-like...    357   3e-115   
ref|XP_004249854.1|  PREDICTED: leucine-rich repeat extensin-like...    365   4e-115   
ref|XP_007198810.1|  hypothetical protein PRUPE_ppa026805mg             356   4e-115   
ref|NP_197937.1|  leucine-rich repeat extensin-like protein 7           357   5e-115   
ref|XP_006480069.1|  PREDICTED: pollen-specific leucine-rich repe...    369   5e-115   
ref|XP_009758506.1|  PREDICTED: leucine-rich repeat extensin-like...    365   5e-115   
ref|XP_002872172.1|  leucine-rich repeat family protein                 357   6e-115   
ref|XP_002517083.1|  serine-threonine protein kinase, plant-type,...    354   7e-115   
ref|XP_010689048.1|  PREDICTED: leucine-rich repeat extensin-like...    355   7e-115   
ref|NP_176434.1|  leucine-rich repeat extensin-like protein 2           368   9e-115   
ref|XP_011018198.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    360   1e-114   
ref|XP_011026539.1|  PREDICTED: leucine-rich repeat extensin-like...    358   1e-114   
ref|XP_010418239.1|  PREDICTED: leucine-rich repeat extensin-like...    364   3e-114   
ref|XP_006360809.1|  PREDICTED: leucine-rich repeat extensin-like...    353   3e-114   
ref|XP_010423784.1|  PREDICTED: pollen-specific leucine-rich repe...    373   3e-114   
ref|XP_010091486.1|  hypothetical protein L484_010328                   353   4e-114   
ref|XP_002517887.1|  serine-threonine protein kinase, plant-type,...    353   5e-114   
ref|XP_004505561.1|  PREDICTED: leucine-rich repeat extensin-like...    353   6e-114   
emb|CDX88190.1|  BnaA06g27810D                                          353   7e-114   
gb|EEE52502.1|  hypothetical protein OsJ_34704                          375   8e-114   
ref|XP_008438627.1|  PREDICTED: leucine-rich repeat extensin-like...    352   8e-114   
ref|XP_003540926.1|  PREDICTED: leucine-rich repeat extensin-like...    353   8e-114   
ref|XP_009151086.1|  PREDICTED: leucine-rich repeat extensin-like...    353   9e-114   
ref|XP_003566833.2|  PREDICTED: leucine-rich repeat extensin-like...    356   1e-113   
ref|XP_002514492.1|  LRX2, putative                                     363   1e-113   
ref|XP_006391867.1|  hypothetical protein EUTSA_v10023291mg             364   1e-113   
ref|XP_004134434.1|  PREDICTED: leucine-rich repeat extensin-like...    351   1e-113   
gb|KEH43816.1|  LRR/extensin 2                                          351   1e-113   
dbj|BAK04234.1|  predicted protein                                      361   2e-113   
ref|NP_001150408.1|  receptor-like protein kinase precursor             352   2e-113   
gb|ACL53978.1|  unknown                                                 352   2e-113   
ref|XP_006494306.1|  PREDICTED: pollen-specific leucine-rich repe...    370   2e-113   
gb|KGN56949.1|  hypothetical protein Csa_3G146350                       351   2e-113   
ref|XP_006351117.1|  PREDICTED: leucine-rich repeat extensin-like...    361   3e-113   
ref|XP_006489442.1|  PREDICTED: leucine-rich repeat extensin-like...    351   3e-113   
ref|XP_011026538.1|  PREDICTED: leucine-rich repeat extensin-like...    358   4e-113   
ref|XP_006420005.1|  hypothetical protein CICLE_v10004988mg             352   4e-113   
gb|KDP40220.1|  hypothetical protein JCGZ_02218                         349   4e-113   
emb|CDY15964.1|  BnaC08g41590D                                          357   5e-113   
ref|XP_010488313.1|  PREDICTED: leucine-rich repeat extensin-like...    352   7e-113   
ref|XP_003629650.1|  Receptor-like protein kinase                       358   8e-113   
gb|EPS72402.1|  hypothetical protein M569_02357                         350   9e-113   
ref|XP_007225572.1|  hypothetical protein PRUPE_ppa019759m1g            353   1e-112   
ref|XP_009415697.1|  PREDICTED: leucine-rich repeat extensin-like...    357   1e-112   
ref|XP_009385615.1|  PREDICTED: leucine-rich repeat extensin-like...    356   1e-112   
ref|XP_006417273.1|  hypothetical protein EUTSA_v10006975mg             358   1e-112   
ref|XP_006489595.1|  PREDICTED: leucine-rich repeat extensin-like...    349   1e-112   
emb|CDX80525.1|  BnaC07g29190D                                          350   1e-112   
ref|XP_008796915.1|  PREDICTED: leucine-rich repeat extensin-like...    358   2e-112   
gb|EYU41449.1|  hypothetical protein MIMGU_mgv1a007525mg                349   2e-112   
ref|XP_010656991.1|  PREDICTED: leucine-rich repeat extensin-like...    349   2e-112   
ref|XP_009390486.1|  PREDICTED: leucine-rich repeat extensin-like...    356   2e-112   
ref|XP_006304470.1|  hypothetical protein CARUB_v10011166mg             358   3e-112   
ref|XP_008802123.1|  PREDICTED: pollen-specific leucine-rich repe...    353   3e-112   
gb|ACU18125.1|  unknown                                                 348   3e-112   
gb|KEH40754.1|  pollen-specific LRR extensin-like protein               357   4e-112   
ref|XP_009145262.1|  PREDICTED: leucine-rich repeat extensin-like...    351   4e-112   
emb|CDY10673.1|  BnaA05g16890D                                          351   5e-112   
ref|XP_010466571.1|  PREDICTED: leucine-rich repeat extensin-like...    352   5e-112   
ref|XP_010476158.1|  PREDICTED: leucine-rich repeat extensin-like...    357   7e-112   
gb|EYU42650.1|  hypothetical protein MIMGU_mgv1a0203581mg               352   7e-112   
gb|KFK40601.1|  hypothetical protein AALP_AA2G016700                    359   8e-112   
ref|NP_172668.1|  leucine-rich repeat extensin-like protein 1           358   1e-111   
ref|XP_010533784.1|  PREDICTED: leucine-rich repeat extensin-like...    359   1e-111   
ref|XP_006406127.1|  hypothetical protein EUTSA_v10022219mg             348   2e-111   
ref|XP_004247590.1|  PREDICTED: leucine-rich repeat extensin-like...    346   2e-111   
ref|NP_188919.1|  leucine-rich repeat extensin-like protein 6           348   2e-111   
ref|XP_006654107.1|  PREDICTED: leucine-rich repeat extensin-like...    345   2e-111   
ref|XP_010533785.1|  PREDICTED: leucine-rich repeat extensin-like...    359   2e-111   
tpg|DAA58808.1|  TPA: leucine-rich repeat (LRR) family protein          351   3e-111   
ref|XP_010458626.1|  PREDICTED: leucine-rich repeat extensin-like...    357   3e-111   
ref|XP_008455274.1|  PREDICTED: leucine-rich repeat extensin-like...    346   3e-111   
ref|XP_002455880.1|  hypothetical protein SORBIDRAFT_03g026730          352   4e-111   
dbj|BAJ89804.1|  predicted protein                                      355   4e-111   
emb|CDX83065.1|  BnaA01g20650D                                          349   7e-111   
emb|CDY26536.1|  BnaA09g47410D                                          353   8e-111   
ref|XP_002440709.1|  hypothetical protein SORBIDRAFT_09g005520          345   9e-111   
ref|XP_008224262.1|  PREDICTED: leucine-rich repeat extensin-like...    344   9e-111   
ref|XP_010511710.1|  PREDICTED: leucine-rich repeat extensin-like...    345   1e-110   
ref|XP_009118117.1|  PREDICTED: leucine-rich repeat extensin-like...    350   1e-110   
ref|XP_011100435.1|  PREDICTED: leucine-rich repeat extensin-like...    343   1e-110   
dbj|BAD53794.1|  putative extensin                                      348   2e-110   
ref|XP_010695983.1|  PREDICTED: leucine-rich repeat extensin-like...    342   2e-110   
ref|XP_006367488.1|  PREDICTED: leucine-rich repeat extensin-like...    343   2e-110   
emb|CDY31235.1|  BnaC08g15300D                                          354   2e-110   
ref|XP_004243365.1|  PREDICTED: leucine-rich repeat extensin-like...    343   2e-110   
ref|XP_002516600.1|  serine-threonine protein kinase, plant-type,...    348   2e-110   
ref|XP_002885524.1|  hypothetical protein ARALYDRAFT_898761             345   2e-110   
ref|XP_004174158.1|  PREDICTED: pollen-specific leucine-rich repe...    343   2e-110   
ref|XP_008458674.1|  PREDICTED: pollen-specific leucine-rich repe...    340   4e-110   
ref|XP_009110797.1|  PREDICTED: leucine-rich repeat extensin-like...    343   4e-110   
ref|XP_009389012.1|  PREDICTED: leucine-rich repeat extensin-like...    342   4e-110   
ref|XP_006299744.1|  hypothetical protein CARUB_v10015937mg             344   6e-110   
ref|XP_003557501.1|  PREDICTED: leucine-rich repeat extensin-like...    342   6e-110   
dbj|BAO45886.1|  leucine-rich repeat extensin-like protein              343   6e-110   
ref|XP_004297998.1|  PREDICTED: uncharacterized protein LOC101315333    352   1e-109   
ref|XP_010228296.1|  PREDICTED: leucine-rich repeat extensin-like...    341   1e-109   
dbj|BAJ85515.1|  predicted protein                                      342   1e-109   
ref|XP_009408506.1|  PREDICTED: leucine-rich repeat extensin-like...    341   3e-109   
ref|XP_009781630.1|  PREDICTED: leucine-rich repeat extensin-like...    340   4e-109   
ref|XP_004137033.1|  PREDICTED: leucine-rich repeat extensin-like...    340   4e-109   
emb|CDY21028.1|  BnaA08g24970D                                          352   5e-109   
ref|XP_004296668.1|  PREDICTED: leucine-rich repeat extensin-like...    339   5e-109   
ref|XP_009781465.1|  PREDICTED: leucine-rich repeat extensin-like...    339   5e-109   
dbj|BAJ98253.1|  predicted protein                                      339   7e-109   
ref|XP_009626397.1|  PREDICTED: leucine-rich repeat extensin-like...    338   9e-109   
ref|XP_007132678.1|  hypothetical protein PHAVU_011G115300g             340   9e-109   
ref|XP_006663645.1|  PREDICTED: pollen-specific leucine-rich repe...    362   1e-108   
ref|XP_011030645.1|  PREDICTED: leucine-rich repeat extensin-like...    338   1e-108   
dbj|BAJ86997.1|  predicted protein                                      338   1e-108   
gb|AFW70087.1|  leucine-rich repeat (LRR) family protein                347   2e-108   
ref|XP_002463746.1|  hypothetical protein SORBIDRAFT_01g005300          338   2e-108   
ref|XP_004303132.1|  PREDICTED: pollen-specific leucine-rich repe...    338   2e-108   
ref|XP_008224557.1|  PREDICTED: leucine-rich repeat extensin-like...    349   2e-108   
ref|XP_004170132.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    338   2e-108   
gb|KDP43798.1|  hypothetical protein JCGZ_23006                         351   3e-108   
ref|XP_002314670.2|  hypothetical protein POPTR_0010s09320g             336   5e-108   
ref|NP_001045834.1|  Os02g0138000                                       347   5e-108   
ref|XP_003568808.1|  PREDICTED: leucine-rich repeat extensin-like...    338   6e-108   
ref|XP_006849391.1|  hypothetical protein AMTR_s00160p00027170          337   7e-108   
ref|XP_004955608.1|  PREDICTED: leucine-rich repeat extensin-like...    338   1e-107   
ref|XP_002972291.1|  hypothetical protein SELMODRAFT_412903             337   1e-107   
ref|XP_009110677.1|  PREDICTED: leucine-rich repeat extensin-like...    348   1e-107   
ref|NP_001043463.1|  Os01g0594300                                       341   1e-107   
dbj|BAJ91841.1|  predicted protein                                      343   2e-107   
tpg|DAA51888.1|  TPA: leucine-rich repeat (LRR) family protein          336   2e-107   
ref|XP_002984203.1|  hypothetical protein SELMODRAFT_423462             336   2e-107   
ref|NP_001130107.1|  uncharacterized protein LOC100191200 precursor     335   2e-107   
dbj|BAB91812.1|  extensin precursor-like                                341   3e-107   
ref|XP_002453278.1|  hypothetical protein SORBIDRAFT_04g003090          338   3e-107   
ref|XP_010927122.1|  PREDICTED: leucine-rich repeat extensin-like...    345   3e-107   
gb|KDP40221.1|  hypothetical protein JCGZ_02219                         336   4e-107   
ref|XP_007153156.1|  hypothetical protein PHAVU_003G011500g             345   5e-107   
ref|XP_006645883.1|  PREDICTED: pollen-specific leucine-rich repe...    337   5e-107   
gb|EMT22007.1|  hypothetical protein F775_31106                         334   6e-107   
ref|XP_008645230.1|  PREDICTED: leucine-rich repeat extensin-like...    344   7e-107   
ref|XP_002862780.1|  hypothetical protein ARALYDRAFT_920276             333   7e-107   
ref|XP_002457818.1|  hypothetical protein SORBIDRAFT_03g014350          335   1e-106   
ref|XP_003567675.1|  PREDICTED: pollen-specific leucine-rich repe...    338   1e-106   
ref|XP_008391000.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    333   1e-106   
gb|EAZ02952.1|  hypothetical protein OsI_25092                          333   2e-106   
ref|XP_010694037.1|  PREDICTED: leucine-rich repeat extensin-like...    334   2e-106   
ref|XP_011091034.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    332   2e-106   
ref|NP_001152233.1|  systemin receptor SR160 precursor                  333   2e-106   
gb|EEC70617.1|  hypothetical protein OsI_01869                          337   2e-106   
ref|XP_006584319.1|  PREDICTED: pollen-specific leucine-rich repe...    340   2e-106   
ref|NP_001051547.1|  Os03g0795300                                       333   3e-106   



>ref|XP_009616761.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nicotiana tomentosiformis]
Length=638

 Score =   468 bits (1205),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 223/370 (60%), Positives = 279/370 (75%), Gaps = 10/370 (3%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A +IARRQLL         G+  E+ + + + FAN R KKAYVALQAWK AIYS
Sbjct  23    AITDVEAASIARRQLL---------GDKGEYDMTINMAFANSRLKKAYVALQAWKKAIYS  73

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GPNVC+YNGVFCD+ALD+P   VVAGID+NH+DIAGHLP E+GLL+D++L
Sbjct  74    DPTNFTANWEGPNVCAYNGVFCDNALDNPNISVVAGIDLNHADIAGHLPVELGLLSDVSL  133

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             IH+NSNR CGI+PK+I NL LL EIDFSNN  VGPFP+V+LELP LKYLDLRYNNFEG++
Sbjct  134   IHINSNRFCGIIPKSIKNLTLLDEIDFSNNRFVGPFPEVVLELPKLKYLDLRYNNFEGSV  193

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LF+K+LD I LNNNR  S +PEN GNS ASV+VLANNKF GC+PSSIG+M  +++++
Sbjct  194   PSALFEKNLDAIFLNNNRFHSTIPENLGNSNASVVVLANNKFFGCIPSSIGKMSSTIDEL  253

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  NN+ SGCLPEEIT L+++T FD+  NK VG LPK L YMQ +E    A N F G+VP
Sbjct  254   VFTNNDLSGCLPEEITKLTSLTTFDISGNKFVGSLPKDLKYMQQVEVFDIASNKFMGNVP  313

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + LC+LPNL NL+FS NYFE  D+ C P +   + ++  +NC+ E+P QK  ++C   LS
Sbjct  314   ENLCTLPNLANLTFSNNYFESLDQKCTPSRSHDLEIEGKENCLQEQPDQKTEKECLPVLS  373

Query  165   KPVDCSKTGC  136
              PVDCSK  C
Sbjct  374   NPVDCSKGHC  383



>ref|XP_009606354.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1, partial [Nicotiana tomentosiformis]
Length=661

 Score =   468 bits (1203),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 296/392 (76%), Gaps = 4/392 (1%)
 Frame = -3

Query  1302  MAAVGClvflsllsfssisLAFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFA  1123
             + A+GC + L+L+SFSS S AFTD +A  IARRQL     ++       E++ ++KL FA
Sbjct  7     IKALGCFLLLNLVSFSSFSFAFTDNEAALIARRQLTAGTGDLP---NPVEYEKNIKLTFA  63

Query  1122  NDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDIN  943
             N R KKAY+ALQAWK AIYSDP   T NW GP+VC+YNGVFCD+ALDDP   VVAGID+N
Sbjct  64    NARLKKAYIALQAWKKAIYSDPSNFTSNWEGPDVCAYNGVFCDNALDDPNISVVAGIDLN  123

Query  942   HSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVI  763
             H+DIAGHLP E+G L+D++LIH+NSNR CGIVPK++SNLKLL EIDFSNN  VGPFP V+
Sbjct  124   HADIAGHLPVELGFLSDVSLIHINSNRFCGIVPKSVSNLKLLDEIDFSNNRFVGPFPKVV  183

Query  762   LELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANN  583
             LELP+LKYLDLRYN+FEG++P  LFDK LD I LNNNR  S +P N GNS ASV+VLANN
Sbjct  184   LELPNLKYLDLRYNDFEGSVPSELFDKSLDAIFLNNNRFHSTIPPNIGNSNASVVVLANN  243

Query  582   KFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLG  403
             KF GC+P SIG+ME ++++++  NN  SGC+ +EIT L ++TVFD+ RNK VG LP+GL 
Sbjct  244   KFHGCIPHSIGKMENTLDELVFTNNNLSGCVTDEITKLKSLTVFDISRNKFVGSLPQGLK  303

Query  402   YMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCL-PLKDGVAVDDSD  226
             +MQ ++    A NMF G VP+ +C+LPNL N +FS NYF+  D++C  PLK  + V+D +
Sbjct  304   FMQKVQVLDIASNMFIGEVPEAICTLPNLANFTFSYNYFDALDKACAPPLKKNLVVEDKE  363

Query  225   NCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
             NC+  RP Q+  + C   LSKPVDCSK  CRA
Sbjct  364   NCLGGRPDQRKERDCQSVLSKPVDCSKDKCRA  395



>ref|XP_009800281.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nicotiana sylvestris]
Length=633

 Score =   464 bits (1195),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/370 (60%), Positives = 278/370 (75%), Gaps = 9/370 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A +IARRQLL    E D        ++ + ++FAN R KKAYVALQAWK AIYS
Sbjct  23    ALTDVEAASIARRQLLVDNGEYD--------QMTINMKFANARLKKAYVALQAWKKAIYS  74

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GPNVC+YNGVFCD+ALDDP   VVAGID+NH+DIAGHLP E+GLL+D++L
Sbjct  75    DPTNFTANWEGPNVCAYNGVFCDNALDDPNISVVAGIDLNHADIAGHLPVELGLLSDVSL  134

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             IH+NSNR CGI+PK+I N+ LL EIDFSNN  VGPFPDV+LELP+LKYLDLR+NNFEG +
Sbjct  135   IHINSNRFCGIIPKSIKNITLLDEIDFSNNRFVGPFPDVVLELPNLKYLDLRFNNFEGLV  194

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP+LF+K+LD I LNNNR  S +PEN GNS ASV+VLANNKF GC+PSSIG+M  +++++
Sbjct  195   PPALFEKNLDAIFLNNNRFHSTIPENLGNSNASVVVLANNKFFGCIPSSIGKMSNTLDEL  254

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  NN+ SGCLPEEIT L+++T  D+  NK VG LPK L YMQ +E    A N F G+VP
Sbjct  255   VFTNNDLSGCLPEEITKLTSLTTLDISGNKFVGSLPKDLKYMQKVEVFDIASNKFMGNVP  314

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + LC+LP L NL+FS NYFE  D+ C P +   + ++  +NC+ E+P QK  ++C   LS
Sbjct  315   ENLCTLPKLANLTFSKNYFESLDQKCTPSRSHDLEIEGKENCLQEQPDQKTEKECLPVLS  374

Query  165   KPVDCSKTGC  136
              PVDCSK  C
Sbjct  375   NPVDCSKGHC  384



>emb|CDO97126.1| unnamed protein product [Coffea canephora]
Length=608

 Score =   461 bits (1186),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 238/397 (60%), Positives = 291/397 (73%), Gaps = 8/397 (2%)
 Frame = -3

Query  1302  MAAVGClvflsllsfssisLAFTDADAENIARRQLLHFAAEVDFSGEG-----FEHKLDL  1138
             M A+GC  F+SLLS SS SLA TDA+A  IARRQLL F+ ++D   EG          +L
Sbjct  7     MRALGCFFFISLLSSSSFSLALTDAEATYIARRQLLTFS-KLDHLSEGGILDSTNFDFEL  65

Query  1137  KLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVA  958
                F NDR KKAY+ALQAWK A YSDP   T NW GP+VC Y GVFC  ALDDP   VVA
Sbjct  66    NFTFENDRLKKAYIALQAWKKATYSDPHNTTGNWDGPDVCQYTGVFCAPALDDPNVTVVA  125

Query  957   GIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGP  778
             GID+NH+DIAGHLP EIGLLTD++L+H+NSNR CGI+PK+IS L LL+E+D SNN  VGP
Sbjct  126   GIDLNHADIAGHLPVEIGLLTDISLLHLNSNRFCGIIPKSISKLTLLYELDVSNNRFVGP  185

Query  777   FPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVI  598
             FP V+LELP+LKYLD+R+N+FEGALPP+LFDK LD I +NNNR  SNLPENFGNS ASVI
Sbjct  186   FPHVVLELPNLKYLDIRFNDFEGALPPALFDKQLDAIFINNNRFHSNLPENFGNSPASVI  245

Query  597   VLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGEL  418
             V+A N FSGC+P SIG+M +++++I   +N  SGCLPEEIT L + TVFD+  NK VG L
Sbjct  246   VVAQNHFSGCLPKSIGKMGETLDEINFAHNGLSGCLPEEITELQSATVFDISENKFVGSL  305

Query  417   PKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV  238
             P GL Y+Q LE  S A NMF+G+VP+ LC+LP++ N+S S NYFE ED SC+     + +
Sbjct  306   PVGLEYLQKLEEISIAQNMFTGNVPESLCTLPSVTNISLSYNYFENEDVSCVS-SGNLTI  364

Query  237   DDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRAA  127
             +D  NC L++P QK    C    S PVDC+K GCR +
Sbjct  365   EDDSNC-LDKPSQKTKAACLPVTSHPVDCAKEGCRKS  400



>ref|XP_009775306.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nicotiana sylvestris]
Length=822

 Score =   463 bits (1191),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 221/372 (59%), Positives = 278/372 (75%), Gaps = 4/372 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  IARRQL     ++       E++ ++KL FAN R KKAY+ALQAWK AIYS
Sbjct  28    ALTDNEAAFIARRQLTAGTGDLP---NLVEYEKNIKLTFANGRLKKAYIALQAWKKAIYS  84

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC+YNGVFCD+ALDDP   VVAGID+NH+DIAGHLP E+G L D++L
Sbjct  85    DPSNFTNNWEGPDVCAYNGVFCDNALDDPNISVVAGIDLNHADIAGHLPVELGFLADVSL  144

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             IH+NSNR CGIVPK+I+NLKLL EIDFSNN  VGPFP V+LELP+LKYLDLRYN+FEG++
Sbjct  145   IHINSNRFCGIVPKSITNLKLLDEIDFSNNRFVGPFPKVVLELPNLKYLDLRYNDFEGSV  204

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDK+LD I LNNNR  S +P N GNS ASV+VLANNKF GC+P SIG+ME +++++
Sbjct  205   PSELFDKNLDAIFLNNNRFHSTIPPNIGNSNASVVVLANNKFHGCIPHSIGKMENTLDEL  264

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  NN  SGC+ +EI  L ++T+FD+ RNK VG LP+GL  MQ ++    A NMF G VP
Sbjct  265   VFTNNNLSGCVTDEIAKLKSLTIFDISRNKFVGSLPQGLKSMQKVQVLDIASNMFIGEVP  324

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCL-PLKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C+LPNL N +FS NYF+  D++C  PLK  + V+D +NC+  RP Q+  + C   LS
Sbjct  325   EAICTLPNLANFTFSYNYFDALDKTCAPPLKKNLVVEDKENCLGGRPDQRKEKDCQSVLS  384

Query  165   KPVDCSKTGCRA  130
             KPVDCSK  CRA
Sbjct  385   KPVDCSKDKCRA  396



>ref|XP_006346494.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3-like [Solanum tuberosum]
Length=674

 Score =   452 bits (1164),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 218/370 (59%), Positives = 277/370 (75%), Gaps = 4/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A +IARRQLL    E+      +E ++ + ++F N R KKAYVALQAWK AIYS
Sbjct  23    ALSDIEAASIARRQLLGNNGELP---NTYESEMTINMKFENARLKKAYVALQAWKKAIYS  79

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW G NVC+YNGVFCD+ALDDP   VVAGID+NH+DIAGHLP E+GLL D++L
Sbjct  80    DPTNFTANWEGNNVCAYNGVFCDNALDDPNISVVAGIDLNHADIAGHLPVELGLLADVSL  139

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             IH+NSNR CGI+PK+I NL LL EIDFSNN  VGPFPDV+LELP L YLDLR+NNFEG +
Sbjct  140   IHINSNRFCGIIPKSIKNLTLLDEIDFSNNRFVGPFPDVVLELPKLNYLDLRFNNFEGQV  199

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LF+K+LD IL+NNNR  S +PE+ GNS ASV+VLANNKF GC+PSSIG+M  S++++
Sbjct  200   PSALFEKNLDAILINNNRFHSTIPESLGNSNASVVVLANNKFYGCIPSSIGKMGNSLDEL  259

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  NNE SGCLPEEIT L+++T+FD+  NK VG LP+ L  MQ +E    A N F G+VP
Sbjct  260   VFTNNELSGCLPEEITKLTSLTLFDISGNKFVGSLPQDLKSMQKVEIFDIASNKFMGNVP  319

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCVLERPGQKLPQKCYEYLS  166
               LC+LP+L N +FS NYFE  DE+C P +   V +D ++NC+  R  Q+  ++C+  +S
Sbjct  320   KNLCTLPSLTNFTFSKNYFESMDETCTPSQTKQVKIDGNENCLGGRSEQRTEKECFPVVS  379

Query  165   KPVDCSKTGC  136
             KPVDCSK  C
Sbjct  380   KPVDCSKGHC  389



>ref|XP_004230831.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Solanum lycopersicum]
Length=725

 Score =   450 bits (1158),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 215/370 (58%), Positives = 278/370 (75%), Gaps = 4/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A +IARRQLL    ++      +E ++ + ++F N R KKAYVALQAWK +IYS
Sbjct  23    ALSDIEAASIARRQLLSNNGQL---SNTYESEMTINMKFENARLKKAYVALQAWKKSIYS  79

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW G NVC+YNGVFCD+ALDDP   VVAGID+NH+DIAGHLP E+GLL D++L
Sbjct  80    DPTNFTANWEGSNVCAYNGVFCDNALDDPNISVVAGIDLNHADIAGHLPVELGLLADVSL  139

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             IH+NSNR CGI+PK+I+NL LL EIDFSNN  VGPFPDV+LELP L YLDLR+N+FEG +
Sbjct  140   IHINSNRFCGIIPKSITNLTLLDEIDFSNNRFVGPFPDVVLELPKLNYLDLRFNDFEGQV  199

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LF+K+LD IL+NNNR  S +PE+ GNS ASV+VLANNKF GC+PSSIG+M  S++++
Sbjct  200   PSALFEKNLDAILINNNRFHSTIPESLGNSNASVVVLANNKFYGCIPSSIGKMGNSLDEL  259

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  NNE SGCLPEEIT L+++T+ D+  NK VG LP+ L  MQ +E    A N F G+VP
Sbjct  260   VFTNNELSGCLPEEITKLTSLTLLDISGNKFVGSLPQDLKSMQKVEIFDIASNKFMGNVP  319

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCVLERPGQKLPQKCYEYLS  166
               LC+LP+LKN +FS NYFE  DE+C P +   V +D ++NC+  R  Q+  ++C+  +S
Sbjct  320   KNLCTLPSLKNFTFSKNYFESMDETCRPSESKQVKIDGNENCLGGRSEQRTEKECFPVVS  379

Query  165   KPVDCSKTGC  136
             KPVDCSK  C
Sbjct  380   KPVDCSKGHC  389



>gb|AAD55979.1|AF159296_1 extensin-like protein [Solanum lycopersicum]
Length=711

 Score =   449 bits (1154),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 214/370 (58%), Positives = 278/370 (75%), Gaps = 4/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A +IARRQLL    ++      +E ++ + ++F N R KKAYVALQAWK +IYS
Sbjct  23    ALSDIEAASIARRQLLSNNGQL---SNTYESEMTINMKFENARLKKAYVALQAWKKSIYS  79

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW G NVC+YNGVFCD+ALDDP   VVAGID+NH+DIAGHLP E+GLL D++L
Sbjct  80    DPTNFTANWEGSNVCAYNGVFCDNALDDPNISVVAGIDLNHADIAGHLPVELGLLADVSL  139

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             IH+NSNR CGI+PK+I+NL LL EIDFSNN  VGPFPDV+L+LP L YLDLR+N+FEG +
Sbjct  140   IHINSNRFCGIIPKSITNLTLLDEIDFSNNRFVGPFPDVVLDLPKLNYLDLRFNDFEGQV  199

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LF+K+LD IL+NNNR  S +PE+ GNS ASV+VLANNKF GC+PSSIG+M  S++++
Sbjct  200   PSALFEKNLDAILINNNRFHSTIPESLGNSNASVVVLANNKFYGCIPSSIGKMGNSLDEL  259

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  NNE SGCLPEEIT L+++T+ D+  NK VG LP+ L  MQ +E    A N F G+VP
Sbjct  260   VFTNNELSGCLPEEITKLTSLTLLDISGNKFVGSLPQDLKSMQKVEIFDIASNKFMGNVP  319

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCVLERPGQKLPQKCYEYLS  166
               LC+LP+LKN +FS NYFE  DE+C P +   V +D ++NC+  R  Q+  ++C+  +S
Sbjct  320   KNLCTLPSLKNFTFSKNYFESMDETCRPSESKQVKIDGNENCLGGRSEQRTEKECFPVVS  379

Query  165   KPVDCSKTGC  136
             KPVDCSK  C
Sbjct  380   KPVDCSKGHC  389



>ref|XP_004248904.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Solanum lycopersicum]
Length=710

 Score =   439 bits (1129),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 218/392 (56%), Positives = 280/392 (71%), Gaps = 4/392 (1%)
 Frame = -3

Query  1302  MAAVGClvflsllsfssisLAFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFA  1123
             + A+GC   L LL+  S S A T+ +  +IARRQL+    ++    E +E  +DLK E  
Sbjct  7     IKALGCFFLLILLNLVSSSYALTNDEVASIARRQLISGTGDLPNIVE-YEKNIDLKFE--  63

Query  1122  NDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDIN  943
             N R K+AY+ALQAWK AIYSDP   T NW G NVC+YNGVFCD ALDDP   VVAGID+N
Sbjct  64    NPRLKRAYIALQAWKKAIYSDPSKFTSNWEGANVCAYNGVFCDKALDDPNINVVAGIDLN  123

Query  942   HSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVI  763
             ++DIAGHLP EIG L D++L+H+NSNR CGI+PK+I+NLKLL EIDFSNN  VGPFP ++
Sbjct  124   NADIAGHLPVEIGFLADVSLVHINSNRFCGIIPKSINNLKLLDEIDFSNNRFVGPFPKIV  183

Query  762   LELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANN  583
             LELP L +LD+R+N+FEG +P  LFDK+LD I LNNNR  S +P N GNS ASV+VLANN
Sbjct  184   LELPKLNFLDIRFNDFEGPVPSELFDKNLDAIFLNNNRFVSTIPPNIGNSNASVVVLANN  243

Query  582   KFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLG  403
             +F GC+P SIG+ME ++++++  NN  SGC+ EEI+ L ++ VFD+ +NK VG LP+GL 
Sbjct  244   RFHGCIPHSIGKMENTLDELVFTNNNLSGCVTEEISKLKSLKVFDISKNKFVGSLPRGLE  303

Query  402   YMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCL-PLKDGVAVDDSD  226
              MQ +E    A NMF G +P  +C+LPNL N +FS NYFE  DE C  PL     +DD +
Sbjct  304   LMQKVEVLDIASNMFRGEIPKAICTLPNLANFTFSYNYFENLDEGCAPPLPRNPVLDDKE  363

Query  225   NCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
             NC+  +PGQ+  + C   LSK VDCSK  CR+
Sbjct  364   NCLKGKPGQRSEKDCQSVLSKIVDCSKDKCRS  395



>ref|XP_006356596.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3-like [Solanum tuberosum]
Length=709

 Score =   437 bits (1123),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 219/395 (55%), Positives = 284/395 (72%), Gaps = 4/395 (1%)
 Frame = -3

Query  1302  MAAVGClvflsllsfssisLAFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFA  1123
             + A+GC   L LL+F S S A T+ +A  IARRQL+    ++    E +E  +DLK E  
Sbjct  7     IKALGCFFLLVLLNFLSFSYALTNDEAAFIARRQLISGTGDLPNIVE-YEKNIDLKFE--  63

Query  1122  NDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDIN  943
             N R K+AY+ALQAWK AIYSDP   T NW G +VC+YNGVFCD ALDDP   VVAGID+N
Sbjct  64    NHRLKRAYIALQAWKKAIYSDPSKFTSNWEGADVCAYNGVFCDKALDDPNINVVAGIDLN  123

Query  942   HSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVI  763
             ++DIAGHLP EIG L D++L+H+NSNR CGI+PK+I+NLKLL EIDFSNN  VGPFP ++
Sbjct  124   NADIAGHLPVEIGFLADVSLVHINSNRFCGIIPKSINNLKLLDEIDFSNNRFVGPFPKIV  183

Query  762   LELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANN  583
             LELP L +LDLR+N+FEG++P  LFDK LD I LNNNR  S +P N GNS ASV+VLANN
Sbjct  184   LELPKLNFLDLRFNDFEGSVPSELFDKSLDAIFLNNNRFVSTIPPNIGNSNASVVVLANN  243

Query  582   KFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLG  403
             KF GC+P SIG+ME ++++++  NN+ SGC+ EE++ L ++TVFD+ +NK VG LP+GL 
Sbjct  244   KFHGCIPHSIGKMENTLDELVFTNNDLSGCVTEEVSKLKSLTVFDISKNKFVGSLPRGLE  303

Query  402   YMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCL-PLKDGVAVDDSD  226
              MQ +E    A NMF G +P  +C+LPNL N +FS NYF+  DE C  PL     +DD +
Sbjct  304   LMQKVEVLDIASNMFRGEIPKAICTLPNLANFTFSYNYFDELDEGCAPPLPRNPVLDDKE  363

Query  225   NCVLERPGQKLPQKCYEYLSKPVDCSKTGCRAATK  121
             NC+  +P Q+  + C   LSK VDCSK  CR+ ++
Sbjct  364   NCLNGKPDQRNEKDCQSVLSKIVDCSKDKCRSNSE  398



>ref|XP_004173680.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like, 
partial [Cucumis sativus]
Length=451

 Score =   422 bits (1084),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 211/369 (57%), Positives = 256/369 (69%), Gaps = 6/369 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I +RQLL++  E  F   G E  +D KL F NDR + AY+ALQAWK AI S
Sbjct  46    GLTDAEAHYIRQRQLLYYRDE--FGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILS  103

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +TKNWVG +VC Y GVFC  A D+ +   VAGID+NH DIAG+LP E+GLL DLAL
Sbjct  104   DPLNLTKNWVGSDVCHYKGVFCAPAPDNSSIRTVAGIDLNHGDIAGYLPEELGLLVDLAL  163

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP    NLKLLFE+D SNN   G FP V+LELP LK+LDLR+N FEG +
Sbjct  164   FHINSNRFCGTVPHKFKNLKLLFELDLSNNRFAGKFPRVVLELPELKFLDLRFNEFEGTV  223

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   +LPENFGNS  SVIVLANNKF GCVP SIG M + + +I
Sbjct  224   PKELFDKDLDAIFINHNRFRFDLPENFGNSPVSVIVLANNKFHGCVPGSIGNMTR-LNEI  282

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN F  CLP EI  L N+TVFDV  N+  G+LP+ +G M SLE  + A N  SG +P
Sbjct  283   ILMNNGFRSCLPSEIGFLKNLTVFDVSHNEFFGKLPETIGGMVSLEQLNVAHNFLSGKIP  342

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             D +C LPNL+N ++S N+F  E  SCL L D    DD  NC+ ERP Q+  ++C  +LSK
Sbjct  343   DSICKLPNLQNFTYSYNFFTGEAPSCLALPD---FDDRRNCIPERPVQRSERQCKSFLSK  399

Query  162   PVDCSKTGC  136
             PVDCS  GC
Sbjct  400   PVDCSSFGC  408



>ref|XP_010251730.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nelumbo nucifera]
Length=605

 Score =   425 bits (1092),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/374 (54%), Positives = 263/374 (70%), Gaps = 2/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               + A+A  IA RQLL      D   + +E+++D+K+ FAN R ++AY+ALQAWK AIYS
Sbjct  24    TLSQAEASFIASRQLLALPENGDLPHD-YEYEIDVKVTFANSRLRRAYIALQAWKKAIYS  82

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVGPNVCSYNGVFC  A DDP   VVAG+D+N++DIAG LP E+G +TDL+L
Sbjct  83    DPYNVTGNWVGPNVCSYNGVFCSVAADDPQASVVAGVDLNNADIAGFLPLELGHMTDLSL  142

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGIVPK+ S +++L E+D SNN  VGPFP+V+L +P LKYLD+RYN+FEG L
Sbjct  143   FHVNSNRFCGIVPKSFSKMEILHELDLSNNRFVGPFPEVVLSIPKLKYLDIRYNDFEGPL  202

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LFDKDLD I LN+NR E  +PEN GNS ASVIV ANN  SGC+P SI +M+ ++ +I
Sbjct  203   PPELFDKDLDAIFLNDNRFEDTIPENLGNSPASVIVFANNNLSGCIPQSISKMKHTLNEI  262

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + LNN  SGCLP +I LL N+TVF    N   G LPK L  M+SLE    + N  +G VP
Sbjct  263   IFLNNHLSGCLPPDIGLLENVTVFIAASNSFSGILPKSLSSMKSLELLDVSDNHLTGFVP  322

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP+L N +FS NYF+ E  +C+  K   V  DD+ NC+ +RP QK  + C   ++
Sbjct  323   ENICKLPSLGNFTFSYNYFKGESPACVTSKQMDVVFDDTSNCLPDRPKQKTSKTCMPVVN  382

Query  165   KPVDCSKTGCRAAT  124
             +PVDC K+ C  ++
Sbjct  383   RPVDCGKSKCAGSS  396



>ref|XP_008371522.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Malus domestica]
Length=474

 Score =   419 bits (1078),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 198/370 (54%), Positives = 264/370 (71%), Gaps = 2/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  +A RQL+      D   + +E +++L L+F N R ++AY+ LQA K A+YS
Sbjct  23    ALTDAEASFLAHRQLVSLPEGGDIP-DNYEFEVELDLKFPNTRLRRAYIGLQALKKAVYS  81

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T+NWVG NVC+YNGVFC  ALDDP   VVAGIDINH+DIAGHLP E+GLLTD+AL
Sbjct  82    DPLKTTENWVGENVCAYNGVFCAPALDDPELEVVAGIDINHADIAGHLPAELGLLTDMAL  141

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   L LL E D SNN  VG FPDV+LE+P+LKYLDLR+N+FEG L
Sbjct  142   FHINSNRFCGIIPKSFRRLTLLHEFDVSNNRFVGSFPDVVLEIPNLKYLDLRFNDFEGKL  201

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF+K+LD + LN+NR  S +PEN GNS  SV+V+ANN+  GC+P+SIG+M +++ ++
Sbjct  202   PPELFNKELDALFLNDNRFTSTIPENLGNSPVSVLVVANNQLEGCIPNSIGKMVKTLNEV  261

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  NN+F+GCLP EI  L+N+TVFD+  N   G + K    ++ +E    A NM +G VP
Sbjct  262   VFSNNKFTGCLPPEIGQLANMTVFDISSNTFSGIMSKTFKGLEKVEELDIAHNMLTGFVP  321

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C+LPNL N +FS NYF  E + C+P  +  V  DD  NC+ +RP QK  ++C+  +S
Sbjct  322   NSICTLPNLGNFTFSYNYFNGETQKCVPGSRKDVVFDDVSNCLPDRPEQKSAKECHVVVS  381

Query  165   KPVDCSKTGC  136
             KPVDCSK  C
Sbjct  382   KPVDCSKAKC  391



>gb|AAM13864.1| unknown protein [Arabidopsis thaliana]
Length=712

 Score =   425 bits (1093),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 202/370 (55%), Positives = 261/370 (71%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + RRQLL  +   D   +  E+++DL L+FAN+R K+AY+ALQAWK A YS
Sbjct  30    ALTDEEASFLTRRQLLALSENGDLPDD-IEYEVDLDLKFANNRLKRAYIALQAWKKAFYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP     NWVGP+VCSY GVFC  ALDDP+  VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  89    DPFNTAANWVGPDVCSYKGVFCAPALDDPSVLVVAGIDLNHADIAGYLPPELGLLTDVAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK++S L L++E D SNN  VGPFP V L  PSLK+LD+RYN+FEG L
Sbjct  149   FHVNSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGPFPTVALSWPSLKFLDIRYNDFEGKL  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +FDKDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  209   PPEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTFAHNKFSGCIPKTIGQM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGCLP EI  L+N+TVFD   N  VG LP  L  + ++E   F+ N F+G V 
Sbjct  268   VFIGNNLSGCLPNEIGSLNNVTVFDASSNGFVGSLPSTLSGLANVEQMDFSYNKFTGFVT  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS N+F  E +SC+P        DD+ NC+  RP QK  ++C   +S
Sbjct  328   DNICKLPKLSNFTFSYNFFNGEAQSCVPGSSQEKQFDDTSNCLQNRPNQKSAKECLPVVS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>ref|XP_006375015.1| hypothetical protein POPTR_0014s03600g [Populus trichocarpa]
 gb|ERP52812.1| hypothetical protein POPTR_0014s03600g [Populus trichocarpa]
Length=477

 Score =   417 bits (1072),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 202/370 (55%), Positives = 259/370 (70%), Gaps = 2/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A + ++A  IARRQ L     V+   + FE K++L + F N R +KAY+ALQAWK AI S
Sbjct  24    ALSHSEASFIARRQPLSLEKNVNLP-DYFELKIELNITFPNPRLRKAYIALQAWKKAIRS  82

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  IT NW G  VC YNGVFC  ALDDP Q VVAGID+NH DI G+LP E+GLLTD+AL
Sbjct  83    DPFNITGNWEGLRVCDYNGVFCAPALDDPKQNVVAGIDLNHFDIVGYLPVELGLLTDIAL  142

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR  GI+PK+ S L LL E+D SNN LVGPFP+V++ LPSLKYLD+RYN+FEG L
Sbjct  143   FHINSNRFSGIIPKSFSRLTLLHELDVSNNRLVGPFPEVVISLPSLKYLDIRYNDFEGGL  202

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +F+KDLD + LNNNR  S +PE  G+S ASV+V+ANNK +GC+PSSIG+M  ++ + 
Sbjct  203   PPEVFEKDLDALFLNNNRFTSTIPETLGSSPASVVVIANNKLTGCIPSSIGKMGSTLNEF  262

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + LNN  SGCLP EI  L N TV DV  N   G LP+    +  +E    + N+ +G VP
Sbjct  263   VFLNNSLSGCLPSEIGKLGNATVLDVGSNSFSGVLPRCFKGLSQVERLDVSHNLLTGFVP  322

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLK-DGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             +G+C LPNL N +FS NYF  E ++C P K   + +DD+ NC+ +RP QK P+ C+  +S
Sbjct  323   EGICKLPNLVNFTFSYNYFNGEAQACSPPKRKDITMDDTSNCLPDRPKQKSPKICHPVVS  382

Query  165   KPVDCSKTGC  136
             KPVDC+K  C
Sbjct  383   KPVDCNKAMC  392



>ref|XP_009599187.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nicotiana tomentosiformis]
Length=569

 Score =   420 bits (1079),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 201/377 (53%), Positives = 266/377 (71%), Gaps = 3/377 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A  +ARRQL           + +E ++ +   F N R ++AY+AL+AWK+A+YS
Sbjct  22    ALSDHEASLLARRQLSTLPENGKLP-DNYEFEVHVNYTFPNSRFRRAYIALKAWKEAVYS  80

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GVFC  ALDDP   VVAGID+NH+DIAG+LP E+GLLTD AL
Sbjct  81    DPYKFTSNWKGPHVCKYKGVFCSPALDDPNVTVVAGIDLNHADIAGYLPVELGLLTDAAL  140

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P++ S L+L+ E+D SNN LVGPFP V+L +P+LKYLDLR+NNFEG L
Sbjct  141   FHLNSNRFCGIIPESFSRLRLMHELDLSNNRLVGPFPKVVLNMPNLKYLDLRFNNFEGEL  200

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LFDKDLD + LN+NR  S +PE  GNS+ASVIV ANNKF GC+PSSIG+M  ++++I
Sbjct  201   PPQLFDKDLDALFLNDNRFVSTIPETIGNSSASVIVFANNKFHGCIPSSIGKM-SNLDEI  259

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  NN+  GCLP E+ LL NITVFDV  N   G LPK L  +  +E    + N  +G VP
Sbjct  260   VFRNNDLGGCLPVEVGLLKNITVFDVAGNSFSGILPKTLNALSHVEQLDLSHNTLTGFVP  319

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + LC LP+LKN +FS NYF  E + C P ++  V  DD++NC+ +RP QK  ++C   +S
Sbjct  320   ENLCRLPSLKNFTFSFNYFNGEAKGCEPNVRKDVFFDDTNNCLRDRPKQKSQKQCQPIVS  379

Query  165   KPVDCSKTGCRAATKET  115
             KP+DCSK  C A++ ++
Sbjct  380   KPIDCSKAKCGASSSKS  396



>ref|XP_004139428.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
Length=608

 Score =   421 bits (1082),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/369 (57%), Positives = 256/369 (69%), Gaps = 6/369 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I +RQLL++  E  F   G E  +D KL F NDR + AY+ALQAWK AI S
Sbjct  46    GLTDAEAHYIRQRQLLYYRDE--FGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILS  103

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +TKNWVG +VC Y GVFC  A D+ +   VAGID+NH DIAG+LP E+GLL DLAL
Sbjct  104   DPLNLTKNWVGSDVCHYKGVFCAPAPDNSSIRTVAGIDLNHGDIAGYLPEELGLLVDLAL  163

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP    NLKLLFE+D SNN   G FP V+LELP LK+LDLR+N FEG +
Sbjct  164   FHINSNRFCGTVPHKFKNLKLLFELDLSNNRFAGKFPRVVLELPELKFLDLRFNEFEGTV  223

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   +LPENFGNS  SVIVLANNKF GCVP SIG M + + +I
Sbjct  224   PKELFDKDLDAIFINHNRFRFDLPENFGNSPVSVIVLANNKFHGCVPGSIGNMTR-LNEI  282

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN F  CLP EI  L N+TVFDV  N+  G+LP+ +G M SLE  + A N  SG +P
Sbjct  283   ILMNNGFRSCLPSEIGFLKNLTVFDVSHNEFFGKLPETIGGMVSLEQLNVAHNFLSGKIP  342

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             D +C LPNL+N ++S N+F  E  SCL L D    DD  NC+ ERP Q+  ++C  +LSK
Sbjct  343   DSICKLPNLQNFTYSYNFFTGEAPSCLALPD---FDDRRNCIPERPVQRSERQCKSFLSK  399

Query  162   PVDCSKTGC  136
             PVDCS  GC
Sbjct  400   PVDCSSFGC  408



>ref|XP_006384469.1| hypothetical protein POPTR_0004s153601g, partial [Populus trichocarpa]
 gb|ERP62266.1| hypothetical protein POPTR_0004s153601g, partial [Populus trichocarpa]
Length=552

 Score =   418 bits (1075),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/370 (52%), Positives = 261/370 (71%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  IARRQLL      +   E FE+++D+K+ FAN R ++AY+ LQAWK AIYS
Sbjct  27    ALTDAEASYIARRQLLTLNENSELPHE-FEYEVDVKITFANQRLRRAYIGLQAWKKAIYS  85

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVG NVC+YNGVFC  ALDDP+  VVAG+D+N +DIAGHLP E+GL+TD+AL
Sbjct  86    DPFNTTGNWVGANVCAYNGVFCAPALDDPSLSVVAGVDLNGADIAGHLPAELGLMTDVAL  145

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P++ S L L++E D SNN  VG FP V+L  PSLKYLD+R+N+FEG+L
Sbjct  146   FHINSNRFCGIIPESFSKLTLMYEFDVSNNRFVGDFPSVVLSWPSLKYLDVRFNDFEGSL  205

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF+K+LD + LN+NR  S +PE  GNS  SV+  ANNKF+GC+P S+G+M  ++ ++
Sbjct  206   PPELFNKELDALFLNDNRFTSTIPETIGNSAVSVVTFANNKFTGCIPHSVGKM-ANLNEV  264

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N+  GC P EI LL N+TVFD   N   G LP     ++ +E    A N  +G VP
Sbjct  265   IFMGNDLGGCFPAEIGLLRNVTVFDASHNGFTGILPPSFAGLKKVELLDLADNKLTGFVP  324

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPL-KDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP+L N +FS NYF+ E ++C+P  +  + +DD+ NC+ +RP QK  + CY  +S
Sbjct  325   ENICKLPSLTNFTFSYNYFKGEAQACVPPSRKDIVLDDTSNCLSDRPKQKSARTCYPVVS  384

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  385   RPVDCSKDKC  394



>ref|XP_009801066.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Nicotiana sylvestris]
Length=510

 Score =   416 bits (1070),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 198/377 (53%), Positives = 265/377 (70%), Gaps = 3/377 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A  +ARRQL           + +E ++ +   F N R ++AY+AL+AWK+A+YS
Sbjct  22    ALSDHEASLLARRQLSTLPENGKLP-DNYEFEVHVNYTFPNSRLRRAYIALKAWKEAVYS  80

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GVFC  ALDDP   VVAGID+NH+DIAG+LP E+GLLTD AL
Sbjct  81    DPYKFTNNWKGPDVCKYKGVFCSPALDDPNVTVVAGIDLNHADIAGYLPVELGLLTDAAL  140

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P++ S L+L+ E+D SNN LVGPFP V+L LP+LKYLDLR+NNFEG L
Sbjct  141   FHLNSNRFCGIIPESFSRLRLMHELDLSNNRLVGPFPKVVLNLPNLKYLDLRFNNFEGEL  200

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LFDKDLD + LN+NR  S +PE  GNS+ASVIV ANNKF GC+P+SIG+M + +++I
Sbjct  201   PPQLFDKDLDALFLNDNRFVSTIPETIGNSSASVIVFANNKFHGCIPNSIGKMSK-LDEI  259

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + +NN+  GCLP E+ LL N+TVFDV  N   G LPK L  +  +E    + N  +G V 
Sbjct  260   VFMNNDLGGCLPVEVGLLKNVTVFDVAGNSFSGILPKTLNDLSHVEQLDLSHNTLTGFVQ  319

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + LC LPNLKN +FS NYF  E + C P ++  V  DD++NC+ +RP QK  ++C   ++
Sbjct  320   ENLCRLPNLKNFTFSFNYFNGEAKGCEPHMRKDVIFDDTNNCLPDRPKQKSQKQCQPIVN  379

Query  165   KPVDCSKTGCRAATKET  115
             KP+DC K  C A++ ++
Sbjct  380   KPIDCRKAKCGASSSKS  396



>ref|XP_003523588.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like [Glycine max]
Length=529

 Score =   416 bits (1070),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/369 (55%), Positives = 256/369 (69%), Gaps = 1/369 (0%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A ++A+   IARRQLLH   E D   + +    +  L F+N R K AY+AL+A K AIYS
Sbjct  23    ALSNAEVSFIARRQLLHLH-ENDELSDNYVDNYETNLTFSNPRLKLAYIALEALKKAIYS  81

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW G NVCSYNGVFC+ ALDDP   VVAGID+NH+DIAG++P EIGLLTDLAL
Sbjct  82    DPSNFTANWEGQNVCSYNGVFCEKALDDPKIDVVAGIDLNHADIAGYIPPEIGLLTDLAL  141

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK+ S LKLL+E D SNN  VG FP+ +L +P LK+LDLR+NNFEG L
Sbjct  142   FHINSNRFCGVLPKSFSKLKLLYEADISNNRFVGRFPEPVLPIPDLKFLDLRFNNFEGEL  201

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF+K LD I LNNNR  S +P+N G+S ASV+V ANN  +GCVPSSIG M +++ + 
Sbjct  202   PSELFNKSLDAIFLNNNRFTSTIPQNLGSSPASVVVFANNNLTGCVPSSIGNMTKTLNEF  261

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L NN  +GCLP EI  L  +TVFD+ +N  VG LP+ L  ++S+E  S   N  +G VP
Sbjct  262   VLTNNNLTGCLPAEIGKLEKVTVFDISQNNFVGMLPRTLNGLKSVEHLSIEHNKLTGFVP  321

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +CSL NL N +FS NYF  E+E C+P K  V +DD  NC+ +RP QK+   C   +SK
Sbjct  322   RNVCSLSNLVNFTFSYNYFNGEEEGCVPPKKDVVLDDESNCIPDRPKQKVANICNVVISK  381

Query  162   PVDCSKTGC  136
             PVDCSK  C
Sbjct  382   PVDCSKAQC  390



>ref|XP_010064140.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Eucalyptus grandis]
Length=580

 Score =   417 bits (1073),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/376 (51%), Positives = 257/376 (68%), Gaps = 2/376 (1%)
 Frame = -3

Query  1239  FTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSD  1060
              + ++A  IARRQLL            +E+ +++   FAN R ++AY+AL+AWK+A+YSD
Sbjct  25    LSTSEASLIARRQLLALRENTKLP-RNYEYVVEVNETFANSRLRRAYIALRAWKEAMYSD  83

Query  1059  PKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALI  880
             P   T NWVGP VC YNGVFC  ALDDP   VVAGID+NH+DIAG+LP E+ LL DLAL 
Sbjct  84    PLNTTGNWVGPGVCEYNGVFCSPALDDPNLIVVAGIDLNHADIAGYLPPELSLLGDLALF  143

Query  879   HMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALP  700
             H+NSNR CG++P++   L LL+E+D SNN  VG FP VIL LP LKYLD+RYN+FEG LP
Sbjct  144   HINSNRFCGVIPESFEKLTLLYELDLSNNRFVGLFPKVILSLPQLKYLDIRYNDFEGKLP  203

Query  699   PSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQIL  520
             P LF+KD D I LNNNR  S +PENFGNS ASV+V+A+N   GC+P SIG+M  ++ +++
Sbjct  204   PQLFEKDFDAIFLNNNRFTSTIPENFGNSPASVVVVAHNDLKGCIPRSIGKMANTLNELI  263

Query  519   LLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPD  340
               NN  +GCLP EI +L N+TV DV  N  +G LPK    + ++E    +GN  +G VP 
Sbjct  264   FSNNGLAGCLPPEIGMLGNVTVLDVASNSFIGTLPKSFQGLSAIELLDISGNTMTGFVPG  323

Query  339   GLCSLPNLKNLSFSGNYFEMEDESC-LPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             G+C LP L N +FS NYF  ED++C  P + G+ +DDS NC+ ERP Q+  + C   + K
Sbjct  324   GICGLPKLTNFTFSNNYFNGEDQACEPPSRRGIFLDDSSNCLPERPRQRPAKACVPVVRK  383

Query  162   PVDCSKTGCRAATKET  115
             PVDC ++ C   ++ +
Sbjct  384   PVDCGRSRCGGPSRSS  399



>ref|NP_188532.2| pollen-specific leucine-rich repeat extensin-like protein 1 [Arabidopsis 
thaliana]
 sp|Q9LJ64.1|PLRX1_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like 
protein 1; Short=AtPEX1; Short=Pollen-specific LRR/EXTENSIN1; 
AltName: Full=Cell wall hydroxyproline-rich glycoprotein; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01698.1| extensin protein-like [Arabidopsis thaliana]
 gb|AEE76184.1| pollen-specific leucine-rich repeat extensin-like protein 1 [Arabidopsis 
thaliana]
Length=956

 Score =   427 bits (1097),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 202/370 (55%), Positives = 261/370 (71%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + RRQLL  +   D   +  E+++DL L+FAN+R K+AY+ALQAWK A YS
Sbjct  30    ALTDEEASFLTRRQLLALSENGDLPDD-IEYEVDLDLKFANNRLKRAYIALQAWKKAFYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP     NWVGP+VCSY GVFC  ALDDP+  VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  89    DPFNTAANWVGPDVCSYKGVFCAPALDDPSVLVVAGIDLNHADIAGYLPPELGLLTDVAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK++S L L++E D SNN  VGPFP V L  PSLK+LD+RYN+FEG L
Sbjct  149   FHVNSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGPFPTVALSWPSLKFLDIRYNDFEGKL  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +FDKDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  209   PPEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTFAHNKFSGCIPKTIGQM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGCLP EI  L+N+TVFD   N  VG LP  L  + ++E   F+ N F+G V 
Sbjct  268   VFIGNNLSGCLPNEIGSLNNVTVFDASSNGFVGSLPSTLSGLANVEQMDFSYNKFTGFVT  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS N+F  E +SC+P        DD+ NC+  RP QK  ++C   +S
Sbjct  328   DNICKLPKLSNFTFSYNFFNGEAQSCVPGSSQEKQFDDTSNCLQNRPNQKSAKECLPVVS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>ref|XP_009385321.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3, partial [Musa acuminata subsp. malaccensis]
Length=572

 Score =   415 bits (1066),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 200/371 (54%), Positives = 255/371 (69%), Gaps = 2/371 (1%)
 Frame = -3

Query  1227  DAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGI  1048
             +A  IARRQLL  +   D   + +E  + + L F N R ++AY+ LQAW+ A+YSDP   
Sbjct  29    EAALIARRQLLALSKNGDLPDD-YEFDVKVDLSFPNARLRRAYIGLQAWRHALYSDPSNF  87

Query  1047  TKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNS  868
             T NWVG +VC Y GVFC  ALDDP   VVAG+D+N +DIAG+LP E+GLLT++AL H+NS
Sbjct  88    TGNWVGADVCGYRGVFCAPALDDPKLTVVAGVDLNGADIAGYLPVELGLLTEVALFHINS  147

Query  867   NRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLF  688
             NR CGI+PK+ S L LL E+D SNN  VGPFP V++ LPSL+YLDLR+N+FEGALPP LF
Sbjct  148   NRFCGIIPKSFSRLVLLHELDVSNNRFVGPFPMVVVGLPSLRYLDLRFNDFEGALPPELF  207

Query  687   DKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNN  508
             DK LD I LN+NR  S +P+NFGNSTASV+VLANNK  GC+P S GRM  ++ +++LLNN
Sbjct  208   DKGLDAIFLNDNRFSSPIPDNFGNSTASVVVLANNKLGGCIPGSTGRMGATLNELVLLNN  267

Query  507   EFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCS  328
                GCLP E+  L N TV D   N L G+LP     +  +E    + N+ +G VP+ LC 
Sbjct  268   GLVGCLPSEVGELGNATVLDASWNSLTGDLPTSFAALSKVEDLDLSHNVLTGVVPEKLCR  327

Query  327   LPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCVLERPGQKLPQKCYEYLSKPVDC  151
             LP+L N +FS NYF+ E   C+P     VA DD  NC+ +RPGQK  + CY  LS+PVDC
Sbjct  328   LPSLTNFTFSFNYFKGEAAECVPSAGSDVAFDDKGNCLEKRPGQKSAKTCYRVLSRPVDC  387

Query  150   SKTGCRAATKE  118
             SK  CR +  E
Sbjct  388   SKDKCRPSQPE  398



>gb|KGN60627.1| hypothetical protein Csa_2G004760 [Cucumis sativus]
Length=765

 Score =   421 bits (1082),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 211/369 (57%), Positives = 256/369 (69%), Gaps = 6/369 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I +RQLL++  E  F   G E  +D KL F NDR + AY+ALQAWK AI S
Sbjct  46    GLTDAEAHYIRQRQLLYYRDE--FGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILS  103

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +TKNWVG +VC Y GVFC  A D+ +   VAGID+NH DIAG+LP E+GLL DLAL
Sbjct  104   DPLNLTKNWVGSDVCHYKGVFCAPAPDNSSIRTVAGIDLNHGDIAGYLPEELGLLVDLAL  163

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP    NLKLLFE+D SNN   G FP V+LELP LK+LDLR+N FEG +
Sbjct  164   FHINSNRFCGTVPHKFKNLKLLFELDLSNNRFAGKFPRVVLELPELKFLDLRFNEFEGTV  223

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   +LPENFGNS  SVIVLANNKF GCVP SIG M + + +I
Sbjct  224   PKELFDKDLDAIFINHNRFRFDLPENFGNSPVSVIVLANNKFHGCVPGSIGNMTR-LNEI  282

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN F  CLP EI  L N+TVFDV  N+  G+LP+ +G M SLE  + A N  SG +P
Sbjct  283   ILMNNGFRSCLPSEIGFLKNLTVFDVSHNEFFGKLPETIGGMVSLEQLNVAHNFLSGKIP  342

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             D +C LPNL+N ++S N+F  E  SCL L D    DD  NC+ ERP Q+  ++C  +LSK
Sbjct  343   DSICKLPNLQNFTYSYNFFTGEAPSCLALPD---FDDRRNCIPERPVQRSERQCKSFLSK  399

Query  162   PVDCSKTGC  136
             PVDCS  GC
Sbjct  400   PVDCSSFGC  408



>ref|XP_006300262.1| hypothetical protein CARUB_v100151920mg, partial [Capsella rubella]
 gb|EOA33160.1| hypothetical protein CARUB_v100151920mg, partial [Capsella rubella]
Length=649

 Score =   417 bits (1072),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/370 (54%), Positives = 258/370 (70%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + RRQLL  +   D   +  E+++D+ L+F N+R K+AY+ALQAWK AIYS
Sbjct  1     ALTDEEASFLTRRQLLALSENGDLPDD-MEYEVDVDLKFDNNRLKRAYIALQAWKKAIYS  59

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP     NWVGPNVC+Y GVFC  ALDDP+  VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  60    DPFNTAANWVGPNVCTYKGVFCAPALDDPSVMVVAGIDLNHADIAGYLPPELGLLTDVAL  119

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK+ S L L++E D SNN  VG FP V L  PSLK+LD+RYN+FEG L
Sbjct  120   FHVNSNRFCGVIPKSFSKLTLMYEFDISNNRFVGSFPTVALSWPSLKFLDIRYNDFEGKL  179

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +FDKDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  180   PPEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTFAHNKFSGCIPKTIGQM-KNLNEI  238

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGCLP EI  L+N+TVFD   N  VG LP  L  + ++E   F+ N  +G V 
Sbjct  239   VFIGNNLSGCLPNEIGSLNNVTVFDASSNGFVGSLPSTLSGLANVEQMDFSYNKLTGVVT  298

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS N+F  E +SC+P        DD+ NC+  RP QK  ++C   +S
Sbjct  299   DSICKLPKLSNFTFSYNFFNGEAQSCVPGSSQEKQFDDTSNCLQNRPNQKSAKECLPVVS  358

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  359   RPVDCSKDKC  368



>ref|XP_002885290.1| hypothetical protein ARALYDRAFT_479420 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61549.1| hypothetical protein ARALYDRAFT_479420 [Arabidopsis lyrata subsp. 
lyrata]
Length=927

 Score =   425 bits (1093),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 202/370 (55%), Positives = 260/370 (70%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + RRQLL  +   D   +  E+++DL L+FAN+R K+AY+ALQAWK A YS
Sbjct  25    ALTDEEASFLTRRQLLALSENGDLPDD-MEYEVDLDLKFANNRLKRAYIALQAWKKAFYS  83

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP     NWVGP+VCSY GVFC  ALDDP+  VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  84    DPFNTAANWVGPDVCSYKGVFCAPALDDPSVLVVAGIDLNHADIAGYLPPELGLLTDVAL  143

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK++S L L++E D SNN  VGPFP V L  PSLK+LD+RYN+FEG L
Sbjct  144   FHINSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGPFPTVALSWPSLKFLDIRYNDFEGKL  203

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +FDKDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  204   PPEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTFAHNKFSGCIPKTIGQM-KNLNEI  262

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGCLP EI  L+N+TVFD   N  VG LP  L  + ++E   F+ N F+G V 
Sbjct  263   VFIGNNLSGCLPNEIGSLNNVTVFDASSNGFVGSLPSTLSGLANVEQMDFSYNKFTGFVT  322

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS N+F  E +SC+P        DD  NC+  RP QK  ++C   +S
Sbjct  323   DNICKLPKLSNFTFSYNFFNGEAQSCVPGSSQEKQFDDMSNCLQNRPNQKSAKECLPVVS  382

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  383   RPVDCSKDKC  392



>ref|XP_011030760.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Populus euphratica]
Length=604

 Score =   416 bits (1068),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/366 (55%), Positives = 257/366 (70%), Gaps = 2/366 (1%)
 Frame = -3

Query  1230  ADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKG  1051
             ++A  IARRQ +     V    + FE K++L + F N R +KAY+ALQAWK AI SDP  
Sbjct  28    SEASFIARRQPVSLKKNVHLP-DSFELKIELNITFPNPRLRKAYIALQAWKKAIRSDPFN  86

Query  1050  ITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMN  871
             IT NW G  VC YNGVFC  ALDDP Q VVAGID+NH DI G+LP E+GLLTD+AL H+N
Sbjct  87    ITGNWEGLRVCDYNGVFCAPALDDPKQNVVAGIDLNHFDIVGYLPVELGLLTDIALFHIN  146

Query  870   SNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSL  691
             SNR  GI+PK+ S L LL E+D SNN LVGPFP+V++ LPSLKYLD+RYN+FEG LPP +
Sbjct  147   SNRFRGIIPKSFSRLTLLHELDVSNNRLVGPFPEVVISLPSLKYLDIRYNDFEGGLPPEV  206

Query  690   FDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLN  511
             F+KDLD + LNNNR  S +PE  G+S ASV+V+ANNK +GC+PSSIG+M  ++ + + LN
Sbjct  207   FEKDLDALFLNNNRFTSTIPETLGSSPASVLVIANNKLTGCIPSSIGKMGSTLNEFVFLN  266

Query  510   NEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLC  331
             N  SGCLP EI  L N TV DV  N   G LP+    +  +E    + N+ +G VP+G+C
Sbjct  267   NSLSGCLPSEIGKLGNATVLDVGSNSFSGVLPRCFKGLSQVERLDVSHNLLTGFVPEGIC  326

Query  330   SLPNLKNLSFSGNYFEMEDESCLPLK-DGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVD  154
              LPNL N +FS NYF  E ++C P K   + +DD+ NC+ +RPGQK P+ C+  +SKPVD
Sbjct  327   KLPNLVNFTFSYNYFNGEAQACSPPKRKDITMDDTSNCLPDRPGQKSPKICHPVVSKPVD  386

Query  153   CSKTGC  136
             C+K  C
Sbjct  387   CNKAMC  392



>ref|XP_008458246.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Cucumis melo]
Length=666

 Score =   417 bits (1071),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/369 (57%), Positives = 255/369 (69%), Gaps = 6/369 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I +RQLL++  E  F   G E  +D KL F NDR + AY+ALQAWK AI S
Sbjct  46    GLTDAEAHYIRQRQLLYYRDE--FGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILS  103

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +TKNWVG +VC Y GVFC  A D+ +   VAGID+NH DIAG+LP E+GLL DLAL
Sbjct  104   DPLNLTKNWVGSDVCHYKGVFCAPAPDNSSIRTVAGIDLNHGDIAGYLPEELGLLVDLAL  163

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP    NLKLLFE+D SNN   G FP V+L+LP LK+LDLR+N FEG +
Sbjct  164   FHINSNRFCGTVPHKFKNLKLLFELDLSNNRFAGKFPRVVLKLPELKFLDLRFNEFEGTV  223

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   +LPENFGNS  SVIVLANNKF GCVP SIG M + + +I
Sbjct  224   PKELFDKDLDAIFINHNRFRFDLPENFGNSPVSVIVLANNKFHGCVPGSIGNMTR-LNEI  282

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN F  CLP EI  L N+TVFDV  N+  G+LP  +G M SLE  + A N  SG +P
Sbjct  283   ILMNNGFRSCLPPEIGFLKNLTVFDVSHNEFFGKLPDTIGGMVSLEQLNVAHNFLSGKIP  342

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             D +C LPNL+N ++S N+F  E  SCL L D    DD  NC+ +RP Q+  ++C  +LSK
Sbjct  343   DSICKLPNLQNFTYSYNFFTGEAPSCLALPD---FDDRRNCIPDRPVQRSERQCKSFLSK  399

Query  162   PVDCSKTGC  136
             PVDCS  GC
Sbjct  400   PVDCSSFGC  408



>ref|XP_010664614.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1, partial [Vitis vinifera]
Length=514

 Score =   412 bits (1058),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 194/367 (53%), Positives = 258/367 (70%), Gaps = 2/367 (1%)
 Frame = -3

Query  1233  DADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPK  1054
             D +A  IA RQLL    + D   + FE+++DL + FAN R ++AY+ALQAWK A+YSDP 
Sbjct  27    DEEASLIAHRQLLAIPKDGDLPND-FEYEVDLVVAFANARLRQAYIALQAWKHAMYSDPF  85

Query  1053  GITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHM  874
               T NW G NVC+Y GVFC  ALD+P   VVAG+D+NH+DIAG+LP E+GL+TDLAL H+
Sbjct  86    NTTSNWEGANVCAYKGVFCAPALDNPKLSVVAGVDLNHADIAGYLPVELGLMTDLALFHI  145

Query  873   NSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPS  694
             NSNR CGI+PK+ S L +L E+D SNN  VGPFP V+L +P+L+YLDLRYN FEG LPP 
Sbjct  146   NSNRFCGIIPKSFSRLTILHELDVSNNRFVGPFPAVVLSIPALRYLDLRYNEFEGELPPE  205

Query  693   LFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLL  514
             LFDKDLD + +N+NR  SN+PE  G+S ASVIV A NKF+GC+P SIG+M  ++ +I+  
Sbjct  206   LFDKDLDALFVNHNRFTSNIPETLGHSRASVIVFAGNKFTGCIPRSIGQMGNTLNEIIFA  265

Query  513   NNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGL  334
             +N+ SGCLP EI +L N+TVFD   N   G LPK    ++ +E  + A N  +G V D +
Sbjct  266   SNDMSGCLPTEIGMLRNLTVFDAASNSFTGILPKSFNGLKQIEHLNVAHNTLTGFVSDSI  325

Query  333   CSLPNLKNLSFSGNYFEMEDESC-LPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             C+L +L N +FS NYF+ E ++C  P +  + +DD+ NC+ +RP QK    C   +S+PV
Sbjct  326   CNLSSLSNFTFSYNYFKGEAKACEPPSRTDITLDDTSNCLPDRPKQKSAATCNPVVSRPV  385

Query  156   DCSKTGC  136
             DCSK  C
Sbjct  386   DCSKAKC  392



>ref|XP_009419628.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Musa acuminata subsp. malaccensis]
Length=678

 Score =   416 bits (1070),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 205/371 (55%), Positives = 257/371 (69%), Gaps = 3/371 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +DA+A  IARRQLL          + FE ++++ +  +N R + +YVALQAWK AIYS
Sbjct  26    ALSDAEAAAIARRQLLALPENGQLPDD-FEFEIEIGIRISNPRLRSSYVALQAWKTAIYS  84

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC YNG+FC  A DDP+  VVAG D+N +DIAG LP E+GLLTD+AL
Sbjct  85    DPHNFTANWDGPDVCGYNGIFCSPAPDDPSLNVVAGADLNGADIAGFLPAELGLLTDVAL  144

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+ S+LKLL E D SNN  VGPFPDV+L LPSLKYLDLR+NNFEGAL
Sbjct  145   FHINSNRFCGIIPKSFSHLKLLHEFDASNNRFVGPFPDVVLGLPSLKYLDLRFNNFEGAL  204

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LFD+DLD I LNNNR  S++P NFGNS ASVIVLANNK  GC+P+SIG M  ++ ++
Sbjct  205   PPVLFDRDLDAIFLNNNRFSSHIPNNFGNSKASVIVLANNKLGGCIPASIGDMGATLNEL  264

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +LLNN   GCLP EI  L N TV DV  N L G L K    +  +E    + N+ +G VP
Sbjct  265   VLLNNGLDGCLPPEIGSLGNTTVVDVSWNSLTGVLSKSFDGLTKVEQLDLSHNVLTGVVP  324

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
              GLC LP+L N +FS N+F+ E + C+P   K  V  DD+ NC+  RP QK  + C   +
Sbjct  325   AGLCRLPSLANFTFSYNFFKGEADECVPTSTKSDVVFDDTSNCLARRPTQKSGEMCAPVV  384

Query  168   SKPVDCSKTGC  136
             S+PVDC ++ C
Sbjct  385   SRPVDCGRSKC  395



>ref|XP_011005677.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Populus euphratica]
Length=799

 Score =   420 bits (1079),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 261/370 (71%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  IARRQLL      +   E FE+++D+K+ FAN R ++AY+ LQAWK AIYS
Sbjct  27    ALTDAEASYIARRQLLTLNENSELPHE-FEYEVDVKITFANQRLRRAYIGLQAWKKAIYS  85

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T +WVG NVC+YNGVFC  ALDDP+  VVAG+D+N +DIAGHLP E+GL+TD+AL
Sbjct  86    DPFNTTGDWVGANVCAYNGVFCAPALDDPSLSVVAGVDLNGADIAGHLPAELGLMTDVAL  145

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+ S L L++E D SNN  VG FP V+L  PSLKYLD+R+N+FEG L
Sbjct  146   FHINSNRFCGIIPKSFSKLTLMYEFDVSNNRFVGDFPSVVLSWPSLKYLDVRFNDFEGGL  205

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF+K+LD + LN+NR  S +PE  GNST SV+  ANNKF+GC+P S+G+M  ++ ++
Sbjct  206   PPELFNKELDALFLNDNRFTSTIPETIGNSTVSVVTFANNKFTGCIPHSVGKM-ANLNEV  264

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N+  GC P EI LL N+TVFD   N   G LP     ++ +E    A N  +G VP
Sbjct  265   IFMGNDLGGCFPAEIGLLGNVTVFDASHNGFTGILPPSFAGLKKVELLDLADNKLTGFVP  324

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPL-KDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP+L N +FS NYF+ E ++C+P  +  + +DD+ NC+ +RP QK  + CY  +S
Sbjct  325   ENICKLPSLTNFTFSYNYFKGEAQACVPPSRKDIVLDDTSNCLSDRPKQKSARTCYPVVS  384

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  385   RPVDCSKDKC  394



>ref|XP_011001177.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Populus euphratica]
Length=830

 Score =   419 bits (1078),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 261/370 (71%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  IARRQLL      +   E FE+++D+K+ FAN R ++AY+ LQAWK AIYS
Sbjct  27    ALTDAEASYIARRQLLTLNENSELPHE-FEYEVDVKITFANQRLRRAYIGLQAWKKAIYS  85

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T +WVG NVC+YNGVFC  ALDDP+  VVAG+D+N +DIAGHLP E+GL+TD+AL
Sbjct  86    DPFNTTGDWVGANVCAYNGVFCAPALDDPSLSVVAGVDLNGADIAGHLPAELGLMTDVAL  145

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+ S L L++E D SNN  VG FP V+L  PSLKYLD+R+N+FEG L
Sbjct  146   FHINSNRFCGIIPKSFSKLTLMYEFDVSNNRFVGDFPSVVLSWPSLKYLDVRFNDFEGGL  205

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF+K+LD + LN+NR  S +PE  GNST SV+  ANNKF+GC+P S+G+M  ++ ++
Sbjct  206   PPELFNKELDALFLNDNRFTSTIPETIGNSTVSVVTFANNKFTGCIPHSVGKM-ANLNEV  264

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N+  GC P EI LL N+TVFD   N   G LP     ++ +E    A N  +G VP
Sbjct  265   IFMGNDLGGCFPAEIGLLGNVTVFDASHNGFTGILPPSFAGLKKVELLDLADNKLTGFVP  324

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPL-KDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP+L N +FS NYF+ E ++C+P  +  + +DD+ NC+ +RP QK  + CY  +S
Sbjct  325   ENICKLPSLTNFTFSYNYFKGEAQACVPPSRKDIVLDDTSNCLSDRPKQKSARTCYPVVS  384

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  385   RPVDCSKDKC  394



>ref|XP_010096273.1| Pollen-specific leucine-rich repeat extensin-like protein 3 [Morus 
notabilis]
 gb|EXB63668.1| Pollen-specific leucine-rich repeat extensin-like protein 3 [Morus 
notabilis]
Length=845

 Score =   420 bits (1079),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 205/367 (56%), Positives = 252/367 (69%), Gaps = 2/367 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+   IARRQLL    E       FE++ DL + FAN+R +KAY+ LQA KDAIYS
Sbjct  32    ALTDAEVSFIARRQLLTMPTENGDLPNDFEYEFDLVITFANERLRKAYIGLQALKDAIYS  91

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW G NVC+YNGVFC  ALDDP   VVAG+D+NH+DIAGHLP E+GLLTD+AL
Sbjct  92    DPYNFTGNWAGANVCAYNGVFCAPALDDPKLSVVAGVDLNHADIAGHLPAELGLLTDVAL  151

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P++   L L+ E D SNN  VGPFP V+L+ PS+KYLDLRYN+FEG +
Sbjct  152   FHLNSNRFCGIIPESFKKLVLMHEFDVSNNRFVGPFPKVVLKWPSVKYLDLRYNDFEGEI  211

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF K LD I LNNNR +S +P++ GNST SV+  ANNKF+GC+P +IG M  ++ +I
Sbjct  212   PSELFVKQLDAIFLNNNRFKSKIPDSLGNSTVSVVTFANNKFNGCIPRTIGNM-PNLNEI  270

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + LNNE  GC P EI LL N+ VFD   N  VG LPK    ++SLE    A N  +G V 
Sbjct  271   IFLNNELGGCFPPEIGLLGNMMVFDASDNDFVGTLPKSFTGLKSLEEIDIANNKLTGFVS  330

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
               LC+LP L N +FS NYF  EDESC+P  K  V  DD  NC+  RP QK  + C+  ++
Sbjct  331   KSLCTLPKLANFTFSFNYFIKEDESCVPSSKSNVVFDDESNCLSGRPKQKSARTCFPVVT  390

Query  165   KPVDCSK  145
             KPVDCSK
Sbjct  391   KPVDCSK  397



>ref|XP_007214112.1| hypothetical protein PRUPE_ppa017121mg, partial [Prunus persica]
 gb|EMJ15311.1| hypothetical protein PRUPE_ppa017121mg, partial [Prunus persica]
Length=767

 Score =   417 bits (1072),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 200/370 (54%), Positives = 260/370 (70%), Gaps = 2/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A T+A+A +IARRQLL      D   + +E +++L L F N R ++AY+ALQAWK AIYS
Sbjct  23    ALTNAEASSIARRQLLALPEGGDLP-DHYEFEVELNLNFPNTRLRRAYIALQAWKKAIYS  81

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T+NWVG NVCSY GVFC  ALDDP   VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  82    DPLKTTENWVGANVCSYTGVFCAKALDDPELEVVAGIDLNHADIAGYLPVELGLLTDIAL  141

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+ S L LL E D SNN  VG FP+V+L +P+LKYLDLR+NNFEG L
Sbjct  142   FHINSNRFCGIIPKSFSRLTLLHEFDVSNNRFVGSFPEVVLHIPNLKYLDLRFNNFEGKL  201

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF+K LD + LN+NR  S +P+  GNS  SV+V+ANN   GC+P+SIG+M  ++ +I
Sbjct  202   PPELFNKKLDGLFLNDNRFTSTIPDTLGNSPVSVLVVANNDLEGCIPNSIGKMVNTLNEI  261

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L NN+F+GCLP EI  LS +TVFD+  N   G L K    ++ LE    + NM +G VP
Sbjct  262   ILSNNKFAGCLPPEIGYLSKVTVFDISSNTFSGILSKTFKGLEKLEEVDISHNMLTGFVP  321

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C+LPNL N +FS N+F  E + C+P  +  V  DD  NC+ +RP QK  ++C   +S
Sbjct  322   ESICTLPNLVNFTFSYNFFNGETQECVPSSRKNVVFDDISNCLPDRPQQKSAKECQVVVS  381

Query  165   KPVDCSKTGC  136
             KPVDC K  C
Sbjct  382   KPVDCGKAKC  391



>ref|XP_009402787.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1, partial [Musa acuminata subsp. malaccensis]
Length=813

 Score =   418 bits (1075),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 199/370 (54%), Positives = 262/370 (71%), Gaps = 2/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A ++A+A  IARRQLL  +   D   + FE  + + L+FAN R ++AY+ALQAW+ A+YS
Sbjct  23    ALSNAEAAWIARRQLLALSRGGDLPDD-FEFDIKIDLDFANARLRRAYIALQAWRHAMYS  81

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVG +VCSYNGVFC  ALD+P   VVAG+D+N +DIAGHLP E+GLLTD AL
Sbjct  82    DPFNFTGNWVGRDVCSYNGVFCSPALDNPNIAVVAGVDLNGADIAGHLPIELGLLTDAAL  141

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             IH+NSNR CGI+PK+ S L+LL E+D SNN  VGPFP V++ LPSL+Y+DLR+N+FEG L
Sbjct  142   IHINSNRFCGIIPKSFSRLQLLHELDVSNNRFVGPFPMVLVGLPSLRYIDLRFNDFEGPL  201

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LFDK LD I LN+NR  S +P+NFGNSTAS++VLANN   GC+PSS G+M  ++ ++
Sbjct  202   PPELFDKALDAIFLNDNRFSSPIPDNFGNSTASIVVLANNNLGGCIPSSAGKMGATLNEL  261

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +LLNN   GCLP EI LL N+TVFD   N L G LP     +  +E    + N+ +G VP
Sbjct  262   VLLNNGLVGCLPVEIGLLGNVTVFDASSNSLTGTLPTSFAALSKVEELDLSHNVLTGIVP  321

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + LC LP+L N +FS NYF+ E   C+      +  +D+ NC+ +RPGQK  + C+  ++
Sbjct  322   EKLCRLPSLANFTFSYNYFKGEAGECVSSSSSDIVFEDTGNCLEKRPGQKSTKTCFPVMT  381

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  382   RPVDCSKDKC  391



>gb|KFK39231.1| hypothetical protein AALP_AA3G216900 [Arabis alpina]
Length=919

 Score =   421 bits (1082),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 201/370 (54%), Positives = 259/370 (70%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + RRQLL  +   D   +  E+++DL L+FAN+R K+AY+ALQAWK A YS
Sbjct  24    AITDEEASLLTRRQLLALSENGDLPDD-MEYEVDLNLKFANNRLKRAYIALQAWKKAFYS  82

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP     NWVG NVCSY GVFC  ALDDP+  VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  83    DPFNTAGNWVGSNVCSYKGVFCAPALDDPSIMVVAGIDLNHADIAGYLPPELGLLTDVAL  142

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK++S L L++E D SNN  VGPFP V L  PSLK+LD+RYN+FEG L
Sbjct  143   FHINSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGPFPTVSLSWPSLKFLDIRYNDFEGKL  202

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +FDKDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  203   PPEIFDKDLDAIFLNNNRFESLIPETIGKSTASVVTFAHNKFSGCIPKTIGQM-KNLNEI  261

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGC P EI  L+N+TVFD   N  VG LP  L  + ++E   F+ N  +G V 
Sbjct  262   VFIGNNLSGCFPNEIGKLNNVTVFDASHNGFVGSLPSSLSGLANVEQMDFSYNKLTGFVT  321

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPL-KDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             DG+C LP L N +FS N+F  E +SC+P        DD+ NC+  RP QK  ++C   +S
Sbjct  322   DGVCKLPKLSNFTFSYNFFNGEAQSCVPGNSQETQFDDTSNCLQNRPKQKSAKECLPVVS  381

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  382   RPVDCSKDKC  391



>ref|XP_010254179.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=764

 Score =   417 bits (1071),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 205/369 (56%), Positives = 254/369 (69%), Gaps = 5/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I +RQLL++  E  F   G   ++D  L F N RQK AY+ALQAWK AI S
Sbjct  45    GLTDAEARYIQQRQLLYYRDE--FCDRGEHVRVDPSLVFENPRQKNAYIALQAWKQAIIS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG NVC+Y GVFC  ALDDP+   VAGID+NH DIAG+LP E+GLLTD+AL
Sbjct  103   DPLNLTSNWVGSNVCNYTGVFCTSALDDPSIKTVAGIDLNHGDIAGYLPEELGLLTDIAL  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP    NLKLLFE+D SNN   G FP+V+L LP LKYLD+R+N FEG +
Sbjct  163   FHINSNRFCGTVPHKFVNLKLLFELDLSNNRFAGKFPEVVLRLPKLKYLDIRFNEFEGKV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   +LP+N GNS  SVIVLANNKF GCVP+S+G M +++ +I
Sbjct  223   PRELFDKDLDAIFINHNRFAFDLPDNLGNSPVSVIVLANNKFHGCVPASLGNMSKTLNEI  282

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+ N F  C+P EI LL  +TV D+  N+L+G LP  +G M SLE  + A NM SG +P
Sbjct  283   ILMKNGFRSCVPTEIGLLKELTVLDLSFNQLMGPLPDTIGGMLSLEQLNVAHNMLSGTIP  342

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +CSLPNLKN ++S NYF  E   CL L D    DD  NC+ ERP Q+   +C  +LS+
Sbjct  343   AKICSLPNLKNFTYSYNYFTGEPPVCLSLPD---FDDQKNCLPERPAQRSASQCKSFLSR  399

Query  162   PVDCSKTGC  136
             PV CS   C
Sbjct  400   PVHCSAFRC  408



>ref|XP_007136648.1| hypothetical protein PHAVU_009G062000g [Phaseolus vulgaris]
 gb|ESW08642.1| hypothetical protein PHAVU_009G062000g [Phaseolus vulgaris]
Length=634

 Score =   412 bits (1059),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 195/369 (53%), Positives = 257/369 (70%), Gaps = 2/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A  IARRQL+H     D     +        +F+N R K AY+AL+AWK AIYS
Sbjct  23    ALSDVEASFIARRQLMHLNENEDLPS-NYVSNYKTNFKFSNSRLKSAYIALEAWKKAIYS  81

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW G +VCSYNGVFC+ ALDDP   VVAGID+N++DIAG++P E+GLL DLAL
Sbjct  82    DPSNFTSNWSGQDVCSYNGVFCEKALDDPKIEVVAGIDLNNADIAGYIPPEVGLLVDLAL  141

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             +H+NSNR CGI+P + SNLK+L+E+D SNN  VG FP+ +L +P LK+LD+R+N+FEG L
Sbjct  142   LHINSNRFCGIIPHSFSNLKILYELDISNNRFVGQFPETVLSIPDLKFLDIRFNDFEGEL  201

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF+K  D I LNNNR  S +P+N G++ A+V+V+ANN  SGCVP+SIG M +S+ + 
Sbjct  202   PSDLFEKSFDAIFLNNNRFTSTIPQNLGSTPATVVVMANNNLSGCVPASIGDM-KSLNEF  260

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN   GCLP EI  L  ++VFD+  N  VG LPK L  ++++E  S + N F+G VP
Sbjct  261   ILINNNLMGCLPTEIGNLEKVSVFDISNNNFVGVLPKTLNGLKNVEHLSISHNKFTGFVP  320

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +CSLP+L N +FS NYF  E+E C P K   A+DD +NC+ +RP QK    C E +SK
Sbjct  321   RNVCSLPHLMNFTFSDNYFNGEEEGCSPQKKEPALDDENNCIPDRPKQKQSNACNEVISK  380

Query  162   PVDCSKTGC  136
             PVDCSK  C
Sbjct  381   PVDCSKDKC  389



>ref|XP_008225416.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Prunus mume]
Length=777

 Score =   416 bits (1070),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 201/370 (54%), Positives = 261/370 (71%), Gaps = 2/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A +IARRQLL      D   + +E +++L L F N R ++AY+ALQAWK A+YS
Sbjct  23    ALTDAEASSIARRQLLALPEGGDLP-DHYEFEVELNLNFPNTRLRRAYIALQAWKKAMYS  81

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T+NWVG NVCSY GVFC  ALDDP   VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  82    DPLKTTENWVGANVCSYTGVFCAKALDDPELEVVAGIDLNHADIAGYLPVELGLLTDIAL  141

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+ S L LL E D SNN  VG FP+V+L +P+LKYLDLR+NNFEG L
Sbjct  142   FHINSNRFCGIIPKSFSRLTLLHEFDVSNNRFVGSFPEVVLHIPNLKYLDLRFNNFEGKL  201

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF+K LD + LN+NR  S +P+  GNS  SV+V+ANN   GC+P+SIG+M  ++ +I
Sbjct  202   PPELFNKKLDGLFLNDNRFTSTIPDTLGNSPVSVLVVANNDLEGCIPNSIGKMVNTLNEI  261

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L NN+F+GCLP EI  LS +TVFD++ N   G L K    ++ LE    + NM +G VP
Sbjct  262   ILSNNKFAGCLPPEIGYLSKVTVFDIRSNTFSGILSKTFKGLEKLEEVDISHNMLTGFVP  321

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV-DDSDNCVLERPGQKLPQKCYEYLS  166
             + +C+LPNL N +FS N+F  E + C+P     AV DD  NC+ +RP QK  ++C   +S
Sbjct  322   ESICTLPNLVNFTFSYNFFNGETQECVPSSRKNAVFDDISNCLPDRPQQKSAKECQVVVS  381

Query  165   KPVDCSKTGC  136
             KPVDC K  C
Sbjct  382   KPVDCGKAKC  391



>ref|XP_008225431.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Prunus mume]
Length=934

 Score =   421 bits (1081),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/370 (53%), Positives = 266/370 (72%), Gaps = 2/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  +A RQLLHF A  D  G+  E++++L L+F + R + AYVALQAWK AIYS
Sbjct  22    ALTDAEASFVAHRQLLHFHASYDLRGD-HEYEVELNLKFPHPRLRSAYVALQAWKKAIYS  80

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T+NWVG NVC+Y GVFC  ALDDP   VVAGIDINH+DIAG+LP E+G+L+D+A+
Sbjct  81    DPLKTTENWVGANVCAYTGVFCAPALDDPQLEVVAGIDINHADIAGYLPVELGMLSDIAV  140

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+N+NR CGI+PK+ + L LL E+D SNN  VG FP+V+L++P+LKYLDLR+N+FEG L
Sbjct  141   FHINTNRFCGIIPKSFARLTLLHELDVSNNRFVGSFPEVVLQIPNLKYLDLRFNDFEGKL  200

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF+K+LD + LNNNR  S +P+  GNS  SV+V+ANN   GC+P+SIG+M  ++ + 
Sbjct  201   PPELFNKELDALFLNNNRFTSTIPDTLGNSPISVLVVANNHLEGCIPNSIGKMVNNLNEA  260

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N+F+GCLP EI  LSN+TVFDV  N L G L K    ++ +E  + A NM +G VP
Sbjct  261   IFSHNKFAGCLPPEIGYLSNVTVFDVSSNTLSGLLSKTFKGLEKVEELNIAHNMLTGFVP  320

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + LC LP+L N +FS NYF  ED+ C+P  +     DD+ NC+ +RP QK  ++C   ++
Sbjct  321   ESLCKLPSLGNFTFSYNYFNGEDQKCVPSSRMDTLFDDTSNCLPDRPKQKSAKQCQVVVN  380

Query  165   KPVDCSKTGC  136
             KPVDC +  C
Sbjct  381   KPVDCGRAKC  390



>ref|XP_009405471.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Musa acuminata subsp. malaccensis]
Length=502

 Score =   407 bits (1046),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/371 (53%), Positives = 259/371 (70%), Gaps = 7/371 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A ++ +A +I  RQLL  + + D S +      ++ +  AN R  +AY+AL+AWK A+YS
Sbjct  26    ALSNVEAASIIHRQLLALSKKEDLSDD-----FEIDVNIANPRLHRAYIALRAWKKAMYS  80

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW+GP+VCSY+GVFC  A DDP+  VVAG+D+N +DIAG+LP E+G LTD AL
Sbjct  81    DPYNFTDNWIGPDVCSYHGVFCTTAPDDPSINVVAGVDLNSADIAGYLPAELGHLTDAAL  140

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             +H+NSNR CGI+P+ IS+LKLL+E D SNN  VGPFPDV+L LPSLKYLDLR+N+FEGAL
Sbjct  141   LHINSNRFCGIIPQNISHLKLLYEFDVSNNRFVGPFPDVVLRLPSLKYLDLRFNDFEGAL  200

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LFDK+LD I LN+N   S +P NFGNS ASVIV+ANNK  GC+P+SIG+M  ++ ++
Sbjct  201   PSALFDKELDAIFLNDNHFSSQMPYNFGNSKASVIVIANNKIRGCIPNSIGKMAATLNEL  260

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN  SGCLP EI LL N TV D+  N   G L K L  +  +E    + NM +G VP
Sbjct  261   VLMNNVLSGCLPPEIGLLRNATVVDLSWNSFAGVLSKSLEGLTKVEQLDVSHNMLTGVVP  320

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPL--KDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
               LC +PNL N  FS N+F+ E E C+P+  K    V+D  NC+ +RP QK  + C   +
Sbjct  321   GTLCRMPNLVNFHFSYNFFKGEAEECVPMSTKSTAVVEDKSNCLADRPAQKSAKMCAPVV  380

Query  168   SKPVDCSKTGC  136
             S+PVDC ++ C
Sbjct  381   SRPVDCGRSKC  391



>ref|XP_010251729.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nelumbo nucifera]
Length=692

 Score =   413 bits (1062),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 261/370 (71%), Gaps = 2/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A T+A+   I +RQLL      D   + +E+++++ + F N R ++AY+ALQAWK A+YS
Sbjct  24    ALTEAETSYITQRQLLSLPENGDLPDD-YEYEVNINITFPNARLRRAYIALQAWKKAMYS  82

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG +VC+Y GVFC +ALD+P   VVAGID+N+ DIAG LP E+GLL D+AL
Sbjct  83    DPHNVTGNWVGADVCNYTGVFCANALDEPKLTVVAGIDLNNEDIAGFLPVELGLLRDIAL  142

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P + S L +L E+D SNN  VGPFP  +L +P+LKYLD+RYN+FEG L
Sbjct  143   FHINSNRFCGIIPNSFSKLTILHELDVSNNRFVGPFPRAVLSIPALKYLDIRYNDFEGRL  202

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LFDKDLD + LN+NRLE N+PEN GNS ASVIV A+N+F+GC+P SIG+M +++ +I
Sbjct  203   PPELFDKDLDAVFLNHNRLEGNIPENIGNSPASVIVFADNRFTGCIPRSIGKMGKTLNEI  262

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + LNN  +GCLP EI LL N+TVF    N  VG LPK +  M+S+E    + NM +G V 
Sbjct  263   VFLNNNLTGCLPPEIGLLENVTVFAAASNSFVGLLPKSISEMKSVEYLDISYNMLTGFVT  322

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV-DDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP+L N +FS NYF  E+  C+P K   A+ DD+ NC+ +RPGQK    C   ++
Sbjct  323   ENICRLPSLVNFTFSYNYFNGEEAGCMPSKRTDAILDDTSNCLPDRPGQKTASLCIPVVN  382

Query  165   KPVDCSKTGC  136
             + VDC K  C
Sbjct  383   RQVDCGKALC  392



>ref|XP_010647882.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1, partial [Vitis vinifera]
Length=719

 Score =   414 bits (1063),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/367 (53%), Positives = 260/367 (71%), Gaps = 2/367 (1%)
 Frame = -3

Query  1233  DADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPK  1054
             DA+A  IARRQLL    + D   + FE+++DL + FAN R ++AY+ALQAWK+A+YSDP 
Sbjct  32    DAEASLIARRQLLSLPEDGDLPDD-FEYEIDLVVTFANSRLRRAYIALQAWKNAMYSDPF  90

Query  1053  GITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHM  874
               T NWVG NVC+YNGVFC  ALDD    VVAG+DINH+DIAG+LP E+GL+TDLAL H+
Sbjct  91    NTTGNWVGANVCAYNGVFCAPALDDSNLSVVAGVDINHADIAGYLPAELGLMTDLALFHI  150

Query  873   NSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPS  694
             NSNR CGI+PK+ S L L+ E D SNN  VGPFP V+L LP+L+YLD+R+N+FEG+LP  
Sbjct  151   NSNRFCGIIPKSFSRLLLMHEFDISNNRFVGPFPTVVLSLPALRYLDIRFNDFEGSLPEE  210

Query  693   LFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLL  514
             +F+K+LD + +N+NR   ++PE  G STASV+V ANNK +GC+P SIG+M  ++ +I+  
Sbjct  211   VFEKELDALFVNDNRFTGSIPETLGQSTASVVVFANNKLTGCIPKSIGKMANTLNEIVFS  270

Query  513   NNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGL  334
             NN+F GCLP EI +L N TVF    N   G L K    ++ +E    + N  +G VPDG+
Sbjct  271   NNDFGGCLPTEIGMLGNATVFAAGSNSFTGVLLKSFSGLKKVEHLDVSHNTLTGFVPDGI  330

Query  333   CSLPNLKNLSFSGNYFEMEDESCL-PLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             C LP+L N +FS N+F+ E  SC  P +  + +DD+ NC+ +RP QK  + C   +S+PV
Sbjct  331   CKLPSLSNFTFSYNFFKGEAPSCQPPSRADITLDDTSNCLSDRPKQKSARTCLPVVSRPV  390

Query  156   DCSKTGC  136
             DCSK+ C
Sbjct  391   DCSKSKC  397



>ref|XP_010104364.1| Pollen-specific leucine-rich repeat extensin-like protein 1 [Morus 
notabilis]
 gb|EXB99784.1| Pollen-specific leucine-rich repeat extensin-like protein 1 [Morus 
notabilis]
Length=939

 Score =   419 bits (1077),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 204/371 (55%), Positives = 261/371 (70%), Gaps = 3/371 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDL-KLEFANDRQKKAYVALQAWKDAIY  1066
             A TDA+A +I RRQLL      D   + +E+K+DL  L F+N R K+AY+ALQAWK AIY
Sbjct  81    ALTDAEASSIVRRQLLTLHQHGDLPDD-YEYKVDLGNLTFSNSRLKRAYIALQAWKKAIY  139

Query  1065  SDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLA  886
             SDP  IT  WVG +VCSYNGVFC  ALD+PT  VVAGIDINH DIAG+LP E+GLLT++A
Sbjct  140   SDPLNITGGWVGTDVCSYNGVFCAPALDEPTLEVVAGIDINHGDIAGYLPVELGLLTEIA  199

Query  885   LIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGA  706
             L H+NSNR CG++P++ S L LL E+D SNN  VGPFP V+L +P+LKYLDLRYN+FEG 
Sbjct  200   LFHINSNRFCGVIPESFSRLTLLHELDVSNNRFVGPFPKVVLSIPNLKYLDLRYNDFEGI  259

Query  705   LPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQ  526
             LPP LF+KDLD + LNNNR  S +PEN GNS  SV+V+ANN F GC+P SIG+M  ++ +
Sbjct  260   LPPELFNKDLDALFLNNNRFTSTIPENLGNSPVSVLVIANNHFHGCLPKSIGKMGNTLNE  319

Query  525   ILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHV  346
             I++ NN   GCLP EI  L N+TV D+  N   G LPK    +  +E    A N  +G V
Sbjct  320   IIVSNNNLVGCLPMEIGNLGNLTVLDISSNSFGGILPKTFKSLHKVEQLVLAQNTLTGFV  379

Query  345   PDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSDNCVLERPGQKLPQKCYEYL  169
              + +C LP+L NL+FS NYF  E + C P K+  + +DD+ NC+ +RP QK  ++C   +
Sbjct  380   QESICELPSLMNLTFSYNYFNGEAQECEPSKNKNIVLDDTSNCLPDRPKQKAAKQCKVVV  439

Query  168   SKPVDCSKTGC  136
             +KPVDCSK  C
Sbjct  440   NKPVDCSKAKC  450



>ref|XP_008775577.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific leucine-rich 
repeat extensin-like protein 3 [Phoenix dactylifera]
Length=714

 Score =   412 bits (1060),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 197/369 (53%), Positives = 263/369 (71%), Gaps = 2/369 (1%)
 Frame = -3

Query  1233  DADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPK  1054
             DA+A  IA RQLL      D   + FE  + + +  AN R ++AY+ALQAWK AIYSDP 
Sbjct  29    DAEAAFIAHRQLLTLRENGDLPDD-FEFDIKIGVRIANPRLRRAYIALQAWKKAIYSDPL  87

Query  1053  GITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHM  874
               T NWVGP VC+YNGVFC  ALDDP   VVAG+D+N +DIAG+LP E+GLL D+A+ H+
Sbjct  88    NFTGNWVGPEVCTYNGVFCSKALDDPNVTVVAGVDLNGADIAGYLPVELGLLNDIAIFHI  147

Query  873   NSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPS  694
             NSNR CG++PK+ S L LL E+D SNN  VG FP V++ LP+LKYLDLR+N+FEG +P  
Sbjct  148   NSNRFCGVIPKSFSRLALLHELDVSNNRFVGSFPMVVIGLPNLKYLDLRFNDFEGPIPSE  207

Query  693   LFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLL  514
             LFDK+LD I LN+NR  S++PENFGNSTASVIVLANNK  GC+P+S+GRM  ++ +++L+
Sbjct  208   LFDKELDAIFLNDNRFNSHIPENFGNSTASVIVLANNKLGGCIPTSVGRMGATLNEMVLM  267

Query  513   NNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGL  334
             NN   GCLP EI  L++ TVFD   N L+G LPK    +  +E+  F+ N+ +G VP+ L
Sbjct  268   NNGLVGCLPWEIGSLASATVFDASWNSLIGVLPKSFVGLTKVEALDFSHNILTGIVPESL  327

Query  333   CSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             C LP+L NL+FS N+F+ E + C+P  +  +  DD +NC+ +RP QK  + C   +++PV
Sbjct  328   CRLPSLINLTFSYNFFKGEAKECMPGARSDIVFDDINNCLPKRPKQKSARMCAPIVNRPV  387

Query  156   DCSKTGCRA  130
             DCS+  CRA
Sbjct  388   DCSRFKCRA  396



>ref|XP_010932003.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Elaeis guineensis]
Length=722

 Score =   412 bits (1060),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 198/372 (53%), Positives = 260/372 (70%), Gaps = 2/372 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A ++A+A  I RRQLL      D   + FE  + + + FAN   ++AY+ALQAWK AIYS
Sbjct  27    ALSNAEAAFITRRQLLALPENGDLPDD-FEFDIKIGIHFANPHLRRAYIALQAWKHAIYS  85

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVGP VC+YNGVFC  ALDDP   VVAG+D+N +DIAG+LP E+GLLTD+A+
Sbjct  86    DPLNFTNNWVGPEVCTYNGVFCSQALDDPNVTVVAGVDLNGADIAGYLPVELGLLTDIAI  145

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+ S L LL E+D SNN  VG FP V++ LP+LKYLDLR+N+FEG L
Sbjct  146   FHINSNRFCGIIPKSFSRLTLLHELDVSNNRFVGSFPMVVIGLPNLKYLDLRFNDFEGPL  205

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LFDK+LD I +N+NR  S++PENFGNSTASVIVLANNK  GCVP+S+GRM  ++ ++
Sbjct  206   PPELFDKELDAIFVNDNRFNSHIPENFGNSTASVIVLANNKLGGCVPTSVGRMGATLNEM  265

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN   GCLP EI  L N TVFD   N L+G LPK    +  +E    + N+ +G V 
Sbjct  266   ILMNNALVGCLPWEIGSLGNATVFDASWNSLIGVLPKNFAGLVKVEELDLSHNILTGVVS  325

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + LC LP+L N +FS N+F+   E C+   +     DD +NC+ +RP QK  + C   ++
Sbjct  326   ESLCRLPSLVNFTFSYNFFKGAAEECMSGSRSDTVFDDINNCLFKRPKQKSARMCAPIVN  385

Query  165   KPVDCSKTGCRA  130
             +PVDCS++ CRA
Sbjct  386   RPVDCSRSKCRA  397



>ref|XP_007013716.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY31335.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=614

 Score =   409 bits (1051),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 209/399 (52%), Positives = 272/399 (68%), Gaps = 8/399 (2%)
 Frame = -3

Query  1329  ITAKFLSIIMAAVGClvflsllsfssisLAFTDADAENIARRQLLHFAAEVDFSGEGFEH  1150
             I A F+S I+ +         +S SS + A TD+ A  I +RQL+++  +   SG  F+ 
Sbjct  8     ILASFVSFILISF---TTAHKISTSSHATALTDSQASFIKQRQLIYYREQFG-SGGKFD-  62

Query  1149  KLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQ  970
              +  +L F N R + AYVALQAWK AI SDP  +T NWVG +VC+Y GVFC  ALDDP+ 
Sbjct  63    SVPSQLTFDNSRLRSAYVALQAWKQAIISDPLNLTSNWVGSDVCNYTGVFCSPALDDPSI  122

Query  969   WVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNW  790
               VAGID+NH D+AG+LP E+GLLTD+AL H+NSNR CG VP +   LK LFE+D SNN 
Sbjct  123   QTVAGIDLNHGDLAGYLPEELGLLTDIALFHINSNRFCGKVPWSFKKLKHLFELDLSNNH  182

Query  789   LVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNST  610
               G FP V+L LPSLK+LDLR+N FEG +P +LFDKDLD I +N+NR    LP+N GNS 
Sbjct  183   FAGKFPYVVLRLPSLKFLDLRFNEFEGKVPEALFDKDLDAIFINHNRFAFELPDNLGNSP  242

Query  609   ASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKL  430
              SVIVLANN+F GC+P S+G M +++ +++L+NN    C P+EI LL N+TVFDV  NKL
Sbjct  243   VSVIVLANNRFHGCLPMSLGNMSKTLNEVILMNNGLHSCFPKEIGLLKNLTVFDVSYNKL  302

Query  429   VGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD  250
             +GELP  +G M SLE  + A NMFSG +P+ +CSLPNL+N SF+ N+F  E   CL L++
Sbjct  303   MGELPDSIGEMVSLEQLNVAHNMFSGTIPESVCSLPNLRNFSFAYNFFTGEPPVCLALEE  362

Query  249   GVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCR  133
                 DD  NC+  RP Q+   +C  +LS+PVDCS   CR
Sbjct  363   ---FDDRRNCLRGRPVQRSRLQCKVFLSRPVDCSVIKCR  398



>emb|CBI32495.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   414 bits (1063),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 193/367 (53%), Positives = 260/367 (71%), Gaps = 2/367 (1%)
 Frame = -3

Query  1233  DADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPK  1054
             DA+A  IARRQLL    + D   + FE+++DL + FAN R ++AY+ALQAWK+A+YSDP 
Sbjct  32    DAEASLIARRQLLSLPEDGDLPDD-FEYEIDLVVTFANSRLRRAYIALQAWKNAMYSDPF  90

Query  1053  GITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHM  874
               T NWVG NVC+YNGVFC  ALDD    VVAG+DINH+DIAG+LP E+GL+TDLAL H+
Sbjct  91    NTTGNWVGANVCAYNGVFCAPALDDSNLSVVAGVDINHADIAGYLPAELGLMTDLALFHI  150

Query  873   NSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPS  694
             NSNR CGI+PK+ S L L+ E D SNN  VGPFP V+L LP+L+YLD+R+N+FEG+LP  
Sbjct  151   NSNRFCGIIPKSFSRLLLMHEFDISNNRFVGPFPTVVLSLPALRYLDIRFNDFEGSLPEE  210

Query  693   LFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLL  514
             +F+K+LD + +N+NR   ++PE  G STASV+V ANNK +GC+P SIG+M  ++ +I+  
Sbjct  211   VFEKELDALFVNDNRFTGSIPETLGQSTASVVVFANNKLTGCIPKSIGKMANTLNEIVFS  270

Query  513   NNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGL  334
             NN+F GCLP EI +L N TVF    N   G L K    ++ +E    + N  +G VPDG+
Sbjct  271   NNDFGGCLPTEIGMLGNATVFAAGSNSFTGVLLKSFSGLKKVEHLDVSHNTLTGFVPDGI  330

Query  333   CSLPNLKNLSFSGNYFEMEDESCL-PLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             C LP+L N +FS N+F+ E  SC  P +  + +DD+ NC+ +RP QK  + C   +S+PV
Sbjct  331   CKLPSLSNFTFSYNFFKGEAPSCQPPSRADITLDDTSNCLSDRPKQKSARTCLPVVSRPV  390

Query  156   DCSKTGC  136
             DCSK+ C
Sbjct  391   DCSKSKC  397



>ref|XP_008800833.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Phoenix dactylifera]
Length=769

 Score =   413 bits (1061),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 197/369 (53%), Positives = 263/369 (71%), Gaps = 2/369 (1%)
 Frame = -3

Query  1233  DADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPK  1054
             D +A  IA RQLL      D   + FE  + + + FAN   ++AY+ALQAWK AIYSDP 
Sbjct  29    DVEASFIAHRQLLALPENGDLPDD-FEFDIKIGIRFANPHLRRAYIALQAWKHAIYSDPL  87

Query  1053  GITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHM  874
               T NWVGP VC+YNGVFC  AL+DP   VVAG+D+N++DIAG+LP E+GLLTD+A+ H+
Sbjct  88    NFTGNWVGPEVCTYNGVFCSQALNDPNITVVAGVDLNNADIAGYLPVELGLLTDIAVFHI  147

Query  873   NSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPS  694
             NSNR CGI+P++ S+L LL E+D SNN  VG FP VI+ LP+LKYLDLR+N+FEG LPP 
Sbjct  148   NSNRFCGIIPRSFSHLTLLHELDVSNNRFVGSFPMVIIGLPNLKYLDLRFNDFEGPLPPE  207

Query  693   LFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLL  514
             LFDK+LD I LN+NR  S++PENFGNSTASVIVLANNK  GC+P+S+GRM  ++ +++L+
Sbjct  208   LFDKELDAIFLNDNRFNSHIPENFGNSTASVIVLANNKLEGCIPTSVGRMGATLNEMILM  267

Query  513   NNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGL  334
             NN   GCLP EI  L N+TVFD   N L+G LPK    +  +E    + N+ +G VP+ L
Sbjct  268   NNGLVGCLPWEIGSLGNVTVFDSSWNSLIGVLPKSFARLMKVEELDLSHNILTGVVPESL  327

Query  333   CSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             C L +L N +FS N+F+ E + C+P  +  V  DD +NC+ ERP QK  + C   +++P+
Sbjct  328   CRLSSLVNFTFSYNFFKGEAKECMPGSRLDVVFDDINNCLSERPKQKSARMCTPIVNRPI  387

Query  156   DCSKTGCRA  130
             +CS++ CRA
Sbjct  388   NCSRSKCRA  396



>ref|XP_010466040.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Camelina sativa]
Length=920

 Score =   417 bits (1072),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 199/370 (54%), Positives = 257/370 (69%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + RRQLL  +   D   +  E+++DL L+F N+R K+AY+ALQAWK AIYS
Sbjct  30    ALTDEEASFLTRRQLLALSENGDLPDD-MEYEVDLDLKFDNNRLKRAYIALQAWKKAIYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP     NWVGPNVCSY GVFC  ALDDP+  VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  89    DPFNTAANWVGPNVCSYKGVFCAPALDDPSVMVVAGIDLNHADIAGYLPPELGLLTDVAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+N+NR CG++PK+ S L L++E D SNN  VG FP V L  PSLK+LD+RYN+FEG L
Sbjct  149   FHVNTNRFCGVIPKSFSKLTLMYEFDVSNNRFVGSFPTVALSWPSLKFLDIRYNDFEGKL  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +FDKDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  209   PPEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTFAHNKFSGCIPKTIGQM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGC P EI  L+N+TVFD   N  VG LP  L  + ++E   F+ N  +G V 
Sbjct  268   VFIGNNLSGCFPNEIGSLNNVTVFDASSNGFVGSLPSTLSGLVNVEQMDFSYNKLTGFVT  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS N+F  E +SC+P        DD+ NC+  RP QK  ++C   +S
Sbjct  328   DSICKLPKLSNFTFSYNFFNGEAQSCVPGSSQEKQFDDTSNCLQNRPKQKSAKECLPVVS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>gb|EPS66537.1| extensin-like protein, partial [Genlisea aurea]
Length=386

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/344 (58%), Positives = 246/344 (72%), Gaps = 7/344 (2%)
 Frame = -3

Query  1128  FANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGID  949
             FAN R  KAY ALQAWK  ++SDP   T NW GP+VCSYNGVFC  ALDDP   VVAG+D
Sbjct  1     FANPRLNKAYDALQAWKAVVFSDPYNFTLNWEGPDVCSYNGVFCAEALDDPNITVVAGVD  60

Query  948   INHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPD  769
             +NH DIAG+LP EIG LTD++L+H+NSNR CG++P TI  L LLFEID SNN  VG FP 
Sbjct  61    LNHGDIAGNLPDEIGNLTDISLLHLNSNRFCGLIPHTIRKLSLLFEIDVSNNRFVGRFPS  120

Query  768   VILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLA  589
             V+LELP L YLDLR+NNFEGALPP LFDK LD I LN+NR  S +PENFGNS ASV+V++
Sbjct  121   VLLELPELAYLDLRFNNFEGALPPELFDKKLDAIFLNSNRFCSTIPENFGNSPASVVVMS  180

Query  588   NNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKG  409
             +NK +GC+P SIG M   ++++++ +N  SGCLPEEITLL+  TV D+ RNKLVG+LP+G
Sbjct  181   HNKLTGCLPKSIGNMAGKLDELVVSHNYLSGCLPEEITLLNTTTVLDISRNKLVGDLPRG  240

Query  408   LGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLK-DGVAVDD  232
             + YMQ +E  +  GN F   VP+ +C+LP+L+N +FS NYF+  DE+C P     V+VDD
Sbjct  241   MEYMQGMEIFNIRGNNFRSKVPESVCTLPSLENFTFSYNYFDAMDEACYPHAVPEVSVDD  300

Query  231   SDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA-----ATKET  115
               NC      Q+   +C E   K VDCS   CR+     A KET
Sbjct  301   QMNCFAGANKQRSEAECSEAQKKSVDCSG-ACRSGSDGEAPKET  343



>gb|KHN04530.1| Pollen-specific leucine-rich repeat extensin-like protein 1 [Glycine 
soja]
Length=762

 Score =   412 bits (1058),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 201/360 (56%), Positives = 250/360 (69%), Gaps = 1/360 (0%)
 Frame = -3

Query  1215  IARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNW  1036
             IARRQLLH   E D   + +    +  L F+N R K AY+AL+A K AIYSDP   T NW
Sbjct  32    IARRQLLHLH-ENDELSDNYVDNYETNLTFSNPRLKLAYIALEALKKAIYSDPSNFTANW  90

Query  1035  VGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRIC  856
              G NVCSYNGVFC+ ALDDP   VVAGID+NH+DIAG++P EIGLLTDLAL H+NSNR C
Sbjct  91    EGQNVCSYNGVFCEKALDDPKIDVVAGIDLNHADIAGYIPPEIGLLTDLALFHINSNRFC  150

Query  855   GIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDL  676
             G++PK+ S LKLL+E D SNN  VG FP+ +L +P LK+LDLR+NNFEG LP  LF+K L
Sbjct  151   GVLPKSFSKLKLLYEADISNNRFVGRFPEPVLPIPDLKFLDLRFNNFEGELPSELFNKSL  210

Query  675   DVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSG  496
             D I LNNNR  S +P+N G S ASV+V ANN  +GCVPSSIG M +++ + +L NN  +G
Sbjct  211   DAIFLNNNRFTSTIPQNLGFSPASVVVFANNNLTGCVPSSIGNMTKTLNEFVLTNNNLTG  270

Query  495   CLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNL  316
             CLP EI  L  +TVFD+ +N  VG LP+ L  ++S+E  S   N  +G VP  +CSL NL
Sbjct  271   CLPAEIGKLEKVTVFDISQNNFVGMLPRTLNGLKSVEHLSIEHNKLTGFVPRNVCSLSNL  330

Query  315   KNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
              N +FS NYF  E+E C+P K  V +DD  NC+ +RP QK+   C   +SKPVDCSK  C
Sbjct  331   VNFTFSYNYFNGEEEGCVPPKKDVVLDDESNCIPDRPKQKVANVCNVVISKPVDCSKAQC  390



>ref|XP_004173261.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like, partial [Cucumis sativus]
Length=487

 Score =   402 bits (1032),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 202/369 (55%), Positives = 249/369 (67%), Gaps = 3/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             + ++A+A  + RRQLL      +   + F+++LD+   F N+R KKAY ALQAWK A+YS
Sbjct  43    SLSEAEASYLTRRQLLTLKKHYELPDD-FQYELDIADTFPNERLKKAYRALQAWKLAVYS  101

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP+ +T NWVG +VCSY GVFC  ALDDP   VVAGID+NH DIAGHLP E+GLLTDLAL
Sbjct  102   DPQNMTANWVGADVCSYTGVFCAPALDDPKIEVVAGIDLNHGDIAGHLPPELGLLTDLAL  161

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P + SNL L+FE D SNN  VG FP V+LE PS KYLDLRYN+FEG +
Sbjct  162   FHINSNRFCGIIPSSFSNLVLMFEFDVSNNRFVGHFPLVVLEWPSAKYLDLRYNDFEGEI  221

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LF KD D I LNNNR  S +P+  GNST SV+  ANN+F GC+PS+IG+M  ++ QI
Sbjct  222   PSTLFTKDFDAIFLNNNRFNSLIPDTIGNSTVSVVSFANNEFHGCIPSTIGQM-SNLNQI  280

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             L L N+ SGC P EI  L N+TVFDV  N  +G+LP+ L  +Q+LE    + N   G V 
Sbjct  281   LFLGNKLSGCFPPEIGNLVNLTVFDVSNNDFIGQLPESLSSLQNLEIMDVSNNELRGSVS  340

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV-DDSDNCVLERPGQKLPQKCYEYLS  166
              GLC LP L N +FS NYF  ED +C   K    + DDS NC+  RP QK   KC   L 
Sbjct  341   GGLCKLPKLANFTFSFNYFNGEDAACATSKGSEKLFDDSQNCLANRPMQKDANKCSTVLK  400

Query  165   KPVDCSKTG  139
             K VDC   G
Sbjct  401   KSVDCGNCG  409



>ref|XP_010525682.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Tarenaya hassleriana]
Length=915

 Score =   415 bits (1066),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 197/370 (53%), Positives = 255/370 (69%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A  I  RQLL      D   +G E+ +D  L F N R K+AY+ALQAWK  +YS
Sbjct  29    ALSDEEASFIVGRQLLALGENEDLL-DGMEYDVDTNLSFDNSRLKRAYIALQAWKKGMYS  87

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T+NWVGPNVC+YNGVFC  ALDDP+  VVAGID+NH+DIAG+LP E+GL+TD+AL
Sbjct  88    DPFDTTENWVGPNVCAYNGVFCAPALDDPSITVVAGIDLNHADIAGYLPPELGLMTDVAL  147

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++S L L++E D SNN  VGPFP V L  PSLKYLD+RYN+FEG L
Sbjct  148   FHINSNRFCGIIPKSLSKLTLMYEFDVSNNRFVGPFPTVALSWPSLKYLDIRYNDFEGTL  207

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I LNNNR ES +P+  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  208   PKELFDKDLDAIFLNNNRFESTIPDAIGKSTASVVTFAHNKFSGCIPKTIGKM-KNLNEI  266

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  +GC P EI +L+N TVFD   N+  G LP  L  + S+E   F+GN  +G V 
Sbjct  267   VFIGNNLTGCFPSEIGMLNNATVFDASNNEFFGSLPSSLSGLASVEQLDFSGNKLTGFVS  326

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS N+F  E ++C+  +      DD+ NC+  RP QK  ++C   +S
Sbjct  327   DSICKLPKLVNFTFSHNFFSGEGKNCVAGMSKDKQFDDTSNCLQNRPKQKSAKECLPVMS  386

Query  165   KPVDCSKTGC  136
              PVDCSK  C
Sbjct  387   HPVDCSKDKC  396



>ref|XP_008344101.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4, partial [Malus domestica]
Length=526

 Score =   403 bits (1035),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 201/370 (54%), Positives = 251/370 (68%), Gaps = 6/370 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A  I  RQLL++  E  F   G    +   L F NDR + AY+ALQA K AI S
Sbjct  49    ALSDEEALYIKNRQLLYYRDE--FGDRGELVTVXPSLVFENDRLRNAYIALQALKQAILS  106

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  IT NWVG NVC Y GVFC  ALD+ T   VAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  107   DPLNITGNWVGSNVCKYTGVFCTKALDNSTIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  166

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP   + LKLLFE+D SNN   G FP V+L+LP LK+LDLR+N FEG +
Sbjct  167   FHINSNRFCGTVPHKFNRLKLLFELDLSNNRFAGKFPRVVLQLPKLKFLDLRFNEFEGTV  226

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   +LP+NFGNS  SVIVLANNKF GCVP+S+G M  ++ +I
Sbjct  227   PKELFDKDLDAIFINHNRFRFDLPDNFGNSPVSVIVLANNKFHGCVPASLGNMS-NLNEI  285

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +++NN F  CLP EI +L N+TVFDV  N+ +G LP+ +G M SLE  + A N+ SG +P
Sbjct  286   IMMNNGFRSCLPPEIGMLKNVTVFDVSFNQFLGSLPESIGGMVSLEQLNVAHNLLSGKIP  345

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +CSLPNL+N ++S N+F  E   CL L      DD  NC+  RP Q+   +C  +LSK
Sbjct  346   ASICSLPNLQNFTYSYNFFTSEPPVCLGL---AGFDDKRNCLPNRPAQRTAAQCKSFLSK  402

Query  162   PVDCSKTGCR  133
             PVDCS   C+
Sbjct  403   PVDCSSFRCK  412



>ref|XP_010914722.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Elaeis guineensis]
Length=785

 Score =   411 bits (1056),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 200/369 (54%), Positives = 258/369 (70%), Gaps = 2/369 (1%)
 Frame = -3

Query  1233  DADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPK  1054
             DA+A  I  RQLL  +   D   + FE  + + + FAN R ++AY+ALQAWK AIYSDP 
Sbjct  30    DAEAAFITHRQLLTLSENGDLPDD-FEFDIKIGIRFANPRLRRAYIALQAWKKAIYSDPL  88

Query  1053  GITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHM  874
               T NWVGP +C+YNGVFC  ALDDP   VVAG+D+N +DIAG+LP E+GLL D+A+ H+
Sbjct  89    NFTGNWVGPEICTYNGVFCSKALDDPNATVVAGVDLNGADIAGYLPLELGLLNDIAVFHI  148

Query  873   NSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPS  694
             NSNR CGI+PK+ S L LL E+D SNN  VG FP V++ LP+LKYLDLR+N+FEG LP  
Sbjct  149   NSNRFCGIIPKSFSRLTLLHELDVSNNRFVGSFPMVVIGLPNLKYLDLRFNDFEGPLPSE  208

Query  693   LFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLL  514
             LFDK+LD I LN+NR  S++PENFGNSTASVIVLANNK  GC+PSS+GRM  ++ +++L+
Sbjct  209   LFDKELDAIFLNDNRFSSHIPENFGNSTASVIVLANNKLGGCIPSSVGRMGATLNEMILM  268

Query  513   NNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGL  334
             NN   GCLP EI  L N TVFD   N LVG LPK    +  +E   F+ N+ +G V + L
Sbjct  269   NNGLVGCLPWEIGSLGNATVFDASWNSLVGVLPKSFAGLTKVEELDFSHNVLTGIVSESL  328

Query  333   CSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             C LP+L NL+FS N+F+ E E C+P  +  V  DD  NC+ + P QK    C   +++PV
Sbjct  329   CRLPSLVNLTFSYNFFKGEAEECMPGARPDVVFDDISNCLPKTPKQKSATMCAPIVNRPV  388

Query  156   DCSKTGCRA  130
             DCS++ C A
Sbjct  389   DCSQSKCGA  397



>ref|XP_007042323.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOX98154.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=726

 Score =   409 bits (1051),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 194/377 (51%), Positives = 259/377 (69%), Gaps = 3/377 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +DA+A  IA RQLL      +   E FE+++ +   FAN R K+AY+ALQAWK A+YS
Sbjct  29    ALSDAEASYIAHRQLLTLPENGELP-EDFEYEVKIVETFANQRLKRAYIALQAWKKAMYS  87

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVGPNVC+Y GVFC  ALDDP   VVAG+D+NH+DIAG+LP E+GL+TDLAL
Sbjct  88    DPLNTTGNWVGPNVCAYTGVFCAPALDDPKLSVVAGVDLNHADIAGYLPAELGLMTDLAL  147

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++S L L+ E D SNN  VGPFP+V+L  P LKYLD+R+N+FEG L
Sbjct  148   FHINSNRFCGIIPKSLSKLTLMHEFDVSNNRFVGPFPEVVLSWPGLKYLDVRFNDFEGKL  207

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  +F+KDLD + LNNNR  S +PE  G ST SV+  ANNKFSGC+P SIG+M  ++ +I
Sbjct  208   PCGIFEKDLDALFLNNNRFTSTIPETIGKSTVSVVTFANNKFSGCIPHSIGKM-ANLNEI  266

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
               +NN+  GC P E+ LLSN+TVFD   N   G LP+    ++ +E    + N  +G VP
Sbjct  267   TFMNNDLGGCFPAEVGLLSNMTVFDAGLNSFTGILPQSFSGLKKVELLDISHNKLTGIVP  326

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPL-KDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C L +L N +FS NYF+ E  +C+P  +  + +DD+ NC+  RP QK  ++CY  +S
Sbjct  327   ENVCKLSSLSNFTFSYNYFKGEANACIPPSRKDIVIDDTSNCLGGRPKQKSAKECYPVVS  386

Query  165   KPVDCSKTGCRAATKET  115
             +PVDCSK  C   +  +
Sbjct  387   RPVDCSKDKCGGGSSPS  403



>emb|CDY02276.1| BnaA03g38910D [Brassica napus]
Length=605

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/370 (51%), Positives = 260/370 (70%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  IA+RQLL      D   +  E+++DLK  FAN+R K+AY+ALQAWK A+YS
Sbjct  26    ALTDAEASFIAQRQLLTLPENGDLPDD-IEYEVDLKETFANNRLKRAYIALQAWKKAVYS  84

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GVFC  ALDDP+  VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  85    DPFNTTGNWHGPHVCGYTGVFCAPALDDPSVAVVAGVDLNGADIAGHLPVELGLMTDVAM  144

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++  LKL++E D SNN  VGPFP V+L  P++K++DLR+N+FEG +
Sbjct  145   FHLNSNRFCGIIPKSLDRLKLMYEFDASNNRFVGPFPSVVLSWPAVKFIDLRFNDFEGQV  204

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF KDLD I LNNNR  S +PE+ G S+ASV+  A+NKF+GCVP SIG M +++ +I
Sbjct  205   PPQLFKKDLDAIFLNNNRFTSTIPESLGESSASVVTFAHNKFNGCVPKSIGNM-KNLNEI  263

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N   GC P EI  L+N+ VFD   N   G LP+    +  +E    +GN  +G VP
Sbjct  264   IFKDNRLGGCFPSEIGKLANVNVFDASMNSFTGVLPQSFVGLTGVEEIDISGNKLTGFVP  323

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L NL+++ NYF  + +SC+P  +  +A+DD+ NC+ +RP Q+  ++C   +S
Sbjct  324   ENICKLPKLVNLTYAYNYFNGQGDSCVPGSQKEIALDDTRNCLPDRPKQRSAKECAVVIS  383

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  384   RPVDCSKDKC  393



>ref|XP_010251965.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=734

 Score =   408 bits (1049),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 190/370 (51%), Positives = 256/370 (69%), Gaps = 2/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A ++A+   IA RQLL      D   E +E+++D+ L F N R ++AY+ALQAWK+AI S
Sbjct  24    ALSEAEVSFIAHRQLLSLPENGDLP-ENYEYQVDVNLTFPNARLRRAYIALQAWKEAIVS  82

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  IT +WVG +VC Y GVFC  A DDP   VVAG+D+N++D+AG LP E+GL++DLAL
Sbjct  83    DPHKITTSWVGADVCDYKGVFCAPAPDDPKSTVVAGVDLNNADLAGFLPVELGLMSDLAL  142

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P++ S + +L+E D SNN LVGPFP  +  +P+LKYLDLRYN+FEG++
Sbjct  143   FHVNSNRFCGIIPQSFSKMAVLYEFDVSNNRLVGPFPMPVTAMPALKYLDLRYNDFEGSI  202

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LFD DLD + LNNNR ++ +PEN GNS ASVIV ANN+ +GC+P SI +ME ++ +I
Sbjct  203   PPELFDMDLDAVFLNNNRFQNEIPENLGNSPASVIVFANNRLTGCIPHSIKKMENTLNEI  262

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  NN+ +GCLP EI  L N+TVF    N L G LPK    ++S+E    + N  +G VP
Sbjct  263   IFTNNKLTGCLPMEIGSLENLTVFAAASNSLSGVLPKSFSGIKSVELIDISNNFLTGFVP  322

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCVLERPGQKLPQKCYEYLS  166
             +G+C LPNL N +FS NYF  E   C   +   V VDD+DNC  +RP QK  + C   ++
Sbjct  323   EGICKLPNLVNFTFSYNYFRGESPECESSRTKDVVVDDTDNCFPDRPKQKASKTCTPVVN  382

Query  165   KPVDCSKTGC  136
             +PVDC K+ C
Sbjct  383   RPVDCGKSKC  392



>ref|XP_010487832.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Camelina sativa]
Length=923

 Score =   414 bits (1063),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 197/370 (53%), Positives = 256/370 (69%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + RRQLL  +   D   +  E+++ L L+F N+R K+AY+ALQAWK AIYS
Sbjct  30    ALTDEEASFLTRRQLLALSENGDLPDD-MEYEVHLDLKFDNNRLKRAYIALQAWKKAIYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP     NWVGPN+CSY GVFC  ALDDP+  VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  89    DPFNTAANWVGPNLCSYKGVFCAPALDDPSVMVVAGIDLNHADIAGYLPPELGLLTDVAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK+ S L L++E D SNN  VG FP V L  PSLK+LD+RYN+FEG L
Sbjct  149   FHVNSNRFCGVIPKSFSKLTLMYEFDVSNNRFVGSFPTVALSWPSLKFLDIRYNDFEGKL  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +FDKDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  209   PPEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTFAHNKFSGCIPKTIGQM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGC P EI  L+++TVFD   N  VG LP  L  + ++E   F+ N  +G V 
Sbjct  268   VFIGNNLSGCFPNEIGSLNSVTVFDASSNGFVGSLPSTLSGLANVEQMDFSYNKLTGFVT  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS N+F  E +SC+P        DD+ NC+  RP QK  ++C   +S
Sbjct  328   DSICKLPKLSNFTFSYNFFNGEAQSCVPGSSQEKQFDDTSNCLQNRPKQKSAKECLPVVS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>emb|CDX69018.1| BnaC01g04350D [Brassica napus]
Length=652

 Score =   405 bits (1042),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/383 (50%), Positives = 255/383 (67%), Gaps = 12/383 (3%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEG-----FEHKLDLKLEFANDRQKKAYVALQAWK  1078
             A +D +A  + RRQLL        +GEG      E+++DLK  FAN R KKAY+ALQAWK
Sbjct  27    AISDTEAAFLVRRQLLTLPE----NGEGELPDDIEYEVDLKATFANTRLKKAYIALQAWK  82

Query  1077  DAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLL  898
              AIYSDP   T NW GP+VC+Y GV C  ALDDP   VVAG+D+N +DIAGHLP E+GL+
Sbjct  83    KAIYSDPFNTTANWHGPHVCAYTGVVCAPALDDPNVTVVAGVDLNGADIAGHLPVELGLM  142

Query  897   TDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNN  718
             TD+A+ H+NSNR CGI+PK+   +KL+ E D S+N  VGPFP+VIL  PS KY DLR+N+
Sbjct  143   TDVAMFHLNSNRFCGIIPKSFEKMKLMHEFDVSSNCFVGPFPNVILSWPSAKYFDLRFND  202

Query  717   FEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQ  538
             FEG +PP LF K+LD I LNNNR  S +PE  G STASV+  ANNKF+GC+P S+G M +
Sbjct  203   FEGQVPPELFKKELDAIFLNNNRFTSVIPETLGESTASVVTFANNKFTGCIPKSVGNM-K  261

Query  537   SVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMF  358
             ++ +I+ ++N   GC P EI  LSN+TVFD  +N  VG LP     +  +E    +GN  
Sbjct  262   NLNEIVFMDNGLGGCFPSEIGKLSNVTVFDASKNSFVGRLPTSFVGLTGVEELDISGNKL  321

Query  357   SGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQK  184
             +G V D +C LPNL N ++S NYF  +  SC+P   +  + +DD+ NC+ +RP Q+  Q+
Sbjct  322   TGLVGDEICKLPNLVNFTYSYNYFNGQGSSCVPGGGRKEIVLDDTRNCLTDRPDQRSAQE  381

Query  183   CYEYLSKPVDCSKTGCRAATKET  115
             C   +++PVDCSK  C      T
Sbjct  382   CAVVINRPVDCSKDKCAGGGSST  404



>ref|XP_010249819.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=701

 Score =   406 bits (1044),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 199/369 (54%), Positives = 255/369 (69%), Gaps = 4/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TD +A  I +RQLL++  E    GE +  KLD  L F N R + AY+ALQAWK A+ S
Sbjct  33    GLTDIEARYIRQRQLLYYRDEFYDRGEHYV-KLDPSLVFENPRLRNAYIALQAWKKAMIS  91

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG +VC+Y GVFC +ALDD +   VAGID+NH DIAG+LP EIGLL D+AL
Sbjct  92    DPLNLTGNWVGFDVCNYTGVFCANALDDRSIRTVAGIDLNHGDIAGYLPEEIGLLVDIAL  151

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP  + NL LL+E+D SNN   G FP+V+L LPSLKYLD+R+N FEG +
Sbjct  152   FHINSNRFCGTVPHKLVNLTLLYELDLSNNRFAGKFPEVVLRLPSLKYLDIRFNEFEGKV  211

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   NLP+NFGNS  SVIVLANNKF GCVP+S+G M +++ +I
Sbjct  212   PRELFDKDLDAIFINHNRFAFNLPDNFGNSPVSVIVLANNKFHGCVPASLGNMSKTLNEI  271

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN F  C+P+EI LL N+TV D+  N+L+G LP  +G M SLE  + A NM SG++P
Sbjct  272   ILMNNGFRSCVPKEIGLLKNLTVLDISFNQLMGPLPDSIGGMVSLEQVNVAHNMLSGNIP  331

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +C LPNL+N ++S N+F  E   CL +     VDD  NC+  RP Q+  + C  +LS 
Sbjct  332   SSICLLPNLQNFTYSYNFFTGEPPVCLNI---TGVDDRRNCLRRRPTQRQARVCKSFLSH  388

Query  162   PVDCSKTGC  136
              VDCS   C
Sbjct  389   RVDCSAFRC  397



>ref|XP_010507385.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 isoform X2 [Camelina sativa]
Length=891

 Score =   411 bits (1057),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 198/370 (54%), Positives = 255/370 (69%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + RRQLL  +   D   +  E+++ L L+F N+R K+AY+ALQAWK AIYS
Sbjct  30    ALTDEEASFLTRRQLLALSENGDLPDD-MEYEVHLDLKFDNNRLKRAYIALQAWKKAIYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP     NWVGPNVCSY GVFC  ALDDP+  VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  89    DPFNTAGNWVGPNVCSYKGVFCAPALDDPSVMVVAGIDLNHADIAGYLPPELGLLTDVAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK+ S L L++E D SNN  VG FP V L  PSLK+LD+RYN+FEG L
Sbjct  149   FHVNSNRFCGVIPKSFSKLTLMYEFDVSNNRFVGSFPTVALSWPSLKFLDIRYNDFEGKL  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  +FDKDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  209   PAEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTFAHNKFSGCIPKTIGQM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGC P EI  L+N+TVFD   N  VG LP  L  + ++E   F+ N  +G V 
Sbjct  268   VFIGNNLSGCFPNEIGSLNNVTVFDASSNGFVGSLPSTLSGLANVEQMDFSYNKLTGIVT  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS N+F  E +SC+P        DD+ NC+  RP QK  ++C   +S
Sbjct  328   DSICKLPKLSNFTFSYNFFNGEAQSCVPGSSQEKQFDDTSNCLQNRPKQKSAKECLPVVS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>emb|CDO99097.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   397 bits (1021),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/333 (57%), Positives = 234/333 (70%), Gaps = 3/333 (1%)
 Frame = -3

Query  1128  FANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGID  949
             F N R   AY+ALQAWK AI SDPKG T NW GPNVCSYNGV+C  ALDDP    VAGID
Sbjct  40    FPNPRLSNAYIALQAWKHAITSDPKGFTSNWYGPNVCSYNGVYCAQALDDPHIITVAGID  99

Query  948   INHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPD  769
             +NH+D+AG+LP E+GLLTDLAL H+NSNR CG VPK+  +L LL+E+D SNN   G FP 
Sbjct  100   LNHADLAGYLPEELGLLTDLALFHINSNRFCGAVPKSFIHLHLLYELDISNNLFSGEFPS  159

Query  768   VILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLA  589
             V+L LPSLK+LD+RYN F+G++P +LFD  LD + +NNN  +S LP N GNST SV+VLA
Sbjct  160   VVLCLPSLKFLDIRYNQFQGSIPSALFDLKLDALFINNNNFQSTLPRNIGNSTVSVLVLA  219

Query  588   NNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKG  409
             NN   GC+PSSIG M  ++ +I+LLN    GCLP+E+ LL  +TVFDV  N LVG LP  
Sbjct  220   NNNLQGCLPSSIGNMANTLNEIILLNVGLGGCLPQELGLLKGVTVFDVSFNNLVGTLPDS  279

Query  408   LGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDS  229
             +G M SLE  + A N  SG +P  +CSLP L+N ++S NYF  E   CL L D    DD 
Sbjct  280   IGNMVSLEQLNVAHNKLSGEIPASICSLPRLQNFTYSYNYFCTEPSLCLKLPDK---DDE  336

Query  228   DNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
              NC+  RP Q+ PQ+C  + S PVDCS  GC+A
Sbjct  337   QNCIPGRPAQRSPQECQAFYSHPVDCSAFGCQA  369



>ref|XP_004287084.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Fragaria 
vesca subsp. vesca]
Length=715

 Score =   406 bits (1044),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 202/372 (54%), Positives = 256/372 (69%), Gaps = 6/372 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             + TDA+A  I +RQLL++  E  F   G   K+D  L F N R + AY+ALQAWK AI S
Sbjct  35    SLTDAEAHYIKQRQLLYYRDE--FGDRGEVVKVDPSLVFENPRLRNAYIALQAWKKAILS  92

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T +WVG +VCSY GVFC  ALD+ +   VAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  93    DPFNLTGDWVGSDVCSYTGVFCAPALDNSSIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  152

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP    NLKLL+E+D SNN   G FP V+L LP LK+LDLR+N FEG +
Sbjct  153   FHINSNRFCGTVPHKFRNLKLLYELDISNNRFAGKFPHVVLHLPELKFLDLRFNEFEGTV  212

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   NLPENFGNS  SVIVLANNKF GCVP+S+G M  ++++I
Sbjct  213   PKELFDKDLDAIFINHNRFRFNLPENFGNSPVSVIVLANNKFHGCVPASLGNM-SNLDEI  271

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +++NN F  CLPEEI +L N+TVFDV  N+ +G LP  +G M SLE  + A N+ SG +P
Sbjct  272   IMMNNGFRSCLPEEIGMLKNLTVFDVSYNQFLGPLPDTIGGMVSLEQLNVAHNLLSGSIP  331

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +CSLP+L+N ++S N+F  E   CL L      DD  NC+  RP Q+   +C  +LSK
Sbjct  332   PAICSLPSLENFTYSYNFFTGEPPVCLALP---GFDDKRNCLPNRPLQRSAAQCKSFLSK  388

Query  162   PVDCSKTGCRAA  127
             PV C   GC+ +
Sbjct  389   PVSCQSFGCKGS  400



>ref|XP_010507380.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 isoform X1 [Camelina sativa]
Length=907

 Score =   412 bits (1058),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 198/370 (54%), Positives = 255/370 (69%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + RRQLL  +   D   +  E+++ L L+F N+R K+AY+ALQAWK AIYS
Sbjct  30    ALTDEEASFLTRRQLLALSENGDLPDD-MEYEVHLDLKFDNNRLKRAYIALQAWKKAIYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP     NWVGPNVCSY GVFC  ALDDP+  VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  89    DPFNTAGNWVGPNVCSYKGVFCAPALDDPSVMVVAGIDLNHADIAGYLPPELGLLTDVAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK+ S L L++E D SNN  VG FP V L  PSLK+LD+RYN+FEG L
Sbjct  149   FHVNSNRFCGVIPKSFSKLTLMYEFDVSNNRFVGSFPTVALSWPSLKFLDIRYNDFEGKL  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  +FDKDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  209   PAEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTFAHNKFSGCIPKTIGQM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGC P EI  L+N+TVFD   N  VG LP  L  + ++E   F+ N  +G V 
Sbjct  268   VFIGNNLSGCFPNEIGSLNNVTVFDASSNGFVGSLPSTLSGLANVEQMDFSYNKLTGIVT  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS N+F  E +SC+P        DD+ NC+  RP QK  ++C   +S
Sbjct  328   DSICKLPKLSNFTFSYNFFNGEAQSCVPGSSQEKQFDDTSNCLQNRPKQKSAKECLPVVS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>ref|XP_006476103.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Citrus 
sinensis]
Length=700

 Score =   405 bits (1041),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 206/370 (56%), Positives = 249/370 (67%), Gaps = 6/370 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I +RQLL++  E  F   G    +D  L FAN R + AY+ALQAWK AI S
Sbjct  43    GLTDAEAHYIRQRQLLYYRDE--FGDRGENVTVDPSLVFANPRIRNAYIALQAWKQAILS  100

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T +WVG  VCSY GVFC  A D+     VAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  101   DPYNLTADWVGSAVCSYTGVFCAPAPDNKRIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  160

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP    NLKLLFE+D SNN   G FP V+L LP LK+LDLRYN FEG +
Sbjct  161   FHINSNRFCGTVPHKFENLKLLFELDLSNNRFAGKFPKVLLRLPQLKFLDLRYNEFEGTV  220

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +NNNR    +P+NFGNS  SVIVLANNKF GCVPSS+G M + + +I
Sbjct  221   PRELFDKDLDAIFINNNRFRFEIPDNFGNSPVSVIVLANNKFHGCVPSSLGNMSR-LNEI  279

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +LLNN    CLP EI +L N+TVFDV  N+L+G LP  +G M SLE  + A NM SG +P
Sbjct  280   ILLNNGLRSCLPPEIGMLKNVTVFDVSFNQLLGPLPDTIGRMVSLEQLNVAHNMLSGTIP  339

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +C LPNL+N +FS N+F  E   CL L+   A DD  NC+  RP Q+   +C  +LSK
Sbjct  340   ASICRLPNLQNFTFSYNFFTGEPPVCLSLQ---AFDDRRNCLPARPAQRSSAQCKSFLSK  396

Query  162   PVDCSKTGCR  133
              VDCS   C+
Sbjct  397   RVDCSSFKCK  406



>ref|XP_006371912.1| hypothetical protein POPTR_0018s06150g [Populus trichocarpa]
 gb|ERP49709.1| hypothetical protein POPTR_0018s06150g [Populus trichocarpa]
Length=509

 Score =   399 bits (1024),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 202/393 (51%), Positives = 256/393 (65%), Gaps = 6/393 (2%)
 Frame = -3

Query  1314  LSIIMAAVGClvflsllsfssisLAFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLK  1135
             +++ +  V CL         S     +DADA  I +RQLL++  E  F   G    +D  
Sbjct  15    IALFLGTVVCLSAAKQAPTISSYGGLSDADAMYIKKRQLLYYKDE--FGDRGERVTVDPS  72

Query  1134  LEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAG  955
             L F N R + AY+ALQAWK AI+SDP  +T NWVG  VC+Y GVFC  A D+ T   VAG
Sbjct  73    LVFPNPRLRNAYIALQAWKQAIFSDPLNLTANWVGSQVCNYEGVFCAPAPDNKTIRTVAG  132

Query  954   IDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPF  775
             ID+NH DIAG+LP E+GLL D+AL H+NSNR CG VP+   +++LLFE+D SNN   G F
Sbjct  133   IDLNHGDIAGYLPEELGLLVDIALFHINSNRFCGTVPRKFKDMRLLFELDLSNNRFAGKF  192

Query  774   PDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIV  595
             P V+L+LPSLK+LDLR+N FEG +P  LFDKDLD I +N+NR   +LPEN GNS  SVIV
Sbjct  193   PQVVLKLPSLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFVFDLPENLGNSPVSVIV  252

Query  594   LANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELP  415
             LANNKF GCVPSS+G M  ++ +I+L+NN F  C+P EI LL ++TV DV  N+L+G LP
Sbjct  253   LANNKFHGCVPSSLGNMS-NLNEIILMNNGFRSCMPAEIGLLKDLTVLDVSFNQLMGPLP  311

Query  414   KGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVD  235
                G M SLE  + A NM SG +P  +C LPNL N +FS N+F  E   CL L D     
Sbjct  312   DAFGGMASLEQLNVAHNMLSGKIPASICKLPNLDNFTFSYNFFTGEPPVCLSLPD---FS  368

Query  234   DSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
             D  NC+  RP Q+   +C  +LS+PVDCS   C
Sbjct  369   DRRNCLPARPLQRSAAQCNAFLSRPVDCSSFRC  401



>ref|XP_006582471.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4-like [Glycine max]
Length=503

 Score =   398 bits (1022),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 193/364 (53%), Positives = 249/364 (68%), Gaps = 1/364 (0%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A ++ +A  I RRQLLH   E D   + +    +  L F N R K AY+AL+A K AIYS
Sbjct  79    ALSNVEASFIVRRQLLHLH-ENDELSDNYADNYETNLTFPNPRLKSAYIALEALKKAIYS  137

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GPNVCSYNGVFC+ ALDDP   VVAGID+NH+DIAG++P EIGLLTDLAL
Sbjct  138   DPSNFTANWEGPNVCSYNGVFCEKALDDPKIDVVAGIDLNHADIAGYIPPEIGLLTDLAL  197

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK+ S LKLL+E+D SNN  VG FP+ +L +P +K+LDLR+N FEG L
Sbjct  198   FHINSNRFCGVLPKSFSKLKLLYELDISNNRFVGRFPEPVLLIPDIKFLDLRFNEFEGEL  257

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF+K LD I LNNNR  S +P+N G+S ASV+V A N  +GC+PSSIG M +++ + 
Sbjct  258   PSELFNKSLDAIFLNNNRFTSTIPQNMGSSPASVMVFAYNNLTGCLPSSIGNMTKTLNEF  317

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN  +GCLP EI  L  + VFD+ +N  VG LP+    +++ E  S   N  +G VP
Sbjct  318   VLINNNLTGCLPAEIGKLEQVYVFDISQNNFVGMLPRTFDGLKNAEHLSIGHNKLTGFVP  377

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +CSLPNL N +FS NYF  E+E C+P K  V +DD +NC+  RP QK+   C   +SK
Sbjct  378   RNVCSLPNLVNFTFSYNYFNGEEEGCVPPKKDVVLDDENNCIPNRPKQKVADVCNVVISK  437

Query  162   PVDC  151
              VDC
Sbjct  438   HVDC  441



>ref|XP_007017392.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY14617.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=911

 Score =   410 bits (1054),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 199/364 (55%), Positives = 256/364 (70%), Gaps = 2/364 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D++   IARRQLL      D   + +E+ ++L L F N R ++AY+ALQA K AIYS
Sbjct  31    ALSDSEVAFIARRQLLTLPENGDLPHD-YEYNVELNLTFENSRLRRAYIALQALKHAIYS  89

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T+NW GP VC+Y GVFC  A+DDP   VVAGID+NH+DIAG+LP E+GLLTDLAL
Sbjct  90    DPLKTTQNWKGPKVCNYKGVFCAPAVDDPKLMVVAGIDLNHADIAGYLPVELGLLTDLAL  149

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+ S L LL+E+D SNN  VGPFPDV++ LPSLK+LDLRYNNFEG L
Sbjct  150   FHINSNRFCGIIPKSFSKLILLYELDVSNNRFVGPFPDVVISLPSLKFLDLRYNNFEGEL  209

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF+K+LD + LNNNR  SN+PE  G+S ASVIV+ANNK SGC+P SIG+M  ++ +I
Sbjct  210   PSELFEKELDALFLNNNRFVSNIPETLGSSPASVIVVANNKLSGCIPDSIGKMCNTLNEI  269

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  NN  SGCLP EI +L N+TV DV  N   G L K    +  +E    A NM +G V 
Sbjct  270   IFANNNLSGCLPSEIGMLRNVTVLDVASNSFSGVLAKTFKGLGKVEHFDVAHNMLTGFVS  329

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLK-DGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS NYF  E +SC P K  G+ +DD+ NC+ +RP QK  ++C+  +S
Sbjct  330   DDICRLPGLNNFTFSHNYFNGEAKSCEPSKGRGIVLDDTSNCLPDRPKQKSAKECHSVVS  389

Query  165   KPVD  154
             +P+D
Sbjct  390   RPID  393



>ref|XP_006409498.1| hypothetical protein EUTSA_v10023190mg, partial [Eutrema salsugineum]
 gb|ESQ50951.1| hypothetical protein EUTSA_v10023190mg, partial [Eutrema salsugineum]
Length=518

 Score =   398 bits (1023),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/373 (50%), Positives = 259/373 (69%), Gaps = 3/373 (1%)
 Frame = -3

Query  1239  FTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSD  1060
              TDA+A  IA+RQLL      D   +  E+++DLK+ FA +R K+AY+ALQAWK A++SD
Sbjct  1     LTDAEASFIAQRQLLTLPENGDLPDD-IEYEVDLKVTFAKNRLKRAYIALQAWKKAVFSD  59

Query  1059  PKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALI  880
             P   T NW GP+VC Y GVFC  ALDDP+  VVAG+D+N +DIAGHLP E+GL+TD+A+ 
Sbjct  60    PFNTTGNWHGPHVCGYTGVFCAPALDDPSVAVVAGVDLNGADIAGHLPVELGLMTDVAMF  119

Query  879   HMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALP  700
             H+NSNR CGI+PK++  LKL+ E D SNN  VGPFP V+L  P++KY+DLR+N+FEG +P
Sbjct  120   HLNSNRFCGIIPKSLDRLKLMHEFDVSNNRFVGPFPSVVLSWPAVKYIDLRFNDFEGQVP  179

Query  699   PSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQIL  520
             P+LF KDLD I LNNNR  + +PE+ G+S+ SV+  A+NKF+GC+P SIG M +++ +I+
Sbjct  180   PTLFKKDLDAIFLNNNRFTATIPESLGDSSVSVVTFAHNKFTGCIPKSIGNM-KNLNEII  238

Query  519   LLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPD  340
               +N   GC P EI  L+N+ VFD   N   G LP     +  +E    +GN  +G +P+
Sbjct  239   FKDNSLGGCFPSEIGKLANVNVFDASMNSFTGVLPPSFVGLTGVEEFDISGNKLTGFMPE  298

Query  339   GLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
              +C LPNL NL+++ NYF  + +SC+P  +  VA+DD  NC+ +RP Q+  ++C   +S+
Sbjct  299   NICKLPNLVNLTYAYNYFNGQGDSCVPGSQKQVALDDIRNCLPDRPKQRSAKECAVVISR  358

Query  162   PVDCSKTGCRAAT  124
             PVDCSK  C   +
Sbjct  359   PVDCSKDKCAGGS  371



>ref|XP_009351868.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Pyrus x bretschneideri]
Length=849

 Score =   408 bits (1049),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 195/370 (53%), Positives = 259/370 (70%), Gaps = 2/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+   +A RQ +      D   + +E +++L L+F N R ++AY+ LQA K A+YS
Sbjct  23    ALTDAEVSFLAHRQFVSLPEGGDIP-DNYEFEVELDLKFPNTRLRRAYIGLQALKKAVYS  81

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T+NWVG NVC+YNGVFC  ALDDP   VVAGIDINH+DIAGHLP E+GLLTD+AL
Sbjct  82    DPLKTTENWVGENVCAYNGVFCAPALDDPELEVVAGIDINHADIAGHLPAELGLLTDMAL  141

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   L LL E+D SNN  VG FPDV+LE+ +LKYLDLR+N+FEG L
Sbjct  142   FHINSNRFCGIIPKSFRRLTLLHELDVSNNRFVGSFPDVVLEIHNLKYLDLRFNDFEGKL  201

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF+K+LD + LN+NR  S +PEN GNS  SV+V+ANN+  GC+P+SIG+M +++ + 
Sbjct  202   PHELFNKELDALFLNDNRFTSTIPENLGNSPVSVLVVANNQLEGCIPNSIGKMVKTLNEA  261

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  NN+F+GCLP EI  L+N+TVFD+  N   G + K     + +E  + A NM +G VP
Sbjct  262   VFSNNKFTGCLPPEIGQLANVTVFDISSNTFSGIMSKTFKGFEKVEELNIAHNMLTGFVP  321

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LPNL N +FS NYF  E + C+P  +  V  DD  NC+ +RP QK  ++C+  +S
Sbjct  322   DSICMLPNLGNFTFSYNYFNGETQECVPGSRKDVVFDDVSNCLPDRPEQKSAKECHAVVS  381

Query  165   KPVDCSKTGC  136
             KPVDCSK  C
Sbjct  382   KPVDCSKAKC  391



>gb|EPS67596.1| hypothetical protein M569_07180, partial [Genlisea aurea]
Length=398

 Score =   394 bits (1011),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 188/332 (57%), Positives = 240/332 (72%), Gaps = 1/332 (0%)
 Frame = -3

Query  1128  FANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGID  949
             F N R KKAY ALQAWK A+YSDP   T NWVGP+VCSYNGVFC  ALD+PT  VVAG+D
Sbjct  4     FGNQRLKKAYDALQAWKSAVYSDPFNYTGNWVGPDVCSYNGVFCAPALDEPTVTVVAGVD  63

Query  948   INHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPD  769
             +NH DIAGHLP EIG LTD++L+H+NSNR CG++P+TI  LKLL+E+D SNN  VG FP 
Sbjct  64    LNHGDIAGHLPDEIGNLTDISLLHLNSNRFCGVIPETIRKLKLLYELDVSNNRFVGCFPM  123

Query  768   VILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLA  589
             V+LELP LKYLDLRYN+FEG LPP LF+K LD I LN+NR  S +PENFG+S ASV+V+A
Sbjct  124   VVLELPELKYLDLRYNDFEGNLPPELFEKKLDAIFLNSNRFNSRIPENFGDSPASVVVIA  183

Query  588   NNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKG  409
             +N+  GC+P SIG+M   +++++L +N  SGCLPEE+TLL+  +VFD+  NK VG+LP G
Sbjct  184   DNRLFGCLPKSIGKMAGKLDELILSHNNLSGCLPEEMTLLNTTSVFDINLNKFVGDLPGG  243

Query  408   LGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGV-AVDD  232
             + +M+ +E      N+F  HVP  +C+LP LKNL+ S NYF+  DE+C P    V A+D+
Sbjct  244   MEHMKGMEVLDIGNNVFRHHVPATVCTLPGLKNLTVSYNYFDALDEACFPSGFPVAAIDN  303

Query  231   SDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
               NC+     Q+   +C   L   VDC    C
Sbjct  304   EMNCITGDEKQRSKDECSRVLKNKVDCGGADC  335



>ref|XP_011092901.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Sesamum indicum]
Length=914

 Score =   410 bits (1053),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 245/340 (72%), Gaps = 1/340 (0%)
 Frame = -3

Query  1167  GEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHA  988
             G    H       F N R K AY+ LQAWK AIYSDP   T NWVG +VCSYNGV C+ A
Sbjct  63    GHSDGHDDQAASTFPNPRLKSAYIGLQAWKKAIYSDPTNFTTNWVGTDVCSYNGVVCEKA  122

Query  987   LDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEI  808
              DDP   VVAG+D+NH+DIAGHLP EI  L D++L+H+NSNR CGI+P+ I  LKLL+E+
Sbjct  123   PDDPNITVVAGVDLNHADIAGHLPWEIEYLIDISLLHINSNRFCGIIPEGIKKLKLLYEL  182

Query  807   DFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPE  628
             D SNN  VGPFP+V+LELPSLKYLDLR+N+FEGALPP LFDK+ D I LN+NR ES +PE
Sbjct  183   DLSNNRFVGPFPEVVLELPSLKYLDLRFNDFEGALPPELFDKNFDAIFLNSNRFESTIPE  242

Query  627   NFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFD  448
             NFGN+ ASV+V++NN F+GC+P+SIG+M   ++++++ NN  SGCLPEEITLL+  TVFD
Sbjct  243   NFGNTPASVVVMSNNNFTGCIPTSIGKMAGKMDELIMSNNALSGCLPEEITLLNTTTVFD  302

Query  447   VQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDES  268
             +  NK +G+LP+G+ +MQ LE  + A N F   VP+ +C+LP+LKN +FS NYFE ++  
Sbjct  303   ISSNKFMGDLPRGMEFMQGLEVINIADNKFRSKVPETVCTLPSLKNFTFSFNYFEEKNPI  362

Query  267   CLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDC  151
             C P    G+ +DD DNC      Q+   +C   LSK  DC
Sbjct  363   CDPNALPGLELDDKDNCFGREQHQRSQNECALELSKKADC  402



>ref|XP_010527734.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Tarenaya hassleriana]
Length=979

 Score =   411 bits (1057),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 198/370 (54%), Positives = 254/370 (69%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A  IARRQLL      D   E  E+++D  L FAN R K+AY+ALQ WK A+YS
Sbjct  26    ALSDEEASFIARRQLLALGENGDLP-EDIEYEVDENLTFANSRLKRAYIALQTWKKAMYS  84

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVGP VC+Y GVFC  ALDD +  VVAGID+NH+DIAG+LP E+GL+TD+AL
Sbjct  85    DPFNTTVNWVGPYVCAYTGVFCASALDDASITVVAGIDLNHADIAGYLPPELGLMTDVAL  144

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++S L L++E D SNN  VGPFP V L  P+LKYLD+RYN+FEG L
Sbjct  145   FHINSNRFCGIIPKSLSKLTLMYEFDISNNRFVGPFPTVTLSWPALKYLDIRYNDFEGKL  204

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  +FDKDLD I LNNNR ES +P   G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  205   PEEVFDKDLDAIFLNNNRFESTIPNTIGKSTASVVTFAHNKFSGCIPKTIGKM-KNLNEI  263

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGC P EI LL+N+TVFD   N   G LP  L  + ++E   F+GN  +G V 
Sbjct  264   VFIGNNLSGCFPSEIGLLNNVTVFDASNNGFFGILPSSLSGLANVEQLDFSGNKLTGFVG  323

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV-DDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L N +FS N+F  E ++C+P      V DD+ NC+  RP QK  ++C   LS
Sbjct  324   ENICKLPKLVNFTFSYNFFNGESQACVPGTSNEKVFDDTSNCLQNRPKQKSAKECLPVLS  383

Query  165   KPVDCSKTGC  136
              PVDCSK  C
Sbjct  384   HPVDCSKDKC  393



>gb|AGT16383.1| hypothetical protein SHCRBa_052_I12_F_230 [Saccharum hybrid cultivar 
R570]
Length=641

 Score =   402 bits (1032),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 196/372 (53%), Positives = 255/372 (69%), Gaps = 8/372 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +DA+A NIARRQLL          + FE  + + + FANDR ++AYVALQAW+ A+YSDP
Sbjct  44    SDAEASNIARRQLLSLREGDGDLPDDFEFDIHVDVTFANDRLRRAYVALQAWRRAMYSDP  103

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
             K  T  WVG +VCSY G+ C  ALDD    VVAG+D+N  DIAG+LP E+G+LTD+A  H
Sbjct  104   KNFTGGWVGADVCSYFGITCVPALDDAKTTVVAGVDLNGGDIAGYLPVELGMLTDIAFFH  163

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CGI+PK+ S L LL E+D SNN  VG FPDV+L++P LKYLDLR+N+F+G LPP
Sbjct  164   INSNRFCGIIPKSFSRLALLHELDVSNNRFVGGFPDVVLQIPMLKYLDLRFNDFDGTLPP  223

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDKDLD I +N+NR    +PENFGNSTA+V+VLANN F GC+P S+ RM  +++Q++L
Sbjct  224   HLFDKDLDAIFVNSNRFVGFIPENFGNSTATVVVLANNAFVGCIPRSVSRMADTLDQLML  283

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             LNN   GC+P E+  L N TV DV  N L+G LP+GL  M  LE    + N F+G V + 
Sbjct  284   LNNRLDGCIPPELAELINSTVVDVSGNALIGTLPEGLVNMTRLEQLDVSRNQFAGAVAER  343

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCVLERPGQKLPQK----CYEY  172
             +C LP L N SF+ N+F +E E+C+P +D  VA+DD  NC+    G +L QK    C   
Sbjct  344   ICKLPALANFSFAHNFFSVEAEACVPSEDSPVALDDRGNCL---DGGRLEQKPSLECAPV  400

Query  171   LSKPVDCSKTGC  136
             L+ PV+C    C
Sbjct  401   LAHPVNCRTNVC  412



>emb|CDY53036.1| BnaC03g73850D [Brassica napus]
Length=1096

 Score =   414 bits (1064),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 203/370 (55%), Positives = 263/370 (71%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + +RQLL  + E D   +  E+++D+ L+FAN+R K+AY+ALQAWK AIYS
Sbjct  30    ALTDEEASFLTKRQLLT-SPENDNLLDDIEYEVDVDLKFANNRLKRAYIALQAWKKAIYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   + NWVG NVCSY GVFC  ALDDP   VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  89    DPFNTSANWVGTNVCSYKGVFCAPALDDPNMMVVAGIDMNHADIAGYLPHELGLLTDVAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++S L L++E D SNN  VGPFP V L  PSLK+LD+RYN+FEG L
Sbjct  149   FHINSNRFCGIIPKSLSKLTLMYEFDVSNNRFVGPFPIVALSWPSLKFLDVRYNDFEGKL  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +FDKDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  209   PPEIFDKDLDAIFLNNNRFESIIPETIGKSTASVVTFAHNKFSGCIPKTIGKM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGC P EI  L+N+TVFD  +N  VG LP  L  + ++E   F+ N  +G VP
Sbjct  268   MFIGNNLSGCFPNEIGSLNNVTVFDASKNGFVGSLPSSLSLLDNVEQMDFSYNKLTGFVP  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLK-DGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS N+F  E +SC+P K      DD+ NC+  RP QK  ++C   +S
Sbjct  328   DSICKLPKLSNFTFSYNFFNGEAQSCVPGKSQDKQFDDTSNCLQNRPQQKSAKECLAVVS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>ref|XP_010690992.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Beta vulgaris subsp. vulgaris]
Length=625

 Score =   400 bits (1029),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/349 (53%), Positives = 246/349 (70%), Gaps = 1/349 (0%)
 Frame = -3

Query  1158  FEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDD  979
             F+ KL +   F N R ++AY+ALQAWK AIYSDP   TKNWVGPNVC Y G+FC  ALDD
Sbjct  59    FDQKLKVPFFFQNSRLRRAYIALQAWKLAIYSDPNDATKNWVGPNVCDYKGIFCSPALDD  118

Query  978   PTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFS  799
                 VV+G+D+NH DIAG+LP E+GLLTDLAL H+NSNR CGI+P++ S LK+L+E+D S
Sbjct  119   EKVTVVSGVDLNHEDIAGYLPVELGLLTDLALFHINSNRFCGIIPRSFSKLKVLYELDVS  178

Query  798   NNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFG  619
             NN  VG FP+V+L+L  LKYLDLR+NNFEG LPP +F++  D +LLN+NR +  +PE  G
Sbjct  179   NNRFVGVFPEVVLKLKELKYLDLRFNNFEGCLPPEVFNRPFDALLLNDNRFKCGIPETIG  238

Query  618   NSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQR  439
             NST S++VLANNKF+GC+P SIG M   VEQI+   N+ +GC+P EI LL N+TV D+ +
Sbjct  239   NSTVSLMVLANNKFTGCIPKSIGNMAGKVEQIVFQGNKLTGCMPTEIGLLHNVTVLDLSK  298

Query  438   NKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLP  259
             N  VG +P     +  +ES   +GN F+G V D LC LP+L    FS NYF+ E +SC P
Sbjct  299   NDFVGSIPSCFSSLGKMESLDLSGNKFTGFVSDDLCKLPSLNQFLFSSNYFKGEGKSCDP  358

Query  258   -LKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRAATKET  115
              +++ V  +D  NC+  RP Q+ P++C++ +S  +DC K  C   +K T
Sbjct  359   EVRNNVEFEDKKNCLPSRPNQRSPKECFQMVSSTIDCDKFNCGQPSKST  407



>ref|XP_002443305.1| hypothetical protein SORBIDRAFT_08g017290 [Sorghum bicolor]
 gb|EES17143.1| hypothetical protein SORBIDRAFT_08g017290 [Sorghum bicolor]
Length=527

 Score =   397 bits (1020),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 251/363 (69%), Gaps = 2/363 (1%)
 Frame = -3

Query  1218  NIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKN  1039
             +IARRQLL          + FE  + + + FAN+R ++AYVALQAW+ AIYSDPK  T  
Sbjct  52    HIARRQLLSLREGDGDLPDDFEFDIHVDVTFANERLRRAYVALQAWRRAIYSDPKNFTGG  111

Query  1038  WVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRI  859
             WVG +VCSY GV C  ALDD    VVAG+D+N  DIAG+LP E+GLLTD+A  H+NSNR 
Sbjct  112   WVGADVCSYFGVTCVPALDDAKTTVVAGVDLNGGDIAGYLPAELGLLTDIAFFHINSNRF  171

Query  858   CGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKD  679
             CGI+PK+ S L LL E+D SNN LVG FPDV+L++P LKYLDLR+N+F+G LPP LFDKD
Sbjct  172   CGIIPKSFSRLALLHELDVSNNRLVGGFPDVVLQIPVLKYLDLRFNDFDGTLPPHLFDKD  231

Query  678   LDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFS  499
             LD I +N+NR    +P+NFGNSTA+V+VLANN F GC+P S+GRM  +++Q++LLNN   
Sbjct  232   LDAIFVNSNRFVGFIPDNFGNSTATVVVLANNAFVGCIPRSVGRMAGTLDQLMLLNNRLD  291

Query  498   GCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPN  319
             GC+P E+  L N TV DV  N LVG LP+GL  M  LE    + N  +G V + +C LP 
Sbjct  292   GCIPPELAELVNSTVVDVSGNALVGTLPEGLVNMTRLEQLDVSRNQLAGAVEERVCKLPA  351

Query  318   LKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCVL-ERPGQKLPQKCYEYLSKPVDCSK  145
             L N SF+ N+F +E E+C+P  D  VA+DDS NC+   RP QK   +C   L+ PVDC  
Sbjct  352   LANFSFAHNFFSVEAEACVPSMDSPVALDDSGNCLHGGRPEQKSSLECTPVLAHPVDCRT  411

Query  144   TGC  136
               C
Sbjct  412   NVC  414



>ref|XP_006393251.1| hypothetical protein EUTSA_v10012214mg [Eutrema salsugineum]
 gb|ESQ30537.1| hypothetical protein EUTSA_v10012214mg [Eutrema salsugineum]
Length=811

 Score =   406 bits (1043),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 243/344 (71%), Gaps = 2/344 (1%)
 Frame = -3

Query  1152  HKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPT  973
             +K+D  L F NDR K+AY+ALQAWK AIYSDP   TKNWVG +VCSYNGV+C  ALDDP+
Sbjct  47    NKIDPNLRFENDRLKRAYIALQAWKKAIYSDPFKTTKNWVGSDVCSYNGVYCAEALDDPS  106

Query  972   QWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNN  793
               VVAG+D+NH+DIAGHLP E+GL+TDLA+ H+NSNR CGI+PK++S L L++E D SNN
Sbjct  107   LTVVAGVDLNHADIAGHLPPELGLITDLAMFHINSNRFCGIIPKSLSKLVLMYEFDVSNN  166

Query  792   WLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNS  613
               VG FP+V L  PSLKYLDLRYN FEG+LP  +FDK+LD I LNNNR ES +P   G S
Sbjct  167   RFVGQFPEVSLSWPSLKYLDLRYNEFEGSLPSEIFDKNLDAIFLNNNRFESVIPGTIGKS  226

Query  612   TASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNK  433
             TASV+  ANNKFSGC+P SIG+M +++ +++   N  +GC P EI  L+N+TVFD   N 
Sbjct  227   TASVVTFANNKFSGCIPKSIGQM-KNLNEVVFTGNNLTGCFPNEIGSLNNVTVFDASNNG  285

Query  432   LVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLK  253
               G +P  L  + S+E    + N  +G V D  C LPNL+N  FS NYF  E ESC+P K
Sbjct  286   FFGSVPSSLSGLASVEQLDLSNNKLTGFVADTFCKLPNLENFKFSFNYFSGEAESCVPGK  345

Query  252   -DGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRAAT  124
              +G   DD+ NC+  RP QK  ++C   +S+PVDCSK  C   +
Sbjct  346   NNGKQFDDTSNCLKNRPNQKSVRQCLPVVSRPVDCSKDKCSGGS  389



>emb|CDY51859.1| BnaC03g77110D [Brassica napus]
Length=657

 Score =   401 bits (1031),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/378 (50%), Positives = 254/378 (67%), Gaps = 4/378 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +  +A  + RRQLL      +   +  E+++DLK  FAN R KKAY+ALQAWK AIYS
Sbjct  33    AISQTEAAFLVRRQLLTLPENGELPND-IEYEVDLKATFANSRLKKAYIALQAWKKAIYS  91

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC+Y GV C  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  92    DPFNTTGNWHGPHVCNYTGVICAPALDDPNVTVVAGVDLNGADIAGHLPAELGLMTDVAM  151

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P + S L L+ E D SNN  VGPFP VIL  P +KY D+R+N+FEG +
Sbjct  152   FHLNSNRFCGIIPNSFSKLTLMHEFDVSNNCFVGPFPCVILTWPDVKYFDVRFNDFEGQV  211

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K+LD I LNNNR  S +PE+ G+STASV+  ANNKF+GC+P SIG M +S+ +I
Sbjct  212   PPELFKKELDAIFLNNNRFTSTIPESLGDSTASVVTFANNKFTGCIPKSIGNM-KSLNEI  270

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI +LSN+TVFD  +N  +G LP     +  +E    +GN  +G + 
Sbjct  271   VFMDNGLGGCFPSEIGMLSNVTVFDASKNSFIGRLPTTFAGLTGVEELDISGNKLTGLLA  330

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +D SC+P   +  + +DD+ NC+ +RP Q+  Q+C   +
Sbjct  331   DSICKLPNLVNFTYSYNYFNGQDGSCVPGGGRKEIVLDDTRNCLPDRPEQRSAQECAVVI  390

Query  168   SKPVDCSKTGCRAATKET  115
             ++PVDCSK  C      T
Sbjct  391   NRPVDCSKDKCAGGGSST  408



>ref|XP_009136040.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1, partial [Brassica rapa]
Length=1022

 Score =   411 bits (1057),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/370 (54%), Positives = 259/370 (70%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + +RQLL    E D   +  E+++D  L+FAN+R K+AY+ALQAWK AIYS
Sbjct  30    ALTDEEASFLTKRQLLTLP-ENDNLLDDIEYEVDADLKFANNRLKRAYIALQAWKKAIYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   + NWVG NVCSY GVFC  ALDDP   VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  89    DPFNTSSNWVGTNVCSYKGVFCAPALDDPNMMVVAGIDMNHADIAGYLPHELGLLTDVAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++S L L++E D SNN  VGPFP V L  PSLK+LD+RYN+FEG L
Sbjct  149   FHINSNRFCGIIPKSLSKLTLMYEFDVSNNRFVGPFPIVALSWPSLKFLDVRYNDFEGKL  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +FDKDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG+M +++ +I
Sbjct  209   PPEIFDKDLDAIFLNNNRFESIIPETIGKSTASVVTFAHNKFSGCIPKTIGKM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N  SGC P EI  L+N+TVFD  +N  VG LP  L  + ++E   F+ N  +G V 
Sbjct  268   MFIGNNLSGCFPNEIGSLNNVTVFDASKNGFVGSLPSSLSLLDNVEQMDFSYNKLTGFVT  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C LP L N +FS N+F  E +SC+P        DD+ NC+  RP QK  ++C   +S
Sbjct  328   DNICKLPKLSNFTFSYNFFNGEAQSCVPGTSQDKQFDDTSNCLQNRPQQKSAKECLPVVS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>ref|XP_006285576.1| hypothetical protein CARUB_v10007020mg [Capsella rubella]
 gb|EOA18474.1| hypothetical protein CARUB_v10007020mg [Capsella rubella]
Length=700

 Score =   402 bits (1034),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 251/371 (68%), Gaps = 4/371 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL    E D      E+++DLK  FAN R K+AY+ALQAWK AI+S
Sbjct  44    ALTDTEAAFIVQRQLLTLP-ENDELPNDIEYEVDLKATFANTRLKRAYIALQAWKKAIFS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VCSY GV C  ALDD    VVAG+D+N +DIAGHLP EIGL+TD+A+
Sbjct  103   DPFNTTANWHGPHVCSYTGVVCAPALDDSDVTVVAGVDLNGADIAGHLPAEIGLMTDVAM  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VGPFP V+L  P +KY DLR+N+FEG +
Sbjct  163   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGPFPKVVLSWPDVKYFDLRFNDFEGQV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K LD I LNNNR  S +PE+ G S ASV+  ANNKF+GC+P SIG M +++ +I
Sbjct  223   PPELFKKQLDAIFLNNNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNM-KNLNEI  281

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI  LSN+TVFD  +N  +G LP     +  +E    +GN  +G VP
Sbjct  282   VFMDNGLGGCFPSEIGKLSNVTVFDASKNSFIGRLPTSFAGLTGVEEFDISGNKLTGLVP  341

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +D SC+P   +  +A+DD+ NC+  RP Q+  Q+C   +
Sbjct  342   DNICKLPNLVNFTYSYNYFNGQDGSCVPGGGRKEIALDDTRNCLPARPDQRSAQECAVVI  401

Query  168   SKPVDCSKTGC  136
             ++PVDCSK  C
Sbjct  402   NRPVDCSKDKC  412



>gb|KGN45680.1| hypothetical protein Csa_6G006180 [Cucumis sativus]
Length=617

 Score =   400 bits (1027),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/369 (54%), Positives = 250/369 (68%), Gaps = 3/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             + ++A+A  + RR+LL      +   + F+++LD+   F N+R KKAY ALQAWK A+YS
Sbjct  30    SLSEAEASYLTRRRLLTLKNHYELPDD-FQYELDIADTFPNERLKKAYRALQAWKLAVYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP+ +T NWVG +VCSY GVFC  ALDDP   VVAGID+NH DIAGHLP E+GLLTDLAL
Sbjct  89    DPQNMTANWVGADVCSYTGVFCAPALDDPKIEVVAGIDLNHGDIAGHLPPELGLLTDLAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P + SNL L+FE D SNN  VG FP V+LE PS KYLDLRYN+FEG +
Sbjct  149   FHINSNRFCGIIPSSFSNLVLMFEFDVSNNRFVGHFPLVVLEWPSAKYLDLRYNDFEGEI  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LF K+ D I LNNNR  S +PE  GNST SV+  ANN+F GC+PS+IG+M  ++ QI
Sbjct  209   PSTLFTKEFDAIFLNNNRFNSLIPETIGNSTVSVVSFANNEFHGCIPSTIGQM-SNLNQI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             L L N+ SGC P EI  L N+TVFDV  N  +G+LP+ L  +Q+LE    + N   G V 
Sbjct  268   LFLGNKLSGCFPPEIGNLVNLTVFDVSNNDFIGQLPESLSSLQNLEIMDVSNNELRGSVS  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV-DDSDNCVLERPGQKLPQKCYEYLS  166
              GLC LP L N +FS NYF+ ED +C   K    + DDS NC+  RP QK   KC   L 
Sbjct  328   GGLCKLPKLANFTFSFNYFDGEDAACATSKGSEKLFDDSQNCLANRPMQKDANKCSTVLK  387

Query  165   KPVDCSKTG  139
             K VDC   G
Sbjct  388   KSVDCGNCG  396



>ref|XP_007013226.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY30845.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=740

 Score =   403 bits (1036),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 204/369 (55%), Positives = 250/369 (68%), Gaps = 6/369 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TD +   I +RQLL++  E  F   G    +D  L F N R + AY+ALQAWK AI S
Sbjct  38    GLTDQEVLYIKQRQLLYYRDE--FGDRGERVTVDPSLVFENPRLRNAYIALQAWKQAILS  95

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG  VC+Y GVFC  A D+     VAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  96    DPFNLTGNWVGSEVCNYTGVFCAAAPDNKKIKTVAGIDLNHGDIAGYLPEELGLLTDLAL  155

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP    NLK+LFE+D SNN   G FPDV+L+LP LK+LDLR+N FEG +
Sbjct  156   FHINSNRFCGTVPHKFINLKILFELDLSNNRFAGKFPDVVLKLPKLKFLDLRFNEFEGTV  215

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   N+P+NFGNS  SVIVLANNKF GCVPSS+G M   +E+I
Sbjct  216   PKELFDKDLDAIFINHNRFRFNIPDNFGNSPVSVIVLANNKFHGCVPSSLGNM-SGLEEI  274

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN F  CLPEEI +L N+TVFDV  N+L+G LP  +G M SLE  + A NM SG +P
Sbjct  275   ILMNNGFRSCLPEEIGMLKNLTVFDVSFNELMGPLPDKIGEMVSLEQLNVAHNMLSGEIP  334

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +C LP L+N +FS N+F  E   CL L+D    DD  NC+  RP Q+   +C  +LSK
Sbjct  335   ASICKLPKLQNFTFSYNFFTGEPPVCLSLQD---FDDRRNCLPARPLQRSAAQCKSFLSK  391

Query  162   PVDCSKTGC  136
             PVDCS   C
Sbjct  392   PVDCSSFRC  400



>emb|CDY18563.1| BnaA01g26320D [Brassica napus]
Length=638

 Score =   400 bits (1028),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 195/373 (52%), Positives = 259/373 (69%), Gaps = 3/373 (1%)
 Frame = -3

Query  1239  FTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSD  1060
              T+ +   + +RQLL  +   D S +  E+++DL L+FAN R K+AY+ALQAWK AIYSD
Sbjct  31    LTNEETSFLTKRQLLALSENEDLSDD-MEYEVDLNLKFANTRLKRAYIALQAWKKAIYSD  89

Query  1059  PKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALI  880
             P   + NW+G NVCSY GVFC  ALDD +  VVAGIDINH+DIAG+LP E+GLLTD+AL 
Sbjct  90    PFNTSANWIGQNVCSYKGVFCAPALDDQSIMVVAGIDINHADIAGYLPPELGLLTDVALF  149

Query  879   HMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALP  700
             H+NSNR CG++PK++S L L++E D SNN  VG FP V L  PSLK+LD+RYN+FEG LP
Sbjct  150   HVNSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGSFPMVALSWPSLKFLDIRYNDFEGKLP  209

Query  699   PSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQIL  520
               +F+KDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG M +++ +I+
Sbjct  210   ADIFNKDLDAIFLNNNRFESIIPETIGESTASVVTFAHNKFSGCIPKTIGHM-KNLNEIV  268

Query  519   LLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPD  340
              + N+ SGC P EI  L+N+TVFD   N+ VG LP  L  + ++E   F+ N  +G V D
Sbjct  269   FIGNKLSGCFPNEIGSLNNVTVFDASNNEFVGSLPLSLSSLTNVEQMDFSFNKLTGFVTD  328

Query  339   GLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
              +C LP L N +FS N+F  E +SC+P        DD++NC+  RP QKL  +C   +++
Sbjct  329   DVCKLPKLSNFTFSYNFFNGEAQSCVPGTSQDKQFDDTNNCLQNRPKQKLANECLPVITR  388

Query  162   PVDCSKTGCRAAT  124
             PVDCSK  C  +T
Sbjct  389   PVDCSKDKCAVST  401



>emb|CDX89681.1| BnaC03g45950D [Brassica napus]
Length=784

 Score =   404 bits (1039),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/370 (51%), Positives = 260/370 (70%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  IA+RQLL      D   +  E+++DLK  FAN+R K+AY+ALQAWK A+YS
Sbjct  26    ALTDAEASFIAQRQLLTLPENGDLPDD-IEYEVDLKETFANNRLKRAYIALQAWKKAVYS  84

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GVFC  ALDDP+  VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  85    DPFNTTGNWHGPHVCGYTGVFCAPALDDPSVAVVAGVDLNGADIAGHLPVELGLMTDVAM  144

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++  LKL++E D SNN  VGPFP V+L  P++K++DLR+N+FEG +
Sbjct  145   FHLNSNRFCGIIPKSLDRLKLMYEFDASNNRFVGPFPSVVLSWPAVKFIDLRFNDFEGQV  204

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF KDLD I LNNNR  S +PE+ G S+ASV+  A+NKF+GCVP SIG M +++ +I
Sbjct  205   PPQLFKKDLDAIFLNNNRFTSTIPESLGESSASVVTFAHNKFNGCVPKSIGNM-KNLNEI  263

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N   GC P EI  L+N+ VFD   N   G LP+    +  +E    +GN  +G VP
Sbjct  264   IFKDNRLGGCFPSEIGKLANVNVFDASMNSFTGVLPQSFVGLTGVEEIDISGNKLTGFVP  323

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L NL+++ NYF  + +SC+P  +  +A+DD+ NC+ +RP Q+  ++C   +S
Sbjct  324   ENICKLPKLVNLTYAYNYFNGQGDSCVPGSQKEIALDDTRNCLPDRPKQRSAKECAVVIS  383

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  384   RPVDCSKDKC  393



>ref|XP_009336917.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=750

 Score =   403 bits (1036),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 203/370 (55%), Positives = 253/370 (68%), Gaps = 6/370 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A  I  RQLL++  E  F   G    +D  L F NDR + AY+ALQA K AI S
Sbjct  49    ALSDEEALYIKNRQLLYYRDE--FGDRGELVTVDPSLVFENDRLRNAYIALQALKQAILS  106

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  IT NWVG NVC+Y GVFC  ALD+ T   VAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  107   DPLNITGNWVGSNVCNYTGVFCTKALDNRTIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  166

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP   + LKLLFE+D SNN   G FP V+L+LP LK+LDLR+N FEG +
Sbjct  167   FHINSNRFCGTVPHKFNRLKLLFELDLSNNRFAGKFPRVVLQLPKLKFLDLRFNEFEGTV  226

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   +LP+NFGNS  SVIVLANNKF GCVP+S+G M  ++ +I
Sbjct  227   PKELFDKDLDAIFINHNRFRFDLPDNFGNSPVSVIVLANNKFHGCVPASLGNMS-NLNEI  285

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN F  CLP EI +L N+TVFDV  N+ +G LP+ +G M SLE  + A N+ SG +P
Sbjct  286   ILMNNGFRSCLPPEIGMLKNLTVFDVSFNQFLGSLPESIGGMVSLEQLNVAHNLLSGKIP  345

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +CSLPNL+N ++S N+F  E   CL L      DD  NC+  RP Q+   +C  +LSK
Sbjct  346   ASICSLPNLQNFTYSYNFFTSEPPVCLGL---AGFDDKRNCLPNRPAQRTAAQCKSFLSK  402

Query  162   PVDCSKTGCR  133
             PVDCS   C+
Sbjct  403   PVDCSSFRCK  412



>ref|XP_010479383.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Camelina sativa]
Length=888

 Score =   407 bits (1046),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 241/339 (71%), Gaps = 2/339 (1%)
 Frame = -3

Query  1149  KLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQ  970
             K+D  L F NDR K+AY+ALQAWK AIYSDP   T NWVG NVCSYNGV+C  ALDDP+ 
Sbjct  52    KVDPNLRFENDRLKRAYIALQAWKKAIYSDPFKTTSNWVGSNVCSYNGVYCAPALDDPSL  111

Query  969   WVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNW  790
              VVAG+D+NH+DI+GHLP E+GL+TDLAL H+NSNR CGI+PK++S L L++E D SNN 
Sbjct  112   NVVAGVDLNHADISGHLPPELGLMTDLALFHINSNRFCGIIPKSLSKLALMYEFDVSNNR  171

Query  789   LVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNST  610
              VG FPDV L  PSLKYLD+RYN FEG+LPP +FDKDLD I LNNNR ES +P   G S 
Sbjct  172   FVGKFPDVSLLWPSLKYLDIRYNEFEGSLPPEIFDKDLDAIFLNNNRFESFIPGTIGKSK  231

Query  609   ASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKL  430
             ASV+  ANNKF+GC+P SIG M +++ +I+   N  +GC P EI LL+N+TVFD  +N  
Sbjct  232   ASVVTFANNKFTGCIPKSIGNM-KNLNEIVFTGNNLTGCFPNEIGLLNNVTVFDASKNGF  290

Query  429   VGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD  250
             VG LP  L  + S+E    + N  +G V D  C LP+L++  FS N+F  E ESC+P ++
Sbjct  291   VGSLPSSLSGLASIEQFDLSHNKLTGFVVDKFCKLPSLESFKFSYNFFNGEAESCVPGRN  350

Query  249   G-VAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
                  DD +NC+  RP QK   +C+  +S+PVDCSK  C
Sbjct  351   NEKQFDDKNNCLQNRPSQKSANQCFPVVSRPVDCSKDKC  389



>emb|CDY51948.1| BnaA08g11700D [Brassica napus]
Length=660

 Score =   400 bits (1028),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 189/378 (50%), Positives = 254/378 (67%), Gaps = 4/378 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A ++ +A  + RRQLL      +   +  E+++DLK  FAN R KKAY+ALQAWK AIYS
Sbjct  33    AISETEAAFLVRRQLLTLPENGELPND-IEYEVDLKATFANSRLKKAYIALQAWKKAIYS  91

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC+Y GV C  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  92    DPFNTTGNWHGPHVCNYTGVICAPALDDPNVTVVAGVDLNGADIAGHLPAELGLMTDVAM  151

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P + S L L+ E D SNN  VG FP VIL  P +KY D+R+N+FEG +
Sbjct  152   FHLNSNRFCGIIPNSFSKLTLMHEFDVSNNCFVGSFPCVILTWPDVKYFDVRFNDFEGQV  211

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K+LD I LNNNR  S +PE+ G+STASV+  ANNKF+GC+P SIG M +S+ +I
Sbjct  212   PPELFKKELDAIFLNNNRFTSTIPESLGDSTASVVTFANNKFTGCIPKSIGNM-KSLNEI  270

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI +LSN+TVFD  +N  +G LP     +  +E    +GN  +G + 
Sbjct  271   VFMDNGLGGCFPSEIGMLSNVTVFDASKNSFIGRLPTSFAGLTGVEELDISGNKLTGLLA  330

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +D SC+P   +    +DD+ NC+ +RP Q+L Q+C   +
Sbjct  331   DSICKLPNLVNFTYSYNYFNGQDGSCVPGGGRKETVLDDTRNCLPDRPEQRLAQECAVVI  390

Query  168   SKPVDCSKTGCRAATKET  115
             ++PVDCSK  C      T
Sbjct  391   NRPVDCSKDKCAGGGSST  408



>ref|XP_008366033.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific leucine-rich 
repeat extensin-like protein 3 [Malus domestica]
Length=922

 Score =   408 bits (1048),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 192/374 (51%), Positives = 266/374 (71%), Gaps = 2/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+  +I RRQLLHF  E D   +  E++++L + F + R ++AY+ALQAWK AIYS
Sbjct  150   ALTDAEVSSITRRQLLHFH-EGDDQRDEKEYEVELNVTFPHTRLRRAYIALQAWKKAIYS  208

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T+NWVG +VC+Y GVFC  ALDDP   VVAGIDINH+DIAG+LP E+GLL+D+AL
Sbjct  209   DPLKTTENWVGGDVCAYTGVFCAPALDDPKIEVVAGIDINHADIAGYLPVELGLLSDIAL  268

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+N+NR CG++PK+ + L LL E+D SNN  VG FP+V+L++P+LKYLDLR+N+FEG L
Sbjct  269   FHINTNRFCGVIPKSFARLTLLHELDVSNNQFVGSFPEVVLKIPNLKYLDLRFNDFEGKL  328

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF+K+LD + LNNN+  S +P+  GNS  SV+V++NN+  GC+P +IG M  ++ ++
Sbjct  329   PXELFNKELDALFLNNNKFTSTIPDTLGNSPVSVLVVSNNRLEGCIPHTIGXMVNTLNEV  388

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +   N+F GCLP EI  LSN+TVFDV  N   G + K     Q +E  + A NM +G VP
Sbjct  389   IFSENKFGGCLPNEIGYLSNVTVFDVSSNTFNGIMSKKFEGFQKVEELNIAHNMLTGFVP  448

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPL-KDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + LC+LP+L N +FS NYF  E + C+P+ + GV  +D++NC+ +RP QK  ++C   +S
Sbjct  449   ECLCNLPSLGNFTFSYNYFNGEAKXCVPVSQKGVVFEDTNNCLPDRPKQKSAKQCQVVVS  508

Query  165   KPVDCSKTGCRAAT  124
             KPVDCSK  C   +
Sbjct  509   KPVDCSKAKCXXGS  522



>ref|XP_002281292.2| PREDICTED: leucine-rich repeat extensin-like protein 4 [Vitis 
vinifera]
Length=752

 Score =   403 bits (1036),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 199/368 (54%), Positives = 253/368 (69%), Gaps = 5/368 (1%)
 Frame = -3

Query  1239  FTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSD  1060
              TDA+   I RRQLL++  E  F   G +  +D  L F N RQ+ AY+ALQAWK AI SD
Sbjct  38    LTDAEVMYIKRRQLLYYRDE--FGDRGEDVTVDPSLVFENPRQRNAYIALQAWKQAILSD  95

Query  1059  PKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALI  880
             P  +T NWVG NVC+Y GV+C  A D+ +   VAGID+NH DIAG+LP E+GLLTDLAL 
Sbjct  96    PLNLTLNWVGSNVCNYTGVYCAQAPDNSSIRTVAGIDLNHGDIAGYLPEELGLLTDLALF  155

Query  879   HMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALP  700
             H+NSNR CG VP   + LK+LFE+D SNN   G FP+V+L LP+LK+LDLR+N FEG +P
Sbjct  156   HINSNRFCGTVPHKFAKLKILFELDLSNNRFAGKFPEVVLHLPTLKFLDLRFNEFEGTVP  215

Query  699   PSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQIL  520
               LFDKDLD I +N+NR   +LP+NFGNS  SVIV+ANNK  GCVP+S+G M  ++ +I+
Sbjct  216   KELFDKDLDAIFINHNRFAFDLPDNFGNSPVSVIVVANNKLHGCVPASLGNMADTLNEII  275

Query  519   LLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPD  340
             L+NN+F  CLP EI LL N+TV DV  N L+G LPK +G M  LE  + A NM SG +P 
Sbjct  276   LMNNQFRSCLPVEIGLLKNLTVLDVSYNGLLGPLPKEIGGMVELEQLNVAHNMLSGSIPA  335

Query  339   GLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKP  160
              +C LPNL+N +FS N+F  E  +CL L D    +D  NC+  RP Q+   +C  +LS+P
Sbjct  336   SICKLPNLENFTFSYNFFTGEPPACLGLAD---FEDRRNCLPGRPEQRSAGQCNSFLSRP  392

Query  159   VDCSKTGC  136
             VDCS   C
Sbjct  393   VDCSSFRC  400



>ref|XP_011043443.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Populus euphratica]
Length=661

 Score =   400 bits (1028),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 204/393 (52%), Positives = 256/393 (65%), Gaps = 6/393 (2%)
 Frame = -3

Query  1314  LSIIMAAVGClvflsllsfssisLAFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLK  1135
             +++ +  V CL         S     +DADA  I +RQLL++  E  F   G    +D  
Sbjct  15    VALFLGTVVCLSAAKQAPTISSYGGLSDADAMYIKKRQLLYYKDE--FGDRGERVTVDPS  72

Query  1134  LEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAG  955
             L F N R + AY+ALQAWK AI+SDP  +T NWVG  VC+Y GVFC  A D+ T   VAG
Sbjct  73    LVFPNPRLRNAYIALQAWKQAIFSDPLNLTANWVGSQVCNYEGVFCAPAPDNKTILTVAG  132

Query  954   IDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPF  775
             ID+NH DIAG+LP E+GLL DLAL H+NSNR CG VP+   +++LLFE+D SNN   G F
Sbjct  133   IDLNHGDIAGYLPEELGLLVDLALFHINSNRFCGTVPRKFKDMRLLFELDLSNNRFAGKF  192

Query  774   PDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIV  595
             P V+L+LPSLK+LDLR+N FEG +P  LFDKDLD I +N+NR   +LPEN GNS  SVIV
Sbjct  193   PQVVLKLPSLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFVFDLPENLGNSPVSVIV  252

Query  594   LANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELP  415
             LANNKF GCVPSSIG M  ++ +I+L+NN F  C+P EI LL ++TV DV  N+L+G LP
Sbjct  253   LANNKFHGCVPSSIGNMS-NLNEIILMNNGFRSCMPAEIGLLKDLTVLDVSFNQLMGPLP  311

Query  414   KGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVD  235
                G M SLE  + A NM SG +P  +C LPNL N +FS N+F  E   CL L D     
Sbjct  312   DAFGGMVSLEQLNVAHNMLSGKIPASICKLPNLDNFTFSYNFFTGEPPVCLSLPD---FS  368

Query  234   DSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
             D  NC+  RP Q+   +C  +LS+PVDCS   C
Sbjct  369   DRRNCLPARPLQRSAAQCKAFLSRPVDCSSFRC  401



>ref|XP_003602966.1| Serine/threonine protein kinase BRI1-like protein [Medicago truncatula]
 gb|AES73217.1| pollen-specific LRR extensin-like protein, putative [Medicago 
truncatula]
Length=685

 Score =   401 bits (1030),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/376 (51%), Positives = 253/376 (67%), Gaps = 2/376 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A ++ +A +IARRQ+LH     D   E +       L+F N   K AY+ALQAWK AIYS
Sbjct  24    AISNEEAASIARRQMLHLQENEDLP-ENYVDTYKTDLKFPNPNLKSAYIALQAWKKAIYS  82

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GPNVCSYNG+FC  +L+D    VVAGID+N +DIAG++P E GLL D+AL
Sbjct  83    DPTNFTSNWEGPNVCSYNGIFCAASLNDSKIQVVAGIDLNQADIAGYIPAEFGLLADIAL  142

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             +H+NSNR CG++PK+ S LKLL E+D SNN  VG FP  +L +P +K++D+R+N FEG +
Sbjct  143   LHINSNRFCGVLPKSFSKLKLLHELDISNNRFVGKFPCHVLSIPDIKFIDIRFNEFEGEI  202

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF+K LD I +NNNR  S +PEN GNS ASVIV ANN  SGC+PSSIG+M +++ + 
Sbjct  203   PPELFNKTLDAIFINNNRFTSTIPENMGNSPASVIVFANNGISGCIPSSIGQM-KNLNEF  261

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +++ N  +GCLPE+I  L  + VFDV  N  VG LPK L  +  +E  S A N  +G VP
Sbjct  262   VVIGNNLTGCLPEDIGKLQQLAVFDVSENLFVGALPKTLQGLSEVEVISIAHNKLTGSVP  321

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +CSLPNL N +FS NYF +E+E C+P    + ++D DNC+  RP QK    C   +SK
Sbjct  322   KSICSLPNLANFTFSYNYFNVEEEGCVPPGKEIELEDMDNCIPNRPKQKTTNDCNVVISK  381

Query  162   PVDCSKTGCRAATKET  115
             PVDC+K  C +   ++
Sbjct  382   PVDCTKGLCSSKPSQS  397



>gb|AID60115.1| leucine-rich repeat (LRR) family protein [Brassica napus]
 gb|AID60158.1| leucine-rich repeat (LRR) family protein [Brassica napus]
 emb|CDX75393.1| BnaA01g03090D [Brassica napus]
Length=666

 Score =   400 bits (1028),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 191/379 (50%), Positives = 254/379 (67%), Gaps = 4/379 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFS-GEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIY  1066
             A +D++A  + RRQLL      D    +  E+++DLK  FAN R KKAY+ALQAWK AIY
Sbjct  27    AISDSEAAFLVRRQLLTLPENGDGELPDDIEYEVDLKATFANTRLKKAYIALQAWKKAIY  86

Query  1065  SDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLA  886
             SDP   T NW GP+VC+Y GV C  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+A
Sbjct  87    SDPFNTTANWHGPHVCAYTGVVCAPALDDPNVTVVAGVDLNGADIAGHLPVELGLMTDVA  146

Query  885   LIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGA  706
             + H+NSNR CGI+PK+   +KL+ E D S+N  VGPFP+VIL  PS KY DLR+N+FEG 
Sbjct  147   MFHLNSNRFCGIIPKSFEKMKLMHEFDVSSNCFVGPFPNVILSWPSAKYFDLRFNDFEGQ  206

Query  705   LPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQ  526
             +PP LF K+LD I LNNNR  S +PE  G STASV+  ANNKF+GC+P S+G M +++ +
Sbjct  207   VPPELFKKELDAIFLNNNRFTSVIPETLGESTASVVTFANNKFTGCIPKSVGNM-KNLNE  265

Query  525   ILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHV  346
             I+ ++N   GC P EI  LSN+TVFD  +N  VG LP     +  +E    +GN  +G V
Sbjct  266   IVFMDNGLGGCFPSEIGKLSNVTVFDASKNSFVGRLPTSFVGLTGVEELDISGNKLTGLV  325

Query  345   PDGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEY  172
              D +C LPNL N ++S NYF  +  SC+P   +  + +DD+ NC+ +RP Q+  Q+C   
Sbjct  326   GDEICKLPNLVNFTYSYNYFNGQGGSCIPGGGRKEIVLDDTRNCLTDRPDQRSAQECAVV  385

Query  171   LSKPVDCSKTGCRAATKET  115
             +++PVDCSK  C      T
Sbjct  386   INRPVDCSKDKCAGGGSST  404



>ref|XP_008219840.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Prunus 
mume]
Length=559

 Score =   397 bits (1019),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 196/362 (54%), Positives = 250/362 (69%), Gaps = 5/362 (1%)
 Frame = -3

Query  1218  NIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKN  1039
             +I +RQLL +  +    GE     +   L F N R + AYVALQAWK A+ SDP G T N
Sbjct  39    HINQRQLLFYTDQDGSRGELV--AVPSSLVFHNPRLRSAYVALQAWKQAMLSDPLGETSN  96

Query  1038  WVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRI  859
             WVG N+CSY GVFC  ALDDP+   VAGID+NH  IAG+LP E+GLL+D+AL H+NSNR 
Sbjct  97    WVGSNICSYTGVFCSRALDDPSVETVAGIDLNHGGIAGYLPEELGLLSDIALFHINSNRF  156

Query  858   CGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKD  679
             CG VPK+ S LKLLFE+D SNN   G FP V+L+LP LK+LDLR+N FEG +P  LFDKD
Sbjct  157   CGSVPKSFSKLKLLFELDLSNNRFAGKFPLVVLQLPKLKFLDLRFNEFEGKVPKELFDKD  216

Query  678   LDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFS  499
             LD I +N+NR    LP+NFGNS  SVIVLANN F GCVP+S+G M +++ +++L NN F 
Sbjct  217   LDAIFINHNRFSFKLPDNFGNSPVSVIVLANNNFHGCVPASLGNMSKNLNEVVLTNNGFH  276

Query  498   GCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPN  319
              CLP+EI +L ++T+FDV  N++VGELP+ +G M SLE+ + A NM  G++P+ +C L N
Sbjct  277   SCLPKEIGMLKDVTLFDVSYNQIVGELPEAVGEMVSLEALNVAHNMLRGNIPESVCELQN  336

Query  318   LKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTG  139
             L+N SF  N+F  E  +CL L+     DDS NC+  RP Q+    C   LSK V CS  G
Sbjct  337   LRNFSFEHNFFTSEQPTCLKLEK---FDDSKNCLRRRPKQRTMLHCKLALSKGVRCSSFG  393

Query  138   CR  133
             CR
Sbjct  394   CR  395



>ref|XP_008242638.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Prunus 
mume]
Length=667

 Score =   400 bits (1028),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 200/370 (54%), Positives = 252/370 (68%), Gaps = 6/370 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A + A+A  I +RQLL++  E  F   G    +D  L F N R + AY+ALQAWK AI S
Sbjct  44    ALSHAEALYIKQRQLLYYRDE--FGDRGELVTVDPSLVFENQRIRNAYIALQAWKQAILS  101

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG NVCSY GVFC  ALD+ +   VAGID+NH DIAG+LP E+GLL DLAL
Sbjct  102   DPLNLTGNWVGSNVCSYTGVFCTKALDNSSIRTVAGIDLNHGDIAGYLPEELGLLADLAL  161

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP     LKLLFE+D SNN   G FP V+L+LP LK+LDLR+N FEG +
Sbjct  162   FHINSNRFCGTVPHKFKQLKLLFELDISNNRFAGKFPRVVLQLPKLKFLDLRFNEFEGTV  221

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   +LP+NFGNS  SVIVLANNKF GCVP+S+G M  ++ +I
Sbjct  222   PKELFDKDLDAIFINHNRFRFDLPDNFGNSPVSVIVLANNKFHGCVPASLGNMS-NLNEI  280

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN F  CLPEEI +L N+TVFDV  N+ +G LP+ +G M SLE  + A N+ SG +P
Sbjct  281   ILMNNGFRSCLPEEIGMLKNLTVFDVSFNQFLGSLPETIGGMVSLEQLNVAHNLLSGTIP  340

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +CSLP L+N ++S N+F  E   CL L    + DD  NC+  RP Q+   KC  +LS+
Sbjct  341   ASICSLPRLQNFTYSYNFFTGEPPVCLGL---ASFDDKRNCLPNRPAQRPAAKCKSFLSR  397

Query  162   PVDCSKTGCR  133
             PVDC    C+
Sbjct  398   PVDCKSFRCK  407



>gb|AGT17388.1| hypothetical protein SHCRBa_176_L06_F_110 [Saccharum hybrid cultivar 
R570]
Length=605

 Score =   398 bits (1023),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 193/366 (53%), Positives = 251/366 (69%), Gaps = 2/366 (1%)
 Frame = -3

Query  1227  DAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGI  1048
             +A +IARRQLL          + FE  + + + FAN+  ++AYVALQAW+ A+YSDPK  
Sbjct  47    EASDIARRQLLSLREGDGDLPDDFEFDIHVDVTFANNHLRRAYVALQAWRRAMYSDPKNF  106

Query  1047  TKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNS  868
             T  WVG +VCSY GV C  ALDD    VVAG+D+N  DIAG+LP E+G+LTD+A  H+NS
Sbjct  107   TGGWVGADVCSYFGVTCVPALDDAKTTVVAGVDLNGGDIAGYLPAELGMLTDIAFFHINS  166

Query  867   NRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLF  688
             NR CGI+PK+ S L LL E+D SNN  VG FPDV+L++P LKYLDLR+N+F+G LPP LF
Sbjct  167   NRFCGIIPKSFSRLALLHELDVSNNRFVGGFPDVVLQIPVLKYLDLRFNDFDGTLPPHLF  226

Query  687   DKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNN  508
             DKDLD I +N+NR    +PENFGNSTA+V+VLANN F GC+P S+GRM  +++Q++LLNN
Sbjct  227   DKDLDAIFVNSNRFVGFIPENFGNSTATVVVLANNAFVGCIPRSVGRMADTLDQLMLLNN  286

Query  507   EFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCS  328
                GC+P E+  L N TV DV  N L+G LP+GL  M  LE    + N  +G V + +C 
Sbjct  287   RLDGCIPPELAELINSTVVDVSGNALIGTLPEGLVNMTRLEQLDVSRNQLAGAVAERVCK  346

Query  327   LPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCV-LERPGQKLPQKCYEYLSKPVD  154
             LP L N SF+ N+F +E E+C+P +D  VA+DD  NC+   RP QK   +C   L+ PVD
Sbjct  347   LPALANFSFAHNFFSVEAEACVPSEDSPVALDDRGNCLNGGRPEQKPSLECAPVLAHPVD  406

Query  153   CSKTGC  136
             C    C
Sbjct  407   CRTNVC  412



>ref|XP_006389464.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
 gb|ERP48378.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
Length=569

 Score =   397 bits (1020),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 201/369 (54%), Positives = 247/369 (67%), Gaps = 6/369 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               +DA+A  I +RQLL++  E  F   G    +D  L F N R K AY+ALQAWK AI+S
Sbjct  40    GLSDAEAMYINKRQLLYYKDE--FGDRGERVTVDPSLVFENPRLKNAYMALQAWKQAIFS  97

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG  VC+Y GVFC  A D+ T   VAGID+NH DIAG+LP E+G L DLAL
Sbjct  98    DPLNLTANWVGSQVCNYEGVFCSRAPDNKTIRTVAGIDLNHGDIAGYLPEELGFLVDLAL  157

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG +P     L+LLFE+D SNN   G FP V+L+LPSLK+LDLR+N FEG +
Sbjct  158   FHINSNRFCGTIPHKFKKLRLLFELDLSNNRFAGKFPQVVLKLPSLKFLDLRFNEFEGTV  217

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR   +LP NFGNS  SVIVLANNKF GCVPSS+G M  ++ +I
Sbjct  218   PKELFDKDLDAIFINHNRFVFDLPVNFGNSPVSVIVLANNKFHGCVPSSLGNMS-NLNEI  276

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN F  CLP EI LL N+TVFDV  N+L+G LP  +G M SLE  + A NM SG +P
Sbjct  277   ILMNNGFRSCLPAEIGLLKNLTVFDVSFNQLIGPLPDTVGGMVSLEQLNVAHNMLSGKIP  336

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +C LPNL+N +FS N+F  E   CL L D     D  NC+  RP Q+   +C  +LS 
Sbjct  337   ASICQLPNLENFTFSYNFFTGEPPVCLSLPD---FSDRRNCLPGRPEQRSAAQCKAFLSM  393

Query  162   PVDCSKTGC  136
             PVDCS   C
Sbjct  394   PVDCSSFRC  402



>ref|XP_008663867.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Zea mays]
Length=733

 Score =   402 bits (1033),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 196/364 (54%), Positives = 252/364 (69%), Gaps = 2/364 (1%)
 Frame = -3

Query  1221  ENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITK  1042
              +IARRQLL          + FE  + + + FAN+R ++AYVALQAW+ A+YSDPK  T 
Sbjct  40    SDIARRQLLSLREGDGDLPDDFEFDIHVDVTFANERLRRAYVALQAWRRAMYSDPKNFTG  99

Query  1041  NWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNR  862
              WVG +VCSY GV C  ALDD    VVAGID+N  DIAG+LP E+G+LTD+A  H+NSNR
Sbjct  100   GWVGADVCSYFGVTCVPALDDANTTVVAGIDLNGGDIAGYLPAELGMLTDIAFFHINSNR  159

Query  861   ICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDK  682
              CGI+PK+ S L LL E+D SNN  VG FPDV+L++P LKYLDLR+N+F+G LPP LFDK
Sbjct  160   FCGIIPKSFSRLTLLHELDVSNNRFVGGFPDVVLQIPVLKYLDLRFNDFDGTLPPHLFDK  219

Query  681   DLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEF  502
             DLD I +N+NR    +PENFGNSTA+V+VLANN F GC+P S+GRM  ++++++LLNN  
Sbjct  220   DLDAIFVNSNRFVGFIPENFGNSTATVVVLANNAFIGCIPRSVGRMADTLDELMLLNNRL  279

Query  501   SGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLP  322
              GC+P E+  L N TV DV  N LVG LP+GL  M  LE    + N  +G V + +C LP
Sbjct  280   DGCIPPELAELVNSTVVDVSGNALVGTLPEGLVNMIRLEQLDVSRNQLAGAVAENVCKLP  339

Query  321   NLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCV-LERPGQKLPQKCYEYLSKPVDCS  148
              L N SF+ N+F +E E+C+P +D  VA+DDS NC+   RPGQK   +C   L+ PVDC 
Sbjct  340   ALANFSFAHNFFSVEAEACVPSEDSPVALDDSGNCLDGGRPGQKPLPECALVLAHPVDCR  399

Query  147   KTGC  136
                C
Sbjct  400   TNVC  403



>ref|XP_004138582.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like [Cucumis sativus]
Length=613

 Score =   398 bits (1022),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 203/369 (55%), Positives = 248/369 (67%), Gaps = 3/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             + ++A+A  + RRQLL      D     F+++LD+   F N+R KKAY ALQAWK A+YS
Sbjct  30    SLSEAEASYLTRRQLLTLK-NYDELPLDFQYELDIPDTFPNERLKKAYRALQAWKLAVYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP+ +T NWVG +VCSY GVFC  ALDDP   VVAGID+NH DIAGHLP E+GLLTDLAL
Sbjct  89    DPQNMTANWVGADVCSYTGVFCAPALDDPKIEVVAGIDLNHGDIAGHLPPELGLLTDLAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P + SNL L+FE D SNN  VG FP V+LE PS KYLDLRYN+FEG +
Sbjct  149   FHINSNRFCGIIPSSFSNLVLMFEFDVSNNRFVGHFPLVVLEWPSAKYLDLRYNDFEGEI  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LF KD D I LNNNR  S +P+  GNST SV+  ANN+F GC+PS+IG+M  ++ QI
Sbjct  209   PSTLFTKDFDAIFLNNNRFNSLIPDTIGNSTVSVVSFANNEFHGCIPSTIGQM-SNLNQI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             L L N+ SGC P EI  L N+TVFDV  N  +G+LP+ L  +Q+LE    + N   G V 
Sbjct  268   LFLGNKLSGCFPPEIGNLVNLTVFDVSNNDFIGQLPESLSSLQNLEIMDVSNNELRGSVS  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV-DDSDNCVLERPGQKLPQKCYEYLS  166
              GLC LP L N +FS NYF  ED +C   K    + DDS NC+  RP QK   KC   L 
Sbjct  328   GGLCKLPKLANFTFSFNYFNGEDAACATSKGSEKLFDDSQNCLANRPMQKDANKCSTVLK  387

Query  165   KPVDCSKTG  139
             K VDC   G
Sbjct  388   KSVDCGNCG  396



>ref|XP_010500490.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Camelina sativa]
Length=894

 Score =   406 bits (1044),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 242/339 (71%), Gaps = 2/339 (1%)
 Frame = -3

Query  1149  KLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQ  970
             K+D  L F N+R KKAY+ALQAWK AIYSDP   T NWVG NVCSYNGV+C  ALDDP+ 
Sbjct  52    KVDPNLRFENERLKKAYIALQAWKKAIYSDPFKTTSNWVGSNVCSYNGVYCAPALDDPSL  111

Query  969   WVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNW  790
              VVAG+D+NH+DI+GHLP E+GL+TDLAL H+NSNR CGI+PK++S L L++E D SNN 
Sbjct  112   NVVAGVDLNHADISGHLPLELGLMTDLALFHINSNRFCGIIPKSLSKLALMYEFDVSNNR  171

Query  789   LVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNST  610
              VG FPDV L  PSLKYLD+RYN FEG+LPP +FDKD D I LNNNR ES +P   G S 
Sbjct  172   FVGKFPDVSLLWPSLKYLDIRYNEFEGSLPPEIFDKDFDAIFLNNNRFESFIPGTIGKSK  231

Query  609   ASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKL  430
             ASV+  ANNKF+GC+P SIG M +++ +I+   N  +GC P EI LL+N+TVFD  +N  
Sbjct  232   ASVVTFANNKFTGCIPKSIGNM-KNLNEIVFTGNNLTGCFPNEIGLLNNVTVFDASKNGF  290

Query  429   VGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD  250
             VG LP  L  + S+E    + N  +G V D  C LP+L++  FS N+F  E ESC+P ++
Sbjct  291   VGSLPSSLSGLASIEQLDLSHNKLTGFVVDKFCKLPSLESFKFSYNFFNGEAESCVPGRN  350

Query  249   GVA-VDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
                  DD++NC+L RP QK   +C+  +S+PVDCSK  C
Sbjct  351   NQKQFDDTNNCLLNRPSQKSANQCFPVVSRPVDCSKDKC  389



>ref|XP_009118084.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Brassica rapa]
Length=694

 Score =   400 bits (1028),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/379 (50%), Positives = 254/379 (67%), Gaps = 4/379 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFS-GEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIY  1066
             A +D++A  + RRQLL      D    +  E+++DLK  FAN R KKAY+ALQAWK AIY
Sbjct  27    AISDSEAAFLVRRQLLTLPENGDGELPDDIEYEVDLKATFANTRLKKAYIALQAWKKAIY  86

Query  1065  SDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLA  886
             SDP   T NW GP+VC+Y GV C  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+A
Sbjct  87    SDPFNTTANWHGPHVCAYTGVVCAPALDDPNVTVVAGVDLNGADIAGHLPVELGLMTDVA  146

Query  885   LIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGA  706
             + H+NSNR CGI+PK+   +KL+ E D S+N  VGPFP+VIL  PS KY DLR+N+FEG 
Sbjct  147   MFHLNSNRFCGIIPKSFEKMKLMHEFDVSSNCFVGPFPNVILSWPSAKYFDLRFNDFEGQ  206

Query  705   LPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQ  526
             +PP LF K+LD I LNNNR  S +PE  G STASV+  ANNKF+GC+P S+G M +++ +
Sbjct  207   VPPELFKKELDAIFLNNNRFTSVIPETLGESTASVVTFANNKFTGCIPKSVGNM-KNLNE  265

Query  525   ILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHV  346
             I+ ++N   GC P EI  LSN+TVFD  +N  VG LP     +  +E    +GN  +G V
Sbjct  266   IVFMDNGLGGCFPSEIGKLSNVTVFDASKNSFVGRLPTSFVGLTGVEELDISGNKLTGLV  325

Query  345   PDGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEY  172
              D +C LPNL N ++S NYF  +  SC+P   +  + +DD+ NC+ +RP Q+  Q+C   
Sbjct  326   GDEICKLPNLVNFTYSYNYFNGQGGSCIPGGGRKEIVLDDTRNCLTDRPDQRSAQECAVV  385

Query  171   LSKPVDCSKTGCRAATKET  115
             +++PVDCSK  C      T
Sbjct  386   INRPVDCSKDKCAGGGSST  404



>ref|XP_010461787.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Camelina sativa]
Length=905

 Score =   406 bits (1043),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/339 (56%), Positives = 241/339 (71%), Gaps = 2/339 (1%)
 Frame = -3

Query  1149  KLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQ  970
             K+D  L F NDR K+AY+ALQAWK AIYSDP   T NWVG NVCSYNGV+C  ALDDP+ 
Sbjct  52    KVDPNLRFENDRLKRAYIALQAWKKAIYSDPFKTTSNWVGSNVCSYNGVYCAPALDDPSL  111

Query  969   WVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNW  790
              VVAG+D+NH+DI+GHLP E+GL+TDLAL H+NSNR CGI+PK++S L L++E D SNN 
Sbjct  112   NVVAGVDLNHADISGHLPPELGLMTDLALFHINSNRFCGIIPKSLSKLALMYEFDVSNNR  171

Query  789   LVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNST  610
              VG FPDV L  PSLKYLD+RYN FEG+LPP +FDKDLD I +NNNR ES +P+  G S 
Sbjct  172   FVGKFPDVSLLWPSLKYLDIRYNEFEGSLPPEIFDKDLDAIFMNNNRFESFIPDTVGKSK  231

Query  609   ASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKL  430
             ASV+  ANNKF GC+P SIG M +++ +I+   N  +GC P EI LL+N+TVFD  +N  
Sbjct  232   ASVVTFANNKFIGCIPKSIGNM-KNLNEIVFTRNNLTGCFPNEIGLLNNVTVFDASKNGF  290

Query  429   VGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD  250
             VG LP  L  + S+E    + N  +G V D  C LP+L++  FS N+F  E ESC+P ++
Sbjct  291   VGSLPSSLSGLASIEQLDLSHNKLTGFVVDKFCKLPSLESFKFSYNFFNGEAESCVPGRN  350

Query  249   G-VAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
                  DD +NC+  RP QK   +C+  +S+PVDCSK  C
Sbjct  351   NEKQFDDKNNCLQNRPSQKSANQCFPVVSRPVDCSKDKC  389



>ref|XP_007227690.1| hypothetical protein PRUPE_ppa1027218m2g, partial [Prunus persica]
 gb|EMJ28889.1| hypothetical protein PRUPE_ppa1027218m2g, partial [Prunus persica]
Length=413

 Score =   390 bits (1003),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/358 (54%), Positives = 242/358 (68%), Gaps = 5/358 (1%)
 Frame = -3

Query  1206  RQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGP  1027
             RQLL +  +    GE     +   L F N R + AYVALQAWK A+ SDP G T NWVG 
Sbjct  14    RQLLFYTDQDGSRGELV--AVPSSLVFHNPRLRSAYVALQAWKQAMLSDPLGQTSNWVGS  71

Query  1026  NVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIV  847
             NVCSY GVFC  ALDDP+   VAGID+NH  IAG+LP E+GLL+D+AL H+NSNR CG V
Sbjct  72    NVCSYTGVFCSRALDDPSVETVAGIDLNHGGIAGYLPEELGLLSDIALFHINSNRFCGSV  131

Query  846   PKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVI  667
             PK+ S LKLLFE+D SNN   G FP V+L LP LK+LDLR+N FEG +P  LFDKDLD I
Sbjct  132   PKSFSKLKLLFELDLSNNRFAGKFPLVVLRLPKLKFLDLRFNEFEGKVPKELFDKDLDAI  191

Query  666   LLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLP  487
              +N+N     LP+N GNS  SVIVLANN F GCVP+S+G M +++ +++L NN F  CLP
Sbjct  192   FINHNMFSFELPDNLGNSPVSVIVLANNNFHGCVPASLGNMSKNLNEVVLTNNGFHSCLP  251

Query  486   EEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNL  307
             +EI +L ++TVFDV  N++VGELP+ +G M SLE  + A NM  G++P+ +C L NL+N 
Sbjct  252   KEIGMLKDVTVFDVSYNRIVGELPEAVGEMVSLEKLNVAHNMLRGNIPESVCELQNLRNF  311

Query  306   SFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCR  133
             SF  N+F  E   CL L+     DDS NC+  RP Q+    C   LSK V CS  GCR
Sbjct  312   SFEHNFFTSEPPMCLKLEK---FDDSKNCLRRRPKQRTMLHCKLALSKGVRCSSFGCR  366



>gb|AGT16299.1| hypothetical protein SHCRBa_026_P08_R_80 [Saccharum hybrid cultivar 
R570]
Length=654

 Score =   399 bits (1024),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/366 (53%), Positives = 251/366 (69%), Gaps = 2/366 (1%)
 Frame = -3

Query  1227  DAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGI  1048
             +A +IARRQLL          + FE  + + + FAN+  ++AYVALQAW+ A+YSDPK  
Sbjct  47    EASDIARRQLLSLREGDGDLPDDFEFDIHVDVTFANNHLRRAYVALQAWRRAMYSDPKNF  106

Query  1047  TKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNS  868
             T  WVG +VCSY GV C  ALDD    VVAG+D+N  DIAG+LP E+G+LTD+A  H+NS
Sbjct  107   TGGWVGADVCSYFGVTCVPALDDAKTTVVAGVDLNGGDIAGYLPAELGMLTDIAFFHINS  166

Query  867   NRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLF  688
             NR CGI+PK+ S L LL E+D SNN  VG FPDV+L++P LKYLDLR+N+F+G LPP LF
Sbjct  167   NRFCGIIPKSFSRLALLHELDVSNNRFVGGFPDVVLQIPVLKYLDLRFNDFDGTLPPHLF  226

Query  687   DKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNN  508
             DKDLD I +N+NR    +PENFGNSTA+V+VLANN F GC+P S+GRM  +++Q++LLNN
Sbjct  227   DKDLDAIFVNSNRFVGFIPENFGNSTATVVVLANNAFVGCIPRSVGRMADTLDQLMLLNN  286

Query  507   EFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCS  328
                GC+P E+  L N TV DV  N L+G LP+GL  M  LE    + N  +G V + +C 
Sbjct  287   RLDGCIPPELAELINSTVVDVSGNALIGTLPEGLVNMTRLEQLDVSRNQLAGAVAERVCK  346

Query  327   LPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCV-LERPGQKLPQKCYEYLSKPVD  154
             LP L N SF+ N+F +E E+C+P +D  VA+DD  NC+   RP QK   +C   L+ PVD
Sbjct  347   LPALANFSFAHNFFSVEAEACVPSEDSPVALDDRGNCLNGGRPEQKPSLECAPVLAHPVD  406

Query  153   CSKTGC  136
             C    C
Sbjct  407   CRTNVC  412



>ref|XP_009136284.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Brassica rapa]
Length=861

 Score =   404 bits (1039),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/370 (51%), Positives = 260/370 (70%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  IA+RQLL      D   +  E+++DLK  FAN+R K+AY+ALQAWK A+YS
Sbjct  30    ALTDAEASFIAQRQLLTLPENGDLPDD-IEYEVDLKETFANNRLKRAYIALQAWKKAVYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GVFC  ALDDP+  VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  89    DPFNTTGNWHGPHVCGYTGVFCAPALDDPSVAVVAGVDLNGADIAGHLPVELGLMTDVAM  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++  LKL++E D SNN  VGPFP V+L  P++K++DLR+N+FEG +
Sbjct  149   FHLNSNRFCGIIPKSLDRLKLMYEFDASNNRFVGPFPSVVLSWPAVKFIDLRFNDFEGQV  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF KDLD I LNNNR  S +PE+ G S+ASV+  A+NKF+GCVP SIG M +++ +I
Sbjct  209   PPQLFKKDLDAIFLNNNRFTSTIPESLGESSASVVTFAHNKFNGCVPKSIGNM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N   GC P EI  L+N+ VFD   N   G LP+    +  +E    +GN  +G VP
Sbjct  268   IFKDNRLGGCFPSEIGKLANVNVFDASMNLFTGVLPQSFVGLTGVEEIDISGNKLTGFVP  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L NL+++ NYF  + +SC+P  +  +A+DD+ NC+ +RP Q+  ++C   +S
Sbjct  328   ENICKLPKLVNLTYAYNYFNGQGDSCVPGSQKEIALDDTRNCLPDRPKQRSAKECAVVIS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>ref|XP_002885986.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62245.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score =   401 bits (1030),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/374 (50%), Positives = 256/374 (68%), Gaps = 3/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  IA+RQLL      +   +  E+++DLK+ FAN R K+AY+ALQAWK A+YS
Sbjct  18    TLTDAEASFIAQRQLLTLPENGELPDD-IEYEVDLKVTFANHRLKRAYIALQAWKKAVYS  76

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GVFC  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  77    DPFNTTGNWHGPHVCGYTGVFCAPALDDPNVAVVAGVDLNGADIAGHLPAELGLMTDVAM  136

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   L L+ E D SNN  VGPFP V+L  P++K++DLRYN+FEG +
Sbjct  137   FHLNSNRFCGIIPKSFEKLSLMHEFDVSNNRFVGPFPSVVLSWPAVKFIDLRYNDFEGQV  196

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF KDLD I LNNNR  S +P++ G S+ASV+  A+NKFSGC+P SIG M +++ +I
Sbjct  197   PPELFKKDLDAIFLNNNRFTSTIPDSLGESSASVVTFAHNKFSGCIPRSIGNM-KNLNEI  255

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N   GC P EI  LSN+ VFD   N   G LP     + SLE    +GN  +G +P
Sbjct  256   IFKDNSLGGCFPSEIGKLSNVNVFDASMNSFTGVLPPSFVGLTSLEEFDISGNKLTGFMP  315

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L NL+++ NYF  + +SC+P  +  +A+DD+ NC+ +RP Q+  ++C   +S
Sbjct  316   ENICKLPKLVNLTYAYNYFNGQGDSCVPGSQKEIALDDTRNCLPDRPKQRSAKECAVVIS  375

Query  165   KPVDCSKTGCRAAT  124
             +PVDCSK  C   +
Sbjct  376   RPVDCSKDKCAGGS  389



>emb|CDP07600.1| unnamed protein product [Coffea canephora]
Length=560

 Score =   394 bits (1013),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 190/355 (54%), Positives = 246/355 (69%), Gaps = 2/355 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A  IA  Q          S + FE K+D+K+E  N R ++AY+ALQAWK++I+S
Sbjct  24    ALSDEEASVIAEGQFSTLPENGHLSDD-FEFKVDVKVECPNPRLRRAYIALQAWKNSIHS  82

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VCSYNGVFC  ALDDP   VVAG+D+NH+DIAG+LP E+GLL D AL
Sbjct  83    DPSNFTGNWEGPDVCSYNGVFCATALDDPNTTVVAGVDLNHADIAGYLPVELGLLKDAAL  142

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             +H+NSNR CGIVPK++S L LL E+D SNN  VGPFP  +L +P LKYLD+R+NNFEG L
Sbjct  143   LHLNSNRFCGIVPKSLSKLALLHELDISNNRFVGPFPKSVLSMPRLKYLDIRFNNFEGEL  202

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LFDKDLD + LNNN   S +PEN G S  SV+V ANNKF GC+PSS+G M  ++++I
Sbjct  203   PPRLFDKDLDALFLNNNWFNSYIPENLGKSPVSVVVFANNKFKGCIPSSVGNMTNTLDEI  262

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + L NE SGCLP EI  L N TV DV  N   G LP+    ++ +E    + NM +G V 
Sbjct  263   IFLKNELSGCLPTEIGQLRNTTVVDVSFNSFSGILPRTFSGLERVEFLDLSHNMLTGFVS  322

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKC  181
             D +C LP+L N SF+ NYF  E ++C+P  +  +AVDD+ NC+ +RP QK  ++C
Sbjct  323   DAVCQLPSLSNFSFAYNYFNGEGKACVPNSRKDIAVDDTSNCLPDRPKQKSQKEC  377



>ref|XP_010925532.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Elaeis 
guineensis]
Length=523

 Score =   393 bits (1010),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 194/369 (53%), Positives = 248/369 (67%), Gaps = 5/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I +RQLL++  E  F   G    +D  L F N   + AY+ALQAWK AI S
Sbjct  31    GLTDAEAGLIRQRQLLYYRDE--FGDRGESVTVDPSLNFPNSHLRDAYIALQAWKLAIIS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG +VCSY GVFC     DP   VVAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  89    DPLNLTANWVGSDVCSYTGVFCAPLPSDPHLIVVAGIDLNHGDIAGYLPEELGLLTDLAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG +P     L LLFE+D SNN   G FPDV+L LPSLKYLD+R+N FEG +
Sbjct  149   FHINSNRFCGTIPHKFECLHLLFELDLSNNRFAGKFPDVVLRLPSLKYLDIRFNEFEGGV  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LFDKDLD I +N+NR   ++P+N GNS  SVIVLANN+F GCVP+S+G M +++ +I
Sbjct  209   PKALFDKDLDAIFINHNRFAFDIPDNLGNSPVSVIVLANNRFRGCVPASLGNMSKTLNEI  268

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +LLNN    CLP EI LL  +TVFDV  N+LVG LP  + +M+SLE    A N+ SG +P
Sbjct  269   ILLNNGLRSCLPPEIGLLKELTVFDVSFNQLVGPLPDSIAWMRSLEQLDVAHNLLSGQIP  328

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +C+LP+L+N +FS N+F  E   CL +    + +D  NC+  RP Q+   +C  +LS 
Sbjct  329   AAICTLPHLQNFTFSYNFFTGEPPVCLKVP---SFNDRRNCLPGRPAQRSAAQCKSFLSH  385

Query  162   PVDCSKTGC  136
             PVDC+   C
Sbjct  386   PVDCNSFRC  394



>ref|XP_002875655.1| hypothetical protein ARALYDRAFT_347509 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51914.1| hypothetical protein ARALYDRAFT_347509 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   392 bits (1007),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 238/334 (71%), Gaps = 2/334 (1%)
 Frame = -3

Query  1134  LEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAG  955
             L+F NDR K+AY+ALQAWK AIYSDP   T NWVG +VCSYNGV+C  ALDD +  VVAG
Sbjct  78    LKFENDRLKRAYIALQAWKKAIYSDPFKTTANWVGSDVCSYNGVYCAPALDDDSLTVVAG  137

Query  954   IDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPF  775
             +D+NH+DIAGHLP E+GL+TDLAL H+NSNR CGI+PK++S L L++E D SNN  VG F
Sbjct  138   VDLNHADIAGHLPPELGLITDLALFHINSNRFCGIIPKSLSKLALMYEFDVSNNRFVGQF  197

Query  774   PDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIV  595
             P+V L  PSLK+LDLRYN FEG+LP  +FDKDLD I LNNNR ES +P   G S ASV+ 
Sbjct  198   PEVSLSWPSLKFLDLRYNEFEGSLPSEIFDKDLDAIFLNNNRFESVIPGTIGKSKASVVT  257

Query  594   LANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELP  415
              ANNKF GC+P SIG M +++ +I+   N  +GC P EI LL+N+TVFD  +N  VG LP
Sbjct  258   FANNKFIGCIPKSIGNM-KNLNEIVFTGNNLTGCFPNEIGLLNNVTVFDASKNGFVGSLP  316

Query  414   KGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLK-DGVAV  238
               L  + S+E    + N  +G V D  C LPNL++  FS N+F  E ESC+P + +G   
Sbjct  317   TTLSGLASVEQLDLSHNKLTGFVVDKFCKLPNLESFKFSYNFFNGEAESCIPGRNNGKQF  376

Query  237   DDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
             DD++NC+  RP QK  ++C   +S+PVDCSK  C
Sbjct  377   DDTNNCLQNRPSQKPAKQCLPVVSRPVDCSKDKC  410



>ref|XP_006450582.1| hypothetical protein CICLE_v10010264mg [Citrus clementina]
 gb|ESR63822.1| hypothetical protein CICLE_v10010264mg [Citrus clementina]
Length=503

 Score =   392 bits (1008),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 191/374 (51%), Positives = 253/374 (68%), Gaps = 5/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
              F +A+A  I +RQLL++     + G G   ++    +F N R + AY+ALQAWK AI S
Sbjct  33    VFLEAEAAFIKQRQLLYYRNR--YGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAIIS  90

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG  VC+Y GVFC  ALD+ +   VAGID+NH DIAG+LP E+GLL D+AL
Sbjct  91    DPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIAGYLPEELGLLADIAL  150

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+N+NR CG +P++ + LKLLFE+D SNN   G FP V+L LP LK+LDLRYN FEG +
Sbjct  151   FHVNTNRFCGTLPRSFNKLKLLFELDLSNNRFAGKFPYVVLGLPKLKFLDLRYNEFEGKI  210

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LFDKDLD + +NNNR    LP+N GNS  SV+VLANNKF GC+P S G M +++ ++
Sbjct  211   PKALFDKDLDAVFINNNRFSFELPDNIGNSPVSVLVLANNKFHGCLPLSFGNMSRTLNEV  270

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L NN    CLPEEI LL N+TVFDV  NKL+GELP  +  M SL+  + A NM SG VP
Sbjct  271   ILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMGELPDTIAEMTSLQQLNVAHNMLSGTVP  330

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             D +CSLPNL+N SF  N+F  E   CL L+     DD  NC+ ++P Q+   +C  +LS+
Sbjct  331   DSVCSLPNLRNFSFDYNFFTGESPVCLDLQ---GFDDKRNCLRDKPRQRSTLQCRMFLSR  387

Query  162   PVDCSKTGCRAATK  121
              V C+   C+++ +
Sbjct  388   LVYCNTLKCQSSPQ  401



>ref|XP_009108764.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Brassica rapa]
Length=670

 Score =   398 bits (1022),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 188/378 (50%), Positives = 252/378 (67%), Gaps = 4/378 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A ++ +A  + RRQLL      +   +  E+++DLK  FAN R KKAY+ALQAWK AIYS
Sbjct  33    AISETEAAFLVRRQLLTLPENGELPND-IEYEVDLKATFANSRLKKAYIALQAWKKAIYS  91

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC+Y GV C  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  92    DPFNTTGNWHGPHVCNYTGVICAPALDDPNVTVVAGVDLNGADIAGHLPAELGLMTDVAM  151

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P + S L L+ E D SNN  VG FP VIL  P +KY D+R+N+FEG +
Sbjct  152   FHLNSNRFCGIIPNSFSKLTLMHEFDVSNNCFVGSFPCVILTWPDVKYFDVRFNDFEGQV  211

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K+LD I LNNNR  S +PE+ G+STASV+  ANNKF+GC+P SIG M +S+ +I
Sbjct  212   PPELFKKELDAIFLNNNRFTSTIPESLGDSTASVVTFANNKFTGCIPKSIGNM-KSLNEI  270

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI +LSN+TVFD  +N  +G LP     +  +E    +GN  +G + 
Sbjct  271   VFMDNGLGGCFPSEIGMLSNVTVFDASKNSFIGRLPTSFAGLTGVEELDISGNKLTGLLA  330

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +D SC P   +    +DD+ NC+ +RP Q+  Q+C   +
Sbjct  331   DSICKLPNLVNFTYSYNYFNGQDGSCFPGGGRKETVLDDTRNCLPDRPEQRSAQECAVVI  390

Query  168   SKPVDCSKTGCRAATKET  115
             ++PVDCSK  C      T
Sbjct  391   NRPVDCSKDKCAGGGSST  408



>ref|XP_008793507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Phoenix 
dactylifera]
Length=643

 Score =   396 bits (1018),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 197/369 (53%), Positives = 249/369 (67%), Gaps = 5/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I +RQLL++  E  F   G    +D  L F+N   + AY+ALQAWK AI S
Sbjct  31    GLTDAEAGFIRQRQLLYYRDE--FGDRGENGTVDPSLSFSNSHLRDAYIALQAWKLAIIS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG NVC+Y GV+C     DP   VVAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  89    DPLNLTSNWVGSNVCNYTGVYCAPLPSDPHITVVAGIDLNHGDIAGYLPEELGLLTDLAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP     L+LLFE+D SNN   G FPDV+L LPSLKYLDLR+N FEG +
Sbjct  149   FHINSNRFCGTVPHKFDRLRLLFELDLSNNRFAGKFPDVVLRLPSLKYLDLRFNEFEGGV  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P SLFDKDLD I +N+NR   ++P+N GNS  SVIVLANN+F GCVP+S+G M +++ +I
Sbjct  209   PRSLFDKDLDAIFINHNRFAFDIPDNLGNSPVSVIVLANNRFRGCVPASLGNMSRTLNEI  268

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +LLNN    CLP EI LL  +TV DV  N+LVG LP  +G+M SLE    A N+ SG +P
Sbjct  269   ILLNNGLRSCLPPEIGLLKELTVLDVSFNQLVGPLPDSIGWMLSLEQLDVAHNLLSGKIP  328

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +C+LP+L+N +FS N+F  E   CL +    + DD  NC+  RP Q+   +C  +LS 
Sbjct  329   TSICTLPHLQNFTFSYNFFTGEPPVCLKVP---SFDDRRNCLPGRPVQRSAAQCKSFLSH  385

Query  162   PVDCSKTGC  136
             PVDC+   C
Sbjct  386   PVDCNSFRC  394



>ref|XP_006300291.1| hypothetical protein CARUB_v100136950mg, partial [Capsella rubella]
 gb|EOA33189.1| hypothetical protein CARUB_v100136950mg, partial [Capsella rubella]
Length=395

 Score =   388 bits (996),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/365 (49%), Positives = 252/365 (69%), Gaps = 3/365 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  I +RQLL      +   +  E+++DLK+ FAN R K+AY+ALQAWK A+YS
Sbjct  33    ALTDAEASFIPQRQLLTLPENGELPDD-IEYEVDLKVTFANHRLKRAYIALQAWKKAVYS  91

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GVFC  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  92    DPFNTTGNWHGPHVCGYTGVFCASALDDPNVAVVAGVDLNGADIAGHLPAELGLMTDVAM  151

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++  L+L+ E D SNN  VGPFP V+L  P++KY+D+RYN+FEG +
Sbjct  152   FHLNSNRFCGIIPKSLEKLRLMHEFDVSNNRFVGPFPSVVLSWPAVKYIDVRYNDFEGQV  211

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF KDLD I LNNNR  S +P++ G S+ASV+  A+NKF+GC+P +IG M +++ +I
Sbjct  212   PPELFKKDLDAIFLNNNRFTSTIPDSIGESSASVVTFAHNKFNGCIPKTIGNM-KNLNEI  270

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N   GC P EI  L+N+ VFD   N   G LP     +  +E    +GN  +G VP
Sbjct  271   IFKDNNLGGCFPSEIGKLANVNVFDASMNSFTGVLPPSFVGLTGVEEFDISGNKLTGFVP  330

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L NL+++ NYF  + + C+P  +  +A+DD+ NC+ +RP Q+  ++C   +S
Sbjct  331   ENICKLPKLVNLTYAFNYFNGQGDLCIPGSRTEIALDDTRNCLPDRPKQRSARECAIVIS  390

Query  165   KPVDC  151
             +PVDC
Sbjct  391   RPVDC  395



>ref|XP_010447169.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Camelina sativa]
Length=736

 Score =   399 bits (1025),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/371 (51%), Positives = 249/371 (67%), Gaps = 4/371 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL      +   +  E+++DLK  FAN R KKAY+ALQAWK AIYS
Sbjct  44    ALTDTEAAFIVQRQLLTLPENGELPDD-IEYEVDLKATFANTRLKKAYIALQAWKKAIYS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VCSY GV C  ALDD    VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  103   DPFNTTGNWHGPHVCSYTGVVCAPALDDSEVTVVAGVDLNGADIAGHLPAELGLMTDVAM  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VG FPDV+L  P +KY DLR+N+FEG +
Sbjct  163   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGTFPDVVLSWPEVKYFDLRFNDFEGQV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K LD I LNNNR  S +PE+ G S ASV+  ANNKF+GC+P SIG M +++ +I
Sbjct  223   PPELFKKQLDAIFLNNNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNM-KNLNEI  281

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI  LSN+TVFD  +N  +G LP     +  +E    +GN  +G VP
Sbjct  282   VFMDNALGGCFPSEIGKLSNVTVFDASKNSFIGRLPTSFVGLTGVEEFDISGNKLTGLVP  341

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +  SC+P   +  +A+DD  NC+  RP Q+  Q+C   +
Sbjct  342   DNICKLPNLVNFTYSYNYFNGQGGSCVPGGARKEIALDDIRNCLPARPDQRSSQECAVVI  401

Query  168   SKPVDCSKTGC  136
             ++PVDCSK  C
Sbjct  402   NRPVDCSKDKC  412



>ref|XP_008786172.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Phoenix 
dactylifera]
Length=678

 Score =   397 bits (1020),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/369 (53%), Positives = 250/369 (68%), Gaps = 5/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I +RQLL++  E  F   G    +D  L F N   + AY+ALQAWK AI S
Sbjct  31    GLTDAEAGFIRQRQLLYYRDE--FGDRGEYVTVDPSLNFPNSHLRDAYIALQAWKLAIIS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG NVC+Y GV+C     DP   VVAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  89    DPLNLTANWVGSNVCNYTGVYCAPLPSDPHLTVVAGIDLNHGDIAGYLPEELGLLTDLAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP     L LLFE+D SNN   G FPDV+L LPSLK+LDLR+N FEG +
Sbjct  149   FHINSNRFCGTVPHKFECLHLLFELDLSNNRFAGKFPDVVLGLPSLKFLDLRFNEFEGGV  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LFDKDLD I +N+NR   ++P+NFGNS  SVIVLANN+F GCVP+S+G+M +++ +I
Sbjct  209   PKALFDKDLDAIFINHNRFAFDIPDNFGNSPVSVIVLANNRFRGCVPASLGKMSRTLNEI  268

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +LLNN    CLP EI LL ++TVFDV  N+LVG LP  +G+M SLE    A N+ SG +P
Sbjct  269   ILLNNGLRSCLPPEIGLLKDLTVFDVSFNQLVGPLPDSIGWMLSLEQLDVAHNLLSGQIP  328

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +C+LP L+N +FS N+F  E   CL +    + DD  NC+  RP Q+   +C  +LS 
Sbjct  329   TSICTLPRLQNFTFSYNFFTGEPPVCLKVP---SFDDRRNCLPGRPAQRSAAQCKSFLSH  385

Query  162   PVDCSKTGC  136
             PVDC+   C
Sbjct  386   PVDCNSFRC  394



>ref|NP_195123.1| pollen-specific leucine-rich repeat extensin-like protein 4 [Arabidopsis 
thaliana]
 sp|O81765.1|PLRX4_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like 
protein 4; Short=AtPEX4; Short=Pollen-specific LRR/EXTENSIN4; 
AltName: Full=Cell wall hydroxyproline-rich glycoprotein; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA19879.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB80114.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE86302.1| pollen-specific leucine-rich repeat extensin-like protein 4 [Arabidopsis 
thaliana]
Length=699

 Score =   397 bits (1021),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/375 (50%), Positives = 254/375 (68%), Gaps = 4/375 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL      +   +  E+++DLK  FAN R K+AY+ALQAWK AI+S
Sbjct  44    ALTDTEAAFIVQRQLLTLPDNGELPDD-IEYEVDLKATFANTRLKRAYIALQAWKKAIFS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GV C  ALDD    VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  103   DPFNTTGNWHGPHVCGYTGVVCAPALDDSDVTVVAGVDLNGADIAGHLPAELGLMTDVAM  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VGPFP+V+L  P +KY DLR+N+FEG +
Sbjct  163   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGPFPNVVLSWPDVKYFDLRFNDFEGQV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K+LD I LN+NR  S +PE+ G S ASV+  ANNKF+GC+P SIG M +++ +I
Sbjct  223   PPELFKKELDAIFLNDNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNM-KNLNEI  281

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N+  GC P EI  LSN+TVFD  +N  +G LP     + S+E    +GN  +G VP
Sbjct  282   VFMDNDLGGCFPSEIGKLSNVTVFDASKNSFIGRLPTSFVGLTSVEEIDISGNKLTGLVP  341

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
               +C LPNL NL++S NYF  +  SC+P   +  +A+DD+ NC+  RP Q+  Q+C   +
Sbjct  342   HNICQLPNLVNLTYSYNYFSGQGGSCVPGGSRKEIALDDTRNCLASRPEQRSAQECAVVI  401

Query  168   SKPVDCSKTGCRAAT  124
             ++PVDCSK  C   +
Sbjct  402   NRPVDCSKDKCAGGS  416



>ref|NP_179188.1| pollen-specific leucine-rich repeat extensin-like protein 3 [Arabidopsis 
thaliana]
 sp|Q9XIL9.1|PLRX3_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like 
protein 3; Short=AtPEX3; Short=Pollen-specific LRR/EXTENSIN3; 
AltName: Full=Cell wall hydroxyproline-rich glycoprotein; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD41978.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06443.1| pollen-specific leucine-rich repeat extensin-like protein 3 [Arabidopsis 
thaliana]
Length=727

 Score =   398 bits (1023),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/377 (49%), Positives = 256/377 (68%), Gaps = 3/377 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+   IA+RQLL      +   +  E+++DLK+ FAN R K+AY+ALQAWK A+YS
Sbjct  18    TLTDAEVSFIAQRQLLTLPENGELPDD-IEYEVDLKVTFANHRLKRAYIALQAWKKAVYS  76

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GVFC  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  77    DPFNTTGNWHGPHVCGYTGVFCAPALDDPDVAVVAGVDLNGADIAGHLPAELGLMTDVAM  136

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   L L+ E D SNN  VGPFP V+L  P++K++D+RYN+FEG +
Sbjct  137   FHLNSNRFCGIIPKSFEKLSLMHEFDVSNNRFVGPFPSVVLSWPAVKFIDVRYNDFEGQV  196

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF KDLD I LNNNR  S +P++ G S+ASV+  A+NKFSGC+P SIG M +++ +I
Sbjct  197   PPELFKKDLDAIFLNNNRFTSTIPDSLGESSASVVTFAHNKFSGCIPRSIGNM-KNLNEI  255

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N   GC P EI  L+N+ VFD   N   G LP     + S+E    +GN  +G +P
Sbjct  256   IFKDNSLGGCFPSEIGKLANVNVFDASMNSFTGVLPPSFVGLTSMEEFDISGNKLTGFIP  315

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L NL+++ NYF  + +SC+P  +  +A+DD+ NC+ +RP Q+  ++C   +S
Sbjct  316   ENICKLPKLVNLTYAYNYFNGQGDSCVPGSQKQIALDDTRNCLPDRPKQRSAKECAVVIS  375

Query  165   KPVDCSKTGCRAATKET  115
             +PVDCSK  C   + + 
Sbjct  376   RPVDCSKDKCAGGSSQA  392



>ref|XP_010999749.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Populus euphratica]
Length=1004

 Score =   405 bits (1042),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/374 (52%), Positives = 262/374 (70%), Gaps = 5/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A +IARRQLL      +   + FE+++D+K  FAN R ++AY+ LQAWK A+YS
Sbjct  27    ALTDAEASSIARRQLLTLHENGELPDD-FEYEVDVKETFANQRLRRAYIGLQAWKKAMYS  85

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVG +VC+YNGVFC  ALDD    V+AG+D+N +DIAG+LP E+GLLTD+AL
Sbjct  86    DPFNTTGNWVGADVCAYNGVFCAPALDDSGLSVMAGVDLNGADIAGYLPAELGLLTDVAL  145

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++S L L++E D SNN  VG FP V+L LPSLKYLD+R+N+FEG+L
Sbjct  146   FHINSNRFCGIIPKSLSKLTLMYEFDVSNNRFVGDFPSVVLTLPSLKYLDIRFNDFEGSL  205

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF+KDLD + LN+NR  S +PE  GNS  SV+  ANNKF+GC+P SIG+M  ++ ++
Sbjct  206   PPELFNKDLDALFLNDNRFTSTIPETIGNSPVSVVTFANNKFTGCIPHSIGKM-TNLNEV  264

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N+  GC P EI LLSN+T+FD   N   G LP     ++ +E    A N  +G VP
Sbjct  265   IFMGNDLGGCFPAEIGLLSNVTLFDASHNGFAGILPSSFAGLKKVELLDLADNKLTGFVP  324

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             + +C L +L N +FS NYF+ E ++C+P   KD V +DD+ NC+ +RP QK  + CY  +
Sbjct  325   ENICRLSSLTNFTFSYNYFKGEAQACVPPSRKDTV-LDDTSNCLSDRPKQKSARTCYPVV  383

Query  168   SKPVDCSKTGCRAA  127
             S+PVDCS+  C   
Sbjct  384   SRPVDCSEDKCSGG  397



>gb|KDO79655.1| hypothetical protein CISIN_1g041736mg [Citrus sinensis]
Length=500

 Score =   391 bits (1004),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/374 (51%), Positives = 252/374 (67%), Gaps = 5/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
              F +A+A  I +RQLL++     + G G   ++    +F N R + AY+ALQAWK AI S
Sbjct  33    VFLEAEAAFIKQRQLLYYRNR--YGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAIIS  90

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG  VC+Y GVFC  ALD+ +   VAGID+NH DIA +LP E+GLL D+AL
Sbjct  91    DPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIASYLPEELGLLADIAL  150

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+N+NR CG +P++ + LKLLFE+D SNN   G FP V+L LP LK+LDLRYN FEG +
Sbjct  151   FHVNTNRFCGTLPRSFNKLKLLFELDLSNNRFAGKFPYVVLGLPKLKFLDLRYNEFEGKI  210

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LFDKDLD + +NNNR    LP+N GNS  SV+VLANNKF GC+P S G M +++ ++
Sbjct  211   PKALFDKDLDAVFINNNRFSFELPDNIGNSPVSVLVLANNKFHGCLPLSFGNMSRTLNEV  270

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L NN    CLPEEI LL N+TVFDV  NKL+GELP  +  M SL+  + A NM SG VP
Sbjct  271   ILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMGELPDTIAEMTSLQQLNVAHNMLSGTVP  330

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             D +CSLPNL+N SF  N+F  E   CL L+     DD  NC+ ++P Q+   +C  +LS+
Sbjct  331   DSVCSLPNLRNFSFDYNFFTGESPVCLDLQ---GFDDKRNCLRDKPRQRSTLQCRMFLSR  387

Query  162   PVDCSKTGCRAATK  121
              V C+   C+++ +
Sbjct  388   LVYCNTLKCQSSPQ  401



>ref|XP_006389336.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
 gb|ERP48250.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
Length=500

 Score =   390 bits (1003),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 242/360 (67%), Gaps = 6/360 (2%)
 Frame = -3

Query  1215  IARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNW  1036
             I +RQLL++  E  F   G    +D  L F N R K AY+ALQAWK AI+SDP  +T NW
Sbjct  3     IDKRQLLYYKDE--FGDRGERVTVDPSLVFENPRLKNAYMALQAWKQAIFSDPLNLTANW  60

Query  1035  VGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRIC  856
             VG  VC+Y GVFC  A D+ T   VAGID+NH DIAG+LP E+G L DLAL H+NSNR C
Sbjct  61    VGSQVCNYEGVFCSRAPDNKTIRTVAGIDLNHGDIAGYLPEELGFLVDLALFHINSNRFC  120

Query  855   GIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDL  676
             G +P     L+LLFE+D SNN   G FP V+L+LPSLK+LDLR+N FEG +P  LFDKDL
Sbjct  121   GTIPHKFKKLRLLFELDLSNNRFAGKFPQVVLKLPSLKFLDLRFNEFEGTVPKELFDKDL  180

Query  675   DVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSG  496
             D I +N+NR   +LP NFGNS  SVIVLANNKF GCVPSS+G M  ++ +I+L+NN F  
Sbjct  181   DAIFINHNRFVFDLPVNFGNSPVSVIVLANNKFHGCVPSSLGNMS-NLNEIILMNNGFRS  239

Query  495   CLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNL  316
             CLP EI LL N+TVFDV  N+L+G LP  +G M SLE  + A NM SG +P  +C LPNL
Sbjct  240   CLPAEIGLLKNLTVFDVSFNQLIGPLPDTVGGMVSLEQLNVAHNMLSGKIPASICQLPNL  299

Query  315   KNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
             +N +FS N+F  E   CL L D     D  NC+  RP Q+   +C  +LS PVDCS   C
Sbjct  300   ENFTFSYNFFTGEPPVCLSLPD---FSDRRNCLPGRPEQRSAAQCKAFLSMPVDCSSFRC  356



>ref|XP_002867142.1| hypothetical protein ARALYDRAFT_491276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43401.1| hypothetical protein ARALYDRAFT_491276 [Arabidopsis lyrata subsp. 
lyrata]
Length=668

 Score =   396 bits (1018),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/371 (51%), Positives = 256/371 (69%), Gaps = 4/371 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL      +   +  E+++DLK  FAN R K+AY+ALQAWK AI+S
Sbjct  27    ALTDTEAAFIVQRQLLTLPDNGELPDD-IEYEVDLKATFANTRLKRAYIALQAWKKAIFS  85

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VCSY GV C  ALDD    VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  86    DPFNTTGNWHGPHVCSYTGVVCAPALDDSDVTVVAGVDLNGADIAGHLPAELGLMTDVAM  145

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VGPFP V+L  P++KY+DLR+N+FEG +
Sbjct  146   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGPFPKVVLSWPNVKYIDLRFNDFEGQV  205

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K+LD I LN+NR  S +PE+ G S ASV+  ANNKF+GC+P SIG M +++ +I
Sbjct  206   PPELFKKELDAIFLNDNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNM-KNLNEI  264

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N+  GC P EI  LSN+TVFD  +N  +G LP     + ++E    +GN  +G VP
Sbjct  265   VFMDNDLGGCFPSEIGKLSNVTVFDASKNSFIGRLPTSFVGLTNVEEFDISGNKLTGLVP  324

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C+LPNL N ++S NYF  +  SC+P   +  +A+DD+ NC+  RP Q+  Q+C   +
Sbjct  325   DNICNLPNLVNFTYSYNYFNGQGGSCVPGGGRKEIALDDTRNCLPARPDQRSSQECAVVI  384

Query  168   SKPVDCSKTGC  136
             ++PVDCSK  C
Sbjct  385   NRPVDCSKDKC  395



>ref|XP_009408826.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=553

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/370 (53%), Positives = 253/370 (68%), Gaps = 5/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I RRQLL++  E    GE     +D    F N R + AYVALQAWK AI S
Sbjct  33    GLTDAEAGFIRRRQLLYYLDEYGDRGE--RVSVDPSFRFPNPRLRDAYVALQAWKKAILS  90

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T +WVGPNVCSY GVFC     + +  VVAGID+NH+DIAG+LP E+GLLTDLAL
Sbjct  91    DPHNFTGSWVGPNVCSYYGVFCAPLPCNRSLTVVAGIDLNHADIAGYLPEELGLLTDLAL  150

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP+ +  L  LFEID SNN   G FP V+LELPSLK+LD+R+N FEG +
Sbjct  151   FHINSNRFCGTVPQKLRQLTRLFEIDLSNNRFAGKFPRVLLELPSLKFLDIRFNEFEGGV  210

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDK LD I +N+NRL  ++P+N GNS  SVIVLANN+F GC+P+S+G M  ++ +I
Sbjct  211   PRELFDKPLDAIFINHNRLAFDIPDNIGNSPVSVIVLANNRFRGCLPASLGNMSNTLNEI  270

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L++N    CLP EI LL  +TVFD+  N+L+G LP+ +G M SLE    A N+ SG +P
Sbjct  271   ILMDNGLRSCLPPEIGLLRKLTVFDISFNQLLGPLPEEIGRMVSLEQLDVAHNLLSGRIP  330

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             + +C LP+L+N +FS N+F  E  SCL ++   + DD  NC+ ERP Q+  ++C  +LS 
Sbjct  331   ESICQLPHLQNFTFSYNFFTGEPPSCLKVQ---SFDDRRNCLPERPLQRSGKQCESFLSH  387

Query  162   PVDCSKTGCR  133
             PVDCS   C+
Sbjct  388   PVDCSWFRCK  397



>ref|NP_175372.1| Leucine-rich repeat family protein [Arabidopsis thaliana]
 sp|Q9XIB6.1|PLRX2_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like 
protein 2; Short=AtPEX2; Short=Pollen-specific LRR/EXTENSIN2; 
AltName: Full=Cell wall hydroxyproline-rich glycoprotein; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD43152.1|AC007504_7 Hypothetical Protein [Arabidopsis thaliana]
 gb|AEE32435.1| Leucine-rich repeat family protein [Arabidopsis thaliana]
Length=847

 Score =   401 bits (1031),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 242/340 (71%), Gaps = 2/340 (1%)
 Frame = -3

Query  1152  HKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPT  973
             +K+D  L+F NDR K+AY+ALQAWK AIYSDP   T NWVG +VCSYNGV+C  ALDD +
Sbjct  46    NKVDPNLKFENDRLKRAYIALQAWKKAIYSDPFKTTANWVGSDVCSYNGVYCAPALDDDS  105

Query  972   QWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNN  793
               VVAG+D+NH+DIAGHLP E+GL+TDLAL H+NSNR CGI+PK++S L L++E D SNN
Sbjct  106   LTVVAGVDLNHADIAGHLPPELGLMTDLALFHINSNRFCGIIPKSLSKLALMYEFDVSNN  165

Query  792   WLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNS  613
               VG FP+V L  PSLK+LDLRYN FEG+LP  +FDKDLD I LNNNR ES +P   G S
Sbjct  166   RFVGQFPEVSLSWPSLKFLDLRYNEFEGSLPSEIFDKDLDAIFLNNNRFESVIPGTIGKS  225

Query  612   TASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNK  433
              ASV+  ANNKFSGC+P SIG M +++ +I+   N  +GC P EI LL+N+TVFD  +N 
Sbjct  226   KASVVTFANNKFSGCIPKSIGNM-KNLNEIVFTGNNLTGCFPNEIGLLNNVTVFDASKNG  284

Query  432   LVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLK  253
              VG LP  L  + S+E    + N  +G V D  C LPNL +  FS N+F  E ESC+P +
Sbjct  285   FVGSLPSTLSGLASVEQLDLSHNKLTGFVVDKFCKLPNLDSFKFSYNFFNGEAESCVPGR  344

Query  252   -DGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
              +G   DD++NC+  RP QK  ++C   +S+PVDCSK  C
Sbjct  345   NNGKQFDDTNNCLQNRPSQKPAKQCLPVVSRPVDCSKDKC  384



>ref|XP_011088311.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Sesamum indicum]
Length=583

 Score =   393 bits (1009),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 242/332 (73%), Gaps = 1/332 (0%)
 Frame = -3

Query  1128  FANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGID  949
             F N + K+AY  LQAWK  IYSDP+  T NWVG +VC+YNG+ C+ A  + +  VVAG+D
Sbjct  58    FGNSKLKQAYEVLQAWKSTIYSDPQNFTSNWVGHDVCAYNGIVCEKAPYNASLTVVAGVD  117

Query  948   INHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPD  769
             +NH+DIAGHLP E+G L+D++L+H+NSNR CGIVP +  NLKLL+E+D SNN  VGPFP+
Sbjct  118   LNHADIAGHLPDELGNLSDISLLHLNSNRFCGIVPDSFMNLKLLYELDLSNNRFVGPFPE  177

Query  768   VILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLA  589
             V+L LP+LKYLDLR+N+FEG LPP LF KDLD I LNNNR  S +PE  G S ASVIVL+
Sbjct  178   VVLGLPNLKYLDLRFNDFEGELPPELFSKDLDAIFLNNNRFHSTIPETLGKSPASVIVLS  237

Query  588   NNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKG  409
             NNKF+GC+PSSIG M   +E++LL +N+ SGCLPEEI +L+  TVFD+ +NK  G+LP+G
Sbjct  238   NNKFTGCLPSSIGGMAGRLEELLLSDNDLSGCLPEEIIMLNTTTVFDLSKNKFTGDLPRG  297

Query  408   LGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLK-DGVAVDD  232
             + ++QSLE  +  GN F   VPD +C+LPNLK+ + S NYF+  D  C P+   G+ VDD
Sbjct  298   MEHLQSLEMMNIEGNEFRSRVPDTICTLPNLKSFTLSSNYFDAMDPVCSPVALPGLEVDD  357

Query  231   SDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
              +NC+ +   Q+    C   LS+ VDCS   C
Sbjct  358   RNNCLPQEQQQRNEDDCRIALSEKVDCSAGNC  389



>gb|KFK30023.1| hypothetical protein AALP_AA7G207900 [Arabis alpina]
Length=656

 Score =   395 bits (1014),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 189/378 (50%), Positives = 253/378 (67%), Gaps = 4/378 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  I +RQLL    + +   +  E+++DLK  FAN R K+AY+ALQAWK AI+S
Sbjct  28    ALTDAEAAFIVQRQLLTLPEDGELPND-VEYEVDLKATFANTRLKRAYIALQAWKKAIFS  86

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T +W GP+VC Y GV C  ALDD    VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  87    DPFNTTGDWHGPHVCGYTGVVCAPALDDSEITVVAGVDLNGADIAGHLPAELGLMTDVAM  146

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++  L+L+ E D SNN  VGPFP V L  P +K+ DLRYN+FEG +
Sbjct  147   FHLNSNRFCGIIPKSLEKLRLMHEFDVSNNRFVGPFPYVALSWPDVKFFDLRYNDFEGEV  206

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K+LD I LNNNR  S +PEN G S ASV+  ANNKF+GC+P SIG M +++ +I
Sbjct  207   PPELFKKELDAIFLNNNRFTSVIPENLGESPASVVTFANNKFTGCIPKSIGNM-KNLNEI  265

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI  L+N+TVFD  +N   G LP     + S+E    +GN  +G V 
Sbjct  266   VFMDNGLGGCFPSEIGKLTNVTVFDASKNSFTGRLPTSFVGLTSVEEFDISGNKLTGLVA  325

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C+LPNL N ++S NYF  +  SC+P   +  +A+DD+ NC+  RP Q+  Q+C   +
Sbjct  326   DNICTLPNLLNFTYSYNYFNGQGGSCVPGGGQREIALDDTSNCLPTRPNQRSAQECAAVI  385

Query  168   SKPVDCSKTGCRAATKET  115
             S+PVDCSK  C      T
Sbjct  386   SRPVDCSKDKCAGGGSST  403



>ref|XP_006476177.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Citrus 
sinensis]
Length=514

 Score =   390 bits (1002),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 190/374 (51%), Positives = 252/374 (67%), Gaps = 5/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
              F +A+A  I +RQLL++     + G G   ++    +F N R + AY+ALQAWK AI S
Sbjct  33    VFLEAEAAFIKQRQLLYYRNR--YGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAIIS  90

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVG  VC+Y GVFC  ALD+ +   VAGID+NH DIA +LP E+GLL D+AL
Sbjct  91    DPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIASYLPEELGLLADIAL  150

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+N+NR CG +P++ + LKLLFE+D SNN   G FP V+L LP LK+LDLRYN FEG +
Sbjct  151   FHVNTNRFCGTLPRSFNKLKLLFELDLSNNRFAGKFPYVVLGLPKLKFLDLRYNEFEGKI  210

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LFDKDLD + +NNNR    LP+N GNS  SV+VLANNKF GC+P S G M +++ ++
Sbjct  211   PKALFDKDLDAVFINNNRFSFELPDNIGNSPVSVLVLANNKFHGCLPLSFGNMSRTLNEV  270

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L NN    CLPEEI LL N+TVFDV  NKL+GELP  +  M SL+  + A NM SG VP
Sbjct  271   ILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMGELPDTIAEMTSLQQLNVAHNMLSGTVP  330

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             D +CSLPNL+N SF  N+F  E   CL L+     DD  NC+ ++P Q+   +C  +LS+
Sbjct  331   DSVCSLPNLRNFSFDYNFFTGESPVCLDLQ---GFDDKRNCLRDKPRQRSTLQCRMFLSR  387

Query  162   PVDCSKTGCRAATK  121
              V C+   C+++ +
Sbjct  388   LVYCNTLKCQSSPQ  401



>ref|XP_010437693.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 isoform X5 [Camelina sativa]
Length=717

 Score =   396 bits (1018),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 191/371 (51%), Positives = 249/371 (67%), Gaps = 4/371 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL      +   +  E+++DLK  FAN R KKAY+ALQAWK AIYS
Sbjct  44    ALTDTEAAFIVQRQLLTLPENGELPDD-IEYEVDLKATFANTRLKKAYIALQAWKKAIYS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VCSY GV C  ALDD    VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  103   DPFNTTGNWHGPHVCSYTGVVCAPALDDSEVTVVAGVDLNGADIAGHLPAELGLMTDVAM  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VG FPDV+L  P +KY DLR+N+FEG +
Sbjct  163   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGTFPDVVLSWPEVKYFDLRFNDFEGQV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K LD I LNNNR  S +PE+ G S ASV+  ANNKF+GC+P SIG M +++ +I
Sbjct  223   PPELFKKQLDAIFLNNNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNM-KNLNEI  281

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI  LSN+TVFD  +N  +G LP     +  +E    +GN  +G VP
Sbjct  282   VFMDNGLGGCFPSEIGNLSNVTVFDASKNSFIGRLPTSFVGLTGVEEFDISGNKLTGLVP  341

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +  SC+P   +  +A+DD  NC+  RP Q+  Q+C   +
Sbjct  342   DNICKLPNLVNFTYSYNYFNGQGGSCVPGDARKEIALDDIRNCLPARPYQRSSQECAVVI  401

Query  168   SKPVDCSKTGC  136
             ++PVDCSK  C
Sbjct  402   NRPVDCSKDKC  412



>ref|XP_010437692.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 isoform X4 [Camelina sativa]
Length=734

 Score =   397 bits (1019),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 191/371 (51%), Positives = 249/371 (67%), Gaps = 4/371 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL      +   +  E+++DLK  FAN R KKAY+ALQAWK AIYS
Sbjct  44    ALTDTEAAFIVQRQLLTLPENGELPDD-IEYEVDLKATFANTRLKKAYIALQAWKKAIYS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VCSY GV C  ALDD    VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  103   DPFNTTGNWHGPHVCSYTGVVCAPALDDSEVTVVAGVDLNGADIAGHLPAELGLMTDVAM  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VG FPDV+L  P +KY DLR+N+FEG +
Sbjct  163   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGTFPDVVLSWPEVKYFDLRFNDFEGQV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K LD I LNNNR  S +PE+ G S ASV+  ANNKF+GC+P SIG M +++ +I
Sbjct  223   PPELFKKQLDAIFLNNNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNM-KNLNEI  281

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI  LSN+TVFD  +N  +G LP     +  +E    +GN  +G VP
Sbjct  282   VFMDNGLGGCFPSEIGNLSNVTVFDASKNSFIGRLPTSFVGLTGVEEFDISGNKLTGLVP  341

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +  SC+P   +  +A+DD  NC+  RP Q+  Q+C   +
Sbjct  342   DNICKLPNLVNFTYSYNYFNGQGGSCVPGDARKEIALDDIRNCLPARPYQRSSQECAVVI  401

Query  168   SKPVDCSKTGC  136
             ++PVDCSK  C
Sbjct  402   NRPVDCSKDKC  412



>emb|CDY54073.1| BnaA07g36350D [Brassica napus]
Length=649

 Score =   394 bits (1012),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 185/370 (50%), Positives = 253/370 (68%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  IA+RQLL    + D   E  E+K+D+KL F N R K+AY+ALQAWK A+YS
Sbjct  30    ALTDAEASFIAQRQLLTLPEDGDLP-ENIEYKVDIKLTFPNQRLKRAYIALQAWKKAVYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GV C  ALDDP   VV G+D+N +DIAGHLP E+GLLTD+A+
Sbjct  89    DPFNTTGNWHGPHVCDYTGVVCAPALDDPNIAVVTGVDLNGADIAGHLPAELGLLTDVAM  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++S LKL+ E D SNN  VGPFP V+L  P+LK++D+R+N+FEG +
Sbjct  149   FHLNSNRFCGIIPKSVSRLKLMHEFDVSNNRFVGPFPSVVLSWPALKFIDVRFNDFEGKV  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF KDLD I LNNNR  S +PE+ G S+ASV+  A+N F+GC+P SIG M +++ +I
Sbjct  209   PQELFKKDLDAIFLNNNRFTSTIPESLGESSASVVTFAHNNFNGCIPKSIGNM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N+  GC P EI  L+N+ VFD   N   G LP+    +  +E    +GN  +G VP
Sbjct  268   IFKDNKLGGCFPSEIGKLANVNVFDASMNSFTGVLPQSFVGLIGVEEIDISGNKLTGFVP  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L NL+++ NYF  + + C+P  +  +A DD+ NC+ +RP  +  ++C   +S
Sbjct  328   ENICKLPKLNNLTYAYNYFNGQGDMCVPGSQKDIAFDDTRNCLRDRPKPRSAKECAVVIS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>gb|KHN22289.1| Pollen-specific leucine-rich repeat extensin-like protein 4 [Glycine 
soja]
Length=755

 Score =   397 bits (1019),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 192/364 (53%), Positives = 249/364 (68%), Gaps = 1/364 (0%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A ++ +A  I RRQLLH   E D   + +    +  L F N R K AY+AL+A K AIYS
Sbjct  21    ALSNVEASFIVRRQLLHLH-ENDELSDNYADNYETNLTFPNPRLKSAYIALEALKKAIYS  79

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GPNVCSYNGVFC+ ALDDP   VVAGID+NH+DIAG++P EIGLLTDLAL
Sbjct  80    DPSNFTANWEGPNVCSYNGVFCEKALDDPKIDVVAGIDLNHADIAGYIPPEIGLLTDLAL  139

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK+ S LKLL+E+D SNN  VG FP+ +L +P +K++DLR+N FEG L
Sbjct  140   FHINSNRFCGVLPKSFSKLKLLYELDISNNRFVGRFPEPVLLIPDIKFIDLRFNEFEGEL  199

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF+K LD I LNNNR  S +P+N G+S ASV+V A N  +GC+PSSIG M +++ + 
Sbjct  200   PSELFNKSLDAIFLNNNRFTSTIPQNMGSSPASVMVFAYNNLTGCLPSSIGNMTKTLNEF  259

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN  +GCLP EI  L  + VFD+ +N  VG LP+    +++ E  S   N  +G VP
Sbjct  260   VLINNNLTGCLPVEIGKLEQVYVFDISQNNFVGMLPRTFDGLKNAEHLSIGHNKLTGFVP  319

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +CSLPNL N +FS NYF  E+E C+P K  V +DD +NC+  RP QK+   C   +SK
Sbjct  320   RNVCSLPNLVNFTFSYNYFNGEEEGCVPPKKDVVLDDENNCIPNRPKQKVADVCNVVISK  379

Query  162   PVDC  151
              VDC
Sbjct  380   HVDC  383



>ref|XP_006379216.1| hypothetical protein POPTR_0009s11130g [Populus trichocarpa]
 gb|ERP57013.1| hypothetical protein POPTR_0009s11130g [Populus trichocarpa]
Length=1117

 Score =   406 bits (1043),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/374 (52%), Positives = 260/374 (70%), Gaps = 5/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A +IARRQLL      +   + FE+++D+K  FAN R ++AY+ LQAWK A+YS
Sbjct  27    ALTDAEASSIARRQLLTLHENGELPDD-FEYEVDVKETFANQRLRRAYIGLQAWKKAMYS  85

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVG +VC+YNGVFC  ALDD    V+AG+D+N +DIAG+LP E+GLLTD+AL
Sbjct  86    DPFNTTGNWVGADVCAYNGVFCAPALDDSGLSVMAGVDLNGADIAGYLPAELGLLTDVAL  145

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+ S L L++E D SNN  VG FP V+L LPSLKYLD+R+N+FEG+L
Sbjct  146   FHINSNRFCGIIPKSFSKLTLMYEFDVSNNRFVGDFPSVVLTLPSLKYLDIRFNDFEGSL  205

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF+KDLD + LN+NR  S +PE  GNS  SV+  ANNKF+GC+P SIG+M  ++ ++
Sbjct  206   PPELFNKDLDALFLNDNRFTSTIPETIGNSPVSVVTFANNKFTGCIPHSIGKM-TNLNEV  264

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N+  GC P EI LL N+TVFD   N   G LP     ++ +E    A N  +G VP
Sbjct  265   IFMGNDLGGCFPAEIGLLGNVTVFDASHNGFTGILPSSFAGLKKVELLDLADNKLTGFVP  324

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             + +C L +L N +FS NYF+ E ++C+P   KD V +DD+ NC+ +RP QK  + CY  +
Sbjct  325   ENICRLSSLTNFTFSYNYFKGEAQACVPPSRKDTV-LDDTSNCLSDRPKQKSARTCYPVV  383

Query  168   SKPVDCSKTGCRAA  127
             S+PVDCSK  C   
Sbjct  384   SRPVDCSKDKCSGG  397



>ref|XP_004512856.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Cicer 
arietinum]
Length=642

 Score =   393 bits (1010),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/338 (57%), Positives = 237/338 (70%), Gaps = 6/338 (2%)
 Frame = -3

Query  1143  DLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWV  964
             D  L F N+R + AY+A QAWK AI SDP+  T NWVG NVCSY GV+C  ALD+P    
Sbjct  39    DPSLVFENNRIRNAYIAFQAWKQAILSDPQNFTTNWVGSNVCSYTGVYCAQALDNPNIRT  98

Query  963   VAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLV  784
             VAGID+NH+DIAG+LP E+GLL DLAL H+NSNR CG VP + + LKLLFE+D SNN   
Sbjct  99    VAGIDLNHADIAGYLPDELGLLVDLALFHINSNRFCGTVPHSFNKLKLLFELDLSNNRFA  158

Query  783   GPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTAS  604
             G FP+V+L LP LK+LD+R+N FEG++P  LFDKDLD I +N+NR    LPENFGNS  S
Sbjct  159   GKFPEVVLRLPVLKFLDIRFNEFEGSVPKELFDKDLDAIFVNDNRFAFELPENFGNSPVS  218

Query  603   VIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVG  424
             V+VLANNKF GC+PSS+G M  ++ +I  +NN F  CLP EI +L N+TVFDV  N+LVG
Sbjct  219   VVVLANNKFQGCIPSSLGNMS-NLNEINFMNNAFRSCLPSEIGMLKNLTVFDVSFNQLVG  277

Query  423   ELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGV  244
              LP  +G   SLE  + A N FSG +P  +C LPNLKN +FS N+F  E  +C     GV
Sbjct  278   PLPDAIGGAVSLEQLNVADNSFSGKIPASICMLPNLKNFTFSDNFFTGEPPACF----GV  333

Query  243   -AVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCR  133
              A+DD  NC+  RP QK P +C  +LSKP+DC    C+
Sbjct  334   PAIDDKGNCLPSRPFQKPPGQCQTFLSKPLDCKSFRCK  371



>ref|XP_009112175.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Brassica rapa]
Length=840

 Score =   399 bits (1025),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/370 (53%), Positives = 259/370 (70%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               T+ +   + +RQLL  +   D S +  E+++DL L+FAN R K+AY+ALQAWK AIYS
Sbjct  30    GLTNEETSFLTKRQLLALSENEDLSDD-MEYEVDLNLKFANTRLKRAYIALQAWKKAIYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   + NW+G NVCSY GVFC  ALDD +  VVAGIDINH+DIAG+LP E+GLLTD+AL
Sbjct  89    DPFNTSANWIGQNVCSYKGVFCAPALDDQSIMVVAGIDINHADIAGYLPPELGLLTDVAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK++S L L++E D SNN  VG FP V L  PSLK+LD+RYN+FEG L
Sbjct  149   FHVNSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGSFPMVALSWPSLKFLDIRYNDFEGKL  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  +F+KDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG M +++ +I
Sbjct  209   PADIFNKDLDAIFLNNNRFESIIPETIGESTASVVTFAHNKFSGCIPKTIGHM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N+ SGC P EI LL+N+TVFD   N+ VG LP  L  + ++E   F+ N  +G V 
Sbjct  268   VFIGNKLSGCFPNEIGLLNNVTVFDASNNEFVGSLPLSLSSLTNVEQMDFSFNKLTGFVT  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C+LP L N +FS N+F  E +SC+P        DD++NC+  RP QKL  +C   ++
Sbjct  328   DDVCNLPKLSNFTFSYNFFNGEAQSCVPGTSQDKQFDDTNNCLQNRPKQKLANECLPVIT  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>ref|XP_011078360.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=494

 Score =   388 bits (997),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 198/368 (54%), Positives = 244/368 (66%), Gaps = 6/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             T+A+   I +RQLL++  E  F   G    +D  L F N R + AYVALQAWK AI SDP
Sbjct  48    TEAEVFYIKKRQLLYYLDE--FGDRGENVTVDPSLVFENPRLRSAYVALQAWKKAILSDP  105

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               +T +WVG +VC+Y GVFC  ALD+P+   VAGID+NH DIAG+LP E+GLLTDL L H
Sbjct  106   HNLTVDWVGSDVCNYTGVFCAPALDNPSIRTVAGIDLNHGDIAGYLPEELGLLTDLGLFH  165

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VPK   NLK+LFE+D SNN   G FP V+L LP LKYLDLR+N FEG +P 
Sbjct  166   INSNRFCGTVPKKFKNLKILFELDLSNNRFAGKFPYVVLRLPKLKYLDLRFNEFEGPVPS  225

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDK LD I +N+NR    LP+NFGNS  SVIVLANNKF GCVP+S+G M  ++ +I+L
Sbjct  226   ELFDKPLDAIFINHNRFAFELPDNFGNSPVSVIVLANNKFHGCVPASLGNM-SNLNEIIL  284

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN    CLP EI LL N+TVFDV  N L+G LP  +G M SLE  + A NM SG +P  
Sbjct  285   MNNGLRSCLPPEIGLLRNLTVFDVSHNGLMGPLPDSVGGMVSLEQLNVAYNMLSGAIPQS  344

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +C+LP L+N +FS N+F  E   CL L D    DD  NC+  RP Q+   +C   LSK +
Sbjct  345   ICTLPRLENFTFSYNFFTGEPPVCLALPD---FDDRRNCLPNRPAQRSAAQCKAVLSKKI  401

Query  156   DCSKTGCR  133
              C    C 
Sbjct  402   HCGAFRCH  409



>ref|XP_010437689.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 isoform X2 [Camelina sativa]
 ref|XP_010437691.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 isoform X3 [Camelina sativa]
Length=762

 Score =   397 bits (1019),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 191/371 (51%), Positives = 249/371 (67%), Gaps = 4/371 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL      +   +  E+++DLK  FAN R KKAY+ALQAWK AIYS
Sbjct  44    ALTDTEAAFIVQRQLLTLPENGELPDD-IEYEVDLKATFANTRLKKAYIALQAWKKAIYS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VCSY GV C  ALDD    VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  103   DPFNTTGNWHGPHVCSYTGVVCAPALDDSEVTVVAGVDLNGADIAGHLPAELGLMTDVAM  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VG FPDV+L  P +KY DLR+N+FEG +
Sbjct  163   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGTFPDVVLSWPEVKYFDLRFNDFEGQV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K LD I LNNNR  S +PE+ G S ASV+  ANNKF+GC+P SIG M +++ +I
Sbjct  223   PPELFKKQLDAIFLNNNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNM-KNLNEI  281

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI  LSN+TVFD  +N  +G LP     +  +E    +GN  +G VP
Sbjct  282   VFMDNGLGGCFPSEIGNLSNVTVFDASKNSFIGRLPTSFVGLTGVEEFDISGNKLTGLVP  341

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +  SC+P   +  +A+DD  NC+  RP Q+  Q+C   +
Sbjct  342   DNICKLPNLVNFTYSYNYFNGQGGSCVPGDARKEIALDDIRNCLPARPYQRSSQECAVVI  401

Query  168   SKPVDCSKTGC  136
             ++PVDCSK  C
Sbjct  402   NRPVDCSKDKC  412



>ref|XP_009403414.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Musa 
acuminata subsp. malaccensis]
Length=557

 Score =   390 bits (1002),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 252/370 (68%), Gaps = 5/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I RRQLL++  E    GE     +D    F N R + AYVALQAWK AI S
Sbjct  35    GLTDAEAGLIRRRQLLYYLDEYGDRGE--RVSVDPSFHFPNPRLRDAYVALQAWKQAILS  92

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP+  T NWVGPNVC+Y GV+C     + +  VVAGID+NH+DIAG+LP E+GLLTDLAL
Sbjct  93    DPQNFTGNWVGPNVCTYRGVYCAPLPCNSSLNVVAGIDLNHADIAGYLPEELGLLTDLAL  152

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP    NL  LFEID SNN   G FP V+L+LPSLK+LD+R+N FEGA+
Sbjct  153   FHINSNRFCGTVPHKFRNLGRLFEIDLSNNRFAGKFPRVLLDLPSLKFLDIRFNEFEGAV  212

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDK LD I +N+NR   ++P+N GNS  SVIVLANN+F GC+P+S+G M  ++ +I
Sbjct  213   PRELFDKPLDAIFINHNRFAFDVPDNLGNSPVSVIVLANNRFRGCLPASLGNMSNTLNEI  272

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN    CLP EI LL  +TVFDV  N+L+G LP+ +  M SLE    A N+ SG +P
Sbjct  273   ILMNNGLRSCLPSEIGLLRKLTVFDVSFNQLLGPLPEEIRGMVSLEQLDVAHNLLSGRIP  332

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             + +C LP+L+N +FS N+F  E  SCL ++   + DD  NC+ ERP Q+  ++C  +L+ 
Sbjct  333   ESICVLPHLQNFTFSYNFFTGEPPSCLKVQ---SFDDKRNCLPERPLQRSEKQCKSFLAH  389

Query  162   PVDCSKTGCR  133
             PVDCS   C+
Sbjct  390   PVDCSVFRCK  399



>ref|XP_010530870.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Tarenaya hassleriana]
Length=634

 Score =   393 bits (1009),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 185/370 (50%), Positives = 253/370 (68%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  +A RQLL      +   +  E ++DLK+ FAN R K+AY+ALQAWK AIYS
Sbjct  29    ALTDAEASFLAHRQLLALPENGELPDD-LEFEVDLKVTFANSRLKRAYIALQAWKKAIYS  87

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC YNGVFC  ALDD +  VVAG+D+N +DIAGHLP EIGL+TD+AL
Sbjct  88    DPFNTTGNWFGPHVCGYNGVFCAPALDDQSITVVAGVDLNGADIAGHLPAEIGLMTDVAL  147

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   L L+ E D SNN  VG FP V++  P++KY+D+RYN+FEG +
Sbjct  148   FHLNSNRFCGIIPKSFEKLTLMHEFDVSNNRFVGKFPSVVVSWPAVKYIDIRYNDFEGEV  207

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF KDLD I LNNNR  S +P++ G S+ASVI  A+NKF+GC+P S+G M +++ +I
Sbjct  208   PPELFKKDLDAIFLNNNRFTSTIPDSIGESSASVITFAHNKFTGCIPKSVGNM-KNLNEI  266

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI  L+N+TVFD   N   G LP     +  +E    +GN  +G V 
Sbjct  267   IFMDNNLGGCFPSEIGKLANVTVFDASENSFTGVLPASFVGLTGVEEFDISGNKLTGFVL  326

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LPNL N ++S NYF  + +SC+P  +  + +DD+ NC+ +RP Q+  ++C   ++
Sbjct  327   ENICKLPNLANFTYSYNYFNGQADSCVPGGRKDIVLDDTRNCLPDRPKQRSAKECAVVVN  386

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  387   RPVDCSKDKC  396



>ref|XP_010437688.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 isoform X1 [Camelina sativa]
Length=779

 Score =   397 bits (1020),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 191/371 (51%), Positives = 249/371 (67%), Gaps = 4/371 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL      +   +  E+++DLK  FAN R KKAY+ALQAWK AIYS
Sbjct  44    ALTDTEAAFIVQRQLLTLPENGELPDD-IEYEVDLKATFANTRLKKAYIALQAWKKAIYS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VCSY GV C  ALDD    VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  103   DPFNTTGNWHGPHVCSYTGVVCAPALDDSEVTVVAGVDLNGADIAGHLPAELGLMTDVAM  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VG FPDV+L  P +KY DLR+N+FEG +
Sbjct  163   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGTFPDVVLSWPEVKYFDLRFNDFEGQV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K LD I LNNNR  S +PE+ G S ASV+  ANNKF+GC+P SIG M +++ +I
Sbjct  223   PPELFKKQLDAIFLNNNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNM-KNLNEI  281

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI  LSN+TVFD  +N  +G LP     +  +E    +GN  +G VP
Sbjct  282   VFMDNGLGGCFPSEIGNLSNVTVFDASKNSFIGRLPTSFVGLTGVEEFDISGNKLTGLVP  341

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +  SC+P   +  +A+DD  NC+  RP Q+  Q+C   +
Sbjct  342   DNICKLPNLVNFTYSYNYFNGQGGSCVPGDARKEIALDDIRNCLPARPYQRSSQECAVVI  401

Query  168   SKPVDCSKTGC  136
             ++PVDCSK  C
Sbjct  402   NRPVDCSKDKC  412



>ref|XP_010467332.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Camelina sativa]
Length=727

 Score =   395 bits (1016),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/374 (49%), Positives = 257/374 (69%), Gaps = 3/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  IA+RQLL      +   +  E+++DLK+ FAN+R K+AY+ALQAWK A+YS
Sbjct  50    ALTDAEASFIAQRQLLTLPENGELPDD-IEYEVDLKVTFANNRLKRAYIALQAWKKAVYS  108

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GVFC  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  109   DPFNTTGNWHGPHVCGYTGVFCAPALDDPNVAVVAGVDLNGADIAGHLPAELGLMTDVAM  168

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   L+L+ E D SNN  VGPFP V+L  P++K++D+RYN+FEG +
Sbjct  169   FHLNSNRFCGIIPKSFEKLRLMHEFDVSNNRFVGPFPSVVLSWPAVKFIDVRYNDFEGQV  228

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF KDLD I LNNNR  S +P++ G S+ASV+  A+NKFSGC+P +IG M +++ +I
Sbjct  229   PPELFKKDLDAIFLNNNRFTSTIPDSLGESSASVVTFAHNKFSGCIPKTIGNM-KNLNEI  287

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N   GC P EI  L+N+ VFD   N   G LP     +  +E    + N  +G VP
Sbjct  288   IFKDNNLGGCFPSEIGKLANVNVFDASMNSFTGVLPPSFVGLTGVEEFDISVNKLTGFVP  347

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L N++++ NYF  + +SC+P  +  +A+DD+ NC+ +RP Q+  ++C   +S
Sbjct  348   ENVCKLPKLVNMTYAYNYFNGQGDSCVPGSRTEIALDDTRNCLPDRPKQRSAKECAVVIS  407

Query  165   KPVDCSKTGCRAAT  124
             +PVDCSK  C   +
Sbjct  408   RPVDCSKDKCAGGS  421



>ref|XP_006842252.1| hypothetical protein AMTR_s00078p00197410 [Amborella trichopoda]
 gb|ERN03927.1| hypothetical protein AMTR_s00078p00197410 [Amborella trichopoda]
Length=874

 Score =   399 bits (1025),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 198/369 (54%), Positives = 250/369 (68%), Gaps = 5/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               T A+A +I  RQLL++       GE     +D   EF N R ++AY+ALQAWK AI S
Sbjct  75    GLTFAEASSIKHRQLLYYIDRYGDRGESV--FVDPSFEFENSRLREAYIALQAWKMAIIS  132

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  IT NW+GP VC+Y GVFC  +LD     VVAGID+NHSDIAG+LP E+G LTDLAL
Sbjct  133   DPMNITGNWIGPIVCNYTGVFCSKSLDGLNLTVVAGIDLNHSDIAGYLPDELGKLTDLAL  192

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             +H+NSNR CG +P T   LKLL+E+D SNN   G FP V+L+LP+LKYLDLRYN FEG +
Sbjct  193   LHLNSNRFCGTIPHTFKRLKLLYELDLSNNRFAGRFPTVVLKLPTLKYLDLRYNEFEGPV  252

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P SLF++ LD I LN+NR    +PENFGNS  SV+VLANN+F GC+PSS+ +M  ++ +I
Sbjct  253   PSSLFNRPLDAIFLNHNRFHFEIPENFGNSPVSVVVLANNRFRGCIPSSLAKMAPTLNEI  312

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +++NN  SGC+PEE   L N+TV DV  NKLVG LP  LG + SLE  + A NM SG +P
Sbjct  313   IIMNNGLSGCVPEEFGALKNLTVLDVSFNKLVGNLPLNLGGLVSLEQLNVAHNMLSGQIP  372

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +CSLPNL N +FS N+FE E   CL L    + DD  NC+  RP Q+  ++C  +LS 
Sbjct  373   PQICSLPNLDNFTFSYNFFEGEPPVCLRLP---SFDDRRNCINGRPKQRPRKQCKSFLSH  429

Query  162   PVDCSKTGC  136
              VDC    C
Sbjct  430   RVDCGSVKC  438



>ref|XP_002519151.1| protein binding protein, putative [Ricinus communis]
 gb|EEF43362.1| protein binding protein, putative [Ricinus communis]
Length=829

 Score =   397 bits (1021),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 192/370 (52%), Positives = 255/370 (69%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+   I  RQLL      +   E +EH++D+K+ FAN R K+AY+ALQAWK A+YS
Sbjct  27    ALTDAEVSFITGRQLLSLKENEELPNE-YEHEVDVKVTFANQRLKRAYIALQAWKKAMYS  85

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW G NVC+YNGVFC  ALDDP   VVAGID+N +DIAG LP E+GL+TDLAL
Sbjct  86    DPFNTTSNWNGANVCAYNGVFCAPALDDPKLSVVAGIDLNQADIAGFLPPELGLMTDLAL  145

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGIVP+++S LK ++E D SNN  VG FP+V+L+ P++KY+D+R+NNFEG L
Sbjct  146   FHINSNRFCGIVPESLSKLKFMYEFDISNNRFVGHFPNVVLKWPNVKYIDIRFNNFEGCL  205

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +F  +LD ++LNNNR   N+P+  GNST SV+V A N F+GC+P SIG M  ++ +I
Sbjct  206   PPEIFQMNLDALILNNNRFTCNIPDTIGNSTVSVVVFAYNNFTGCIPHSIGNMP-NLNEI  264

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +   N   GC P EI +LSN TV DV  N+ VG L      ++++E  + A N  +G V 
Sbjct  265   IFTGNNLGGCFPAEIGILSNATVLDVSNNQFVGGLASSFSGLKNVEQLNLANNKLTGFVS  324

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + LCSLP+L N +FS NYF+ E +SC+   +  V +DD +NC+ +RP QK  + CY  +S
Sbjct  325   ETLCSLPSLSNFTFSSNYFKGEAKSCISSSNKDVVLDDRNNCLPDRPYQKSARICYPVVS  384

Query  165   KPVDCSKTGC  136
              PVDCSK  C
Sbjct  385   WPVDCSKDKC  394



>gb|EPS57978.1| hypothetical protein M569_16839, partial [Genlisea aurea]
Length=486

 Score =   387 bits (993),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 190/343 (55%), Positives = 245/343 (71%), Gaps = 8/343 (2%)
 Frame = -3

Query  1146  LDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQW  967
             L   L+F N R + AY  LQA K  ++SDP   T NWVG +VCSY+G+FC  ALDD +  
Sbjct  46    LSGSLKFVNSRLETAYRGLQALKATVHSDPYNYTSNWVGADVCSYSGIFCAEALDDASIT  105

Query  966   VVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWL  787
             VVAGID+N++DIAGH+P EIGLLTDL+LIH+NSNR CG++PK I  LKLLFE+D SNN  
Sbjct  106   VVAGIDLNNADIAGHIPPEIGLLTDLSLIHLNSNRFCGLIPKEIEKLKLLFELDLSNNRF  165

Query  786   VGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTA  607
             VG FP  +L LPSLK+LDLRYN+FEG LP  LFD++ D I LNNNR +S LPENFGNS A
Sbjct  166   VGKFPAPVLGLPSLKFLDLRYNDFEGELPGELFDREYDAIFLNNNRFQSTLPENFGNSPA  225

Query  606   SVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLV  427
             SV+V+ANN FSGC+P+SIG+ME  ++++++ +N FSGCLPEE+TLL+  TV D+  NK  
Sbjct  226   SVVVIANNNFSGCIPTSIGKMEGKLDEMIVSHNSFSGCLPEELTLLNTSTVIDLAMNKFT  285

Query  426   GELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESC----LP  259
             G+LP G+ Y+QSLE  +   N F   VP+ +C+LPNLK+ +FS NYF+ +D  C    LP
Sbjct  286   GDLPAGMEYLQSLEFFNIGLNGFRAKVPETVCTLPNLKSFNFSFNYFDAKDPECHGEALP  345

Query  258   LKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
                G+ +DD  NC  +   Q+  ++C   LSK VDC    CR 
Sbjct  346   ---GLELDDRKNCFSDEGEQRSEKECRVELSKKVDCG-AHCRG  384



>ref|XP_009381253.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=546

 Score =   389 bits (999),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 196/374 (52%), Positives = 249/374 (67%), Gaps = 5/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I RRQLL++  E    GE     +D    FAN   + AYVALQAWK AI S
Sbjct  35    GLTDAEAGLIRRRQLLYYLDEYGDRGE--RVTVDPSFHFANPGLRAAYVALQAWKQAILS  92

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVGP+VC Y GV+C     + +  VVAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  93    DPHNFTGNWVGPDVCHYYGVYCASLPCNGSLTVVAGIDLNHGDIAGYLPEELGLLTDLAL  152

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP     L  LFEID SNN   G FP V+LELPSLK+LD+R+N FEG +
Sbjct  153   FHINSNRFCGTVPHKFRQLTRLFEIDISNNRFAGKFPGVLLELPSLKFLDIRFNEFEGGV  212

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDK LD I +N+NR   ++P+NFGNS  SVIVLANN+F GC P+SIG M  ++ +I
Sbjct  213   PRELFDKPLDAIFINHNRFAFDIPDNFGNSPVSVIVLANNRFRGCFPASIGNMSNTLNEI  272

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN    CLP EI LL  +TVFDV  N+L+G LP+ +G M SLE    A N+ SG +P
Sbjct  273   ILMNNGLRSCLPPEIGLLKKLTVFDVSFNELLGPLPEEIGGMVSLEQLDVAHNLLSGCIP  332

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             + +C LP+L+N +FS N+F  E  SCL ++   + DD  NC+ ERP Q+  ++C  +LS 
Sbjct  333   ESICELPHLQNFTFSYNFFTGEPPSCLKVQ---SFDDRRNCLPERPLQRSGKQCGSFLSH  389

Query  162   PVDCSKTGCRAATK  121
             PVDCS   C+   +
Sbjct  390   PVDCSSFRCKPFVR  403



>ref|XP_008357497.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 3, partial [Malus domestica]
Length=557

 Score =   389 bits (999),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 243/358 (68%), Gaps = 5/358 (1%)
 Frame = -3

Query  1209  RRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVG  1030
             +RQLL +  +    GE     +   L F N R + AY+ALQAWK A+ SDP+    NWVG
Sbjct  48    QRQLLXYIDQDGSRGETV--TVPDXLVFENSRLRSAYIALQAWKQAMVSDPRDQISNWVG  105

Query  1029  PNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGI  850
              +VC Y GVFC  A DDP+   VAGID+NH+DIAG LP E+GLL+D+AL H+NSNR CG 
Sbjct  106   SDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLSDIALFHINSNRFCGK  165

Query  849   VPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDV  670
             VPK+ + L+LLFE+D SNN   G FPDV+L+LP+LK+LDLR+N FEG +P  LFDKDLD 
Sbjct  166   VPKSFNKLQLLFELDLSNNRFAGXFPDVVLQLPALKFLDLRFNEFEGEVPKELFDKDLDA  225

Query  669   ILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCL  490
             I +N+NR    LP NFGNS  SVIVLANN F GCVP+S+G M +++ +++L NN F  CL
Sbjct  226   IFINHNRFSFELPNNFGNSPVSVIVLANNNFHGCVPASLGNMSKNLNELVLTNNGFHSCL  285

Query  489   PEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKN  310
             P EI +L  +TVFDV  N+ VGELPK +  M+SLE  + A NM  G +P+G+C L NL  
Sbjct  286   PREIGMLKKVTVFDVSHNRFVGELPKEIVEMESLEQLNVAHNMLRGTIPEGVCELQNLAK  345

Query  309   LSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
              S   N+F +E   CL LK+    DDS NC+ +RP Q+   +C   LSK VDCS  GC
Sbjct  346   FSIEHNFFTVEPPMCLKLKE---FDDSKNCLRKRPKQRTLLQCKLALSKKVDCSSFGC  400



>ref|XP_006282938.1| hypothetical protein CARUB_v100074500mg, partial [Capsella rubella]
 gb|EOA15836.1| hypothetical protein CARUB_v100074500mg, partial [Capsella rubella]
Length=488

 Score =   387 bits (993),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 195/370 (53%), Positives = 249/370 (67%), Gaps = 11/370 (3%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +  +I RRQLL FA          +  +D  L F N R + AY+ALQAWK AI S
Sbjct  24    ALSDNEVRHIQRRQLLEFAER------SVKITVDPSLVFENPRLRNAYIALQAWKQAILS  77

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW+G NVC+Y GVFC  ALD+     VAGID+NH+DIAG+LP E+GLLTDLAL
Sbjct  78    DPNKFTSNWIGSNVCNYTGVFCSPALDNRKIRTVAGIDLNHADIAGYLPEELGLLTDLAL  137

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG+VP   + LKLLFE+D SNN   G FP V+L LPSLK+LDLR+N FEG +
Sbjct  138   FHVNSNRFCGMVPHRFNRLKLLFELDLSNNRFAGKFPTVVLRLPSLKFLDLRFNEFEGTV  197

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF KDLD I +N+NR    LP+NFG+S  SVIVLANN+F GCVPSS+  M +++ +I
Sbjct  198   PKELFSKDLDAIFINHNRFRFELPDNFGDSPVSVIVLANNRFHGCVPSSLVEM-KNLNEI  256

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN  S CLP +I  L N+TVFDV  N+LVG LP+ +G M S+E  + A N  SG++P
Sbjct  257   ILINNGLSSCLPSDIGRLKNVTVFDVSYNELVGPLPESVGGMVSVEQLNVAHNKLSGNIP  316

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +C LP L+N +FS N+F  E   CL L +    DD  NC+  RP Q+ P +C  +LS+
Sbjct  317   ASICQLPKLENFTFSYNFFTGEAPMCLRLPE---FDDRRNCLPGRPSQRSPGQCKAFLSR  373

Query  162   -PVDCSKTGC  136
              PV+C   GC
Sbjct  374   PPVNCGSFGC  383



>ref|XP_006412291.1| hypothetical protein EUTSA_v100245901mg, partial [Eutrema salsugineum]
 gb|ESQ53744.1| hypothetical protein EUTSA_v100245901mg, partial [Eutrema salsugineum]
Length=648

 Score =   392 bits (1006),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 186/378 (49%), Positives = 252/378 (67%), Gaps = 4/378 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL      +   +  E+++DLK  FAN R K+AY+ALQAWK AI+S
Sbjct  45    ALTDTEAAFIVQRQLLTLPENGELPND-IEYEVDLKATFANTRLKRAYIALQAWKKAIFS  103

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GV C  ALDD    VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  104   DPFNTTGNWHGPHVCGYTGVVCAPALDDSEITVVAGVDLNGADIAGHLPAELGLMTDVAM  163

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VGPFP+V+L  P +KY DLR+N+FEG +
Sbjct  164   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGPFPNVVLSWPDVKYFDLRFNDFEGQV  223

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K+LD I LNNNR  S +PE+ G S ASV+  ANNKF+GC+P SIG M +++ +I
Sbjct  224   PPELFKKELDAIFLNNNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNM-KNLNEI  282

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI  LSN+TVFD  +N  +G +P     + ++E    +GN  +G V 
Sbjct  283   VFMDNGLGGCFPSEIGKLSNVTVFDASKNSFIGRVPTSFVGLTAVEELDISGNKLTGLVA  342

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +  SC+P   +  +A+DD+ NC+  RP Q+  Q+C   +
Sbjct  343   DNICGLPNLVNFTYSYNYFNGQGGSCVPGGGRKEIALDDTRNCLPRRPNQRSAQECAVVI  402

Query  168   SKPVDCSKTGCRAATKET  115
             ++PVDC+K  C      T
Sbjct  403   NRPVDCTKDKCAGGGGST  420



>dbj|BAK06060.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score =   394 bits (1013),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 191/369 (52%), Positives = 247/369 (67%), Gaps = 1/369 (0%)
 Frame = -3

Query  1233  DADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPK  1054
             D++A  IA+RQLL          + F   + + + FAN+R + AY ALQAW+ A+YSDPK
Sbjct  28    DSEASYIAQRQLLSLEKGDGELPDDFAFDIRVDVTFANERLRGAYRALQAWRAAMYSDPK  87

Query  1053  GITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHM  874
               T  WVG +VCSY GV C  AL+DP   VVAG+D+N  DIAG+LP  +G LTD+A  H+
Sbjct  88    NFTGGWVGADVCSYFGVTCAQALNDPNVTVVAGVDLNGGDIAGYLPAALGNLTDIAFFHI  147

Query  873   NSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPS  694
             NSNR CGI+P+T S L LL E+D SNN  VG FP V+L++P LKYLD+R+NNFEG LPP 
Sbjct  148   NSNRFCGIIPETFSRLMLLHELDVSNNRFVGGFPKVVLQIPVLKYLDIRFNNFEGELPPE  207

Query  693   LFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLL  514
             LF+K  D I++N+NR    +PEN GNSTASV+VLANNK  GC+P S+GRM  ++++++LL
Sbjct  208   LFEKSFDAIIVNSNRFVGFIPENIGNSTASVVVLANNKLVGCIPRSVGRMADTLDELMLL  267

Query  513   NNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGL  334
             NN   GC+P E+  L N TV DV  N  VG LP+ L  M  LE    + NM +G V + +
Sbjct  268   NNGLDGCIPPELGELINTTVVDVSGNAFVGTLPEELANMSKLEQLDVSRNMLAGAVAEPV  327

Query  333   CSLPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             C LP L N SF+ N+F ME  +C+P  DG V +DD  NCV  RPGQK P +C   L++PV
Sbjct  328   CKLPALANFSFASNFFSMEAAACVPAVDGEVTLDDQGNCVAGRPGQKTPLECGPVLARPV  387

Query  156   DCSKTGCRA  130
             DC    C A
Sbjct  388   DCRTNICSA  396



>ref|XP_010088853.1| Leucine-rich repeat extensin-like protein 4 [Morus notabilis]
 gb|EXB37050.1| Leucine-rich repeat extensin-like protein 4 [Morus notabilis]
Length=777

 Score =   395 bits (1016),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 195/361 (54%), Positives = 250/361 (69%), Gaps = 6/361 (2%)
 Frame = -3

Query  1215  IARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNW  1036
             I +RQLL++  E  F   G    +D  L F NDR + AY+ALQAWK+AI SDP  +T +W
Sbjct  61    IKQRQLLYYRDE--FGDRGENVTVDPSLTFENDRIRSAYIALQAWKNAILSDPNNLTTDW  118

Query  1035  VGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRIC  856
             VG NVC Y GVFC  ALD+P    VAGID+NH DIAG+LP E+GLL DLAL H+NSNR C
Sbjct  119   VGSNVCKYTGVFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLVDLALFHINSNRFC  178

Query  855   GIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDL  676
             G VP     LKLLFE+D SNN   G FP+V+L+LPSLK+LDLR+N FEG +P  LFDK L
Sbjct  179   GTVPHKFKELKLLFELDLSNNRFAGKFPEVVLKLPSLKFLDLRFNEFEGTVPKELFDKPL  238

Query  675   DVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSG  496
             D I +N+NR   +LP+NFGNS  SVIVLANNKF GCVPSS+G M  ++ +I+++NN F  
Sbjct  239   DAIFINHNRFVFDLPDNFGNSPVSVIVLANNKFHGCVPSSLGNM-TNLNEIIMMNNGFKS  297

Query  495   CLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNL  316
             CLP EI  L N+TVFDV  N+L+G +P+  G + ++E  + A NM SG +P  +CSLPNL
Sbjct  298   CLPPEIGSLKNLTVFDVSFNQLLGPIPESFGGLVNIEQLNVAHNMLSGKIPASICSLPNL  357

Query  315   KNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
             +N +FS N+F  E  +CL L+     DD  NC+ +RP Q+   +C  +LS+PVDC    C
Sbjct  358   QNFTFSYNFFTGEPPACLGLE---GFDDRRNCLPKRPAQRSAGQCKAFLSRPVDCGSFKC  414

Query  135   R  133
             +
Sbjct  415   K  415



>ref|XP_004138583.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4-like, partial [Cucumis sativus]
Length=517

 Score =   387 bits (994),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 200/369 (54%), Positives = 245/369 (66%), Gaps = 3/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             + + A+   I +RQLL    E D   + F+++LD+   F N+R KKAYVALQAWK A+YS
Sbjct  6     SVSQAEVSYITQRQLLTLK-EHDQLPDDFKYELDIPDTFPNERLKKAYVALQAWKLAVYS  64

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DPK +T NWVG NVCSYNGVFC  ALDDP   VVAGID+N  DIAG+LP E+GLLTDLAL
Sbjct  65    DPKNMTVNWVGANVCSYNGVFCAPALDDPKIEVVAGIDLNDGDIAGYLPPELGLLTDLAL  124

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P + S L L+FE D SNN  VG FP V+LE  S KYLDLRYN+FEG +
Sbjct  125   FHINSNRFCGIIPSSFSKLVLMFEFDVSNNRFVGHFPLVVLEWSSAKYLDLRYNDFEGEI  184

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LF  + D I LNNNR  S +PE  GNST SV+  ANN+F GC+PS+IG+M  ++ QI
Sbjct  185   PSTLFTNEFDAIFLNNNRFNSLIPETIGNSTVSVVSFANNEFHGCIPSTIGQM-SNLNQI  243

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             L + N+ SGC P EI  L N+TVFDV  N  +G+LP+ L  +Q+LE    + N   G V 
Sbjct  244   LFIGNKLSGCFPPEIGNLVNLTVFDVSNNGFIGQLPESLSGLQNLEIMDVSNNELRGSVS  303

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV-DDSDNCVLERPGQKLPQKCYEYLS  166
               LC LP L N +FS NYF  ED +C   K    + DDS NC+  RP QK   KC   L 
Sbjct  304   GDLCKLPKLANFTFSFNYFNGEDAACATSKGSEKLFDDSQNCLANRPMQKDANKCSTVLK  363

Query  165   KPVDCSKTG  139
             K VDC   G
Sbjct  364   KSVDCGNCG  372



>ref|XP_010252148.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=770

 Score =   395 bits (1014),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 241/337 (72%), Gaps = 4/337 (1%)
 Frame = -3

Query  1134  LEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAG  955
             L FAN R ++AY+ALQ WK AI+SDP   T NW GPNVCSY+GV+C  +L + +  VV+G
Sbjct  47    LRFANPRLRQAYIALQTWKTAIFSDPFNFTANWNGPNVCSYSGVYCSPSLFNSSVTVVSG  106

Query  954   IDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPF  775
             ID+NH+DIAG+LP E+GLLTDLAL H+NSNR CGIVP+T   LKLL+E+D SNN  VG F
Sbjct  107   IDLNHADIAGYLPPELGLLTDLALFHLNSNRFCGIVPRTFRRLKLLYELDLSNNRFVGRF  166

Query  774   PDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIV  595
             PDV+L LPSLKYLDLR+N+FEG++P  LFDKDLD I LN+NR    +P+N GNS  SVIV
Sbjct  167   PDVVLSLPSLKYLDLRFNDFEGSIPSGLFDKDLDAIFLNDNRFRFGIPDNLGNSPVSVIV  226

Query  594   LANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELP  415
             LANN   GC+PSSIG+M  ++ +I+L+N+  +GCLP EI LL ++TVFD+  N + G LP
Sbjct  227   LANNNLGGCIPSSIGKMGHTLNEIILMNDNLTGCLPSEIGLLKDVTVFDISFNHIQGPLP  286

Query  414   KGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDG----  247
               +G M+SLE    A NMF+G VP  +C LP L+N ++S NYF  E   C  L  G    
Sbjct  287   PAIGRMKSLEQLDVAHNMFTGVVPAVVCQLPRLENFTYSFNYFTGEAPKCAALISGGAGR  346

Query  246   VAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
             V +DD  NC+  +P Q+  ++C    ++PVDCSK  C
Sbjct  347   VLLDDRKNCIPGKPDQRSSRECSSQAAQPVDCSKFKC  383



>ref|XP_009119384.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Brassica rapa]
Length=834

 Score =   397 bits (1019),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 186/370 (50%), Positives = 255/370 (69%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  IA+RQLL    + D   E  E+K+D+KL F N R K+AY+ALQAWK A+YS
Sbjct  30    ALTDAEASFIAQRQLLTLPEDGDLP-ENIEYKVDIKLTFPNQRLKRAYIALQAWKKAVYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GV C  ALDDP   VVAG+D+N +DIAGHLP E+GLLTD+A+
Sbjct  89    DPFNTTGNWHGPHVCDYTGVVCAPALDDPNIAVVAGVDLNGADIAGHLPAELGLLTDVAM  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++S LKL+ E D SNN  VGPFP V+L  P++K++D+R+NNFEG +
Sbjct  149   FHLNSNRFCGIIPKSVSRLKLMHEFDVSNNRFVGPFPSVVLSWPAVKFIDVRFNNFEGKV  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF KDLD I LN+NR  S +PE+ G S+ASV+  A+N F+GC+P SIG M +++ +I
Sbjct  209   PQELFKKDLDAIFLNSNRFTSTIPESLGESSASVVTFAHNNFNGCIPKSIGNM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N+  GC P EI  L+N+ VFD   N   G LP+    +  +E    +GN  +G VP
Sbjct  268   IFKDNKLGGCFPSEIGKLANVNVFDASMNSFTGVLPQSFVGLIGVEEIDISGNKLTGFVP  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L NL+++ NYF  + + C+P  +  +A DD+ NC+ +RP Q+  ++C   +S
Sbjct  328   ENICKLPKLNNLTYAYNYFNGQGDMCVPGSQKDIAFDDTRNCLRDRPKQRSAKECAVVIS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>ref|XP_008378297.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Malus 
domestica]
Length=577

 Score =   389 bits (998),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 243/358 (68%), Gaps = 5/358 (1%)
 Frame = -3

Query  1209  RRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVG  1030
             +RQLL +  +    GE     +   L F N R + AY+ALQAWK A+ SDP+    NWVG
Sbjct  48    QRQLLXYIDQDGSRGETV--TVPDXLVFENSRLRSAYIALQAWKQAMVSDPRDQISNWVG  105

Query  1029  PNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGI  850
              +VC Y GVFC  A DDP+   VAGID+NH+DIAG LP E+GLL+D+AL H+NSNR CG 
Sbjct  106   SDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLSDIALFHINSNRFCGK  165

Query  849   VPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDV  670
             VPK+ + L+LLFE+D SNN   G FPDV+L+LP+LK+LDLR+N FEG +P  LFDKDLD 
Sbjct  166   VPKSFNKLQLLFELDLSNNRFAGXFPDVVLQLPALKFLDLRFNEFEGEVPKELFDKDLDA  225

Query  669   ILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCL  490
             I +N+NR    LP NFGNS  SVIVLANN F GCVP+S+G M +++ +++L NN F  CL
Sbjct  226   IFINHNRFSFELPNNFGNSPVSVIVLANNNFHGCVPASLGNMSKNLNELVLTNNGFHSCL  285

Query  489   PEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKN  310
             P EI +L  +TVFDV  N+ VGELPK +  M+SLE  + A NM  G +P+G+C L NL  
Sbjct  286   PREIGMLKKVTVFDVSHNRFVGELPKEIVEMESLEQLNVAHNMLRGTIPEGVCELQNLAK  345

Query  309   LSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
              S   N+F +E   CL LK+    DDS NC+ +RP Q+   +C   LSK VDCS  GC
Sbjct  346   FSIEHNFFTVEPPMCLKLKE---FDDSKNCLRKRPKQRTLLQCKLALSKKVDCSSFGC  400



>emb|CDY64248.1| BnaCnng43540D [Brassica napus]
Length=737

 Score =   394 bits (1011),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 191/344 (56%), Positives = 242/344 (70%), Gaps = 2/344 (1%)
 Frame = -3

Query  1149  KLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQ  970
             K+D  L+F NDR K+AY+ALQAWK AIYSDP   TKNWVGP+VCSYNGV+C  ALDDP+ 
Sbjct  47    KVDPSLKFENDRLKRAYIALQAWKKAIYSDPFKTTKNWVGPDVCSYNGVYCAEALDDPSL  106

Query  969   WVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNW  790
              VVAG+D+NH+DIAGHLP E+GL+TDLA+ H+NSNR CGI+PK+ S L L++E D SNN 
Sbjct  107   KVVAGVDLNHADIAGHLPAELGLITDLAMFHINSNRFCGIIPKSFSKLALMYEFDVSNNR  166

Query  789   LVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNST  610
              VG FP+V L  PSLK+LDLRYN FEG LP  +FDK+LD I LNNNR ES +P+  G S 
Sbjct  167   FVGSFPEVSLSWPSLKFLDLRYNEFEGCLPSEIFDKNLDAIFLNNNRFESVIPDTIGKSA  226

Query  609   ASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKL  430
             ASV+  ANNKFSGC+P SIG+M +++ +++   N  +GC P EI  L+N+TVFD   N  
Sbjct  227   ASVVTFANNKFSGCIPRSIGQM-KNLNEVIFTGNNLTGCFPNEIGSLNNVTVFDASNNGF  285

Query  429   VGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLK-  253
             VG LP  L  + S+E    + N  +G V D  C LPNL++  FS NYF  E ESC+P K 
Sbjct  286   VGSLPLTLSSLSSVEQLDLSNNKLTGSVVDTFCKLPNLESFKFSYNYFNGEAESCVPGKN  345

Query  252   DGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRAATK  121
             +G   DD  NC+  RP QK   +C   +S+P+DCSK  C   ++
Sbjct  346   NGKQFDDRSNCLKNRPNQKSVNQCVPVVSRPLDCSKDKCSGGSQ  389



>ref|XP_008337109.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 3 [Malus domestica]
Length=480

 Score =   385 bits (989),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 244/360 (68%), Gaps = 7/360 (2%)
 Frame = -3

Query  1209  RRQLLHFAAEVDFSG-EGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWV  1033
             +RQLL++    D  G  G        L F N R + AY ALQAWK A+ SDP   T NWV
Sbjct  48    QRQLLYYT---DHHGSRGVTVTAAGSLVFENPRLRSAYTALQAWKRAMVSDPWDQTSNWV  104

Query  1032  GPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICG  853
             G +VC Y GVFC  A DDP+   VAGID+NH+DIAG LP E+GLL D+AL H+NSNR CG
Sbjct  105   GSDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLLDIALFHINSNRFCG  164

Query  852   IVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLD  673
              VPK+ + LKLLFE+D SNN   G FPDV+L+LP+LK+LDLR+N FEG +P  LFDKDLD
Sbjct  165   KVPKSFNKLKLLFELDLSNNRFAGEFPDVVLQLPALKFLDLRFNEFEGKVPKELFDKDLD  224

Query  672   VILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGC  493
              I +N+NR    LP+NFG S  SVIVLANN F GCVP+S+G M +++ +++L +N F  C
Sbjct  225   AIFINHNRFSFQLPDNFGKSPVSVIVLANNNFHGCVPASLGNMSKNLNELVLAHNGFHSC  284

Query  492   LPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLK  313
             LP+EI +L N+ +FDV  N++VGELPK +  M+SLE  + A NM  G +P+G+C L NLK
Sbjct  285   LPKEIGMLKNVRLFDVSHNRVVGELPKEIVEMESLEXLNVAHNMLRGTIPEGVCELQNLK  344

Query  312   NLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCR  133
               SF  N+F  E   CL L++    DDS NC+ +RP Q+   +C   LSK VDCS  GC 
Sbjct  345   KFSFEHNFFTSEPLMCLKLEE---FDDSKNCLRKRPKQRTFLQCKLALSKKVDCSSFGCH  401



>gb|KFK36007.1| hypothetical protein AALP_AA4G065700 [Arabis alpina]
Length=831

 Score =   396 bits (1017),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/338 (56%), Positives = 240/338 (71%), Gaps = 2/338 (1%)
 Frame = -3

Query  1146  LDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQW  967
             +D  L+F NDR KKAY+ALQAWK AIYSDP   TKNWVG +VCSYNGV+C  ALDDP+  
Sbjct  49    VDPNLKFENDRLKKAYIALQAWKKAIYSDPFKTTKNWVGSDVCSYNGVYCAEALDDPSLT  108

Query  966   VVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWL  787
             VVAG+D+NH DIAGHLP E+GL+TDLAL H+NSNR CG++PK++S L L++E D SNN  
Sbjct  109   VVAGVDLNHGDIAGHLPPELGLITDLALFHINSNRFCGVIPKSLSKLGLMYEFDVSNNRF  168

Query  786   VGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTA  607
             VG FP+V L  PSLKYLDLR+N FEG LP  +FDKDLD I LNNNR +S +P   G STA
Sbjct  169   VGNFPEVSLSWPSLKYLDLRFNEFEGCLPKEIFDKDLDAIFLNNNRFDSVIPGTIGKSTA  228

Query  606   SVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLV  427
             SV+  ANNKFSGC+P +IG+M +++ +++   N  +GC P EI LL+N+T+FD   N  V
Sbjct  229   SVVTFANNKFSGCIPKTIGQM-KNLNEVVFTGNNLTGCFPNEIGLLNNMTIFDASNNGFV  287

Query  426   GELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLK-D  250
             G LP  L  + S+E    + N  +G V D +C LPNL+   FS N+F  E ESC+  + +
Sbjct  288   GSLPSSLSGLGSVEQLDLSNNKLTGFVVDKVCKLPNLERFKFSYNFFSGEAESCVNGRNN  347

Query  249   GVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
             G   DDS NC+  RP QK  ++C   +S+PVDCSK  C
Sbjct  348   GKQFDDSSNCLKNRPNQKSVKQCLPVVSRPVDCSKDKC  385



>emb|CDX95474.1| BnaC01g33660D [Brassica napus]
Length=691

 Score =   392 bits (1007),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 193/370 (52%), Positives = 255/370 (69%), Gaps = 4/370 (1%)
 Frame = -3

Query  1239  FTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSD  1060
              T+ +   + +RQLL  +   D S +  E+++DL L+FAN R K+AY+ALQAWK AIYSD
Sbjct  31    LTNEETSFLTKRQLLALSENEDLSDD-MEYEVDLNLKFANTRLKRAYIALQAWKKAIYSD  89

Query  1059  PKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALI  880
             P   + NW+G NVCSY GVFC  ALDD +  VVAGIDINH+DIAG+LP E+GLLTD+AL 
Sbjct  90    PFNTSANWIGQNVCSYKGVFCAPALDDQSIMVVAGIDINHADIAGYLPPELGLLTDVALF  149

Query  879   HMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALP  700
             H+NSNR CG++PK++S L L++E D SNN  VG FP V L  PSLK+LD+RYN+FEG LP
Sbjct  150   HVNSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGSFPMVALSWPSLKFLDIRYNDFEGKLP  209

Query  699   PSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQIL  520
               +F+KDLD I LNNNR ES +PE  G STASV+  A+NKFSGC+P +IG M +++ +I+
Sbjct  210   AEIFNKDLDAIFLNNNRFESIIPETIGESTASVVTFAHNKFSGCIPKTIGHM-KNLNEIV  268

Query  519   LLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPD  340
              + N+ SGC P EI  L+N+TVFD   N  VG LP  L  + ++E   F+ N  +G V D
Sbjct  269   FIGNKLSGCFPNEIGSLNNVTVFDASNNDFVGSLPSSLSSLANVEQMDFSFNKLTGFVTD  328

Query  339   GLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
              +C LP L N +FS N+F  E +SC+P        DD++NC+  RP QK   +C   +++
Sbjct  329   DVCKLPKLSNFTFSYNFFNGEAQSCVPGTSQDKQFDDTNNCLQNRPKQKPANECLPVITR  388

Query  162   PVDC-SKTGC  136
             PVDC S T C
Sbjct  389   PVDCISTTSC  398



>gb|KFK40046.1| hypothetical protein AALP_AA3G322800 [Arabis alpina]
Length=905

 Score =   398 bits (1022),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/370 (50%), Positives = 256/370 (69%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  I +RQLL      D   +  E+++DLK+ FAN R K+AY+ALQAWK A++S
Sbjct  30    ALTDAEASFIVQRQLLTLPENGDLPDD-IEYEVDLKVTFANHRLKRAYIALQAWKKAVFS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC+Y GVFC  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  89    DPFNTTGNWHGPHVCNYTGVFCAPALDDPNVAVVAGVDLNGADIAGHLPVELGLMTDVAM  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK++  LK++ E D SNN  VGPFP V+L  P++K++DLR+N+FEG +
Sbjct  149   FHLNSNRFCGIIPKSLDRLKIMHEFDVSNNRFVGPFPSVVLSWPAVKFIDLRFNDFEGQV  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF KDLD I LNNNR  S +PE+ G S+ASV+  A+NKFSGC+P SIG M +++ +I
Sbjct  209   PPQLFKKDLDAIFLNNNRFISTIPESLGESSASVVTFAHNKFSGCIPKSIGNM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N   GC P EI  L+N+ VFD   N   G LP     +  +E    +GN  +G VP
Sbjct  268   VFKDNSLGGCFPSEIGKLANVNVFDASMNSFTGVLPPSFVGLTGVEEFDISGNKLTGFVP  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L NL+++ NYF  +  SC+P  +  +A+DD+ NC+ +RP Q+  ++C   +S
Sbjct  328   ENICRLPKLVNLTYAYNYFNGQGASCVPGSRKEIALDDTRNCLPDRPKQRSAKECAVVIS  387

Query  165   KPVDCSKTGC  136
             +PVDCSK  C
Sbjct  388   RPVDCSKDKC  397



>ref|XP_011019702.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X4 [Populus euphratica]
Length=469

 Score =   384 bits (987),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 244/360 (68%), Gaps = 5/360 (1%)
 Frame = -3

Query  1212  ARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWV  1033
             ++R LLH+  E+D   E     L   L+F N R + AY+ALQAWK AI SDP  +T NWV
Sbjct  44    SQRHLLHYREELDIEDEYL--MLPACLKFDNPRLRSAYIALQAWKLAIISDPLNLTSNWV  101

Query  1032  GPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICG  853
             G +VCSY GVFC  +LD+ +   VAGID+NH D+AGHL  E+GLLTD+AL H+NSNR CG
Sbjct  102   GSDVCSYTGVFCATSLDNSSIQTVAGIDLNHGDMAGHLVEELGLLTDIALFHVNSNRFCG  161

Query  852   IVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLD  673
              VP++   LKLL+E+D SNN   G FP V+L+LP LKYLDLR+N FEG LP  LFDKDLD
Sbjct  162   KVPRSFKKLKLLYELDLSNNRFAGRFPYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLD  221

Query  672   VILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGC  493
              I +N+NR    LP+NFGNS  SVIVLANNKF GC P+S+  M +++ +++L+NN    C
Sbjct  222   AIFMNHNRFALELPDNFGNSPVSVIVLANNKFHGCFPTSLVNMSKTLNEVILMNNGLRSC  281

Query  492   LPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLK  313
             LP EI LL  +TVFD   NKL G LP  +G M+SLE  + A NM SG++P  +C LP+LK
Sbjct  282   LPREIGLLKKVTVFDASNNKLFGSLPDNIGEMESLELLNVAHNMLSGNIPGSVCLLPHLK  341

Query  312   NLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCR  133
             N S++ N+F  E  +CL L++    DD  NC+  RP Q+   +C  +LS+PV C    C 
Sbjct  342   NFSYAYNFFTGEPPACLDLEN---FDDGRNCLRNRPKQRSTLQCKVFLSRPVKCEAFKCH  398



>ref|XP_010489184.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Camelina sativa]
Length=777

 Score =   394 bits (1013),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/374 (49%), Positives = 255/374 (68%), Gaps = 3/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A  IA+RQLL      +   +  E+++DLK+ FAN R K+AY+ALQAWK A+YS
Sbjct  49    ALTDAEASFIAQRQLLTLPENGELPDD-IEYEVDLKVTFANHRLKRAYIALQAWKKAVYS  107

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC Y GVFC  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  108   DPFNTTGNWHGPHVCGYTGVFCAPALDDPNVAVVAGVDLNGADIAGHLPAELGLMTDVAM  167

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   L+L+ E D SNN  VGPFP V+L  P++K++D+RYN+FEG +
Sbjct  168   FHLNSNRFCGIIPKSFEKLRLMHEFDVSNNRFVGPFPSVVLSWPAVKFIDVRYNDFEGQV  227

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF KDLD I LNNNR  S +P++ G STASV+  A+NKFSGC+P +IG M +++ +I
Sbjct  228   PPELFKKDLDAIFLNNNRFTSTIPDSLGESTASVVTFAHNKFSGCIPKTIGNM-KNLNEI  286

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +  +N   GC P EI  L+N+ VFD   N   G LP     +  +E    + N  +G VP
Sbjct  287   IFKDNNLGGCFPSEIGKLANLNVFDASMNSFTGVLPPSFVGLTGVEEFDISVNKLTGFVP  346

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +C LP L NL+++ NY   + +SC+P  +  VA+DD+ NC+ +RP Q+  ++C   +S
Sbjct  347   ENVCKLPKLVNLTYAYNYLNGQGDSCVPGSRTEVALDDTRNCLPDRPKQRSAKECAVVIS  406

Query  165   KPVDCSKTGCRAAT  124
             +PVDCSK  C   +
Sbjct  407   RPVDCSKDKCAGGS  420



>emb|CDY16503.1| BnaA08g02640D [Brassica napus]
Length=730

 Score =   393 bits (1009),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/344 (55%), Positives = 241/344 (70%), Gaps = 2/344 (1%)
 Frame = -3

Query  1149  KLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQ  970
             K+D  L+F NDR K+AY+ALQAWK AIYSDP   TKNWVGP+VCSYNGV+C  ALDDP+ 
Sbjct  47    KVDPSLKFENDRLKRAYIALQAWKKAIYSDPFKTTKNWVGPDVCSYNGVYCAEALDDPSL  106

Query  969   WVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNW  790
              VVAG+D+NH+DIAGHLP E+GL+TDLA+ H+NSNR CGI+PK++S L L++E D SNN 
Sbjct  107   KVVAGVDLNHADIAGHLPAELGLITDLAMFHINSNRFCGIIPKSLSKLALMYEFDVSNNR  166

Query  789   LVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNST  610
              VGPFP+V L  PSLK+LDLRYN FEG LP  +FDK+LD I LNNNR ES +P+  G S 
Sbjct  167   FVGPFPEVSLSWPSLKFLDLRYNEFEGCLPSEIFDKNLDAIFLNNNRFESVIPDTIGKSA  226

Query  609   ASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKL  430
             AS++  ANNKFSGC+P SIG+M +++ +++   N  +GC P EI  L+N+TVFD   N  
Sbjct  227   ASIVTFANNKFSGCIPRSIGQM-KNLNEVIFTGNNLTGCFPNEIGSLNNVTVFDASNNGF  285

Query  429   VGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLK-  253
             +G LP  L  +  +E    + N  +G V D  C LPNL+   FS NYF  E ESC+  K 
Sbjct  286   IGSLPLTLSSLSRVEQLDLSNNKLTGSVVDTFCKLPNLERFKFSYNYFNGEAESCVHGKN  345

Query  252   DGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRAATK  121
             +G   DD  NC+  RP QK   +C   +S+PVDCSK  C   ++
Sbjct  346   NGKQFDDRSNCLKNRPDQKSVNQCVPVVSRPVDCSKDKCSGGSQ  389



>ref|XP_008463374.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Cucumis 
melo]
Length=771

 Score =   394 bits (1012),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 198/369 (54%), Positives = 252/369 (68%), Gaps = 6/369 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               +DA+A  I  RQLL++  E  F   G    +D  L F NDR + AY+ALQAWK AI S
Sbjct  26    TLSDAEALFIRHRQLLYYRDE--FGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILS  83

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVG NVC+Y GVFC  +LD+P    VAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  84    DPLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  143

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG +P     LKLL+E+D SNN   G FPDV+L+LP+LK+LDLR+N FEG++
Sbjct  144   FHINSNRFCGTLPHRFDRLKLLYELDLSNNRFAGKFPDVVLKLPTLKFLDLRFNEFEGSV  203

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR    LP+NFGNS  SVIVLANNKF GCVPSS+G M + + +I
Sbjct  204   PRELFDKDLDAIFINHNRFRFELPDNFGNSPVSVIVLANNKFHGCVPSSLGNMTR-LNEI  262

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +++NN  + CLP EI  L N+TVFDV  N+LVG LP+  G + SLE  + A N  SG +P
Sbjct  263   IMMNNGLNSCLPPEIGALKNLTVFDVSSNELVGPLPETFGGLVSLEQLNVADNFLSGKIP  322

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             + +C LP L+N +FS N+F  E  +CL + D     D  NC+  RPGQ+   +C  +LS+
Sbjct  323   ESICELPKLQNFTFSNNFFSGEPPACLRVPD---FSDRRNCLAGRPGQRSTGQCNAFLSR  379

Query  162   PVDCSKTGC  136
             PVDC+   C
Sbjct  380   PVDCNAFKC  388



>ref|XP_011019700.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Populus euphratica]
 ref|XP_011019701.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X3 [Populus euphratica]
Length=482

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 244/360 (68%), Gaps = 5/360 (1%)
 Frame = -3

Query  1212  ARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWV  1033
             ++R LLH+  E+D   E     L   L+F N R + AY+ALQAWK AI SDP  +T NWV
Sbjct  44    SQRHLLHYREELDIEDEYL--MLPACLKFDNPRLRSAYIALQAWKLAIISDPLNLTSNWV  101

Query  1032  GPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICG  853
             G +VCSY GVFC  +LD+ +   VAGID+NH D+AGHL  E+GLLTD+AL H+NSNR CG
Sbjct  102   GSDVCSYTGVFCATSLDNSSIQTVAGIDLNHGDMAGHLVEELGLLTDIALFHVNSNRFCG  161

Query  852   IVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLD  673
              VP++   LKLL+E+D SNN   G FP V+L+LP LKYLDLR+N FEG LP  LFDKDLD
Sbjct  162   KVPRSFKKLKLLYELDLSNNRFAGRFPYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLD  221

Query  672   VILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGC  493
              I +N+NR    LP+NFGNS  SVIVLANNKF GC P+S+  M +++ +++L+NN    C
Sbjct  222   AIFMNHNRFALELPDNFGNSPVSVIVLANNKFHGCFPTSLVNMSKTLNEVILMNNGLRSC  281

Query  492   LPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLK  313
             LP EI LL  +TVFD   NKL G LP  +G M+SLE  + A NM SG++P  +C LP+LK
Sbjct  282   LPREIGLLKKVTVFDASNNKLFGSLPDNIGEMESLELLNVAHNMLSGNIPGSVCLLPHLK  341

Query  312   NLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCR  133
             N S++ N+F  E  +CL L++    DD  NC+  RP Q+   +C  +LS+PV C    C 
Sbjct  342   NFSYAYNFFTGEPPACLDLEN---FDDGRNCLRNRPKQRSTLQCKVFLSRPVKCEAFKCH  398



>ref|XP_002885650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61909.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score =   385 bits (988),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 191/375 (51%), Positives = 251/375 (67%), Gaps = 7/375 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +D +   I RRQLL++  E  F   G +  +D  L F N R + AY+ALQAWK AI SDP
Sbjct  35    SDTEVRFIQRRQLLYYRDE--FGDRGEKVTVDPSLIFENPRLRSAYIALQAWKQAILSDP  92

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               IT NW+G NVC+Y GVFC  ALD+     VAGID+NH+DIAG+LP E+GLLTDLAL H
Sbjct  93    NNITVNWIGSNVCNYTGVFCSRALDNRKIRTVAGIDLNHADIAGYLPEELGLLTDLALFH  152

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP     LKLLFE+D SNN   G FP V+L LPSLK+LDLR+N FEG +P 
Sbjct  153   VNSNRFCGTVPHKFKQLKLLFELDLSNNRFAGKFPTVVLHLPSLKFLDLRFNEFEGTVPK  212

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LF K+LD I +N+NR    LPENFG+S  SVIVLANN F GC+P+S+  M +++ +I+ 
Sbjct  213   ELFSKNLDAIFINHNRFRFELPENFGDSPVSVIVLANNHFHGCIPTSLVEM-KNLNEIIF  271

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN  + CLP +I  L N+TVFDV  N+LVG LP+ +G M ++E  + A N+ SG +P  
Sbjct  272   MNNGLNSCLPADIGSLKNVTVFDVSFNELVGPLPESVGGMVAVEQLNVAHNLLSGKIPAS  331

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK-P  160
             +C LP L+N ++S N+F  E   CL L +    DD  NC+  RP Q+  ++C  +LS+ P
Sbjct  332   ICQLPKLENFTYSYNFFTGEAPVCLRLPE---FDDRRNCLPGRPAQRSSRQCSAFLSRPP  388

Query  159   VDCSKTGCRAATKET  115
             VDC   GC  + K++
Sbjct  389   VDCGSFGCGRSVKQS  403



>ref|XP_004501605.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like [Cicer arietinum]
Length=906

 Score =   397 bits (1020),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 189/369 (51%), Positives = 254/369 (69%), Gaps = 1/369 (0%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A ++ +   IARRQLLH     D   E +       L F +   K+AY+ALQAWK A+YS
Sbjct  24    ALSNEEVSFIARRQLLHLHENEDLP-ENYTDNYTTDLTFPHPGLKRAYIALQAWKKAMYS  82

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T +WVGP+VCSY+GVFC  +L+D    VVAGID+NH+DIAG++P+E GLLTDLAL
Sbjct  83    DPLNSTADWVGPDVCSYHGVFCAPSLNDSNIEVVAGIDLNHADIAGYIPSEFGLLTDLAL  142

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             +H+NSNR CGI+PK+ S L LL+E+D SNN  VG FP  +L +P +K++DLRYN+FEG +
Sbjct  143   LHINSNRFCGIIPKSFSKLILLYELDISNNRFVGTFPTPVLSIPDIKFIDLRYNDFEGEI  202

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF+K LD I LNNNR  S +PEN G+S ASV+VLANN  SGC+P+SIG M+ ++ + 
Sbjct  203   PSELFNKQLDAIFLNNNRFTSTIPENLGSSPASVVVLANNHLSGCIPASIGEMKNTLNEF  262

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             ++LNN  +GCLP +I  L N+TVFDV  N  VG LP+    ++++E  S A N  +G VP
Sbjct  263   VILNNNLTGCLPSDIGKLENVTVFDVSENVFVGVLPRTFKGLKNVEKLSIAHNKLTGFVP  322

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +C+L +L N +FS NYF  E+E C+P +  + ++D  NC+ +RP QK    C   +SK
Sbjct  323   RSVCTLSSLVNFTFSYNYFNGEEEGCVPPRKDIWLNDKYNCIPDRPRQKATNDCNVVISK  382

Query  162   PVDCSKTGC  136
             PVDCSK  C
Sbjct  383   PVDCSKAQC  391



>ref|XP_008458201.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific leucine-rich 
repeat extensin-like protein 3 [Cucumis melo]
Length=636

 Score =   389 bits (1000),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 197/367 (54%), Positives = 248/367 (68%), Gaps = 3/367 (1%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             ++A+A  + RRQLL   A  +   + F+++LD+   F N+R KKAYVALQAWK A+YSDP
Sbjct  32    SEAEASYLTRRQLLALKAHGELPDD-FKYELDIPDTFPNERLKKAYVALQAWKLAVYSDP  90

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
             + +T NWVG +VCSY GVFC  ALDDP   VVAGID+NH DIAG+LP E+GLLTDLAL H
Sbjct  91    QNMTANWVGADVCSYIGVFCAPALDDPKIEVVAGIDLNHGDIAGYLPPELGLLTDLALFH  150

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CGI+P + S L L+FE D SNN  VG FP V+LE PS KYLDLRYN+FEG +P 
Sbjct  151   INSNRFCGIIPSSFSKLVLMFEFDVSNNRFVGYFPLVVLEWPSAKYLDLRYNDFEGEIPS  210

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
             +LF K+ D I LNNNR  S +PE  GNST SV+  ANN+F GC+PS+IG+M  ++ QIL 
Sbjct  211   TLFTKEFDAIFLNNNRFNSLIPETIGNSTVSVVSFANNEFHGCIPSTIGQM-SNLNQILF  269

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             L N+  GC P EI  L N+TVFDV  N  +G+LP+ L  +Q LE    + N   G V  G
Sbjct  270   LGNKLGGCFPPEIGNLVNLTVFDVSSNGFIGQLPESLSGLQKLEILDVSNNELRGSVCGG  329

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV-DDSDNCVLERPGQKLPQKCYEYLSKP  160
             +C LP L N +FS NYF+ +D +C+  K    + DD  NC+  RP QK   KC   L K 
Sbjct  330   ICKLPKLANFTFSFNYFDGKDAACVASKGSEKIFDDGQNCLANRPVQKDANKCSTILKKS  389

Query  159   VDCSKTG  139
             V+C   G
Sbjct  390   VECGNCG  396



>ref|XP_009377376.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=679

 Score =   390 bits (1003),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 243/359 (68%), Gaps = 5/359 (1%)
 Frame = -3

Query  1209  RRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVG  1030
             +RQLL++  +    GE     +   L F N R + AY+ALQAWK A+ SDP     NWVG
Sbjct  48    QRQLLYYIDQDGSRGETV--TVPASLVFENSRLRSAYIALQAWKQAMVSDPLDQISNWVG  105

Query  1029  PNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGI  850
              +VC Y GVFC  A DDP+   VAGID+NH+DIAG LP E+GLL+D+AL H+NSNR CG 
Sbjct  106   SDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLSDIALFHINSNRFCGK  165

Query  849   VPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDV  670
             VPK+   L+LLFE+D SNN   G FPDV+L+LP+LK+LDLR+N FEG +P  LFDKDLD 
Sbjct  166   VPKSFKKLQLLFELDLSNNRFAGEFPDVVLQLPALKFLDLRFNEFEGEIPKELFDKDLDA  225

Query  669   ILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCL  490
             I +N+NR    LP NFGNS  SVIVLANN F GCVP+S+G+M +++ +++L NN F  CL
Sbjct  226   IFINHNRFSFKLPNNFGNSPVSVIVLANNNFHGCVPASLGKMSKNLNELVLTNNGFHSCL  285

Query  489   PEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKN  310
             P EI +L  +TVFDV  N+ VGELPK +  M+SLE  + A NM  G +P+G+C L NL  
Sbjct  286   PREIGMLKKVTVFDVSHNRFVGELPKEIVEMESLEQLNVAHNMLRGTIPEGVCELQNLAK  345

Query  309   LSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCR  133
              SF  N F +E   CL L++    DDS NC+ +RP Q+   +C   LSK VDCS  GC 
Sbjct  346   FSFEHNLFTVEPPMCLKLEE---FDDSKNCLRKRPKQRTLLQCKLALSKKVDCSSFGCH  401



>ref|XP_011019699.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X1 [Populus euphratica]
Length=492

 Score =   384 bits (987),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 244/360 (68%), Gaps = 5/360 (1%)
 Frame = -3

Query  1212  ARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWV  1033
             ++R LLH+  E+D   E     L   L+F N R + AY+ALQAWK AI SDP  +T NWV
Sbjct  44    SQRHLLHYREELDIEDEYL--MLPACLKFDNPRLRSAYIALQAWKLAIISDPLNLTSNWV  101

Query  1032  GPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICG  853
             G +VCSY GVFC  +LD+ +   VAGID+NH D+AGHL  E+GLLTD+AL H+NSNR CG
Sbjct  102   GSDVCSYTGVFCATSLDNSSIQTVAGIDLNHGDMAGHLVEELGLLTDIALFHVNSNRFCG  161

Query  852   IVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLD  673
              VP++   LKLL+E+D SNN   G FP V+L+LP LKYLDLR+N FEG LP  LFDKDLD
Sbjct  162   KVPRSFKKLKLLYELDLSNNRFAGRFPYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLD  221

Query  672   VILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGC  493
              I +N+NR    LP+NFGNS  SVIVLANNKF GC P+S+  M +++ +++L+NN    C
Sbjct  222   AIFMNHNRFALELPDNFGNSPVSVIVLANNKFHGCFPTSLVNMSKTLNEVILMNNGLRSC  281

Query  492   LPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLK  313
             LP EI LL  +TVFD   NKL G LP  +G M+SLE  + A NM SG++P  +C LP+LK
Sbjct  282   LPREIGLLKKVTVFDASNNKLFGSLPDNIGEMESLELLNVAHNMLSGNIPGSVCLLPHLK  341

Query  312   NLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCR  133
             N S++ N+F  E  +CL L++    DD  NC+  RP Q+   +C  +LS+PV C    C 
Sbjct  342   NFSYAYNFFTGEPPACLDLEN---FDDGRNCLRNRPKQRSTLQCKVFLSRPVKCEAFKCH  398



>gb|KDP32304.1| hypothetical protein JCGZ_13229 [Jatropha curcas]
Length=713

 Score =   391 bits (1004),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 194/368 (53%), Positives = 252/368 (68%), Gaps = 6/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +DA+A  I +RQLL++  E    GE  +  +D  L F N R K AY+ALQAWK AI SDP
Sbjct  38    SDAEAMYIKKRQLLYYRDEYGDRGE--KVTVDPSLVFENPRLKNAYIALQAWKQAILSDP  95

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
             + +T +WVGPNVC Y GVFC  A D+ T   VAGID+NH DIAG+LP E+GLL DLAL H
Sbjct  96    QNLTSDWVGPNVCDYTGVFCAPAPDNKTIRTVAGIDLNHGDIAGYLPEELGLLVDLALFH  155

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP     + LLFE+D SNN   G FP V+L+LP LK+LDLR+N FEG +P 
Sbjct  156   INSNRFCGTVPHKFKEMTLLFELDLSNNRFAGKFPQVVLKLPKLKFLDLRFNEFEGTVPK  215

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDKDLD I +N+NR   ++P+NFGNS  SVIVLANN+F GCVPSS+G M  ++ +I+L
Sbjct  216   ELFDKDLDAIFINHNRFVFDIPDNFGNSPVSVIVLANNRFHGCVPSSLGNMS-NLNEIIL  274

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN    CLP EI +L N+TVFDV  N+L+G LP   G + SLE  + A N+ SG++P  
Sbjct  275   MNNNLKSCLPPEIGMLKNLTVFDVSFNQLLGPLPDSFGGLVSLEQLNVAHNLLSGNIPAS  334

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +C LPNL+N +FS N+F  E  +CL L+     +D  NC+  RP Q+   +C  +LSKPV
Sbjct  335   ICQLPNLENFTFSYNFFTGEPPACLSLQ---GFEDRRNCLPGRPVQRSTAQCQAFLSKPV  391

Query  156   DCSKTGCR  133
             +C+   C+
Sbjct  392   NCNSFRCK  399



>ref|XP_008458676.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3, partial [Cucumis melo]
Length=568

 Score =   386 bits (992),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 194/369 (53%), Positives = 246/369 (67%), Gaps = 3/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             + ++ +A  + RRQLL      +   + F++KLD+   F N+R K AYVALQAWK AIYS
Sbjct  26    SISEVEASYLTRRQLLTLKQHDELPND-FKYKLDIADTFPNERLKMAYVALQAWKLAIYS  84

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP+ +T NWVG +VCSY GVFC  ALD+P   VVAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  85    DPQNMTANWVGADVCSYTGVFCAPALDNPNIEVVAGIDLNHGDIAGYLPPELGLLTDLAL  144

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P + S L L+FE D SNN  VG FP V+LE PS KYLDLRYN+FEG +
Sbjct  145   FHINSNRFCGIIPSSFSKLVLMFEFDVSNNRFVGHFPLVVLEWPSAKYLDLRYNDFEGEI  204

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LF K+ D I LNNNR  S +PE  GNST SV+  ANN+F GC+PS+IG+M  ++ QI
Sbjct  205   PSTLFTKEFDAIFLNNNRFNSLIPETIGNSTVSVVSFANNEFHGCIPSTIGQM-SNLNQI  263

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             L L N+  GC P EI  L N+TVFD+  N   G+LP+ L  +Q+LE    + N   G + 
Sbjct  264   LFLGNKLGGCFPPEIGNLVNLTVFDISSNGFTGQLPESLSGLQNLEILDVSNNELRGSIS  323

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV-DDSDNCVLERPGQKLPQKCYEYLS  166
              GLC LP L N +FS NYF+ +D +C+  K    V +D  NC+  RP QK   KC   L 
Sbjct  324   AGLCKLPKLANFTFSFNYFDRQDTTCVASKGSKKVFNDGQNCLANRPVQKDANKCSTVLK  383

Query  165   KPVDCSKTG  139
             K V+C   G
Sbjct  384   KSVECGNCG  392



>ref|XP_006303848.1| hypothetical protein CARUB_v10012584mg [Capsella rubella]
 gb|EOA36746.1| hypothetical protein CARUB_v10012584mg [Capsella rubella]
Length=852

 Score =   395 bits (1014),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 245/344 (71%), Gaps = 2/344 (1%)
 Frame = -3

Query  1152  HKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPT  973
             +K+D  L F NDR K+AY+ALQAWK AIYSDP   T NWVG NVCSYNGVFC  ALD+P+
Sbjct  53    NKVDPNLRFENDRLKRAYIALQAWKKAIYSDPFKTTSNWVGSNVCSYNGVFCAPALDNPS  112

Query  972   QWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNN  793
               VVAG+D+NH+DI+GHLP E+GL+TDLAL H+NSNR CGI+PK++S L L++E D SNN
Sbjct  113   INVVAGVDLNHADISGHLPPELGLMTDLALFHINSNRFCGIIPKSLSKLALMYEFDVSNN  172

Query  792   WLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNS  613
               VG FPDV L  PSLKYLD+RYN FEG+LP  +FDKDLD I LNNNR ES +P   G S
Sbjct  173   RFVGKFPDVTLLWPSLKYLDIRYNEFEGSLPLEIFDKDLDAIFLNNNRFESFIPHTIGKS  232

Query  612   TASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNK  433
              ASV+  ANNKF GC+P SIG M +++ +I+   N  +GC P EI LL+N+TVFD  +N 
Sbjct  233   KASVVTFANNKFIGCIPKSIGNM-KNLNEIVFTGNNLTGCFPNEIGLLNNVTVFDASKNG  291

Query  432   LVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLK  253
              VG LP  L  + S+E    + N  +G V D LC LP+L+   FS N+F  E ESC+P +
Sbjct  292   FVGSLPSSLSSLASVEQLDLSHNKLTGFVVDKLCKLPSLERFKFSYNFFNGEAESCVPGR  351

Query  252   -DGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRAAT  124
              +G  +DD++NC+  RP QKL ++C   +S+PVDCSK  C   +
Sbjct  352   SNGKQIDDTNNCLPNRPSQKLAKQCLPVVSRPVDCSKDICSGGS  395



>ref|XP_003575453.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Brachypodium distachyon]
Length=661

 Score =   389 bits (999),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 239/344 (69%), Gaps = 1/344 (0%)
 Frame = -3

Query  1158  FEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDD  979
             FE  + + + FAN+R ++AY+ALQAW+ AIYSDPK  T  W G +VC+Y GV C  ALDD
Sbjct  37    FEFDIHVDVTFANERLRRAYIALQAWRKAIYSDPKNFTGGWAGADVCAYFGVSCVQALDD  96

Query  978   PTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFS  799
             P   VVA +D+N  DIAGHLP E+GLL D+A+ H+NSNR CGI+P+T S L LL E+D S
Sbjct  97    PNATVVAAVDLNGGDIAGHLPPELGLLADIAVFHINSNRFCGIIPETFSRLSLLHELDVS  156

Query  798   NNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFG  619
             NN  VGPFP V+L +P LKYLDLR+N+FEG LP  LF+K LD ++LN+NR    +P+N G
Sbjct  157   NNRFVGPFPKVVLHIPVLKYLDLRFNDFEGELPKELFEKSLDAVVLNSNRFVGFIPDNIG  216

Query  618   NSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQR  439
             NSTAS++VLANNKF GC+P  +G M  ++++++LLNN   GC+P E+ +L N TV DV  
Sbjct  217   NSTASMVVLANNKFVGCIPRGVGMMAGTLDELVLLNNRLDGCMPPELGMLGNTTVVDVSG  276

Query  438   NKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLP  259
             N L G LP+ L  ++ +E    + N+ +G V + +C+LP L N SF GN+F  E  +C+P
Sbjct  277   NALAGTLPEELQGLKKVEQLDVSRNLMAGAVGEKVCTLPALANFSFGGNFFSQEAPACVP  336

Query  258   LKDG-VAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
              + G V +DD  NC+  RP QK P +C   L++PVDCS   C A
Sbjct  337   KEGGDVEMDDKGNCLPGRPAQKTPLECGPVLARPVDCSTNVCSA  380



>ref|XP_003630813.1| Extensin-like protein [Medicago truncatula]
 gb|AET05289.1| LRR extensin-like protein [Medicago truncatula]
Length=712

 Score =   390 bits (1002),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/336 (58%), Positives = 232/336 (69%), Gaps = 4/336 (1%)
 Frame = -3

Query  1137  KLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVA  958
              L F N+R + AY+ALQA K AI SDP   T NWVG NVCSY G++C  ALD+P    VA
Sbjct  31    SLVFENNRIQNAYIALQALKQAILSDPLNFTTNWVGSNVCSYTGIYCAQALDNPNIRTVA  90

Query  957   GIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGP  778
             GID+NH+DIAG+LP E+GLLTDLAL H+NSNR CG VP T   LKLLFE+D SNN   G 
Sbjct  91    GIDLNHADIAGYLPDELGLLTDLALFHINSNRFCGTVPHTFQKLKLLFELDLSNNRFAGK  150

Query  777   FPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVI  598
             FP V+L LP LK+LD+R+N FEG +P  LFDKDLD I +N+NR   +LPEN GNS  SV+
Sbjct  151   FPKVVLSLPVLKFLDIRFNEFEGTVPKELFDKDLDAIFINDNRFAFDLPENLGNSPVSVV  210

Query  597   VLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGEL  418
             V ANNKF GC+PSSIG M  ++ +I  LNN F  CLP EI LL N+TVFDV  N+LVG L
Sbjct  211   VFANNKFKGCIPSSIGNMS-NLNEINFLNNLFKSCLPSEIGLLKNLTVFDVGFNQLVGPL  269

Query  417   PKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV  238
             P  +G   SLE  + A NMFSG +P  +C LPNLKN +FS N+F  E  +C  L    A 
Sbjct  270   PAAIGGAVSLEELNVAHNMFSGKIPSSICMLPNLKNFTFSDNFFTGEPPACFGLP---AS  326

Query  237   DDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
             DD  NC+  RP QK   +C  +LSKPVDC   GC+A
Sbjct  327   DDRRNCLPARPFQKTLVECASFLSKPVDCKSFGCKA  362



>gb|AGT16233.1| hypothetical protein SHCRBa_161_O13_R_110 [Saccharum hybrid cultivar 
R570]
Length=843

 Score =   394 bits (1012),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/366 (53%), Positives = 251/366 (69%), Gaps = 2/366 (1%)
 Frame = -3

Query  1227  DAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGI  1048
             +A +IARRQLL          + FE  + + + FAN+  ++AYVALQAW+ A+YSDPK  
Sbjct  47    EASDIARRQLLSLREGDGDLPDDFEFDIHVDVTFANNHLRRAYVALQAWRRAMYSDPKNF  106

Query  1047  TKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNS  868
             T  WVG +VCSY GV C  ALDD    VVAG+D+N  DIAG+LP E+G+LTD+A  H+NS
Sbjct  107   TGGWVGADVCSYFGVTCVPALDDAKTTVVAGVDLNGGDIAGYLPAELGMLTDIAFFHINS  166

Query  867   NRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLF  688
             NR CGI+PK+ S L LL E+D SNN  VG FPDV+L++P LKYLDLR+N+F+G LPP LF
Sbjct  167   NRFCGIIPKSFSRLALLHELDVSNNRFVGGFPDVVLQIPVLKYLDLRFNDFDGTLPPHLF  226

Query  687   DKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNN  508
             DKDLD I +N+NR    +PENFGNSTA+V+VLANN F GC+P S+GRM  +++Q++LLNN
Sbjct  227   DKDLDAIFVNSNRFVGFIPENFGNSTATVVVLANNAFVGCIPRSVGRMADTLDQLMLLNN  286

Query  507   EFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCS  328
                GC+P E+  L N TV DV  N L+G LP+GL  M  LE    + N  +G V + +C 
Sbjct  287   RLDGCIPPELAELINSTVVDVSGNALIGTLPEGLVNMTRLEQLDVSRNQLAGAVAERVCK  346

Query  327   LPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCV-LERPGQKLPQKCYEYLSKPVD  154
             LP L N SF+ N+F +E E+C+P +D  VA+DD  NC+   RP QK   +C   L+ PVD
Sbjct  347   LPALANFSFAHNFFSVEAEACVPSEDSPVALDDRGNCLNGGRPEQKPSLECAPVLAHPVD  406

Query  153   CSKTGC  136
             C    C
Sbjct  407   CRTNVC  412



>gb|AFW56506.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=972

 Score =   397 bits (1019),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/363 (54%), Positives = 252/363 (69%), Gaps = 2/363 (1%)
 Frame = -3

Query  1218  NIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKN  1039
             +IARRQLL          + FE  + + + FAN+R ++AYVALQAW+ A+YSDPK  T  
Sbjct  41    DIARRQLLSLREGDGDLPDDFEFDIHVDVTFANERLRRAYVALQAWRRAMYSDPKNFTGG  100

Query  1038  WVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRI  859
             WVG +VCSY GV C  ALDD    VVAGID+N  DIAG+LP E+G+LTD+A  H+NSNR 
Sbjct  101   WVGADVCSYFGVTCVPALDDANTTVVAGIDLNGGDIAGYLPAELGMLTDIAFFHINSNRF  160

Query  858   CGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKD  679
             CGI+PK+ S L LL E+D SNN  VG FPDV+L++P LKYLDLR+N+F+G LPP LFDKD
Sbjct  161   CGIIPKSFSRLTLLHELDVSNNRFVGGFPDVVLQIPVLKYLDLRFNDFDGTLPPHLFDKD  220

Query  678   LDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFS  499
             LD I +N+NR    +PENFGNSTA+V+VLANN F GC+P S+GRM  ++++++LLNN   
Sbjct  221   LDAIFVNSNRFVGFIPENFGNSTATVVVLANNAFIGCIPRSVGRMADTLDELMLLNNRLD  280

Query  498   GCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPN  319
             GC+P E+  L N TV DV  N LVG LP+GL  M  LE    + N  +G V + +C LP 
Sbjct  281   GCIPPELAELVNSTVVDVSGNALVGTLPEGLVNMIRLEQLDVSRNQLAGAVAENVCKLPA  340

Query  318   LKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCV-LERPGQKLPQKCYEYLSKPVDCSK  145
             L N SF+ N+F +E E+C+P +D  VA+DDS NC+   RPGQK   +C   L+ PVDC  
Sbjct  341   LANFSFAHNFFSVEAEACVPSEDSPVALDDSGNCLDGGRPGQKPLPECALVLAHPVDCRT  400

Query  144   TGC  136
               C
Sbjct  401   NVC  403



>ref|XP_009348443.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=745

 Score =   390 bits (1003),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 247/360 (69%), Gaps = 7/360 (2%)
 Frame = -3

Query  1209  RRQLLHFAAEVDFSG-EGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWV  1033
             +RQLL++    D  G  G        L F N R + AY ALQAWK A+ SDP+  T NWV
Sbjct  48    QRQLLYYT---DHHGSRGVTVTAAGSLVFENPRLRSAYTALQAWKRAMVSDPRDQTSNWV  104

Query  1032  GPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICG  853
             G +VC Y GVFC  A DDP+   VAGID+NH+DIAG LP E+GLL D+AL H+NSNR CG
Sbjct  105   GSDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLLDIALFHINSNRFCG  164

Query  852   IVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLD  673
              VPK+ + LKLLFE+D SNN   G FPDV+L+LP+LK+LDLR+N FEG +P  LFDKDLD
Sbjct  165   KVPKSFNKLKLLFELDLSNNRFAGEFPDVVLQLPALKFLDLRFNEFEGKVPKELFDKDLD  224

Query  672   VILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGC  493
              I +N+NR    LP+NFG S  SVIVLANN F GCVP+S+G+M +++ +++L NN F  C
Sbjct  225   AIFINHNRFSFQLPDNFGKSPVSVIVLANNNFHGCVPASLGKMSKNLNELVLANNRFHSC  284

Query  492   LPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLK  313
             LP+EI +L+N+ +FDV  N++VGELPK +  M+SLE  + A NM  G +P+G+C L NLK
Sbjct  285   LPKEIGMLTNVRLFDVSHNRIVGELPKEIVEMESLEQLNVAHNMLRGTIPEGVCELQNLK  344

Query  312   NLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCR  133
               SF  N+F  E   CL L++    DDS NC+ +RP Q+   +C   LSK +DCS  GC 
Sbjct  345   KFSFEHNFFTSEPLMCLKLEE---FDDSKNCLRKRPKQRTFLQCKLALSKKIDCSSFGCH  401



>ref|XP_006342607.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3-like [Solanum tuberosum]
Length=698

 Score =   389 bits (999),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 192/370 (52%), Positives = 255/370 (69%), Gaps = 3/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A +D +A  +ARRQL       +   + +E +++++  F N R ++AY+AL+AWK+AIYS
Sbjct  23    ALSDHEASLLARRQLSTLLENGNLP-DKYEFEVNVEYTFPNSRLRRAYIALKAWKEAIYS  81

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC+Y GVFC  ALDDP   VVAGID+NH+DIAG+ P E+GLLTD+AL
Sbjct  82    DPSEFTSNWKGPDVCNYKGVFCSPALDDPNVTVVAGIDLNHADIAGYFPVELGLLTDVAL  141

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGIVP++ S L L+ E D SNN LVGPFP V+L + SLKYLDLR+NNFEG L
Sbjct  142   FHLNSNRFCGIVPESFSKLTLMHEFDVSNNRLVGPFPKVVLNMSSLKYLDLRFNNFEGEL  201

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD + LN+NR  S +PE  GNS+ASVIV ANNKF GC+PSSIG+M  ++++I
Sbjct  202   PSQLFDKDLDALFLNDNRFVSTIPETLGNSSASVIVFANNKFHGCIPSSIGKM-LNLDEI  260

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + +NN+  GCLP E+ LL N+T+F+   N L G LPK L  +  +E    + N  +G VP
Sbjct  261   VFMNNDLGGCLPVEVGLLKNVTMFNAAGNLLSGILPKTLDGLSHVEELDISHNTLTGFVP  320

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESC-LPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + LCS  +LK   FS NYF  E + C    +  ++ DD +NC+  R  QK  ++C   +S
Sbjct  321   ENLCSSLSLKKFVFSFNYFNGEAKGCEARTRKDMSFDDRNNCLPGRAKQKSQKECQPIVS  380

Query  165   KPVDCSKTGC  136
             KP+DCSK  C
Sbjct  381   KPIDCSKAKC  390



>ref|XP_009352479.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=521

 Score =   383 bits (984),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 201/368 (55%), Positives = 253/368 (69%), Gaps = 6/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +D +A  I  RQLL++  E  F   G    +D  L F NDR + AY+ALQA K AI SDP
Sbjct  46    SDEEALYIKHRQLLYYRDE--FGDRGEHVTVDPSLVFENDRLRNAYIALQALKQAILSDP  103

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               IT NWVG NVC Y GVFC  ALD+ T   VAGID+NH DIAG+LP E+GLLTDLAL+H
Sbjct  104   FNITGNWVGSNVCKYTGVFCTKALDNRTIRTVAGIDLNHGDIAGYLPEELGLLTDLALLH  163

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP   + LKLLFE+D SNN   G FP V+L+LP LK+LDLR+N FEG +P 
Sbjct  164   INSNRFCGTVPHKFNRLKLLFELDLSNNRFAGKFPRVVLQLPKLKFLDLRFNEFEGTVPK  223

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDKDLD I +N+NR   +LP+NFGNS  SVIVLANNKF GCVP+S+G M  ++ +I+L
Sbjct  224   ELFDKDLDAIFINHNRFRFDLPDNFGNSPVSVIVLANNKFHGCVPASLGNM-SNLNEIIL  282

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN F  CLP EI +L N+TVFDV  N+ +G LP+ +G M SLE  + A N+ SG +P  
Sbjct  283   MNNGFRSCLPPEIGMLKNLTVFDVSFNQFLGSLPETIGGMVSLEQLNVAHNLLSGKIPAS  342

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +CSLP+L+N ++S N+F  E  +CL L      DD  NC+  RP Q+   +C  +LSKPV
Sbjct  343   ICSLPSLQNFTYSYNFFTGEPPACLGL---AGFDDKRNCLPNRPAQRTAAQCKSFLSKPV  399

Query  156   DCSKTGCR  133
             DCS   C+
Sbjct  400   DCSSFRCK  407



>ref|XP_004512961.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Cicer 
arietinum]
Length=745

 Score =   390 bits (1002),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 195/371 (53%), Positives = 251/371 (68%), Gaps = 6/371 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             + T+ +A  I  RQLL++  +  F   G    +D  L F N+R K AYVALQAWK AI S
Sbjct  41    SLTENEAMYIKHRQLLYYRDQ--FCDRGENVTVDPNLVFQNNRIKNAYVALQAWKHAILS  98

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP+  T +WVG NVC+Y  V+C  ALD+P    VAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  99    DPRNCTVDWVGSNVCNYTNVYCAPALDNPKIQTVAGIDLNHCDIAGYLPEELGLLTDLAL  158

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP    NLK+LFE+D SNN   G FP+V+L LP LK+LDLR+N FEG +
Sbjct  159   FHVNSNRFCGTVPHKFENLKILFELDLSNNRFAGKFPEVVLRLPELKFLDLRFNEFEGTV  218

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LFDKDLD I +N+NR   +LP+NFGNS  SVIVLANN+F GC P+  G M  ++ +I
Sbjct  219   PKALFDKDLDAIFINHNRFVFDLPDNFGNSPVSVIVLANNRFHGCFPAGFGNM-TNLNEI  277

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +L+NN F  CLP+EI LL N+TVFDV  NK +G LP+ +G   SLE  + A N  SG +P
Sbjct  278   ILMNNGFQSCLPDEIGLLKNLTVFDVSFNKFLGPLPEAIGGAVSLEQLNVAHNYLSGKIP  337

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             + +C LPNLKN ++S N+F  E  SCL +    A DD  NC+  RP Q+  + C  +LS 
Sbjct  338   ESICKLPNLKNFTYSYNFFTGEPPSCLAVP---AFDDKQNCLPARPKQRSEKLCKSFLSH  394

Query  162   PVDCSKTGCRA  130
              +DC+   C+A
Sbjct  395   HIDCNSFRCKA  405



>ref|XP_008365636.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Malus domestica]
Length=505

 Score =   382 bits (982),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 194/368 (53%), Positives = 245/368 (67%), Gaps = 6/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +D +A  I  RQLL++  E  F   G    +D  L F NDR + AY+ALQA K AI SDP
Sbjct  96    SDEEALYIKHRQLLYYHDE--FGDRGEHVTIDPSLVFENDRLRNAYIALQALKQAILSDP  153

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               IT NWVG NVC Y  VF   ALD+ T   VAGID+NH DIAG+LP E+GLLTDLAL H
Sbjct  154   FNITGNWVGSNVCKYTXVFXTKALDNRTIRTVAGIDLNHGDIAGYLPEELGLLTDLALFH  213

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP   + LKLLFE+D SNN   G FP V+L+LP LK+LDLR+N FEG +P 
Sbjct  214   INSNRFCGTVPHKFNXLKLLFELDLSNNRFAGKFPRVVLQLPKLKFLDLRFNEFEGXVPK  273

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDKDLD I +N+NR   +LP+NF NS  SVIVLANNKF GC P+S+G M  ++ +I+L
Sbjct  274   ELFDKDLDAIFINHNRFRFBLPDNFXNSPVSVIVLANNKFHGCXPASLGNMS-NLNEIIL  332

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN F  CLP EI +L N+TVFDV  N+ +G LP+ +  M SLE  + A N+ SG +   
Sbjct  333   MNNGFXSCLPPEIXMLKNLTVFDVSFNQFLGSLPETIXGMVSLEQLNVAHNLLSGKIXXS  392

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +CSLP+L+N ++S N+F  E  +CL L      DD  NC+  RP Q+   +C  +LSKPV
Sbjct  393   ICSLPSLQNFTYSYNFFTGEPPACLGL---AGFDDKRNCLPNRPAQRTAAQCKSFLSKPV  449

Query  156   DCSKTGCR  133
             DC    C+
Sbjct  450   DCISFRCK  457



>ref|XP_006414930.1| hypothetical protein EUTSA_v100275740mg, partial [Eutrema salsugineum]
 gb|ESQ56383.1| hypothetical protein EUTSA_v100275740mg, partial [Eutrema salsugineum]
Length=400

 Score =   379 bits (972),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 191/367 (52%), Positives = 243/367 (66%), Gaps = 11/367 (3%)
 Frame = -3

Query  1233  DADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPK  1054
             D +  +I RRQLL FA        G +  +D  L F N R + AY+ALQAWK AI SDP 
Sbjct  31    DNEVRHIQRRQLLEFAER------GEKVTVDPSLSFENPRLRNAYIALQAWKQAILSDPF  84

Query  1053  GITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHM  874
               T NW+G NVC+Y GVFC  ALD+     VAGID+NH+DIAG+LP E+GLL+DLAL H+
Sbjct  85    NFTANWIGSNVCNYTGVFCSPALDNRRIRTVAGIDLNHADIAGYLPEELGLLSDLALFHV  144

Query  873   NSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPS  694
             NSNR CG VP   + LKLLFE+D SNN   G FP V+L LPSLK+LDLR+N FEG +P  
Sbjct  145   NSNRFCGTVPHRFNRLKLLFELDLSNNRFAGKFPAVVLRLPSLKFLDLRFNEFEGTVPKE  204

Query  693   LFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLL  514
             LF KDLD I +N+NR    LPENFG+S  SVIVLANN+F GC+PSS+  M +++ +I+ +
Sbjct  205   LFSKDLDAIFINHNRFRFELPENFGDSPVSVIVLANNRFHGCIPSSMVEM-KNLNEIIFM  263

Query  513   NNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGL  334
             NN  + CLP +I  L N+TVFDV  N+LVG LP+ +G M S+E    A N  SG +P  +
Sbjct  264   NNGLNSCLPADIGRLKNVTVFDVSFNELVGPLPESVGEMVSVEQLDVAHNKLSGKIPASI  323

Query  333   CSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK-PV  157
             C LP L+N +FS N+F  E   CL L +    DD  NC+  RP Q+ P +C  +LS+ PV
Sbjct  324   CQLPKLENFTFSYNFFTGEAPVCLRLPE---FDDRRNCLPGRPAQRSPGQCKAFLSQPPV  380

Query  156   DCSKTGC  136
             +C    C
Sbjct  381   NCGSFSC  387



>ref|XP_004290381.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4-like [Fragaria vesca subsp. vesca]
Length=542

 Score =   384 bits (985),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 242/370 (65%), Gaps = 4/370 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A T+A+A  IA+RQLL      D   + +E  +D KL FANDR K AYV L A KD IYS
Sbjct  30    ALTNAEAAYIAKRQLLTLPENGDLP-DNYEITVDPKLTFANDRLKSAYVGLHALKDVIYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC YNGV C  ALD+P   VVAG+D+NH+DIA H P E GLLTDLA+
Sbjct  89    DPTNFTANWEGPDVCKYNGVVCSPALDNPKVDVVAGLDLNHADIAAHFPVEFGLLTDLAM  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             IH+NSNR+CGIVPK    LKL+FE D SNN  VG FP V+LE P +KYLDLR+N FEG L
Sbjct  149   IHLNSNRLCGIVPKVFRRLKLMFEFDISNNRFVGQFPTVVLEWPEIKYLDLRFNEFEGEL  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PPSLF   LD I LNNN+  S +P+  GNST SV+  A N+FSGC+PS IG M  +VE++
Sbjct  209   PPSLFLSSLDAIFLNNNKFNSTIPDTIGNSTVSVVTFAFNQFSGCLPSGIGNM-CTVEEL  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             L +NN  SGC P EI  L N+TV DV  N LVG LP  L  ++++E      N   G VP
Sbjct  268   LFMNNNMSGCFPNEIGNLKNVTVLDVSNNGLVGPLPDSLSELKTIEVLDVGYNQLIGLVP  327

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             + +CSLP L+N + + NYF  ED+ C+P   + +  +D  NC   RP QK  + C   ++
Sbjct  328   EKICSLPKLENFTLAYNYFSGEDQKCVPNPYEQLTSNDEGNCFPGRPNQKNTETCNPVVT  387

Query  165   KPVDCSKTGC  136
             + +DC K  C
Sbjct  388   RVIDC-KYSC  396



>gb|EPS61338.1| hypothetical protein M569_13456, partial [Genlisea aurea]
Length=387

 Score =   378 bits (971),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 190/361 (53%), Positives = 235/361 (65%), Gaps = 5/361 (1%)
 Frame = -3

Query  1215  IARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNW  1036
             +  R+LL++  E    GE      +  L F NDR + AY+ALQAWK+AI SDP  +T +W
Sbjct  1     VKERRLLYYLDEFGDRGEDVSVD-EASLVFENDRLRSAYIALQAWKEAILSDPYNLTADW  59

Query  1035  VGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRIC  856
             VG +VC Y GVFC  A+DDP    VAGID+NH DIAG+LP E+GLL DL L H+NSNR C
Sbjct  60    VGSDVCGYTGVFCAQAIDDPEVRTVAGIDLNHGDIAGYLPEELGLLVDLGLFHINSNRFC  119

Query  855   GIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDL  676
             G +P    NLK LFE+D SNN   G FP V+L LP L YLD+RYN FEG +PP LFDK L
Sbjct  120   GKIPTKFRNLKTLFELDLSNNRFAGKFPRVVLSLPKLVYLDIRYNEFEGTVPPELFDKPL  179

Query  675   DVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSG  496
             D I +NNNR    LP+NFGNS  SVIV+ANN F GCVP+S+G M + + +IL LNN    
Sbjct  180   DAIFINNNRFAFELPDNFGNSPVSVIVVANNHFHGCVPASLGNMTR-LNEILFLNNGLRS  238

Query  495   CLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNL  316
             CLPEEI  L N+TVFDV  N+L+G LP+ L  +  LE  + A N  SG +P  +C LPNL
Sbjct  239   CLPEEIGRLVNLTVFDVSFNQLLGPLPENLEGLVKLEQLNVAHNFLSGKIPASICELPNL  298

Query  315   KNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
             KN +FS N+F  E  SCL L    A  D  NC+  RP Q+   +C  +LSK + CS   C
Sbjct  299   KNFTFSYNFFTGEPPSCLALP---ASSDRRNCLSGRPAQRSAAQCKGFLSKKIHCSAIKC  355

Query  135   R  133
             +
Sbjct  356   K  356



>emb|CDY49265.1| BnaA03g50780D [Brassica napus]
Length=598

 Score =   385 bits (989),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 183/371 (49%), Positives = 249/371 (67%), Gaps = 4/371 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL   A  +   +  E+++DLK  FAN R K+AY+ALQ WK A +S
Sbjct  44    ALTDTEAAFIVQRQLLTLPANGELPDD-IEYEVDLKATFANTRLKRAYIALQTWKKAFFS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC YNGV C  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+AL
Sbjct  103   DPFNTTGNWHGPHVCGYNGVVCAPALDDPDVTVVAGVDLNGADIAGHLPAELGLMTDVAL  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VGPFP+V+L  P +K++DLR+N+FEG +
Sbjct  163   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGPFPEVVLAWPDVKFIDLRFNDFEGQV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF K+LD I LNNNR  S +PE+ G S A+V+  ANNKF+GC+P SIG M +++ ++
Sbjct  223   PSELFKKELDAIFLNNNRFTSTIPESLGESPATVVSFANNKFTGCIPKSIGNM-KNLNEV  281

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N+  GC P EI  LSN+T+FD  +N  +G LP     +  +E    + N  +G V 
Sbjct  282   VFMDNKLGGCFPSEIGKLSNVTLFDASKNTFIGRLPTSFVGLTGVEEFDISENKLTGLVA  341

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +  SC+P   +  + +DD  NC+  RP Q+  Q+C   +
Sbjct  342   DNICKLPNLVNFTYSYNYFNGQGGSCVPGGGRKEIELDDVRNCLPHRPDQRSAQECAVVI  401

Query  168   SKPVDCSKTGC  136
             S+PVDCSK  C
Sbjct  402   SRPVDCSKDKC  412



>ref|XP_006300268.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
 gb|EOA33166.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
Length=457

 Score =   380 bits (977),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 190/361 (53%), Positives = 242/361 (67%), Gaps = 11/361 (3%)
 Frame = -3

Query  1215  IARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNW  1036
             I RRQLL FA        G    +D  L F N R + AY+ALQAWK AI SDP  IT NW
Sbjct  48    IQRRQLLEFA------DRGENVTVDPSLVFENPRLRSAYIALQAWKQAILSDPNNITLNW  101

Query  1035  VGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRIC  856
             +G NVCSY GVFC  ALD+     VAGID+NH DIAG+LP E+GLLTDLAL H+NSNR C
Sbjct  102   IGSNVCSYTGVFCSRALDNRRIRTVAGIDLNHGDIAGYLPLELGLLTDLALFHVNSNRFC  161

Query  855   GIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDL  676
             G VP+T + LKLLFE+D SNN   G FP V+L+LPSLK+LDLR+N FEG +P  LF KDL
Sbjct  162   GTVPRTFNQLKLLFELDLSNNRFAGKFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKDL  221

Query  675   DVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSG  496
             D I +N+NR    LPEN G+S  SVIV+ANN F GCVP+S+  M +++ +I+L+NN  + 
Sbjct  222   DAIFINHNRFRFELPENLGDSPVSVIVIANNHFHGCVPTSLVEM-KNLNEIILMNNHLNS  280

Query  495   CLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNL  316
             CLP +I  L N+TVFDV  N+LVG LP+ +G +  +E  + A N+ SG +P  +C LP L
Sbjct  281   CLPADIGRLKNVTVFDVSFNELVGPLPESVGGLVEVEQLNVAHNLLSGKIPASICQLPKL  340

Query  315   KNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK-PVDCSKTG  139
             +N ++S N+F  E   CL L +    DD  NC+  RP Q+  ++C  +LS+ PVDC    
Sbjct  341   ENFTYSYNFFTGEAPVCLRLSE---FDDRRNCLPGRPAQRSSRQCSAFLSRPPVDCESFS  397

Query  138   C  136
             C
Sbjct  398   C  398



>ref|XP_009383792.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Musa acuminata subsp. malaccensis]
Length=922

 Score =   394 bits (1013),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 193/369 (52%), Positives = 252/369 (68%), Gaps = 3/369 (1%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +DA A + ARRQLL    E     + FE  +++ +  AN R ++AY+AL+AW+ AIYSDP
Sbjct  125   SDAGAASTARRQLLALI-ENGILPDDFEFHIEIGVRIANPRLRRAYIALRAWRSAIYSDP  183

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
                T NW GP+VC+YNGVFC  A D+P+  VVAG+D+N +DIAGHLP E+GLLTD AL H
Sbjct  184   FNYTGNWQGPDVCAYNGVFCSPAPDEPSFNVVAGVDLNGADIAGHLPPELGLLTDAALFH  243

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG +PK+ S L +L E+D SNN  VGPFP V+L LPSL YLDLR+N+FEGALPP
Sbjct  244   INSNRFCGTIPKSFSRLVILRELDASNNRFVGPFPRVVLGLPSLTYLDLRFNDFEGALPP  303

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDK+LD I LN+NR  S +P+NFGNS ASV+VLANNK  GC+P+S+G M  ++ +++L
Sbjct  304   ELFDKELDAIFLNDNRFSSGIPDNFGNSKASVVVLANNKLGGCIPASVGNMGATLNELIL  363

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             LNN   GCLP E+ +L N TV D   N L GEL K    +  +E    + N+  G +P  
Sbjct  364   LNNGLVGCLPPEMGMLGNATVVDASWNSLTGELSKSFQGLSKVEQLDLSHNVLMGVLPGR  423

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             LC LP+L NL+ S N+F  E E C+P   K  + VDD  NC+ +RP QK  + C   +S+
Sbjct  424   LCQLPSLANLTVSYNFFTGEAEECVPSSTKLELVVDDRSNCLAKRPRQKSNRLCAPVVSR  483

Query  162   PVDCSKTGC  136
             PVDC +  C
Sbjct  484   PVDCGRFKC  492



>ref|XP_009336235.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=432

 Score =   379 bits (974),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 182/331 (55%), Positives = 229/331 (69%), Gaps = 1/331 (0%)
 Frame = -3

Query  1125  ANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDI  946
             +N R  +A++ALQAWK  IYSDP  IT NWVGP+VC+Y GV+C  ALDDP   VV+GID+
Sbjct  69    SNPRLYRAFLALQAWKHVIYSDPYNITTNWVGPSVCNYMGVYCSPALDDPKIQVVSGIDL  128

Query  945   NHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDV  766
             NH DIAG LP E GLL+DLALIH+NSNR CGI+P++++NL LLFE+D SNN  VGPFP V
Sbjct  129   NHRDIAGFLPEEFGLLSDLALIHLNSNRFCGILPQSMANLTLLFELDLSNNRFVGPFPTV  188

Query  765   ILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLAN  586
             +L LP+L YLDLRYN FEG LPP LF K LD I +NNNRL S +P   G S+ASV+V AN
Sbjct  189   VLSLPTLGYLDLRYNEFEGPLPPELFSKKLDAIFVNNNRLTSVIPATLGGSSASVVVFAN  248

Query  585   NKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGL  406
             N F GC+P SI     ++E++LL+N   SGCLP+E+  L  + V DV  NKLVG +P  L
Sbjct  249   NNFGGCLPPSIVNFANTLEELLLINTSLSGCLPQEVGFLYKLRVLDVSSNKLVGPIPYSL  308

Query  405   GYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDS  229
               +  LE  + A N  +G VP G+C LPNL N +FS NYF  E+ +C  L   G+A D+ 
Sbjct  309   AGLSHLEQLNLAHNKLTGIVPAGVCCLPNLANFTFSYNYFCEEEGTCQNLTSKGIAFDER  368

Query  228   DNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
              NC  E+P Q+  ++C   L  PVDC +  C
Sbjct  369   RNCFPEKPYQRTQKECNAILEHPVDCFEYPC  399



>ref|XP_004979883.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like [Setaria italica]
Length=1174

 Score =   399 bits (1026),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 202/377 (54%), Positives = 255/377 (68%), Gaps = 10/377 (3%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEG------FEHKLDLKLEFANDRQKKAYVALQAW  1081
             A T A+A  IA RQL+  A +    GE       FE    +   F N R ++AY+ALQAW
Sbjct  34    AVTSAEASYIAHRQLV--AMKEAGGGESGDLPPDFEFDDRVGANFPNPRLRRAYIALQAW  91

Query  1080  KDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGL  901
             + A YSDPKG T NWVG +VCSYNGV C  ALDDP   VVAGID+N +DIAG+LP E+GL
Sbjct  92    RRAFYSDPKGYTSNWVGNDVCSYNGVICTEALDDPKLTVVAGIDLNGADIAGYLPPELGL  151

Query  900   LTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYN  721
             LTDLA  H+N+NR CGI+PK++S L +L E D SNN  VGPFP V LE+ SLKYLD+R+N
Sbjct  152   LTDLAFFHINTNRFCGIIPKSMSRLSILHEFDASNNRFVGPFPFVCLEMASLKYLDIRFN  211

Query  720   NFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRME  541
              FEG LPP LFDKDLD I +N NR   ++PEN GNSTASV+V+ANN  +GC+P SIGRM 
Sbjct  212   EFEGELPPGLFDKDLDAIFVNTNRFVGHIPENLGNSTASVVVVANNGLTGCIPKSIGRMA  271

Query  540   QSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNM  361
             +++++I  LNN   GCLP E+ +L N TV DV  N LVG LP+ L  +  LE    + N+
Sbjct  272   RTLDEINFLNNRLDGCLPLEMGMLQNTTVIDVSGNVLVGTLPEQLSNVTKLEQFDCSRNV  331

Query  360   FSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPL-KDGVAVDDSDNCVLE-RPGQKLPQ  187
             F+G V + +C LP L+N SF+ N+F  E   C+P  K  V++DD DNC+   RP QK   
Sbjct  332   FTGIVHEAICELPALQNFSFASNFFNSEAAPCMPSEKARVSLDDRDNCLGALRPAQKTTL  391

Query  186   KCYEYLSKPVDCSKTGC  136
             +C   L++PVDCSK  C
Sbjct  392   QCAPVLARPVDCSKNVC  408



>ref|NP_189091.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
 sp|Q9LHF1.1|LRX4_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 4; Short=AtLRX4; 
Short=LRR/EXTENSIN4; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01951.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE76902.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
Length=494

 Score =   381 bits (979),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 192/376 (51%), Positives = 249/376 (66%), Gaps = 8/376 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +D +   I RRQLL++  E  F   G    +D  L F N R + AY+ALQAWK AI SDP
Sbjct  35    SDTEVRFIQRRQLLYYRDE--FGDRGENVTVDPSLIFENPRLRSAYIALQAWKQAILSDP  92

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               IT NW+G NVC+Y GVFC  ALD+     VAGID+NH+DIAG+LP E+GLLTDLAL H
Sbjct  93    NNITVNWIGSNVCNYTGVFCSKALDNRKIRTVAGIDLNHADIAGYLPEELGLLTDLALFH  152

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP     LKLLFE+D SNN   G FP V+L LPSLK+LDLR+N FEG +P 
Sbjct  153   VNSNRFCGTVPHKFKQLKLLFELDLSNNRFAGKFPTVVLHLPSLKFLDLRFNEFEGTVPK  212

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LF K+LD I +N+NR    LPENFG+S  SVIVLANN F GC+P+S+  M +++ +I+ 
Sbjct  213   ELFSKNLDAIFINHNRFRFELPENFGDSPVSVIVLANNHFHGCIPTSLVEM-KNLNEIIF  271

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN  + CLP +I  L N+TVFDV  N+LVG LP+ +G M  +E  + A N+ SG +P  
Sbjct  272   MNNGLNSCLPADIGRLKNVTVFDVSFNELVGPLPESVGGMVEVEQLNVAHNLLSGKIPAS  331

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKP-  160
             +C LP L+N ++S N+F  E   CL L +    DD  NC+  RP Q+  ++C  +LS+P 
Sbjct  332   ICQLPKLENFTYSYNFFTGEAPVCLRLSE---FDDRRNCLPGRPAQRSSRQCSAFLSRPS  388

Query  159   VDCSKTGC-RAATKET  115
             VDC   GC R+  K +
Sbjct  389   VDCGSFGCGRSVVKPS  404



>ref|XP_009107296.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Brassica rapa]
Length=727

 Score =   389 bits (998),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 240/344 (70%), Gaps = 2/344 (1%)
 Frame = -3

Query  1149  KLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQ  970
             K+D  L+F NDR K+AY+ALQAWK AIYSDP   TKNWVGP+VCSYNGV+C  ALDDP+ 
Sbjct  47    KVDPSLKFENDRLKRAYIALQAWKKAIYSDPFKTTKNWVGPDVCSYNGVYCAEALDDPSL  106

Query  969   WVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNW  790
              VVAG+D+N++DIAGHLP E+ L+TDLA+ H+NSNR CGI+PK++S L L++E D SNN 
Sbjct  107   KVVAGVDLNYADIAGHLPAELALITDLAMFHINSNRFCGIIPKSLSKLALMYEFDVSNNR  166

Query  789   LVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNST  610
              VGPFP+V L  PSLK+LDLRYN FEG LP  +FDK+LD I LNNNR ES +P+  G S 
Sbjct  167   FVGPFPEVSLSWPSLKFLDLRYNEFEGCLPSEIFDKNLDAIFLNNNRFESVIPDTIGKSA  226

Query  609   ASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKL  430
             ASV+  ANNKFSGC+P SIG+M +++ +++   N  +GC P EI  L+N+TVFD   N  
Sbjct  227   ASVVTFANNKFSGCIPRSIGQM-KNLNEVIFTGNNLTGCFPNEIGSLNNVTVFDASNNGF  285

Query  429   VGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLK-  253
             +G LP  L  +  +E    + N  +G V D  C LPNL+   FS NYF  E ESC+  K 
Sbjct  286   IGSLPLTLSSLSRVEQLDLSNNKLTGSVVDTFCKLPNLERFKFSYNYFNGEAESCVHGKN  345

Query  252   DGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRAATK  121
             +G   DD  NC+  RP QK   +C   +S+PVDCSK  C   ++
Sbjct  346   NGKQFDDRSNCLKNRPDQKSVNQCVPVVSRPVDCSKDKCSGGSQ  389



>ref|XP_010527189.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Tarenaya hassleriana]
Length=694

 Score =   387 bits (995),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/368 (53%), Positives = 245/368 (67%), Gaps = 8/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +D + + I  RQLL++  E  F   G    +D  L F N R + AYVALQAWK AI SDP
Sbjct  41    SDHEVKVIRHRQLLYYRDE--FGDRGENVTVDPSLVFENPRLRSAYVALQAWKQAILSDP  98

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
                T+ WVG NVC+Y GVFC  A D+P    VAGID+NH+DIAG+LP E+GLLTDLAL H
Sbjct  99    FNFTETWVGSNVCNYTGVFCAPAPDNPQIRTVAGIDLNHADIAGYLPEELGLLTDLALFH  158

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP   S LKLLFE+D SNN   G FP V+L+LPSLK+LDLR+N FEG +P 
Sbjct  159   INSNRFCGTVPHRFSQLKLLFELDLSNNRFAGKFPTVVLQLPSLKFLDLRFNEFEGTVPK  218

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LF KDLD I +N+NR +  LPENFGNS  SVIVLANN+F GC+P+S+  M +++ +I+ 
Sbjct  219   ELFSKDLDAIFINHNRFQFELPENFGNSPVSVIVLANNRFHGCIPASLSNM-KNLNEIIF  277

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN F  CLP +I  L N+TVFDV  N++VG LP+ +G M +LE  + A N  SG +P  
Sbjct  278   MNNGFKSCLPTDIGRLRNVTVFDVSFNEIVGPLPEAVGRMVALEQLNVAHNKLSGKIPAS  337

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK-P  160
             +C LP L+N +FS NYF  E   CLP   G       NC+  RP Q+ P +C  +LS+ P
Sbjct  338   ICQLPKLENFTFSYNYFTGEPPVCLPKSXGF----ERNCLPARPAQRSPGQCAAFLSRPP  393

Query  159   VDCSKTGC  136
             VDC    C
Sbjct  394   VDCGSFKC  401



>ref|XP_010925096.1| PREDICTED: leucine-rich repeat extensin-like protein 4, partial 
[Elaeis guineensis]
Length=441

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 191/369 (52%), Positives = 253/369 (69%), Gaps = 5/369 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               TDA+A  I RRQLL +  ++   G G    +D    F N R + AY+ALQAWK AI+S
Sbjct  33    GLTDAEAGYIRRRQLLTYRDQL--GGRGENVTVDPTFVFPNPRLRNAYIALQAWKLAIFS  90

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP  +T NWVGP+VC+Y  V+C     DP   VVAGID+NH DIAG+LP E+GLL+DLAL
Sbjct  91    DPLNLTANWVGPDVCNYTSVYCAPLPSDPHLTVVAGIDLNHGDIAGYLPDELGLLSDLAL  150

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
             +H+NSNR CGIVP+T  +L+LLFE+D SNN L G FP+++L+LPSL+YLDLRYN FEG +
Sbjct  151   LHINSNRFCGIVPRTFGHLRLLFELDLSNNRLAGKFPEIVLQLPSLRYLDLRYNEFEGGV  210

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LFDKDLD I +NNNR   ++PEN GNS  SV+V ANN+F GC+P SIG M +++ +I
Sbjct  211   PKALFDKDLDAIFINNNRFVFDIPENLGNSPVSVVVFANNRFRGCLPRSIGNMSKTLNEI  270

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + LNN  + CLP EI LL ++TVFDV  N+LVG LP  +  M SLE    A N+ SG +P
Sbjct  271   IFLNNGLTACLPPEIGLLKSLTVFDVSFNQLVGPLPTSIAGMLSLEQLDVAHNLLSGQIP  330

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +C LP L+N ++S N+F  E   CL +    + D+  NC+  RP Q+   +C  +LS+
Sbjct  331   AQICLLPRLQNFTYSYNFFTGEPPQCLRVP---SFDELQNCLPGRPAQRSDSQCKSFLSQ  387

Query  162   PVDCSKTGC  136
             P+DC+   C
Sbjct  388   PIDCAAFRC  396



>ref|XP_004148723.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like, 
partial [Cucumis sativus]
Length=740

 Score =   389 bits (999),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/369 (53%), Positives = 251/369 (68%), Gaps = 6/369 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             + +DA+A  I  RQLL++  E  F   G    +D  L F NDR + AY+ALQAWK AI S
Sbjct  15    SLSDAEALFIRHRQLLYYRDE--FGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILS  72

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVG NVC+Y GVFC  +LD+P    VAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  73    DPLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  132

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG +P     LKLL+E+D SNN   G FPDV+L+LP+LK+LDLR+N FEG +
Sbjct  133   FHINSNRFCGTLPHRFDRLKLLYELDLSNNRFAGKFPDVVLKLPTLKFLDLRFNEFEGNV  192

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR    LP+NFGNS  SVIVLANNKF GC+PSS+G M + + +I
Sbjct  193   PRELFDKDLDAIFINHNRFRFELPDNFGNSPVSVIVLANNKFHGCLPSSLGNMTR-LNEI  251

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +++NN  + CLP EI  L N+TVFDV  N+LVG LP+  G + SLE  + A N  SG +P
Sbjct  252   IMMNNGLNSCLPPEIGALKNLTVFDVSSNELVGPLPETFGGLVSLEQLNVANNFLSGKIP  311

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             + +C LP L+N +FS N+F  E  +CL + D     D  NC+  R GQ+   +C  +LS+
Sbjct  312   ENICELPKLQNFTFSNNFFSGEPPACLRVPD---FSDRRNCLAGRSGQRSTGQCNAFLSR  368

Query  162   PVDCSKTGC  136
             PVDC+   C
Sbjct  369   PVDCNAFKC  377



>ref|XP_006286011.1| hypothetical protein CARUB_v10007539mg [Capsella rubella]
 gb|EOA18909.1| hypothetical protein CARUB_v10007539mg [Capsella rubella]
Length=395

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 231/333 (69%), Gaps = 1/333 (0%)
 Frame = -3

Query  1125  ANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDI  946
             +N + ++AY ALQAWK  IYSDPK +T +WVGP+VCSY G+FC  +  DP   VVAGID+
Sbjct  42    SNQQLQQAYHALQAWKKVIYSDPKNLTTDWVGPSVCSYTGIFCAPSPSDPNTLVVAGIDL  101

Query  945   NHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDV  766
             NH DIAG LP  IGLL+DLALIH+NSNR CGI+P +++NL LL+E+D SNN  VGPFPDV
Sbjct  102   NHGDIAGFLPEAIGLLSDLALIHLNSNRFCGILPSSLANLSLLYELDLSNNRFVGPFPDV  161

Query  765   ILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLAN  586
             +L LPSLKYLDLRYN FEG LPP LF   LD I +NNNRL S +P +F  +TASV+V AN
Sbjct  162   VLSLPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFAGTTASVVVFAN  221

Query  585   NKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGL  406
             N FSGC+P +I R   ++E++LL+N+  SGCLP E+  L  + V DV  N LVG +P  L
Sbjct  222   NDFSGCLPPTISRFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDVSYNSLVGPVPYSL  281

Query  405   GYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDS  229
               +  LE  +   NMF+G VP G+C LP+L NL+FS NYF  E+  C  L   G+AVDD 
Sbjct  282   AGLGHLEQLNLEHNMFTGTVPLGVCVLPSLLNLTFSYNYFSEEEGICRNLTSRGIAVDDR  341

Query  228   DNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
              NC+ ++P Q   + C   L  P+DC    C A
Sbjct  342   YNCLPDKPLQWSQKVCDAILEHPIDCYDHECSA  374



>ref|XP_004964077.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like [Setaria italica]
Length=802

 Score =   390 bits (1001),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/369 (52%), Positives = 252/369 (68%), Gaps = 2/369 (1%)
 Frame = -3

Query  1215  IARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNW  1036
             IARRQLL          + FE ++ + + FANDR ++AY ALQAW+ AIYSDP+  T  W
Sbjct  37    IARRQLLALREGDGDLPDDFEFEIRVDVTFANDRLRRAYAALQAWRRAIYSDPRNFTGGW  96

Query  1035  VGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRIC  856
             VG +VCSY GV C  ALDD    VVAG+D+N  DIAG+LP E+GLLTDLA  H+NSNR C
Sbjct  97    VGADVCSYFGVTCAPALDDNATTVVAGVDLNGGDIAGYLPAELGLLTDLAFFHINSNRFC  156

Query  855   GIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDL  676
             G++PK+ S L LL E+D SNN  VG FP V+LE+P LKYLDLRYN+F+G LPP LF+KDL
Sbjct  157   GVIPKSFSRLALLHELDVSNNRFVGGFPHVVLEIPVLKYLDLRYNDFDGELPPQLFEKDL  216

Query  675   DVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSG  496
             D I +N+NR    +PENFGNSTASV+VLA+N F GC+P S+GRM  ++++++LL+N   G
Sbjct  217   DAIFVNSNRFVGVIPENFGNSTASVVVLADNAFVGCIPRSVGRMVGTLDELVLLDNRLDG  276

Query  495   CLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNL  316
             C+P E+  L N TV DV  N+LVG LP+G+  M  L+  + + N  +G V + +C LP L
Sbjct  277   CIPPELAELVNTTVVDVSGNELVGTLPEGMVNMTGLQQLAVSRNRLAGGVLERVCELPAL  336

Query  315   KNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCV-LERPGQKLPQKCYEYLSKPVDCSKT  142
              N SF+ N+F +E  +C+P  +  VA+DD+ NC+   RP QK   +C   L+ PVDC K 
Sbjct  337   SNFSFAHNFFSVEPAACVPAANKLVALDDAGNCLGGGRPEQKPAPECAPVLAHPVDCRKN  396

Query  141   GCRAATKET  115
              C A    T
Sbjct  397   ACSAGPSYT  405



>ref|XP_008342893.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Malus 
domestica]
 ref|XP_008362444.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Malus 
domestica]
Length=432

 Score =   378 bits (970),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/331 (55%), Positives = 230/331 (69%), Gaps = 1/331 (0%)
 Frame = -3

Query  1125  ANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDI  946
             +N R  +A++ALQAWK  IYSDP  IT NWVGP+VC+Y GV+C  ALDDP   VV+GID+
Sbjct  69    SNPRLYQAFLALQAWKHVIYSDPYNITTNWVGPSVCNYMGVYCSPALDDPKIQVVSGIDL  128

Query  945   NHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDV  766
             NH DIAG LP E GLL+DLALIH+NSNR CGI+P++++NL LLFE+D SNN  VGPFP V
Sbjct  129   NHRDIAGFLPEEFGLLSDLALIHLNSNRFCGILPQSMANLTLLFELDLSNNRFVGPFPTV  188

Query  765   ILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLAN  586
             +L LP+L YLDLRYN FEG LPP LF K LD I +NNNRL S +P + G S+ASV+V AN
Sbjct  189   VLSLPTLGYLDLRYNEFEGPLPPELFRKKLDAIFVNNNRLTSVIPASLGGSSASVVVFAN  248

Query  585   NKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGL  406
             N F GC+P SI     ++E++LL+N   SGCLP+E+  L  + V DV  NKLVG +P  +
Sbjct  249   NNFGGCLPPSIVNFAGTLEELLLINTSLSGCLPQEVGFLYKLRVLDVSYNKLVGPIPYSM  308

Query  405   GYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDS  229
               +  LE  + A NM +G VP G+C LPNL N +FS NYF  E+  C  L   G+A D+ 
Sbjct  309   TGLSHLEQLNLAHNMLTGIVPAGVCXLPNLANFTFSYNYFCEEEGXCQNLTSKGIAFDER  368

Query  228   DNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
              NC  E+P Q+  ++C   L  PVDC +  C
Sbjct  369   RNCFPEKPYQRTQKECNAILEHPVDCFEYPC  399



>gb|KGN65364.1| hypothetical protein Csa_1G383520 [Cucumis sativus]
Length=775

 Score =   389 bits (998),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/369 (53%), Positives = 251/369 (68%), Gaps = 6/369 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             + +DA+A  I  RQLL++  E  F   G    +D  L F NDR + AY+ALQAWK AI S
Sbjct  25    SLSDAEALFIRHRQLLYYRDE--FGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILS  82

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVG NVC+Y GVFC  +LD+P    VAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  83    DPLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  142

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG +P     LKLL+E+D SNN   G FPDV+L+LP+LK+LDLR+N FEG +
Sbjct  143   FHINSNRFCGTLPHRFDRLKLLYELDLSNNRFAGKFPDVVLKLPTLKFLDLRFNEFEGNV  202

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR    LP+NFGNS  SVIVLANNKF GC+PSS+G M + + +I
Sbjct  203   PRELFDKDLDAIFINHNRFRFELPDNFGNSPVSVIVLANNKFHGCLPSSLGNMTR-LNEI  261

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +++NN  + CLP EI  L N+TVFDV  N+LVG LP+  G + SLE  + A N  SG +P
Sbjct  262   IMMNNGLNSCLPPEIGALKNLTVFDVSSNELVGPLPETFGGLVSLEQLNVANNFLSGKIP  321

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             + +C LP L+N +FS N+F  E  +CL + D     D  NC+  R GQ+   +C  +LS+
Sbjct  322   ENICELPKLQNFTFSNNFFSGEPPACLRVPD---FSDRRNCLAGRSGQRSTGQCNAFLSR  378

Query  162   PVDCSKTGC  136
             PVDC+   C
Sbjct  379   PVDCNAFKC  387



>ref|XP_002451219.1| hypothetical protein SORBIDRAFT_05g025950 [Sorghum bicolor]
 gb|EES10207.1| hypothetical protein SORBIDRAFT_05g025950 [Sorghum bicolor]
Length=744

 Score =   388 bits (996),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 208/380 (55%), Positives = 257/380 (68%), Gaps = 13/380 (3%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLE---------FANDRQKKAYVAL  1090
             A T A+A  IA RQLL  A +    GEG +   D + +         FAN R ++AY+AL
Sbjct  106   AVTSAEASYIAHRQLL--AMKEAGGGEGGDLPSDFEFDDRLGAAAGSFANPRLRRAYIAL  163

Query  1089  QAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTE  910
             QAWK A YSDPKG T NWVG +VC YNGV C  ALDDP   VVAGID+N +DIAG+LP E
Sbjct  164   QAWKRAFYSDPKGFTTNWVGSDVCKYNGVICVEALDDPKIMVVAGIDLNGADIAGYLPPE  223

Query  909   IGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDL  730
             +GLLTDLA  H+N+NR CGI+PK++S L LL E D SNN  VG FP V LE+ SLKYLDL
Sbjct  224   LGLLTDLAFFHINTNRFCGIIPKSMSRLSLLHEFDVSNNRFVGVFPYVCLEMVSLKYLDL  283

Query  729   RYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIG  550
             R+N+FEG LPP+LFDKDLD I +N NR   ++PEN GNSTASVIV ANN F GC+P SIG
Sbjct  284   RFNDFEGDLPPALFDKDLDAIFVNTNRFVGHIPENLGNSTASVIVFANNAFVGCIPKSIG  343

Query  549   RMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFA  370
             RM +++++I+ LNN+  GCLP E+ LL N TV DV  N LVG +P+ L  +  LE    +
Sbjct  344   RMVKTLDEIIFLNNKLDGCLPLEMGLLVNTTVIDVSGNMLVGTIPEQLSNVAKLEQLDVS  403

Query  369   GNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPL-KDGVAVDDSDNCVLE-RPGQK  196
              N+F+G V D +C LP L N SF+ N+F  E   C+P  K  V +DD DNC+   RP QK
Sbjct  404   RNVFTGIVHDKICELPALVNFSFAFNFFNSEAAVCMPSDKALVNLDDRDNCLGALRPAQK  463

Query  195   LPQKCYEYLSKPVDCSKTGC  136
                +C   L++PVDCSK  C
Sbjct  464   TALQCAPVLARPVDCSKHVC  483



>ref|XP_008347715.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Malus 
domestica]
Length=403

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/349 (53%), Positives = 237/349 (68%), Gaps = 5/349 (1%)
 Frame = -3

Query  1209  RRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVG  1030
             +RQLL +  +    GE     +   L F N R + AY+ALQAWK A+ SDP+    NWVG
Sbjct  48    QRQLLXYIDQDGSRGETV--TVPDALVFENSRLRSAYIALQAWKQAMVSDPRDQISNWVG  105

Query  1029  PNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGI  850
              +VC Y GVFC  A DDP+   VAGID+NH+DIAG LP E+GLL+D+AL H+NSNR CG 
Sbjct  106   SDVCKYTGVFCAQAPDDPSVQTVAGIDLNHADIAGFLPEELGLLSDIALFHINSNRFCGK  165

Query  849   VPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDV  670
             VPK+ + L+LLFE+D SNN   G FPDV+L+LP+LK+LDLR+N FEG +P  LFDKDLD 
Sbjct  166   VPKSFNKLQLLFELDLSNNRFAGXFPDVVLQLPALKFLDLRFNEFEGEVPKELFDKDLDA  225

Query  669   ILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCL  490
             I +N+NR    LP NFGNS  SVIVLANN F GCVP+S+G M +++ +++L NN F  CL
Sbjct  226   IFINHNRFSFELPNNFGNSPVSVIVLANNNFHGCVPASLGNMSKNLNELVLTNNGFHSCL  285

Query  489   PEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKN  310
             P EI +L  +TVFDV  N+ VGELPK +  M+SLE  + A NM  G +P+G+C L NL  
Sbjct  286   PREIGMLKKVTVFDVSHNRFVGELPKEIVEMESLEQLNVAHNMLRGTIPEGVCELQNLAK  345

Query  309   LSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
              S   N+F +E   CL LK+    DDS NC+ +RP Q+   +C   LSK
Sbjct  346   FSIEHNFFTVEPPMCLKLKE---FDDSKNCLRKRPKQRTLLQCKLALSK  391



>ref|XP_009345516.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Pyrus x bretschneideri]
Length=710

 Score =   387 bits (993),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 191/376 (51%), Positives = 250/376 (66%), Gaps = 3/376 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A T+A+A +IA RQL       D   + +E ++D KL+F NDR K+AYVALQA K AI+S
Sbjct  31    ALTNAEAAHIAHRQLTSLPENGDLP-DNYEVQVDAKLKFENDRLKRAYVALQAQKKAIFS  89

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVG NVC+Y GVFC  ALD+P+  VVAGID+NH+DIAGHL  E+GLLTDLAL
Sbjct  90    DPFNFTANWVGENVCAYKGVFCAPALDNPSLNVVAGIDLNHADIAGHLVVEMGLLTDLAL  149

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGIVP++   L L++E D SNN  VG FP V+L  P+ KYLDLR+N FEG L
Sbjct  150   FHINSNRFCGIVPESCRRLTLMYEFDISNNQFVGRFPGVVLRWPNCKYLDLRFNGFEGEL  209

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K+ D I LN+NR  S +PE  GNS  SV+  A N FSGC+P S+G M ++V ++
Sbjct  210   PPELFTKEFDAIFLNHNRFTSVIPETIGNSKVSVVSFAFNNFSGCIPHSVGNM-RNVNEL  268

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + +NN+  GC P EI  L  + VF+V  N  +G LPK    +QS+E      N  +G V 
Sbjct  269   IFMNNQLGGCFPHEIGNLGKLQVFEVSYNGFIGSLPKSFVGLQSIEELDIGYNRLTGFVT  328

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C+LP + N +F+ NYF  E + C+P  K  + +DDS NC+  RP QK  + C+  ++
Sbjct  329   DKICTLPKMANFTFAYNYFSGEAQKCMPNPKSEIVLDDSGNCMPGRPKQKNTKTCFPVVT  388

Query  165   KPVDCSKTGCRAATKE  118
             KPVDCSK    ++T E
Sbjct  389   KPVDCSKNCGGSSTPE  404



>ref|XP_004170319.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
Length=785

 Score =   389 bits (998),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 196/369 (53%), Positives = 251/369 (68%), Gaps = 6/369 (2%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             + +DA+A  I  RQLL++  E  F   G    +D  L F NDR + AY+ALQAWK AI S
Sbjct  25    SLSDAEALFIRHRQLLYYRDE--FGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILS  82

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVG NVC+Y GVFC  +LD+P    VAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  83    DPLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLAL  142

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG +P     LKLL+E+D SNN   G FPDV+L+LP+LK+LDLR+N FEG +
Sbjct  143   FHINSNRFCGTLPHRFDRLKLLYELDLSNNRFAGKFPDVVLKLPTLKFLDLRFNEFEGNV  202

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LFDKDLD I +N+NR    LP+NFGNS  SVIVLANNKF GC+PSS+G M + + +I
Sbjct  203   PRELFDKDLDAIFINHNRFRFELPDNFGNSPVSVIVLANNKFHGCLPSSLGNMTR-LNEI  261

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             +++NN  + CLP EI  L N+TVFDV  N+LVG LP+  G + SLE  + A N  SG +P
Sbjct  262   IMMNNGLNSCLPPEIGALKNLTVFDVSSNELVGPLPETFGGLVSLEQLNVANNFLSGKIP  321

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
             + +C LP L+N +FS N+F  E  +CL + D     D  NC+  R GQ+   +C  +LS+
Sbjct  322   ENICELPKLQNFTFSNNFFSGEPPACLRVPD---FSDRRNCLAGRSGQRSTGQCNAFLSR  378

Query  162   PVDCSKTGC  136
             PVDC+   C
Sbjct  379   PVDCNAFKC  387



>ref|XP_009350755.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Pyrus x bretschneideri]
 ref|XP_009350758.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Pyrus x bretschneideri]
Length=702

 Score =   386 bits (992),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 191/376 (51%), Positives = 250/376 (66%), Gaps = 3/376 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A T+A+A +IA RQL       D   + +E ++D KL+F NDR K+AYVALQA K AI+S
Sbjct  31    ALTNAEAAHIAHRQLTSLPENGDLP-DNYEVQVDAKLKFENDRLKRAYVALQAQKKAIFS  89

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NWVG NVC+Y GVFC  ALD+P+  VVAGID+NH+DIAGHL  E+GLLTDLAL
Sbjct  90    DPFNFTANWVGENVCAYKGVFCAPALDNPSLNVVAGIDLNHADIAGHLVVEMGLLTDLAL  149

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGIVP++   L L++E D SNN  VG FP V+L  P+ KYLDLR+N FEG L
Sbjct  150   FHINSNRFCGIVPESCRRLTLMYEFDISNNQFVGRFPGVVLRWPNCKYLDLRFNGFEGEL  209

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K+ D I LN+NR  S +PE  GNS  SV+  A N FSGC+P S+G M ++V ++
Sbjct  210   PPELFTKEFDAIFLNHNRFTSVIPETIGNSKVSVVSFAFNNFSGCIPHSVGNM-RNVNEL  268

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + +NN+  GC P EI  L  + VF+V  N  +G LPK    +QS+E      N  +G V 
Sbjct  269   IFMNNQLGGCFPHEIGNLGKLQVFEVSYNGFIGSLPKSFVGLQSIEELDIGYNRLTGFVT  328

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C+LP + N +F+ NYF  E + C+P  K  + +DDS NC+  RP QK  + C+  ++
Sbjct  329   DKICTLPKMANFTFAYNYFSGEAQKCMPNPKSEIVLDDSGNCMPGRPKQKNTKTCFPVVT  388

Query  165   KPVDCSKTGCRAATKE  118
             KPVDCSK    ++T E
Sbjct  389   KPVDCSKNCGGSSTPE  404



>ref|XP_004252054.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Solanum 
lycopersicum]
Length=727

 Score =   387 bits (994),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/368 (52%), Positives = 247/368 (67%), Gaps = 6/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             TD++A+ I  RQLL++  E  F   G   K+D  + F NDR K AY+ALQAWK AI SDP
Sbjct  42    TDSEAQFIKHRQLLYYRDE--FGDRGENVKIDPSMVFENDRIKNAYIALQAWKQAIISDP  99

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               IT NWVGPNVCSY GVFC  ALD+P    VAGID+NH DIAG+LP E+GLLTDL + H
Sbjct  100   FNITMNWVGPNVCSYTGVFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLGIFH  159

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG +P+ ++ LK+LFE+D SNN   G FP V+L LP L +LD+R+N FEG +P 
Sbjct  160   INSNRFCGTIPRKLNKLKILFELDLSNNRFAGKFPYVVLSLPKLIFLDIRFNEFEGNVPS  219

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDK LD I +N+NR    LPENFGNS  SVIVLA+N F GC+P+SIG M  ++ + +L
Sbjct  220   QLFDKPLDAIFINHNRFAFELPENFGNSPVSVIVLASNSFHGCLPASIGNM-SNLNEAIL  278

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN    CLP EI LL N+TVFDV  N+L+G LP+  G + +LE  + A NM SG +P  
Sbjct  279   MNNGLRSCLPAEIGLLKNLTVFDVSFNELMGPLPENFGGLVNLEQLNVAHNMLSGTIPKS  338

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +C LP L+N ++S N+F  E   CL L +     D  NC+  RP Q+ P +C  +LSK +
Sbjct  339   ICQLPKLENFTYSYNFFTGEPPVCLALPE---FHDQRNCLPNRPVQRSPGQCKAFLSKKI  395

Query  156   DCSKTGCR  133
              CS   C 
Sbjct  396   HCSAFKCH  403



>ref|XP_008458675.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Cucumis melo]
Length=677

 Score =   385 bits (989),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 251/374 (67%), Gaps = 3/374 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             + ++A+A  + RRQLL    E D   + F+++LD+   F N+R K AYVALQAWK AIYS
Sbjct  43    SISEAEASYLTRRQLLALK-EHDELPDDFKYQLDIADTFPNERLKMAYVALQAWKLAIYS  101

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP+ +T NWVG +VCSY GVFC  ALD+P   VVAGID+NH DIAG+LP E+GLLTDLAL
Sbjct  102   DPQNMTANWVGADVCSYTGVFCAPALDNPNIEVVAGIDLNHGDIAGYLPPELGLLTDLAL  161

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P + S L L+FE D SNN  VG FP V+LE P  +YLDLRYN+FEG +
Sbjct  162   FHINSNRFCGIIPSSFSKLVLMFEFDVSNNRFVGHFPLVVLEWPGARYLDLRYNDFEGEI  221

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P +LF K+ D I LNNNR  S +PE  GNST SV+  ANN+F GC+P +IG+M  ++ QI
Sbjct  222   PSTLFTKEFDAIFLNNNRFNSLIPETIGNSTVSVVSFANNEFHGCIPGTIGQM-SNLNQI  280

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             L L N+ SGC P EI  L N+TVFDV  N  +G+LP+ L  +Q+LE    + N   G V 
Sbjct  281   LFLGNKLSGCFPPEIGNLINLTVFDVSSNGFIGQLPESLSGLQNLEILDVSNNELRGSVS  340

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV-DDSDNCVLERPGQKLPQKCYEYLS  166
              GLC LP L N +FS NYF+ +D +C+  K    V +D  NC+  RP QK   KC   L 
Sbjct  341   GGLCKLPKLANFTFSFNYFDGQDTTCVASKGSEKVFNDGQNCLANRPVQKDANKCSTVLK  400

Query  165   KPVDCSKTGCRAAT  124
             K ++C   G  +++
Sbjct  401   KSMECGNCGGGSSS  414



>ref|XP_010532845.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Tarenaya 
hassleriana]
Length=648

 Score =   384 bits (986),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 248/368 (67%), Gaps = 7/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +D + + I +RQLL++  E  F   G    +D  L F N R + AY+ALQAWK AI SDP
Sbjct  47    SDHEVKFIRQRQLLYYRDE--FGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILSDP  104

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
                T +WVG NVC+Y GVFC  A D+     VAGID+NH+DIAG+LP E+GLLTDLAL H
Sbjct  105   FNFTASWVGSNVCNYTGVFCSPAPDNHRIRTVAGIDLNHADIAGYLPEELGLLTDLALFH  164

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP     LKLLFE+D SNN   G FP V+L LPSLK+LDLR+N FEG++P 
Sbjct  165   INSNRFCGTVPHRFRQLKLLFELDLSNNRFAGKFPTVVLHLPSLKFLDLRFNEFEGSVPK  224

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LF+KDLD I +N+NR +  LPENFGNS  SVIVL+NN+F GC+P+S+G M +++ +I+ 
Sbjct  225   ELFNKDLDAIFINHNRFQFELPENFGNSPVSVIVLSNNRFHGCIPASLGNM-KNLNEIIF  283

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN F  CLP EI  L N+TVFDV  N++VG LP+ +G M SLE  + A N  SG +P  
Sbjct  284   MNNGFKSCLPTEIGRLRNVTVFDVSFNEIVGPLPEAVGRMVSLEQLNVAHNRLSGKIPTR  343

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK-P  160
             +C LP L+N +FS N+F  +   CL L    + DD  NC+  RP Q+ P +C  +LS+ P
Sbjct  344   ICQLPKLENFTFSYNFFPGDPPVCLRLP---SFDDRRNCLPARPAQRSPGQCAAFLSRPP  400

Query  159   VDCSKTGC  136
             VDC    C
Sbjct  401   VDCGSFKC  408



>ref|XP_007152809.1| hypothetical protein PHAVU_004G161500g [Phaseolus vulgaris]
 gb|ESW24803.1| hypothetical protein PHAVU_004G161500g [Phaseolus vulgaris]
Length=725

 Score =   386 bits (992),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 199/369 (54%), Positives = 254/369 (69%), Gaps = 6/369 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             TDA+A  I +RQLL++  E  F   G +  +D    F N+R + AY+ALQAWK AI SDP
Sbjct  40    TDAEASYIKQRQLLYYKDE--FGDRGEKVTVDPSFRFENNRLRNAYIALQAWKHAILSDP  97

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
             K +T +WVGPNVC+Y  VFC  ALD+P    VAGID+NH DIAG+LP E+GLLTDLAL+H
Sbjct  98    KNLTLDWVGPNVCNYTSVFCAPALDNPKINTVAGIDLNHGDIAGYLPEELGLLTDLALLH  157

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +N+NR CG VP     LKLLFE+D SNN   G FPDV+L LP LK+LDLR+N FEG +P 
Sbjct  158   INTNRFCGTVPHKFDKLKLLFELDLSNNRFAGKFPDVVLRLPQLKFLDLRFNEFEGTVPK  217

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDK+LD I +N+NR   +LPENFGNS  SVIVLANN+F GCVP+ IG M + + +I+L
Sbjct  218   ELFDKELDAIFINDNRFVFDLPENFGNSPVSVIVLANNRFHGCVPAGIGNM-KGLNEIIL  276

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN F  C PEEI LL+N+TVFDV  N+L+G LP+ +G    LE  + A N+ SG +P+ 
Sbjct  277   MNNAFRSCFPEEIGLLTNLTVFDVSFNQLLGPLPEAIGGAVGLEQLNVAHNLLSGKIPES  336

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +C LPNL+N +FS N+F  E   C  L    A DD  NC+  RP Q+   +C  +LS PV
Sbjct  337   ICKLPNLQNFTFSYNFFTGEPPRCRALP---AADDRRNCLPARPYQRSAGQCKSFLSHPV  393

Query  156   DCSKTGCRA  130
             DC    C++
Sbjct  394   DCKSFRCKS  402



>ref|XP_006353562.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like, 
partial [Solanum tuberosum]
Length=670

 Score =   384 bits (987),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 246/368 (67%), Gaps = 6/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             TD++A+ I  RQLL++  E  F   G   K+D  + F NDR K AY+ALQAWK AI SDP
Sbjct  7     TDSEAQFIKHRQLLYYRDE--FGDRGENVKIDPSMVFENDRIKNAYIALQAWKQAIISDP  64

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               IT NWVGPNVCSY G+FC  ALD+P    VAGID+NH DIAG+LP E+GLLTDL + H
Sbjct  65    FNITLNWVGPNVCSYTGIFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLGIFH  124

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG +P+  S LK+LFE+D SNN   G FP V+L LP L +LD+R+N FEG +P 
Sbjct  125   INSNRFCGTIPRKFSKLKILFELDLSNNRFAGKFPYVVLSLPKLIFLDIRFNEFEGNVPS  184

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDK LD I +N+NR    LPENFGNS  SVIVLA+N F GC+P+SIG M  ++ + +L
Sbjct  185   QLFDKPLDAIFINHNRFAFELPENFGNSPVSVIVLASNSFHGCLPASIGNM-SNLNEAIL  243

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN    CLP EI +L N+TVFDV  N+L+G LP+  G + +LE  + A NM SG +P  
Sbjct  244   MNNGLRSCLPAEIGVLKNLTVFDVSFNQLMGPLPENFGDLVNLEQLNVAHNMLSGTIPKS  303

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +C LP L+N ++S N+F  E   CL L +     D  NC+  RP Q+ P +C  +LSK +
Sbjct  304   ICQLPKLENFTYSYNFFTGEPPVCLGLPE---FHDERNCLPNRPVQRSPGQCKAFLSKKI  360

Query  156   DCSKTGCR  133
              CS   C 
Sbjct  361   HCSAFRCH  368



>ref|XP_009627507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X2 [Nicotiana tomentosiformis]
Length=555

 Score =   380 bits (977),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 185/368 (50%), Positives = 243/368 (66%), Gaps = 6/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             TD +A+ I  RQLL++  E  F   G    +D    F N R K AY+ALQAWK AI SDP
Sbjct  44    TDFEAQYIKHRQLLYYRDE--FGDRGENVSIDPSFVFENSRIKNAYIALQAWKQAIISDP  101

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               +T NWVGPNVC+Y G+FC  ALD+P    VAGID+NH DIAG+LP E+GLL DL + H
Sbjct  102   FNLTANWVGPNVCNYTGIFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLVDLGIFH  161

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG +PK   NLK+LFE+D SNN   G FP V+L L  L +LD+R+N FEG +P 
Sbjct  162   INSNRFCGTIPKKFKNLKILFELDLSNNRFAGKFPYVVLSLHKLIFLDIRFNEFEGNVPS  221

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFD+  D I +N+NR    LP+NFGNS  SVIVLANN+F GC+P+SIG M  ++E++++
Sbjct  222   QLFDRPFDAIFINHNRFSFELPDNFGNSPVSVIVLANNRFHGCLPASIGNM-SNLEEVIM  280

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN    CLP EI +L N+TVFDV  N+L+G LP+  G + +LE  + A NM +G +P  
Sbjct  281   MNNGLRSCLPTEIGMLKNLTVFDVSFNQLMGPLPEKFGELVNLEQLNVAHNMLTGSIPKS  340

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +C LP L+N ++S N+F  E   CL L +    DD  NC+  RP Q+ P +C  +LSK +
Sbjct  341   ICQLPKLENFTYSYNFFTGEPPVCLRLAE---FDDQRNCLPNRPVQRSPAQCKAFLSKRI  397

Query  156   DCSKTGCR  133
              C    CR
Sbjct  398   HCDAFKCR  405



>emb|CDY72552.1| BnaCnng78240D [Brassica napus]
Length=390

 Score =   375 bits (962),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/333 (54%), Positives = 230/333 (69%), Gaps = 1/333 (0%)
 Frame = -3

Query  1110  KKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDI  931
             +KAY ALQAWK  IYSDPK +T +WVGP+VCSY G+FC  +  DP   VVAGID+NH DI
Sbjct  40    QKAYRALQAWKKVIYSDPKNLTGDWVGPSVCSYTGIFCAPSPSDPNTLVVAGIDLNHGDI  99

Query  930   AGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELP  751
             AG LP  IGLL+DLALIH+NSNR CGI+P+++S L LL+E+D SNN  VGPFPDV+L LP
Sbjct  100   AGFLPEPIGLLSDLALIHLNSNRFCGILPRSLSQLSLLYELDLSNNRFVGPFPDVVLSLP  159

Query  750   SLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSG  571
             SLKYLDLRYN FEG LPP LF   LD I +NNNRL S +P +F  +TASV+V ANN FSG
Sbjct  160   SLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANNDFSG  219

Query  570   CVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQS  391
             C+P +I     ++E++LL+N+  SGCLP E+  L  + V D+  N LVG +P  L  +  
Sbjct  220   CLPPTIAHFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPYSLAGLGH  279

Query  390   LESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSDNCVL  214
             LE  +   NMF+G VP G+C LP+L+NL+ S NYF  E+  C  L   G+  DDS+NC+ 
Sbjct  280   LELLNLDHNMFTGAVPLGVCVLPSLQNLTVSDNYFSEEEGICRNLTSRGIVFDDSNNCLP  339

Query  213   ERPGQKLPQKCYEYLSKPVDCSKTGCRAATKET  115
             ++P Q+  + C + L  PVDC    C A   + 
Sbjct  340   DKPHQRSHKVCEDVLDHPVDCYDHECSAVAPQA  372



>ref|XP_009138254.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Brassica rapa]
Length=783

 Score =   387 bits (994),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/378 (49%), Positives = 250/378 (66%), Gaps = 4/378 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL   A  +   +  E+++DLK  FAN R K+AY+ALQ WK A +S
Sbjct  44    ALTDTEAAFIVQRQLLTLPANGELPDD-IEYEVDLKATFANTRLKRAYIALQTWKKAFFS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC YNGV C  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+AL
Sbjct  103   DPFNTTGNWHGPHVCGYNGVVCAPALDDPDVTVVAGVDLNGADIAGHLPAELGLMTDVAL  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VGPFP+V+L  P +K++DLR+N+FEG +
Sbjct  163   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGPFPEVVLAWPDVKFIDLRFNDFEGQV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF K+LD I LNNNR  S +PE+ G S A+V+  ANNKF+GC+P SIG M +++ ++
Sbjct  223   PSELFKKELDAIFLNNNRFTSTIPESLGESPATVVSFANNKFTGCIPKSIGNM-KNLNEV  281

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N+  GC P EI  LSN+T+FD  +N  +G LP     +  +E    + N  +G V 
Sbjct  282   VFMDNKLGGCFPSEIGKLSNVTLFDASKNTFIGRLPTSFVGLTGVEEFDISENKLTGLVA  341

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +  SC+P   +  + +DD  NC+  RP Q+  Q+C   +
Sbjct  342   DNICKLPNLVNFTYSYNYFNGQGGSCVPGGGRKEIELDDVRNCLPHRPDQRSAQECAVVI  401

Query  168   SKPVDCSKTGCRAATKET  115
             S+PVDCSK  C      T
Sbjct  402   SRPVDCSKDKCAGGGSST  419



>ref|XP_006366874.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Solanum 
tuberosum]
Length=716

 Score =   385 bits (989),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 246/368 (67%), Gaps = 6/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             TD++A+ I  RQLL++  E  F   G   K+D  + F NDR K AY+ALQAWK AI SDP
Sbjct  41    TDSEAQFIKHRQLLYYRDE--FGDRGENVKIDPSMVFENDRIKNAYIALQAWKQAIISDP  98

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               IT NWVGPNVCSY G+FC  ALD+P    VAGID+NH DIAG+LP E+GLLTDL + H
Sbjct  99    FNITLNWVGPNVCSYTGIFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLTDLGIFH  158

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG +P+  S LK+LFE+D SNN   G FP V+L LP L +LD+R+N FEG +P 
Sbjct  159   INSNRFCGTIPRKFSKLKILFELDLSNNRFAGKFPYVVLSLPKLIFLDIRFNEFEGNVPS  218

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDK LD I +N+NR    LPENFGNS  SVIVLA+N F GC+P+SIG M  ++ + +L
Sbjct  219   QLFDKPLDAIFINHNRFAFELPENFGNSPVSVIVLASNSFHGCLPASIGNM-SNLNEAIL  277

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN    CLP EI +L N+TVFDV  N+L+G LP+  G + +LE  + A NM SG +P  
Sbjct  278   MNNGLRSCLPAEIGVLKNLTVFDVSFNQLMGPLPENFGDLVNLEQLNVAHNMLSGTIPKS  337

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +C LP L+N ++S N+F  E   CL L +     D  NC+  RP Q+ P +C  +LSK +
Sbjct  338   ICQLPKLENFTYSYNFFTGEPPVCLGLPE---FHDERNCLPNRPVQRSPGQCKAFLSKKI  394

Query  156   DCSKTGCR  133
              CS   C 
Sbjct  395   HCSAFRCH  402



>emb|CDX93014.1| BnaA03g37360D [Brassica napus]
Length=456

 Score =   377 bits (967),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 190/373 (51%), Positives = 247/373 (66%), Gaps = 8/373 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             TD +   I RRQLL++  E  F   G    +D  L F N R + AY+ALQAWK AI SDP
Sbjct  34    TDNEVRFIQRRQLLYYRDE--FGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILSDP  91

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               IT NW+G NVC+Y GVFC  A D+     VAGID+NH+DIAG+LP E+GLLTDLAL H
Sbjct  92    NNITLNWIGSNVCTYTGVFCSRAPDNRRIRTVAGIDLNHADIAGYLPEELGLLTDLALFH  151

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +N+NR CG VP    +LKLLFE+D SNN   G FP V+L+LPSLK+LDLR+N FEG +P 
Sbjct  152   VNTNRFCGTVPHKFKHLKLLFELDLSNNRFAGKFPAVVLDLPSLKFLDLRFNEFEGTVPK  211

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LF K LD I +N+NR    LP+NFG+S  SV+VLANN+F GC+PSS   M +++ +I+ 
Sbjct  212   ELFSKPLDAIFINHNRFRFELPDNFGDSPVSVVVLANNRFHGCIPSSFVEM-KNLNEIIF  270

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN  + CLP +I  L N+TVFDV  N+LVG LP+ +G M S+E  + A N  SG +P  
Sbjct  271   MNNGLNSCLPADIGRLKNVTVFDVSFNELVGPLPESVGGMVSVEQLNVAHNRLSGKIPAS  330

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK-P  160
             +C LP L+N ++S N+F  E   CL L +    DD  NC+  RP Q+  ++C  +LS+ P
Sbjct  331   ICQLPKLENFTYSYNFFTGEAPVCLRLPE---FDDRRNCLPSRPAQRSSEQCAAFLSRPP  387

Query  159   VDCSKTGC-RAAT  124
             VDC    C R+ T
Sbjct  388   VDCESFKCGRSVT  400



>emb|CDY18974.1| BnaC01g20940D [Brassica napus]
Length=390

 Score =   374 bits (961),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/333 (54%), Positives = 230/333 (69%), Gaps = 1/333 (0%)
 Frame = -3

Query  1110  KKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDI  931
             +KAY ALQAWK  IYSDPK +T +WVGP+VCSY G+FC  +  DP   VVAGID+NH DI
Sbjct  40    QKAYRALQAWKKVIYSDPKNLTGDWVGPSVCSYTGIFCAPSPSDPNTLVVAGIDLNHGDI  99

Query  930   AGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELP  751
             AG LP  IGLL+DLALIH+NSNR CGI+P+++S L LL+E+D SNN  VGPFPDV+L LP
Sbjct  100   AGFLPEPIGLLSDLALIHLNSNRFCGILPRSLSQLSLLYELDLSNNRFVGPFPDVVLSLP  159

Query  750   SLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSG  571
             SLKYLDLRYN FEG LPP LF   LD I +NNNRL S +P +F  +TASV+V ANN FSG
Sbjct  160   SLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANNDFSG  219

Query  570   CVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQS  391
             C+P +I     ++E++LL+N+  SGCLP E+  L  + V D+  N LVG +P  L  +  
Sbjct  220   CLPPTIAHFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPYSLAGLGH  279

Query  390   LESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSDNCVL  214
             LE  +   NMF+G VP G+C LP+L+NL+ S NYF  E+  C  L   G+  DDS+NC+ 
Sbjct  280   LELLNLDHNMFTGAVPLGVCVLPSLQNLTVSDNYFSEEEGICRNLTSRGIVFDDSNNCLP  339

Query  213   ERPGQKLPQKCYEYLSKPVDCSKTGCRAATKET  115
             ++P Q+  + C + L  PVDC    C A   + 
Sbjct  340   DKPHQRSHKVCEDVLDHPVDCYDHECSAVAPQA  372



>emb|CDY49264.1| BnaA03g50770D [Brassica napus]
Length=632

 Score =   382 bits (982),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/378 (48%), Positives = 249/378 (66%), Gaps = 4/378 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL   A  +   +  E+++DLK  FAN R K+AY+ALQ WK A +S
Sbjct  44    ALTDTEAAFIVQRQLLTLPANGELPDD-IEYEVDLKATFANTRLKRAYIALQTWKKAFFS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GP+VC YNGV C  ALDDP   VVAG+D+N +DIAGHLP E+GL+TD+AL
Sbjct  103   DPFNTTGNWHGPHVCGYNGVVCAPALDDPDVTVVAGVDLNGADIAGHLPAELGLMTDVAL  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VG FP+V+L  P +K++DLR+N+FEG +
Sbjct  163   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGLFPEVVLAWPDVKFIDLRFNDFEGQV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF K+LD I LNNNR  S +PE+ G S A+V+  ANNKF+GC+P SIG M +++ ++
Sbjct  223   PSELFKKELDAIFLNNNRFTSTIPESLGESPATVVSFANNKFTGCIPKSIGNM-KNLNEV  281

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N+  GC P EI  LSN+T+FD  +N  +G LP     +  +E    + N  +G V 
Sbjct  282   VFMDNKLGGCFPSEIGKLSNVTLFDASKNTFIGRLPTSFVGLTGVEEFDISENKLTGLVA  341

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +  SC+P   +  + +DD  NC+  RP Q+  Q+C   +
Sbjct  342   DNICKLPNLVNFTYSYNYFNGQGGSCVPGGGRKEIELDDVRNCLPHRPDQRSAQECAVVI  401

Query  168   SKPVDCSKTGCRAATKET  115
             S+PVDCSK  C      T
Sbjct  402   SRPVDCSKDKCAGGGSST  419



>ref|XP_009627506.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=605

 Score =   381 bits (979),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/368 (50%), Positives = 243/368 (66%), Gaps = 6/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             TD +A+ I  RQLL++  E    GE     +D    F N R K AY+ALQAWK AI SDP
Sbjct  44    TDFEAQYIKHRQLLYYRDEFGDRGENVS--IDPSFVFENSRIKNAYIALQAWKQAIISDP  101

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               +T NWVGPNVC+Y G+FC  ALD+P    VAGID+NH DIAG+LP E+GLL DL + H
Sbjct  102   FNLTANWVGPNVCNYTGIFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLVDLGIFH  161

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG +PK   NLK+LFE+D SNN   G FP V+L L  L +LD+R+N FEG +P 
Sbjct  162   INSNRFCGTIPKKFKNLKILFELDLSNNRFAGKFPYVVLSLHKLIFLDIRFNEFEGNVPS  221

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFD+  D I +N+NR    LP+NFGNS  SVIVLANN+F GC+P+SIG M  ++E++++
Sbjct  222   QLFDRPFDAIFINHNRFSFELPDNFGNSPVSVIVLANNRFHGCLPASIGNMS-NLEEVIM  280

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN    CLP EI +L N+TVFDV  N+L+G LP+  G + +LE  + A NM +G +P  
Sbjct  281   MNNGLRSCLPTEIGMLKNLTVFDVSFNQLMGPLPEKFGELVNLEQLNVAHNMLTGSIPKS  340

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +C LP L+N ++S N+F  E   CL L +    DD  NC+  RP Q+ P +C  +LSK +
Sbjct  341   ICQLPKLENFTYSYNFFTGEPPVCLRLAE---FDDQRNCLPNRPVQRSPAQCKAFLSKRI  397

Query  156   DCSKTGCR  133
              C    CR
Sbjct  398   HCDAFKCR  405



>ref|XP_010447991.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Camelina sativa]
Length=395

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 229/332 (69%), Gaps = 1/332 (0%)
 Frame = -3

Query  1122  NDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDIN  943
             N + ++AY ALQAWK  IYSDPK +T +WVGP+VCSY G+FC  +  DP   VVAGID+N
Sbjct  43    NQQLQQAYHALQAWKKVIYSDPKNLTADWVGPSVCSYTGIFCAPSPSDPNTLVVAGIDLN  102

Query  942   HSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVI  763
             H DIAG LP  IGLL+DLALIH+NSNR CGI+P +++NL LL+E+D SNN  VGPFPDV+
Sbjct  103   HGDIAGFLPEAIGLLSDLALIHLNSNRFCGILPSSLANLSLLYELDLSNNRFVGPFPDVV  162

Query  762   LELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANN  583
             L LPSLKYLDLRYN FEG LPP LF   LD I +NNNRL S +P +F  +TASV+V ANN
Sbjct  163   LSLPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANN  222

Query  582   KFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLG  403
              FSGC+P +I R   ++E++LL+N+  SGCLP E+  L  + V DV  N LVG +P  L 
Sbjct  223   DFSGCLPPTIARFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDVSYNSLVGPVPYSLA  282

Query  402   YMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSD  226
              +  LE  +   NMF+G VP G+C LP+L NL+FS NY   E+  C  L   G+AVDD  
Sbjct  283   GLGHLEQLNLEHNMFTGTVPLGVCVLPSLLNLTFSYNYISEEEGICKNLTSRGIAVDDRY  342

Query  225   NCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
             NC+ ++P Q   + C   L  P+DC    C A
Sbjct  343   NCLPDKPLQWSQKVCDAVLDHPIDCYDHECSA  374



>ref|XP_010256147.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Nelumbo 
nucifera]
Length=378

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/331 (54%), Positives = 226/331 (68%), Gaps = 3/331 (1%)
 Frame = -3

Query  1128  FANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGID  949
             F N R   AY ALQAWK  I SDPK  T NW GP+VC+Y GVFC  A DDP    VAGID
Sbjct  32    FPNPRLLNAYTALQAWKHVILSDPKNSTANWYGPHVCNYTGVFCAPAPDDPYIKTVAGID  91

Query  948   INHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPD  769
             +NH+DIAG LP E+GLLTDLAL H+NSNR CG +P++  N+ LL+E+D SNNW  GPFP 
Sbjct  92    LNHADIAGSLPEELGLLTDLALFHINSNRFCGTIPESFKNMHLLYELDVSNNWFTGPFPS  151

Query  768   VILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLA  589
             V+L LPSLKYLD+RYN FEG +P  LFD +LD I +NNNR +  LP+N GNS ASV+V+A
Sbjct  152   VVLCLPSLKYLDIRYNQFEGEVPTRLFDLNLDAIFINNNRFKFTLPKNIGNSPASVLVMA  211

Query  588   NNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKG  409
             N + SGC+PSS+G M  +++QI+L+N     C+P EI  L NITVFDV  N L G LP+ 
Sbjct  212   NIQVSGCLPSSLGNMTGTLDQIILMNMGLRSCIPPEIGYLKNITVFDVSFNNLTGPLPET  271

Query  408   LGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDS  229
             +G M+ LE  + A N   G +P+ +C+LP LKN +FS NYF  E   CL LK     +D 
Sbjct  272   IGEMKKLEHLNVAHNKLIGEIPESICALPRLKNFTFSDNYFCSEPHLCLKLKHK---NDK  328

Query  228   DNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
              NC+  +P Q+ P++C  +L  PV C   GC
Sbjct  329   KNCIPYQPKQRSPEECKAFLDHPVHCDSFGC  359



>emb|CDX94809.1| BnaC03g43790D [Brassica napus]
Length=530

 Score =   379 bits (972),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/373 (52%), Positives = 247/373 (66%), Gaps = 8/373 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             TD +   I RRQLL++  E  F   G    +D  L F N R + AY+ALQAWK AI SDP
Sbjct  32    TDNEVRFIQRRQLLYYRDE--FGDRGENVSVDPSLVFENPRLRSAYIALQAWKQAILSDP  89

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               IT NW+G NVCSY GVFC  A D+     VAGID+NH+DIAG+LP E+GLLTDLAL H
Sbjct  90    NNITLNWIGSNVCSYTGVFCSRAPDNRRIRTVAGIDLNHADIAGYLPEELGLLTDLALFH  149

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP    +LKLLFE+D SNN   G FP V+L+LPSLK+LDLR+N FEG +P 
Sbjct  150   VNSNRFCGTVPHKFKHLKLLFELDLSNNRFAGKFPAVVLDLPSLKFLDLRFNEFEGTVPK  209

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LF K LD I +N+NR    LP+NFG+S  SV+VLANN+F GC+PSS   ME ++ +I+ 
Sbjct  210   ELFSKPLDAIFINHNRFRFELPDNFGDSPVSVVVLANNRFHGCIPSSFVEME-NLNEIIF  268

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN  + CLP +I  L N+TVFDV  N+LVG LP+ +G M S+E  + A N  SG +P  
Sbjct  269   MNNGLNSCLPADIGRLKNVTVFDVSFNELVGPLPESVGGMVSVEQLNVAHNQLSGKIPAS  328

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK-P  160
             +C LP L+N ++S N+F  E   CL L +    DD  NC+  RP Q+  ++C  +LS+ P
Sbjct  329   ICQLPKLENFTYSYNFFTGEAPVCLRLPE---FDDRRNCLPSRPAQRSSEQCAAFLSRPP  385

Query  159   VDCSKTGC-RAAT  124
             VDC    C R+ T
Sbjct  386   VDCESFKCGRSVT  398



>ref|XP_007160348.1| hypothetical protein PHAVU_002G314200g [Phaseolus vulgaris]
 gb|ESW32342.1| hypothetical protein PHAVU_002G314200g [Phaseolus vulgaris]
Length=740

 Score =   385 bits (989),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 245/359 (68%), Gaps = 6/359 (2%)
 Frame = -3

Query  1206  RQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGP  1027
             R +L +  E    GE     +D  L F N+R + AY+ALQAWK AI SDP+  T +WVG 
Sbjct  34    RHVLSYRDEFGDRGENV--SVDPSLVFQNNRLRDAYIALQAWKLAILSDPQNQTTDWVGS  91

Query  1026  NVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIV  847
              VC+Y GV+C  ALD+P+   VAGID+NH DIAG+LP E+GLL DLAL H+NSNR CG V
Sbjct  92    QVCTYTGVYCAPALDNPSIQTVAGIDLNHRDIAGYLPEELGLLVDLALFHINSNRFCGTV  151

Query  846   PKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVI  667
             P T   L LL E+D SNN   G FP+V+L LPSLK+LDLR+N FEG +P  LFDKDLD I
Sbjct  152   PHTFHKLILLHELDLSNNRFAGSFPEVVLHLPSLKFLDLRFNEFEGTVPRELFDKDLDAI  211

Query  666   LLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLP  487
              +N+NR   +LP+NFGNS  SVIVLANN+F GC+P S+G M  ++ +I+L+NNEF  CLP
Sbjct  212   FINDNRFVFDLPDNFGNSPVSVIVLANNRFHGCIPHSLGNMS-NLNEIILMNNEFRSCLP  270

Query  486   EEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNL  307
              EI LL N+TVFDV  N+L+G LP  +G   SLE  + A N+ SG +P  +C LP+L N 
Sbjct  271   SEIGLLKNLTVFDVSFNQLLGPLPTAVGNAVSLEQLNVAHNLLSGQIPPSICMLPHLLNF  330

Query  306   SFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
             ++S N+F  E  +CL L    A DD  NC+  RP Q+ P +C  +LSKPVDC+   C++
Sbjct  331   TYSSNFFTGEPPACLALP---AFDDRLNCLPARPVQRPPAQCQAFLSKPVDCNSFNCKS  386



>ref|XP_008776836.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Phoenix 
dactylifera]
 ref|XP_008779029.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Phoenix 
dactylifera]
Length=640

 Score =   382 bits (981),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 191/366 (52%), Positives = 242/366 (66%), Gaps = 10/366 (3%)
 Frame = -3

Query  1233  DADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPK  1054
             DA A  I RR+ L     + + GE     +D    F N R + AY+ALQAWK AI SDP 
Sbjct  30    DAAAGYIRRRRQL-----LTYRGENV--AVDPTFAFPNLRLRDAYIALQAWKLAIISDPL  82

Query  1053  GITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHM  874
              +T NWVGPNVC+Y GV+C     DP   VVAG+D+NH D+AG+LP E+GLL+DLAL H+
Sbjct  83    NLTANWVGPNVCNYTGVYCGPLPSDPHLTVVAGVDLNHGDVAGYLPDELGLLSDLALFHI  142

Query  873   NSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPS  694
             NSNR CG VP T   L+LLFE+D SNN   G FPDV+L LPSL+YLDLRYN FEG +P +
Sbjct  143   NSNRFCGGVPGTFHRLRLLFELDLSNNRFAGKFPDVVLRLPSLRYLDLRYNEFEGGVPKA  202

Query  693   LFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLL  514
             LFDKDLD I +NNNR   ++P+N GNS ASV+V ANN+F GC+P SIG M +++ +I+ L
Sbjct  203   LFDKDLDAIFVNNNRFVFDIPDNLGNSPASVVVFANNRFHGCLPPSIGNMSRTLNEIIFL  262

Query  513   NNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGL  334
             NN    CLP EI LL N+TVFDV  N+LVG LP  +G M SLE    A N+ SG +P  +
Sbjct  263   NNGLRSCLPPEIGLLGNLTVFDVSFNQLVGPLPSSIGGMVSLEQLDVAHNLLSGQIPPEI  322

Query  333   CSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVD  154
             C LP L+N ++S N+F  E   CL +    + DD  NC+  RP Q+   +C  +LS  +D
Sbjct  323   CRLPRLQNFTYSYNFFTGEPPECLRVP---SFDDRRNCLPGRPAQRSDTQCKSFLSHYID  379

Query  153   CSKTGC  136
             CS   C
Sbjct  380   CSSFHC  385



>ref|XP_010488556.1| PREDICTED: leucine-rich repeat extensin-like protein 4, partial 
[Camelina sativa]
Length=444

 Score =   375 bits (964),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 188/368 (51%), Positives = 243/368 (66%), Gaps = 7/368 (2%)
 Frame = -3

Query  1215  IARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNW  1036
             I RRQLL++  E  F   G    +D  L F N R + AY+ALQAWK AI SDP  IT +W
Sbjct  44    IQRRQLLYYRDE--FGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILSDPNNITLDW  101

Query  1035  VGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRIC  856
             +G NVCSY GVFC  ALD+     VAGID+NH+DIAG+LP E+GLLTDLAL H+NSNR C
Sbjct  102   IGSNVCSYTGVFCSRALDNRRIRTVAGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFC  161

Query  855   GIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDL  676
             G VP+    LKLLFE+D SNN   G FP V+L+LPSLK+LDLR+N FEG +P  LF K L
Sbjct  162   GTVPRKFKQLKLLFELDLSNNRFAGKFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKPL  221

Query  675   DVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSG  496
             D I +N+NR    LP N G+S  SVIVLANN F GCVP+S+  M +++ +I+L+NN  + 
Sbjct  222   DAIFINHNRFRFELPGNLGDSPVSVIVLANNHFHGCVPTSLVEM-KNLNEIILMNNHLNS  280

Query  495   CLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNL  316
             CLP +I  L N+TVFDV  N+LVG LPK +G +  +E  + A N+ SG +P  +C LP L
Sbjct  281   CLPADIGRLKNVTVFDVSFNELVGPLPKSVGGLVEVEQLNVAHNLLSGKIPASVCQLPKL  340

Query  315   KNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK-PVDCSKTG  139
             +N ++S N+F  E   CL L      DD  NC+  RP Q+  ++C  +LS+ PVDC    
Sbjct  341   ENFTYSYNFFTGEAPVCLRLSQ---FDDRRNCLPGRPAQRSSRQCSAFLSRPPVDCRSFS  397

Query  138   CRAATKET  115
             C  +  ++
Sbjct  398   CGRSVSQS  405



>ref|XP_009132101.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Brassica 
rapa]
Length=749

 Score =   385 bits (989),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 194/368 (53%), Positives = 247/368 (67%), Gaps = 7/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +D +   I +RQLL++    DF   G    +D  L F N R + AYVALQAWK AI SDP
Sbjct  39    SDKEVHLIRQRQLLYY--RDDFGDRGENVVVDPSLVFENPRLRSAYVALQAWKQAILSDP  96

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
                T NW+G +VCSY GV+C  A D+P    VAGID+NH+DIAG+LP E+GLLTDLAL H
Sbjct  97    NNFTTNWIGSDVCSYTGVYCAPAPDNPRIRTVAGIDLNHADIAGYLPQELGLLTDLALFH  156

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP   + LKLLFE+D SNN   G FP VIL+LPSLK+LDLR+N FEG +P 
Sbjct  157   VNSNRFCGTVPHRFNRLKLLFELDLSNNRFAGIFPAVILQLPSLKFLDLRFNEFEGPVPR  216

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LF KDLD I +N+NR    LP+N G+S  SVIV+ANN+F GC+P+S+G M +++E+I+ 
Sbjct  217   ELFSKDLDAIFINHNRFRFELPDNLGDSPVSVIVVANNQFHGCIPTSLGDM-KNLEEIIF  275

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN F+ CLP EI  L N+TVFD   N+LVG LP   G M SLE  + A N FSG +P  
Sbjct  276   MNNGFNSCLPSEIGRLKNVTVFDFSFNELVGSLPASTGGMVSLEQLNVAHNRFSGKIPAS  335

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLS-KP  160
             +C LP L+N +FS N+F  E   C+ L     VDD  NC+  RP Q+ P +C  +LS  P
Sbjct  336   ICQLPRLENFNFSYNFFTGEPPVCIGLP---GVDDRRNCIPARPAQRSPGQCAAFLSLPP  392

Query  159   VDCSKTGC  136
             V+C+  GC
Sbjct  393   VNCASFGC  400



>emb|CDY49661.1| BnaC09g41390D [Brassica napus]
Length=394

 Score =   374 bits (959),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 230/333 (69%), Gaps = 1/333 (0%)
 Frame = -3

Query  1110  KKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDI  931
             +KAY ALQAWK  IYSDPK +T +W+GP+VCSY G+FC  +  DP   VVAGID+NH DI
Sbjct  40    QKAYRALQAWKKVIYSDPKNLTGDWIGPSVCSYTGIFCAPSPSDPNTLVVAGIDLNHGDI  99

Query  930   AGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELP  751
             AG LP  IGLL+DLALIH+NSNR CGI+P+++S L LL+E+D SNN  VGPFPDV+L LP
Sbjct  100   AGFLPEPIGLLSDLALIHLNSNRFCGILPRSLSQLSLLYELDLSNNRFVGPFPDVVLSLP  159

Query  750   SLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSG  571
             SLKYLDLRYN FEG LPP LF   LD I +NNNRL S +P +F  +TASV+V ANN FSG
Sbjct  160   SLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANNDFSG  219

Query  570   CVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQS  391
             C+P +I     ++E++LL+N+  SGCLP E+  L  + V D+  N LVG +P  L  +  
Sbjct  220   CLPPTIAHFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPYSLAGLGH  279

Query  390   LESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSDNCVL  214
             LE  +   NMF+G VP G+C LP+L+NL+ S NYF  E+  C  L   G+  DDS+NC+ 
Sbjct  280   LELLNLDHNMFTGAVPLGVCVLPSLQNLTVSDNYFSEEEGICRNLTSRGIVFDDSNNCLP  339

Query  213   ERPGQKLPQKCYEYLSKPVDCSKTGCRAATKET  115
             ++P Q+  + C + L  PVDC    C A   + 
Sbjct  340   DKPHQRSHKVCEDVLDHPVDCYDHECSAVAPQA  372



>ref|XP_010438472.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Camelina sativa]
Length=395

 Score =   374 bits (959),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 229/332 (69%), Gaps = 1/332 (0%)
 Frame = -3

Query  1122  NDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDIN  943
             N + ++AY ALQAWK  IYSDPK +T +WVGP+VCSY G+FC  +  DP   VVAGID+N
Sbjct  43    NQQLQQAYHALQAWKKVIYSDPKNLTADWVGPSVCSYTGIFCAPSPSDPNTLVVAGIDLN  102

Query  942   HSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVI  763
             H DIAG LP  IGLL+DLALIH+NSNR CGI+P +++NL LL+E+D SNN  VGPFPDV+
Sbjct  103   HGDIAGFLPEAIGLLSDLALIHLNSNRFCGILPSSLANLSLLYELDLSNNRFVGPFPDVV  162

Query  762   LELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANN  583
             L LPSLKYLDLRYN FEG LPP LF   LD I +NNNRL S +P +F  +TASV+V ANN
Sbjct  163   LSLPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANN  222

Query  582   KFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLG  403
              FSGC+P +I R   ++E++LL+N+  SGCLP E+  L  + V DV  N LVG +P  L 
Sbjct  223   DFSGCLPPTIARFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDVSYNSLVGPVPYSLA  282

Query  402   YMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSD  226
              +  LE  +   NMF+G VP G+C LP+L NL+FS NY   E+  C  L   G+AVDD  
Sbjct  283   GLGHLEQLNLEHNMFTGTVPLGVCVLPSLLNLTFSYNYISEEEGICKNLTSRGIAVDDRY  342

Query  225   NCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
             NC+ ++P Q   + C   L  P+DC    C A
Sbjct  343   NCLPDKPLQWSQKVCDAVLDHPIDCYDHECSA  374



>ref|XP_006406541.1| hypothetical protein EUTSA_v10022433mg, partial [Eutrema salsugineum]
 gb|ESQ47994.1| hypothetical protein EUTSA_v10022433mg, partial [Eutrema salsugineum]
Length=351

 Score =   372 bits (954),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 176/318 (55%), Positives = 226/318 (71%), Gaps = 2/318 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  + RRQLL  +   D   +  E+++DL L FAN+R K+AY+ALQAWK A+YS
Sbjct  30    ALTDEEASFLTRRQLLALSENGDLPDD-MEYEVDLDLNFANNRLKRAYIALQAWKKAVYS  88

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW GPNVCSY GVFC  ALDD +  VVAGID+NH+DIAG+LP E+GLLTD+AL
Sbjct  89    DPFNTTANWFGPNVCSYKGVFCAPALDDQSIMVVAGIDLNHADIAGYLPPELGLLTDVAL  148

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG++PK+ S L L++E D SNN  VGPFP V L  PSLK+LD+RYN+FEG L
Sbjct  149   FHVNSNRFCGVIPKSFSKLTLMYEFDVSNNRFVGPFPTVALSWPSLKFLDIRYNDFEGKL  208

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP +FDKDLD I LNNNR ES +PE  G STASV+  A+NKF+GC+P +IG+M +++ +I
Sbjct  209   PPEIFDKDLDAIFLNNNRFESIIPETIGKSTASVVTFAHNKFTGCIPKTIGQM-KNLNEI  267

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + + N   GC P EI  L+N+TVFD   N  VG LP  L  + ++E   F+ N  +G V 
Sbjct  268   VFIGNNLGGCFPNEIGSLNNVTVFDASSNGFVGSLPSSLSGLANVEQMDFSYNKLTGFVS  327

Query  342   DGLCSLPNLKNLSFSGNY  289
             D +C LP L N +FS N+
Sbjct  328   DSICKLPKLSNFTFSYNF  345



>ref|XP_010050506.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
Length=425

 Score =   374 bits (961),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 187/344 (54%), Positives = 234/344 (68%), Gaps = 6/344 (2%)
 Frame = -3

Query  1233  DADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPK  1054
             DA+A  I +RQLL++  E  F   G    +D  L+F N R + AY+ALQAWK+AI SDPK
Sbjct  47    DAEAMYIKQRQLLYYRDE--FGDRGENVSVDPSLKFENPRIRSAYIALQAWKEAILSDPK  104

Query  1053  GITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHM  874
               T +WVG +VC+Y GV+C  A+DDP    VAGID+NH DIAG+LP E+GLL DLAL H+
Sbjct  105   NYTADWVGSDVCNYTGVYCAPAIDDPKIRTVAGIDLNHGDIAGYLPEELGLLADLALFHI  164

Query  873   NSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPS  694
             NSNR CG VP     LKLLFE+D SNN   G FP V+L LPSLK+LDLR+N FEG +P  
Sbjct  165   NSNRFCGTVPHKFDRLKLLFELDLSNNRFAGKFPAVVLRLPSLKFLDLRFNEFEGTVPKE  224

Query  693   LFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLL  514
             LFDKDLD I +N+NR    LP+NFGNS  SVIVLANNKF GCVPSS+  M  ++ +I+ +
Sbjct  225   LFDKDLDAIFINDNRFRFELPDNFGNSPVSVIVLANNKFHGCVPSSLVNM-SNLNEIIFM  283

Query  513   NNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGL  334
             NN    CLP ++  L N+TVFD   N+LVG LP G+  M SLE  + A N+ SG +P G+
Sbjct  284   NNGLRSCLPTQVGKLKNVTVFDFSHNELVGPLPDGVAKMVSLEQLNVAHNLLSGKIPAGI  343

Query  333   CSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPG  202
             C+LP L+N ++S N+F  E  SCL L D    DD  NC+  RP 
Sbjct  344   CTLPRLENFTYSYNFFTGEPPSCLRLPD---FDDRRNCLPNRPS  384



>ref|XP_006285388.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
 gb|EOA18286.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
Length=747

 Score =   384 bits (986),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 195/373 (52%), Positives = 247/373 (66%), Gaps = 7/373 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +D +   IA+RQLL++  E  F   G    +D  L F N R + AYVALQAWK AI SDP
Sbjct  37    SDNEVRLIAQRQLLYYRDE--FGDRGENVVVDPSLVFENPRLRNAYVALQAWKQAILSDP  94

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
                T NW+G +VCSY GVFC  ALD+     VAGID+NH+DIAG+LP E+GLLTDLAL H
Sbjct  95    NNFTTNWIGSDVCSYTGVFCAPALDNRRIRTVAGIDLNHADIAGYLPQELGLLTDLALFH  154

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP   + LKLLFE+D SNN   G FP VIL LPSLK+LDLR+N FEG +P 
Sbjct  155   VNSNRFCGTVPHRFNRLKLLFELDLSNNRFAGVFPTVILHLPSLKFLDLRFNEFEGPVPR  214

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LF KDLD I +N+NR    LP+N G+S  SVIV+ANN F GC+P+S+G M +++E+I+ 
Sbjct  215   ELFSKDLDAIFINHNRFRFELPDNLGDSPVSVIVVANNHFHGCIPTSLGDM-RNLEEIIF  273

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN F+ CLP +I  L N+TVFD   N+LVG LP  +G M SLE  + A N FSG +P  
Sbjct  274   MNNGFNSCLPSQIGRLKNVTVFDFSFNELVGPLPASVGGMVSLEQLNVAHNRFSGKIPAS  333

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLS-KP  160
             +C LP L+N +FS N+F  E   CL L      DD  NC+  RP Q+ P +C  + S  P
Sbjct  334   ICQLPRLENFTFSNNFFTGEPPVCLALP---GFDDRRNCLPARPAQRSPGQCAAFSSLPP  390

Query  159   VDCSKTGCRAATK  121
             VDC   GC  +++
Sbjct  391   VDCGSFGCGRSSR  403



>ref|XP_010433232.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Camelina sativa]
Length=386

 Score =   372 bits (956),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 181/332 (55%), Positives = 228/332 (69%), Gaps = 1/332 (0%)
 Frame = -3

Query  1122  NDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDIN  943
             N + ++AY ALQ WK  IYSDPK +T +WVGP+VCSY G+FC  +  DP   VVAGID+N
Sbjct  34    NQQLQQAYHALQTWKKVIYSDPKNLTADWVGPSVCSYTGIFCAPSPSDPNTLVVAGIDLN  93

Query  942   HSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVI  763
             H DIAG LP  IGLL+DLALIH+NSNR CGI+P +++NL LL+E+D SNN  VGPFPDV+
Sbjct  94    HGDIAGFLPEAIGLLSDLALIHLNSNRFCGILPSSLANLSLLYELDLSNNRFVGPFPDVV  153

Query  762   LELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANN  583
             L LPSLKYLDLRYN FEG LPP LF   LD I +NNNRL S +P +F  +TASV+V ANN
Sbjct  154   LSLPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANN  213

Query  582   KFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLG  403
              FSGC+P +I R   ++E++LL+N+  SGCLP E+  L  + V DV  N LVG +P  L 
Sbjct  214   DFSGCLPPTIARFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDVSYNSLVGPVPYSLA  273

Query  402   YMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSD  226
              +  LE  +   NMF+G VP G+C LP+L NL+FS NY   E+  C  L   G+AVDD  
Sbjct  274   GLGHLEQLNLEHNMFTGTVPLGVCVLPSLLNLTFSYNYISEEEGICKNLTSRGIAVDDRY  333

Query  225   NCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
             NC+ ++P Q   + C   L  P+DC    C A
Sbjct  334   NCLPDKPLQWSQKVCDAVLDHPIDCYDHECSA  365



>gb|EYU25784.1| hypothetical protein MIMGU_mgv1a026389mg, partial [Erythranthe 
guttata]
Length=390

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/334 (52%), Positives = 228/334 (68%), Gaps = 0/334 (0%)
 Frame = -3

Query  1137  KLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVA  958
             KL F N   ++AY+ALQAWK +I+SDP   T +W G +VCSY GVFC  A  +P+  VVA
Sbjct  40    KLSFENPNLRQAYIALQAWKQSIFSDPFNFTSDWTGSDVCSYGGVFCAPATTNPSVKVVA  99

Query  957   GIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGP  778
             GID+NH+DIAG LP E+GLLTDLAL H+NSNR CGIVP++   LKLLFE+D SNN  VG 
Sbjct  100   GIDLNHADIAGFLPEELGLLTDLALFHINSNRFCGIVPRSFKKLKLLFELDLSNNRFVGG  159

Query  777   FPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVI  598
             FP V+L LPSLK+LDLR+N FEG +P  +FDKDLD I LN+NR +  +PEN GNS  SV+
Sbjct  160   FPTVVLSLPSLKFLDLRFNEFEGGVPSQVFDKDLDAIFLNDNRFQFGIPENLGNSPVSVL  219

Query  597   VLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGEL  418
             VLANN   GC+P SIG+M +++ +++L+N+  +GCLP EI LL  +TVFDV  N L G L
Sbjct  220   VLANNNLGGCIPGSIGKMGKTLNELILMNDNLTGCLPPEIGLLRELTVFDVSFNNLQGPL  279

Query  417   PKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAV  238
             P  +G M+SLE  + A N  +G V   +C LP L+N ++S NYF  E   C         
Sbjct  280   PAAIGSMRSLEQLNVAHNRLTGEVTAAVCQLPRLENFTYSYNYFTKEAAQCGRFGGATVA  339

Query  237   DDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
             D  +NC+  +  Q+  ++C    +KP DCSK+ C
Sbjct  340   DGEENCIPGKSDQRSVKECSSDAAKPFDCSKSKC  373



>ref|XP_010040127.1| PREDICTED: leucine-rich repeat extensin-like protein 2, partial 
[Eucalyptus grandis]
Length=439

 Score =   374 bits (960),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/338 (53%), Positives = 233/338 (69%), Gaps = 1/338 (0%)
 Frame = -3

Query  1149  KLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQ  970
             KLDL L+F N R +KAY+ALQAWK AI+SDP   T NW GPNVCSY GVFC  +  + + 
Sbjct  35    KLDLSLKFENGRLRKAYIALQAWKQAIFSDPFNFTANWHGPNVCSYKGVFCAPSPSNSSL  94

Query  969   WVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNW  790
              VVAGID+NH+DIAG LP E+GLL  LAL H+NSNR CG VP T  ++KLL+E+D SNN 
Sbjct  95    RVVAGIDLNHADIAGFLPRELGLLRHLALFHLNSNRFCGSVPSTFRHMKLLWELDLSNNR  154

Query  789   LVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNST  610
              VG FP+V+L LPSLKYLDLR+N FEG +P  LFDKDLD I LN+NRL   +P+N G S 
Sbjct  155   FVGQFPEVVLRLPSLKYLDLRFNEFEGGVPSKLFDKDLDAIFLNDNRLRFGIPQNLGKSP  214

Query  609   ASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKL  430
              SV+VLANN   GC+PSSIG M +++ +I+LLN+  +GCLP ++ LL  ITVFDV  N+L
Sbjct  215   VSVLVLANNDLGGCIPSSIGEMGKTLNEIILLNDNLTGCLPPQVKLLKQITVFDVSFNRL  274

Query  429   VGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD  250
              G LP G+G M+ LE  + A N F+G +   +C LP L+N ++S NYF  E  +C   + 
Sbjct  275   QGPLPSGIGAMKKLEQLNIAHNGFTGVILSSVCRLPMLQNFTYSFNYFNGEAPTCSSARI  334

Query  249   GVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
                +D   NC+  +  Q+  ++C    ++PV CS+  C
Sbjct  335   RT-LDGRQNCIPRKTDQRSSRECSSAAARPVKCSQLKC  371



>ref|XP_010432489.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Camelina sativa]
Length=727

 Score =   383 bits (983),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 186/371 (50%), Positives = 246/371 (66%), Gaps = 4/371 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TD +A  I +RQLL      +   +  E+++DLK  FAN R KKAY+ALQA K AIYS
Sbjct  44    ALTDTEAAFIVQRQLLMLPENGELPDD-IEYEVDLKATFANTRLKKAYIALQALKKAIYS  102

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW G +VCSY GV C  ALDD    VVAG+D+N +DIAGHLP E+GL+TD+A+
Sbjct  103   DPFNTTGNWHGSHVCSYTGVVCAPALDDSEVTVVAGVDLNGADIAGHLPAELGLMTDVAM  162

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+PK+   LKL+ E D SNN  VG FP+V+L  P +KY DLR+N+FE  +
Sbjct  163   FHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGSFPNVVLSWPDVKYFDLRFNDFEDQV  222

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF K LD I LNNNR  S +PE+ G S ASV+  ANNKF+GC+P SIG M +++ +I
Sbjct  223   PTELFRKQLDAIFLNNNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNM-KNLNEI  281

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + ++N   GC P EI  LSN+TVFD  +N  +G LP     +  +E    +GN  +G VP
Sbjct  282   VFMDNALGGCFPSEIGKLSNVTVFDASKNSFIGRLPTSFVGLTGVEEFDISGNKLTGLVP  341

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP--LKDGVAVDDSDNCVLERPGQKLPQKCYEYL  169
             D +C LPNL N ++S NYF  +  SC+P   +  +A+DD+ NC+  RP Q+  Q+C   +
Sbjct  342   DNICKLPNLVNFTYSYNYFNGQGGSCVPGGARKEIALDDTRNCLPARPDQRSSQECAVVI  401

Query  168   SKPVDCSKTGC  136
             ++PVDCSK  C
Sbjct  402   NRPVDCSKDKC  412



>ref|XP_010049719.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
Length=732

 Score =   383 bits (983),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 188/358 (53%), Positives = 241/358 (67%), Gaps = 6/358 (2%)
 Frame = -3

Query  1209  RRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVG  1030
              R LLH+  E  F   G +  +D    F N R + AYVALQA K AI SDP   T NWVG
Sbjct  38    HRLLLHYLDE--FGDRGLQVTVDPSASFENPRLRNAYVALQALKQAILSDPNNFTANWVG  95

Query  1029  PNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGI  850
             P+VCSY+ V+C  A DDP+   VAG+D+NH DIAG+LP E+GLL DLAL H+NSNR CG 
Sbjct  96    PDVCSYSNVYCSPAPDDPSVRTVAGVDLNHGDIAGYLPEELGLLADLALFHLNSNRFCGS  155

Query  849   VPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDV  670
             VP+   NLK L+E+D SNN   G FP V+LELP+LK+LDLR+N F+G++P  LFDKDLD 
Sbjct  156   VPQKFRNLKRLYELDLSNNRFAGKFPRVVLELPALKFLDLRFNEFDGSVPRELFDKDLDA  215

Query  669   ILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCL  490
             I +N+NR   +LP+N G+S  SVIVLANN F GC+P SI  M +++ +++L+NN F  CL
Sbjct  216   IFINDNRFRFDLPDNLGHSPVSVIVLANNDFGGCLPQSIVEM-KNLNEVILMNNGFKSCL  274

Query  489   PEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKN  310
             P ++  L N+TVFDV  N+L G LP+ +G M SLE  + A N  SG +P  +C LP L+N
Sbjct  275   PSQLGELKNVTVFDVSVNQLAGPLPESVGKMVSLEQLNVAHNRLSGKIPASVCGLPKLQN  334

Query  309   LSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGC  136
              +FS N+F  E  +CL L    AVDD  NC+  RP Q+ P +C    S+PVDCS  GC
Sbjct  335   FTFSDNFFTGEPPACLRLP---AVDDRKNCLAGRPAQRSPIQCRASASRPVDCSAFGC  389



>ref|XP_009144429.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Brassica rapa]
Length=410

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 230/333 (69%), Gaps = 1/333 (0%)
 Frame = -3

Query  1110  KKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDI  931
             +KAY ALQAWK  IYSDPK +T +W+GP+VCSY G+FC  +  D    VVAGID+NH DI
Sbjct  60    QKAYRALQAWKKVIYSDPKNLTGDWIGPSVCSYTGIFCAPSPSDQNTLVVAGIDLNHGDI  119

Query  930   AGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELP  751
             AG LP  IGLL+DLALIH+NSNR CGI+P+++S L LL+E+D SNN  VGPFPDV+L LP
Sbjct  120   AGFLPEPIGLLSDLALIHLNSNRFCGILPRSLSQLSLLYELDLSNNRFVGPFPDVVLSLP  179

Query  750   SLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSG  571
             SLKYLDLRYN FEG LPP LF   LD I +NNNRL S +P +F  +TASV+V ANN FSG
Sbjct  180   SLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANNDFSG  239

Query  570   CVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQS  391
             C+P +I     ++E++LL+N+  SGCLP E+  L  + V D+  N LVG +P  L  +  
Sbjct  240   CLPPTIAHFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPYSLAGLGH  299

Query  390   LESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSDNCVL  214
             LE  +   NMF+G VP G+C LP+L+NL+ S NYF  E+ +C  L   G+  DDS+NC+ 
Sbjct  300   LELLNLDHNMFTGAVPLGVCVLPSLQNLTVSDNYFSEEEGTCRNLTSRGIVFDDSNNCLP  359

Query  213   ERPGQKLPQKCYEYLSKPVDCSKTGCRAATKET  115
             ++P Q+  + C + L  PVDC    C A   + 
Sbjct  360   DKPHQRSHKVCEDVLDHPVDCYDHECSAVAPQA  392



>ref|XP_004292960.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Fragaria 
vesca subsp. vesca]
Length=524

 Score =   376 bits (965),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 191/362 (53%), Positives = 239/362 (66%), Gaps = 6/362 (2%)
 Frame = -3

Query  1218  NIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKD-AIYSDPKGITK  1042
             +I +RQLLH+       GE     +   L F N R + AY+ALQAWK  A+ SDP G T 
Sbjct  39    HIKQRQLLHYKDNNCSRGETV--TVPPSLVFPNPRIRTAYIALQAWKQIAMLSDPLGYTA  96

Query  1041  NWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNSNR  862
             NWVG NVC+Y GVFC  ALDDPT   VAGID+NH+DIAG+LP E+G L+D+ L H+NSNR
Sbjct  97    NWVGSNVCNYTGVFCAQALDDPTIETVAGIDLNHADIAGYLPVELGHLSDITLFHVNSNR  156

Query  861   ICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLFDK  682
              CG VPK+ S LKLL E+D SNN   G FP V+L+LP+LKYLD+R+N FEG +P  LFDK
Sbjct  157   FCGTVPKSFSKLKLLHELDLSNNRFAGKFPLVLLQLPALKYLDIRFNEFEGRIPKKLFDK  216

Query  681   DLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNNEF  502
              LD I LN+NR    LP N GNS  SVIVLANNKF GC+P+S+G M +++ +++L  +  
Sbjct  217   HLDAIFLNDNRFTHELPHNLGNSPVSVIVLANNKFHGCLPASLGNMSKNLNELILTRSGL  276

Query  501   SGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCSLP  322
               CLP+EI  L N+TV DV  N L+GELP  LG M SLE  + A N  +G +P  +C LP
Sbjct  277   YSCLPDEIGKLKNLTVLDVSHNDLIGELPHALGEMLSLEELNVAHNKLTGTIPGSICGLP  336

Query  321   NLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCSKT  142
             NLK  SF  N+F  E   CL L+     DDS NC+ +RP Q+   +C  +LSK V CS  
Sbjct  337   NLKKFSFQDNFFTGEPPMCLDLEQ---FDDSRNCLRDRPNQRSMLQCKLFLSKSVGCSSF  393

Query  141   GC  136
              C
Sbjct  394   EC  395



>ref|XP_008229070.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Prunus 
mume]
Length=434

 Score =   373 bits (957),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 227/332 (68%), Gaps = 1/332 (0%)
 Frame = -3

Query  1125  ANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDI  946
             +N R   A++ALQAWK  IYSDP   T NWVGP+VC+Y GVFC  ALDDP   VVAGID+
Sbjct  68    SNPRLHLAFLALQAWKRVIYSDPYNFTSNWVGPSVCNYKGVFCAPALDDPRIQVVAGIDL  127

Query  945   NHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDV  766
             N  +IAG LP E+GLL DLALIH+NSNR CGI+P++++NL LL+E+D SNN  VGPFP V
Sbjct  128   NKGNIAGFLPEELGLLCDLALIHLNSNRFCGILPQSMANLTLLYELDLSNNRFVGPFPTV  187

Query  765   ILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLAN  586
             +L LP+LKYLDLRYN FEG L P LF K LD I +NNNR  + LP  FG S+ASV+V AN
Sbjct  188   VLSLPTLKYLDLRYNEFEGPLSPQLFKKKLDAIFVNNNRFTNVLPATFGGSSASVLVFAN  247

Query  585   NKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGL  406
             N F GC+P SI     ++E++LL+N   SGCLP+EI  L  + V DV  NKLVG +P  +
Sbjct  248   NNFGGCLPPSIVSFADTLEELLLINTNLSGCLPQEIGFLYKLRVLDVSYNKLVGPIPYSM  307

Query  405   GYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDS  229
               +  LE  + A N  +G VPDG+C LPNL N +FS NYF  E+  C  L   G+A DD 
Sbjct  308   AGLSHLEQLNLAHNSMTGIVPDGVCCLPNLANFTFSYNYFCEEEGICQNLTSKGIAFDDR  367

Query  228   DNCVLERPGQKLPQKCYEYLSKPVDCSKTGCR  133
              NC+ E+P Q+  ++C   L  PVDC +  C 
Sbjct  368   QNCLPEKPYQRSQKECNATLEHPVDCFEHPCE  399



>gb|KEH27082.1| LRR extensin-like protein [Medicago truncatula]
Length=835

 Score =   385 bits (989),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 193/369 (52%), Positives = 247/369 (67%), Gaps = 6/369 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             T+A+ + I  RQLL++  E +  GE     +D  L F+N+R K AYVALQA+K AI SDP
Sbjct  39    TEAETQYIKHRQLLYYRDEFNDRGENV--TVDPTLVFSNNRIKNAYVALQAFKQAILSDP  96

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
             +  T +WVG +VCSY  VFC  ALD+P    VAGID+NH DIAG+LP E+GLLTDLAL H
Sbjct  97    RNCTVDWVGSDVCSYTNVFCAPALDNPKINTVAGIDLNHCDIAGYLPEELGLLTDLALFH  156

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +N+NR CG VP     LK+LFE+D SNN   G FP+V+L LP LK+LDLR+N FEG +P 
Sbjct  157   VNTNRFCGTVPHKFEKLKILFELDLSNNRFAGKFPEVVLRLPELKFLDLRFNEFEGTVPK  216

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDKDLD I +N+NR   NLPENFGNS  SVIVLANN+F GC+P+ IG M + + +I+ 
Sbjct  217   ELFDKDLDAIFINHNRFVFNLPENFGNSPVSVIVLANNRFHGCLPAGIGNMTR-LNEIIA  275

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN F  CLPEE+ LL N+TVFDV  NK +G LP+  G    LE  + A N  SG +P  
Sbjct  276   MNNGFQACLPEEVGLLKNLTVFDVSFNKFLGPLPEKYGNAVGLEVLNVAHNYLSGQIPAS  335

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +C+LPNL N ++S N+F  E   CL L    A DD  NC+  RP Q+  + C  + S  V
Sbjct  336   ICALPNLVNFTYSYNFFTGEPPQCLVLP---AADDRQNCLPARPRQRPAKTCKAFASHHV  392

Query  156   DCSKTGCRA  130
             +C+   C+A
Sbjct  393   NCNAFRCKA  401



>ref|XP_009613983.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Nicotiana 
tomentosiformis]
Length=533

 Score =   376 bits (965),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 186/364 (51%), Positives = 247/364 (68%), Gaps = 11/364 (3%)
 Frame = -3

Query  1227  DAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDPKGI  1048
             D E   RR+LL +  ++          ++  L F N R K AY+ALQAWK+AI SDP  I
Sbjct  46    DIEYTNRRKLLSYNGDI--------LAINPSLNFENFRLKNAYIALQAWKEAILSDPHNI  97

Query  1047  TKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIHMNS  868
             T NW+G NVC+Y GVFC  +LD+P++  VAGIDINH DIAG LP E+GLL D+AL H+NS
Sbjct  98    TANWIGSNVCNYTGVFCWPSLDEPSELTVAGIDINHGDIAGTLPHELGLLYDIALFHINS  157

Query  867   NRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPPSLF  688
             NR CG +P++  NLKLLFE+D SNN  VG FPDV+++LP+L++LDLR+N FEG LP  +F
Sbjct  158   NRFCGTIPESFLNLKLLFELDVSNNRFVGKFPDVVVQLPNLRFLDLRFNEFEGELPRQVF  217

Query  687   DKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILLLNN  508
             ++  D + +NNNR  S LP+NFGNS  SV+VLANNKF GC+P S+G+M +++ ++LL+NN
Sbjct  218   ERSFDALFINNNRFSSELPDNFGNSPVSVMVLANNKFQGCIPVSLGKMAKTLNELLLINN  277

Query  507   EFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDGLCS  328
              F  CLP EI +L N+TV D+  N++VG LP+ +G M+SLE  +   NM SG + D +C 
Sbjct  278   NFHSCLPNEIGMLKNLTVLDLSYNQIVGTLPESIGNMESLEQLNLGHNMLSGKISDNICR  337

Query  327   LPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPVDCS  148
             LPNLK   +  NYF  E  +CL L    A  D  NC+  RP Q+    C  +LSK VDC+
Sbjct  338   LPNLKKFVYDNNYFSQESPACLNLN---AFADQQNCLRGRPMQRPALDCQRFLSKKVDCN  394

Query  147   KTGC  136
                C
Sbjct  395   TFKC  398



>ref|XP_009351253.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Pyrus x bretschneideri]
Length=957

 Score =   388 bits (996),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/376 (51%), Positives = 251/376 (67%), Gaps = 3/376 (1%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
             A TDA+A +IA RQL+      D   + +E ++D+KL+F NDR K+AYVALQA K AI+S
Sbjct  31    ALTDAEAAHIAHRQLISLPENGDLP-DNYEVQVDVKLKFENDRLKRAYVALQAQKSAIFS  89

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW G NVC+Y GVFC  ALDD +  VVAGID+NH+DIAGHL  E+GLLTDLAL
Sbjct  90    DPFKFTANWEGENVCAYKGVFCAPALDDSSLNVVAGIDLNHADIAGHLVVEMGLLTDLAL  149

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CGI+P++   L L++E D SNN  VG FP V+L  P+ KYLDLR+N FEG L
Sbjct  150   FHINSNRFCGIIPESFRRLTLMYEFDISNNRFVGRFPGVVLHWPNCKYLDLRFNGFEGEL  209

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             PP LF K+ D I LN+NR  S +PE  GNS  SV+  A N FSGC+P S+G M  +V ++
Sbjct  210   PPELFFKEFDAIFLNHNRFTSVIPETIGNSKVSVVSFAFNNFSGCIPHSVGNM-HNVNEL  268

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + +NN+  GC P EI  L N+ VFDV  N  +G LPK    +QS+E      N  +G V 
Sbjct  269   IFMNNQLGGCFPPEIGNLGNLQVFDVCYNGFIGSLPKSFVGLQSIEELDIGYNRLTGFVT  328

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLP-LKDGVAVDDSDNCVLERPGQKLPQKCYEYLS  166
             D +C+LP L N +F+ NYF  E ++C+P  K  + +DDS NC+  RP QK  + C+  ++
Sbjct  329   DKICTLPKLANFTFAYNYFSGEAQNCMPNPKSKIVLDDSGNCMPGRPKQKNTKTCFPVVT  388

Query  165   KPVDCSKTGCRAATKE  118
             KPVDCSK    ++T E
Sbjct  389   KPVDCSKNCGGSSTPE  404



>ref|XP_009760538.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nicotiana 
sylvestris]
Length=740

 Score =   382 bits (981),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 187/368 (51%), Positives = 245/368 (67%), Gaps = 6/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             TD +A+ I  RQLL++  E  F   G +  +D    F N+R K AY+ALQAWK AI SDP
Sbjct  44    TDFEAQYIKHRQLLYYRDE--FGDRGEKVTIDPSFIFENNRIKNAYIALQAWKQAIISDP  101

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
               +T+NWVGPNVC+Y G+FC  ALD+P    VAGID+NH DIAG+LP E+GLL DL + H
Sbjct  102   FNLTENWVGPNVCNYTGIFCAPALDNPKIRTVAGIDLNHGDIAGYLPEELGLLVDLGIFH  161

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG +PK   NLK+LFE+D SNN   G FP V+L LP L +LD+R+N FEG +P 
Sbjct  162   INSNRFCGTIPKKFKNLKILFELDLSNNRFAGKFPYVVLSLPKLIFLDIRFNEFEGNVPS  221

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDK LD I +N+NR    LP+NFGNS  SVIVLANNKF GC+P+SIG M  ++ ++++
Sbjct  222   QLFDKPLDAIFINHNRFMFELPDNFGNSPVSVIVLANNKFHGCLPASIGNM-SNLNEVIM  280

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN    CLP EI +L N+TVFDV  N+L+G LP+  G + +LE  + A NM SG +P  
Sbjct  281   MNNGLRSCLPTEIGMLKNLTVFDVSFNQLMGPLPEKFGKLVNLEQLNVAHNMLSGSIPKS  340

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +C LP L+N ++S N+F  E   CL L +    DD  NC+  RP Q+ P +C  + SK +
Sbjct  341   ICQLPKLENFTYSYNFFTGEPPVCLGLPE---FDDQRNCLPNRPVQRSPAQCKAFSSKRI  397

Query  156   DCSKTGCR  133
              C    C 
Sbjct  398   HCGAFKCH  405



>gb|AAD55980.2|AF159297_1 extensin-like protein [Zea mays]
Length=1016

 Score =   389 bits (1000),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 203/380 (53%), Positives = 253/380 (67%), Gaps = 13/380 (3%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLE-------FANDRQKKAYVALQA  1084
             A T A+A  IARRQLL  A +   +GEG +   D + +       F N R ++AY+ALQA
Sbjct  31    AVTSAEASYIARRQLL--AMKEAGAGEGGDLPADFEFDDRVGAANFPNPRLRRAYIALQA  88

Query  1083  WKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIG  904
             W+ A YSDPKG T NWVG +VC YNGV C  ALDDP   VVAGID+N +DIAG+LP E+G
Sbjct  89    WRRAFYSDPKGYTANWVGEDVCKYNGVICTEALDDPKVTVVAGIDLNGADIAGYLPPELG  148

Query  903   LLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRY  724
             LLTDLA  H+N+NR CGI+PK++S L LL E D SNN  VG FP V LE+ SLKYLDLR+
Sbjct  149   LLTDLAFFHINTNRFCGIIPKSMSRLSLLHEFDVSNNRFVGVFPYVCLEMVSLKYLDLRF  208

Query  723   NNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRM  544
             N+FEG LPP+LFDKDLD I +N NR    +PEN GNSTASVIV ANN F GC+P SIGRM
Sbjct  209   NDFEGELPPALFDKDLDAIFVNTNRFVGYIPENLGNSTASVIVFANNAFVGCIPKSIGRM  268

Query  543   EQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGN  364
              +++++I+ LNN+  GCLP E+ LL N TV DV  N LVG +P+ L  +  LE    + N
Sbjct  269   VKTLDEIIFLNNKLDGCLPLEMGLLVNTTVIDVSGNMLVGTIPEQLSNIAKLEQLDVSRN  328

Query  363   MFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDG-VAVDDSDNCV-LERPGQKLP  190
             +F+G V + +C L  L N  F+ N F  E   C+P  +  V  DD DNC+   RP QK  
Sbjct  329   VFTGIVQESMCELRALVNFRFAFNLFNSEAVVCMPSDNALVNFDDRDNCLGALRPAQKTA  388

Query  189   QKCYEYLSKP--VDCSKTGC  136
              +C   L++P  VDCSK  C
Sbjct  389   LQCAPVLARPVEVDCSKHVC  408



>ref|NP_193070.1| leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana]
 sp|Q9T0K5.1|LRX3_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 3; Short=AtLRX3; 
Short=LRR/EXTENSIN3; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB40769.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB78376.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE83265.1| leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana]
Length=760

 Score =   382 bits (982),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 191/370 (52%), Positives = 246/370 (66%), Gaps = 11/370 (3%)
 Frame = -3

Query  1242  AFTDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYS  1063
               +D +  +I RRQLL FA          +  +D  L F N R + AY+ALQAWK AI S
Sbjct  29    VLSDNEVRHIQRRQLLEFAER------SVKITVDPSLNFENPRLRNAYIALQAWKQAILS  82

Query  1062  DPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLAL  883
             DP   T NW+G NVC+Y GVFC  ALD+     VAGID+NH+DIAG+LP E+GLL+DLAL
Sbjct  83    DPNNFTSNWIGSNVCNYTGVFCSPALDNRKIRTVAGIDLNHADIAGYLPEELGLLSDLAL  142

Query  882   IHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGAL  703
              H+NSNR CG VP   + LKLLFE+D SNN   G FP V+L+LPSLK+LDLR+N FEG +
Sbjct  143   FHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAGKFPTVVLQLPSLKFLDLRFNEFEGTV  202

Query  702   PPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQI  523
             P  LF KDLD I +N+NR    LPENFG+S  SVIVLANN+F GCVPSS+  M +++ +I
Sbjct  203   PKELFSKDLDAIFINHNRFRFELPENFGDSPVSVIVLANNRFHGCVPSSLVEM-KNLNEI  261

Query  522   LLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVP  343
             + +NN  + CLP +I  L N+TVFDV  N+LVG LP+ +G M S+E  + A NM SG +P
Sbjct  262   IFMNNGLNSCLPSDIGRLKNVTVFDVSFNELVGPLPESVGEMVSVEQLNVAHNMLSGKIP  321

Query  342   DGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK  163
               +C LP L+N ++S N+F  E   CL L +    DD  NC+  RP Q+ P +C  +LS+
Sbjct  322   ASICQLPKLENFTYSYNFFTGEAPVCLRLPE---FDDRRNCLPGRPAQRSPGQCKAFLSR  378

Query  162   -PVDCSKTGC  136
              PV+C    C
Sbjct  379   PPVNCGSFSC  388



>ref|XP_003620502.1| Extensin-like protein [Medicago truncatula]
Length=838

 Score =   384 bits (987),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 193/369 (52%), Positives = 247/369 (67%), Gaps = 6/369 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             T+A+ + I  RQLL++  E +  GE     +D  L F+N+R K AYVALQA+K AI SDP
Sbjct  39    TEAETQYIKHRQLLYYRDEFNDRGENV--TVDPTLVFSNNRIKNAYVALQAFKQAILSDP  96

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
             +  T +WVG +VCSY  VFC  ALD+P    VAGID+NH DIAG+LP E+GLLTDLAL H
Sbjct  97    RNCTVDWVGSDVCSYTNVFCAPALDNPKINTVAGIDLNHCDIAGYLPEELGLLTDLALFH  156

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +N+NR CG VP     LK+LFE+D SNN   G FP+V+L LP LK+LDLR+N FEG +P 
Sbjct  157   VNTNRFCGTVPHKFEKLKILFELDLSNNRFAGKFPEVVLRLPELKFLDLRFNEFEGTVPK  216

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LFDKDLD I +N+NR   NLPENFGNS  SVIVLANN+F GC+P+ IG M + + +I+ 
Sbjct  217   ELFDKDLDAIFINHNRFVFNLPENFGNSPVSVIVLANNRFHGCLPAGIGNMTR-LNEIIA  275

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN F  CLPEE+ LL N+TVFDV  NK +G LP+  G    LE  + A N  SG +P  
Sbjct  276   MNNGFQACLPEEVGLLKNLTVFDVSFNKFLGPLPEKYGNAVGLEVLNVAHNYLSGQIPAS  335

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSKPV  157
             +C+LPNL N ++S N+F  E   CL L    A DD  NC+  RP Q+  + C  + S  V
Sbjct  336   ICALPNLVNFTYSYNFFTGEPPQCLVLP---AADDRQNCLPARPRQRPAKTCKAFASHHV  392

Query  156   DCSKTGCRA  130
             +C+   C+A
Sbjct  393   NCNAFRCKA  401



>ref|XP_002867981.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44240.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
Length=738

 Score =   382 bits (980),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 193/373 (52%), Positives = 247/373 (66%), Gaps = 7/373 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +D     I +RQLL+F  E+   GE     +D  L F N R + AY+ALQAWK AI SDP
Sbjct  40    SDNQVRLITQRQLLYFRDELGDRGENV--VVDPSLVFENPRLRNAYIALQAWKQAILSDP  97

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
                T NW+G +VCSY GV+C  ALD+     VAGID+NH+DIAG+LP E+GLLTDLAL H
Sbjct  98    NNFTTNWIGSDVCSYTGVYCAPALDNRRIRTVAGIDLNHADIAGYLPQELGLLTDLALFH  157

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP   + LKLLFE+D SNN   G FP V+L+LPSLK+LDLR+N FEG +P 
Sbjct  158   VNSNRFCGTVPHRFNRLKLLFELDLSNNRFAGIFPTVVLQLPSLKFLDLRFNEFEGPVPR  217

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LF KDLD I +N+NR    LP+N G+S  SVIV+ANN F GC+P+S+G M +++E+I+ 
Sbjct  218   ELFSKDLDAIFINHNRFRFELPDNLGDSPVSVIVVANNHFHGCIPTSLGDM-KNLEEIIF  276

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN F+ CLP +I  L N+TVFD   N+LVG LP  +G M SLE  + A N FSG +P  
Sbjct  277   MNNGFNSCLPPQIGRLKNVTVFDFSFNELVGSLPASIGGMVSLEQLNVAHNRFSGKIPAS  336

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLS-KP  160
             +C LP L+N +FS N+F  E   CL L      DD  NC+  RP Q+ P +C  + S  P
Sbjct  337   ICQLPRLENFTFSYNFFTGEPPVCLGLP---GFDDRRNCLPSRPAQRSPVQCAAFSSLPP  393

Query  159   VDCSKTGCRAATK  121
             VDC   GC  +T+
Sbjct  394   VDCGSFGCGRSTR  406



>ref|XP_002310403.2| hypothetical protein POPTR_0007s01000g, partial [Populus trichocarpa]
 gb|EEE90853.2| hypothetical protein POPTR_0007s01000g, partial [Populus trichocarpa]
Length=363

 Score =   369 bits (947),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 172/328 (52%), Positives = 229/328 (70%), Gaps = 1/328 (0%)
 Frame = -3

Query  1107  KAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIA  928
             +AY+ALQAW+  IYSDP   T NWVGP+VCSY G++C  A DDP   VVAGID+N +DIA
Sbjct  3     QAYIALQAWRRVIYSDPNNFTTNWVGPDVCSYKGIYCATATDDPKIRVVAGIDLNFADIA  62

Query  927   GHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPS  748
             G LP E+GLL+DLALIH+NSNR+CGI+P++++NL LL+E+D SNN  VGPFP V+L LP 
Sbjct  63    GFLPNELGLLSDLALIHLNSNRLCGIIPQSLTNLSLLYELDVSNNRFVGPFPSVVLSLPM  122

Query  747   LKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGC  568
             L YLDLRYN FEG LPP LF K +D I +NNNR  S +P   G ++ASV+V+ANN F GC
Sbjct  123   LTYLDLRYNEFEGPLPPQLFQKKIDAIFINNNRFTSAVPAFLGGTSASVVVIANNNFKGC  182

Query  567   VPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSL  388
             +P SI  +  ++E++LL+N   +GCLP E+  L  + V DV  NK+VG +P  L  +  L
Sbjct  183   LPPSIANLADTLEELLLINTSLTGCLPPEVGYLYKLRVLDVSHNKIVGPIPYSLSGLAHL  242

Query  387   ESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSDNCVLE  211
             E  + A N+ +G VP G+C LPNL N +FS N+F  E+  C+ L   G+  DD  NC+ E
Sbjct  243   EQLNLAHNLMTGIVPQGVCILPNLANFTFSYNFFCEEEGICMNLTSKGIKYDDRRNCLPE  302

Query  210   RPGQKLPQKCYEYLSKPVDCSKTGCRAA  127
             +P Q+  ++C + L  PVDC +  C A+
Sbjct  303   KPLQRSQKECNDTLEHPVDCFQECCIAS  330



>ref|XP_006412962.1| hypothetical protein EUTSA_v10027136mg [Eutrema salsugineum]
 gb|ESQ54415.1| hypothetical protein EUTSA_v10027136mg [Eutrema salsugineum]
Length=391

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/332 (54%), Positives = 228/332 (69%), Gaps = 1/332 (0%)
 Frame = -3

Query  1122  NDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDIN  943
             N   ++AY AL+AWK  IYSDPK +T +WVGP+VCSY G+FC  +  DP   VVAGID+N
Sbjct  39    NQHLQQAYRALKAWKKVIYSDPKNLTGDWVGPSVCSYTGIFCAPSPSDPNTLVVAGIDLN  98

Query  942   HSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVI  763
             H DIAG LP  IGLL+ LALIH+NSNR CGI+P++++NL LL+E+D SNN LVGPFPDV+
Sbjct  99    HGDIAGFLPEPIGLLSHLALIHLNSNRFCGILPRSLANLSLLYELDLSNNRLVGPFPDVV  158

Query  762   LELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANN  583
             L LPSLKYLDLRYN FEG LPP LF   LD I +NNNRL S +P +F  +TASV+V ANN
Sbjct  159   LSLPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFSGTTASVVVFANN  218

Query  582   KFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLG  403
              FSGC+P +I R   ++E++LL+N+  SGCLP E+  L  + V D+  N L+G +P  L 
Sbjct  219   DFSGCLPPTISRFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLIGPVPYSLA  278

Query  402   YMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDSD  226
              +  LE  +   NMF+G +P G+C LP+L NL+ S NYF  E+  C  L   G+A DD  
Sbjct  279   GLGHLELLNLEHNMFTGTLPLGVCVLPSLLNLTISDNYFYEEEGICTNLTSRGIAFDDRY  338

Query  225   NCVLERPGQKLPQKCYEYLSKPVDCSKTGCRA  130
             NC+  +P Q+  + C   L  PVDC    C A
Sbjct  339   NCLPNKPLQRSQKVCEAVLDHPVDCHDHECSA  370



>ref|XP_002308630.2| hypothetical protein POPTR_0006s26190g [Populus trichocarpa]
 gb|EEE92153.2| hypothetical protein POPTR_0006s26190g [Populus trichocarpa]
Length=487

 Score =   373 bits (957),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 232/334 (69%), Gaps = 3/334 (1%)
 Frame = -3

Query  1134  LEFANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAG  955
             L+F N R + AY+ALQAWK AI SDP  +T NWVG +VC+Y GVFC  +LD+ +   VAG
Sbjct  6     LKFDNPRLRSAYIALQAWKLAIISDPLNLTSNWVGSDVCNYTGVFCATSLDNSSIQTVAG  65

Query  954   IDINHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPF  775
             ID+NH D+AGHL  E+GLLTD+AL H+NSNR CG VPK+   LKLL+E+D SNN   G F
Sbjct  66    IDLNHGDMAGHLVAELGLLTDIALFHVNSNRFCGKVPKSFKKLKLLYELDLSNNRFAGRF  125

Query  774   PDVILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIV  595
             P V+L+LP LKYLDLR+N FEG LP  LFDKDLD I +N+NR    LP+NFGNS  SVIV
Sbjct  126   PYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLDAIFINHNRFALELPDNFGNSPVSVIV  185

Query  594   LANNKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELP  415
             LANNKF GC P+S+  M +++ +++L+NN    CLP EI LL  +TVFD   NKL G LP
Sbjct  186   LANNKFHGCFPTSLVNMSKNLNEVILMNNGLRSCLPREIGLLKKVTVFDASNNKLFGSLP  245

Query  414   KGLGYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVD  235
               +G M+SLE  + A NM SG++P  +C LP+LKN S++ N+F  E  +CL L++    D
Sbjct  246   DNIGEMESLELLNVAHNMLSGNIPGSVCLLPHLKNFSYAYNFFTGEPPACLDLEN---FD  302

Query  234   DSDNCVLERPGQKLPQKCYEYLSKPVDCSKTGCR  133
             D  NC+  RP Q+   +C  +LS+PV C    C 
Sbjct  303   DGRNCLRNRPKQRSTLQCKVFLSRPVKCEAFKCH  336



>ref|XP_006414071.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
 gb|ESQ55524.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
Length=739

 Score =   380 bits (977),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/368 (52%), Positives = 245/368 (67%), Gaps = 7/368 (2%)
 Frame = -3

Query  1236  TDADAENIARRQLLHFAAEVDFSGEGFEHKLDLKLEFANDRQKKAYVALQAWKDAIYSDP  1057
             +D +   I +RQLL++  E  F   G    +D  L F N R + AY+ALQAWK AI SDP
Sbjct  44    SDKEVRLIRQRQLLYYRDE--FGDRGENVVVDPSLVFENPRLRNAYIALQAWKQAILSDP  101

Query  1056  KGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAGHLPTEIGLLTDLALIH  877
                T NW+G +VCSY GV+C  A D+     VAGID+NH+DIAG+LP E+GLLTDLAL H
Sbjct  102   NNFTTNWIGSDVCSYTGVYCAPAPDNRRIRTVAGIDLNHADIAGYLPQELGLLTDLALFH  161

Query  876   MNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSLKYLDLRYNNFEGALPP  697
             +NSNR CG VP   + LKLLFE+D SNN   G FP VIL+LPSLK+LDLR+N FEG +P 
Sbjct  162   VNSNRFCGTVPHRFNRLKLLFELDLSNNRFAGKFPAVILQLPSLKFLDLRFNEFEGPVPR  221

Query  696   SLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCVPSSIGRMEQSVEQILL  517
              LF KDLD I +N+NR    LP+N G+S  SVIV+ANN+F GC+P+S+G M +++E+I+ 
Sbjct  222   ELFSKDLDAIFINHNRFRFELPDNLGDSPVSVIVVANNQFHGCIPTSLGDM-RNLEEIIF  280

Query  516   LNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLESASFAGNMFSGHVPDG  337
             +NN F  CLP EI  L N+TVFD   N LVG LP  +G M S+E  + A N FSG +P  
Sbjct  281   MNNGFDSCLPSEIGRLKNVTVFDFSFNDLVGPLPASIGGMVSMEQLNVAHNRFSGKIPAS  340

Query  336   LCSLPNLKNLSFSGNYFEMEDESCLPLKDGVAVDDSDNCVLERPGQKLPQKCYEYLSK-P  160
             +C LP L+N +FS N+F  E   CL L      DD  NC+  RP Q+ P +C  +LS+ P
Sbjct  341   ICQLPKLENFTFSYNFFTGEPPVCLGL---AGFDDRRNCLPARPAQRSPGQCAAFLSRPP  397

Query  159   VDCSKTGC  136
             V+C+  GC
Sbjct  398   VNCASFGC  405



>gb|KFK29358.1| hypothetical protein AALP_AA7G123800 [Arabis alpina]
Length=394

 Score =   369 bits (948),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/326 (54%), Positives = 227/326 (70%), Gaps = 1/326 (0%)
 Frame = -3

Query  1104  AYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDINHSDIAG  925
             AY AL+AWK  IYSDPK +T +WVGP+VCSY G+FC  +L D    V+AGID+NH DIAG
Sbjct  48    AYRALKAWKKVIYSDPKNLTADWVGPSVCSYTGIFCAPSLSDANTLVIAGIDLNHGDIAG  107

Query  924   HLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDVILELPSL  745
              LP  +GLL+D+ALIH+NSNR CGI+P++++NL LL+E+D SNN  VGPFPDV+L LPSL
Sbjct  108   FLPEPLGLLSDVALIHLNSNRFCGILPRSLANLSLLYELDLSNNRFVGPFPDVVLSLPSL  167

Query  744   KYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLANNKFSGCV  565
             KYLDLRYN FEG LPP LF   LD I +NNNRL S +P +F  +TASV+V ANN FSGC+
Sbjct  168   KYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANNDFSGCL  227

Query  564   PSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGLGYMQSLE  385
             P +I R   ++E++LL+N+  SGCLP E+  L  + V D+  N LVG +P  L  +  LE
Sbjct  228   PPTIARFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPYSLAGLGHLE  287

Query  384   SASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCL-PLKDGVAVDDSDNCVLER  208
               +   NMF+G VP G+C LP+L NL+ S NYF  E+  C  P   G+A +D +NC+ ++
Sbjct  288   QMNLEHNMFTGTVPLGVCVLPSLLNLTISDNYFYEEEGICKNPTSRGIAFEDRNNCLPDK  347

Query  207   PGQKLPQKCYEYLSKPVDCSKTGCRA  130
             P Q+  + C   L  PVDC    C A
Sbjct  348   PLQRSQKACEAVLEHPVDCYDHECSA  373



>ref|XP_010035772.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
 gb|KCW47235.1| hypothetical protein EUGRSUZ_K01044 [Eucalyptus grandis]
Length=415

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/336 (52%), Positives = 232/336 (69%), Gaps = 1/336 (0%)
 Frame = -3

Query  1125  ANDRQKKAYVALQAWKDAIYSDPKGITKNWVGPNVCSYNGVFCDHALDDPTQWVVAGIDI  946
             +N R   AY+ALQAWK  IYSDP+  T NW G +VC+Y GVFC  ALDDP   VVAGID+
Sbjct  47    SNPRLYHAYIALQAWKRVIYSDPRNFTTNWSGLSVCNYTGVFCAKALDDPKIQVVAGIDL  106

Query  945   NHSDIAGHLPTEIGLLTDLALIHMNSNRICGIVPKTISNLKLLFEIDFSNNWLVGPFPDV  766
             NH+DIAG +P E+GLLTDLAL H+NSNR CG++P+++SNL LL+E+D SNN  VGPFP V
Sbjct  107   NHADIAGLIPEELGLLTDLALFHLNSNRFCGVLPQSLSNLALLYELDLSNNRFVGPFPSV  166

Query  765   ILELPSLKYLDLRYNNFEGALPPSLFDKDLDVILLNNNRLESNLPENFGNSTASVIVLAN  586
             +L +PSL YLD+RYN FEG+LPP LF K LD + LNNNRL + +P + G +++SV+VLAN
Sbjct  167   VLSMPSLHYLDIRYNEFEGSLPPELFKKSLDALFLNNNRLTNAIPASLGQTSSSVLVLAN  226

Query  585   NKFSGCVPSSIGRMEQSVEQILLLNNEFSGCLPEEITLLSNITVFDVQRNKLVGELPKGL  406
             N F GC+P SI     ++E++LL+N   SGCLP E+  L  + V DV  N + G +P  +
Sbjct  227   NNFGGCLPPSIADSADTLEELLLINISLSGCLPPEVGFLYKLRVLDVSLNHVEGPIPYSI  286

Query  405   GYMQSLESASFAGNMFSGHVPDGLCSLPNLKNLSFSGNYFEMEDESCLPLKD-GVAVDDS  229
               +  LE  +   NM +G VP G+C LP+L N +FS NYF  E+ +C+ L   G+A D+S
Sbjct  287   AGLAHLEQLNVGHNMMTGVVPSGVCILPSLANFTFSYNYFCEEEGTCMNLTSKGIAYDES  346

Query  228   DNCVLERPGQKLPQKCYEYLSKPVDCSKTGCRAATK  121
              NC+ E+P Q+  ++C   L  PVDC +  C A  +
Sbjct  347   HNCLPEKPFQRSEKECQAALEHPVDCFQHPCTAGFR  382



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3686926148997