BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c94119_g1_i1 len=105 path=[1:0-104]

Length=105
                                                                      Score     E

ref|WP_016898680.1|  ABC transporter ATP-binding protein              77.8    3e-15   
ref|WP_002453667.1|  ABC transporter ATP-binding protein              77.8    3e-15   
ref|WP_023349998.1|  putative ABC transporter (ATP-binding protein)   75.9    1e-14   
ref|WP_037551070.1|  ABC transporter ATP-binding protein              75.9    1e-14   
ref|WP_002436907.1|  ABC transporter ATP-binding protein              75.9    1e-14   
ref|WP_002445315.1|  ABC transporter ATP-binding protein              73.6    8e-14   
ref|WP_037551266.1|  ABC transporter ATP-binding protein              73.6    9e-14   
ref|WP_037538049.1|  ABC transporter ATP-binding protein              73.6    1e-13   
ref|WP_016931065.1|  MULTISPECIES: ABC transporter ATP-binding pr...  73.2    1e-13   
ref|WP_011275293.1|  ABC transporter ATP-binding protein              73.2    1e-13   
ref|WP_002452016.1|  ABC transporter ATP-binding protein              72.8    1e-13   
ref|WP_002466276.1|  ABC transporter ATP-binding protein              72.8    2e-13   
ref|WP_023373254.1|  ABC transporter ATP-binding protein              72.8    2e-13   
ref|WP_031891512.1|  ABC transporter ATP-binding protein              68.9    2e-13   
ref|WP_002490363.1|  ABC transporter ATP-binding protein              72.0    3e-13   
gb|EWC64685.1|  hypothetical protein W893_14740                       68.9    3e-13   
ref|WP_002475024.1|  ABC transporter ATP-binding protein              71.6    4e-13   
gb|EVZ50145.1|  hypothetical protein U377_01022                       68.9    5e-13   
ref|WP_002498145.1|  ABC transporter ATP-binding protein              71.2    6e-13   
ref|WP_002474166.1|  ABC transporter ATP-binding protein              71.2    6e-13   
gb|EZI13025.1|  ABC transporter, ATP-binding protein                  69.7    6e-13   
ref|WP_017464896.1|  ABC transporter ATP-binding protein              71.2    6e-13   
ref|WP_002457907.1|  ABC transporter ATP-binding protein              71.2    6e-13   
ref|WP_002477472.1|  hypothetical protein                             71.2    6e-13   
ref|WP_038398563.1|  ABC transporter ATP-binding protein              71.2    7e-13   
ref|WP_002468338.1|  ABC transporter ATP-binding protein              71.2    7e-13   
ref|WP_002501549.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_002499952.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_002487330.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_002447524.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_038812489.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_020360110.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_032606591.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_002503802.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_002497206.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_002494076.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_002491501.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_038399518.1|  ABC transporter ATP-binding protein              70.9    7e-13   
ref|WP_001830004.1|  ABC transporter ATP-binding protein              70.9    8e-13   
ref|WP_010959251.1|  ABC transporter ATP-binding protein              70.9    8e-13   
ref|WP_000318406.1|  hypothetical protein                             68.6    8e-13   
ref|WP_002470297.1|  ABC transporter ATP-binding protein              70.9    8e-13   
ref|WP_002440362.1|  ABC transporter ATP-binding protein              70.9    8e-13   
ref|WP_017175285.1|  MULTISPECIES: ABC transporter ATP-binding pr...  70.5    9e-13   
ref|WP_002455083.1|  ABC transporter ATP-binding protein              70.5    1e-12   
ref|WP_002448285.1|  ABC transporter ATP-binding protein              70.5    1e-12   
ref|WP_019835812.1|  ABC transporter ATP-binding protein              70.5    1e-12   
ref|WP_033860767.1|  ABC transporter ATP-binding protein              68.6    1e-12   
ref|WP_002492298.1|  ABC transporter ATP-binding protein              70.5    1e-12   
ref|WP_002477916.1|  ABC transporter ATP-binding protein              70.5    1e-12   
ref|WP_037544451.1|  ABC transporter ATP-binding protein              70.5    1e-12   
ref|WP_031893062.1|  ABC transporter ATP-binding protein              68.6    2e-12   
ref|WP_002461427.1|  ABC transporter ATP-binding protein              70.1    2e-12   
gb|ENN11977.1|  ABC transporter, ATP-binding protein                  68.6    2e-12   
emb|CDR54369.1|  ABC transporter ATP-binding protein                  70.1    2e-12   
ref|WP_031810969.1|  ABC transporter ATP-binding protein              68.9    2e-12   
emb|CDR29021.1|  ABC transporter ATP-binding protein                  70.1    2e-12   
ref|WP_031826493.1|  ABC transporter ATP-binding protein              68.6    2e-12   
ref|WP_002504805.1|  ABC transporter ATP-binding protein              69.7    2e-12   
emb|CDR61786.1|  ABC transporter ATP-binding protein                  69.7    2e-12   
gb|ETJ12471.1|  ABC transporter, ATP-binding protein                  69.7    2e-12   
ref|WP_002468991.1|  ABC transporter ATP-binding protein              69.7    2e-12   
ref|WP_031921197.1|  ABC transporter ATP-binding protein              68.9    2e-12   
ref|WP_031774945.1|  ABC transporter ATP-binding protein              68.9    2e-12   
emb|CDR24650.1|  ABC transporter ATP-binding protein                  69.3    2e-12   
emb|CDR64929.1|  ABC transporter ATP-binding protein                  69.3    2e-12   
gb|KEK68996.1|  ABC transporter family protein                        68.6    2e-12   
emb|CDR60036.1|  ABC transporter ATP-binding protein                  69.3    2e-12   
ref|WP_000602048.1|  ABC transporter ATP-binding protein              69.3    2e-12   
emb|CDR24649.1|  ABC transporter ATP-binding protein                  69.3    3e-12   
ref|WP_031787865.1|  ABC transporter ATP-binding protein              69.3    3e-12   
ref|WP_029056072.1|  ABC transporter ATP-binding protein              69.3    3e-12   
ref|WP_017638107.1|  ABC transporter ATP-binding protein              69.3    3e-12   
gb|ETO56811.1|  ABC transporter ATP-binding protein                   68.6    3e-12   
ref|WP_031895551.1|  ABC transporter ATP-binding protein              68.6    3e-12   
ref|WP_001011594.1|  ABC transporter ATP-binding protein              68.6    4e-12   
emb|CDR67401.1|  ABC transporter ATP-binding protein                  68.6    5e-12   
emb|CDR26379.1|  ABC transporter ATP-binding protein                  68.6    5e-12   
gb|EGL86004.1|  ABC transporter, ATP-binding protein                  68.6    5e-12   
emb|CDR51807.1|  ABC transporter ATP-binding protein                  68.6    5e-12   
ref|WP_031890890.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031775474.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031833635.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031924352.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_020978280.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602049.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031873740.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602067.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602071.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031775880.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031916430.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031921830.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031877706.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031784420.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031836416.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031911007.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602072.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602068.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602050.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602075.1|  ABC transporter ATP-binding protein              68.6    5e-12   
gb|EFM08088.1|  ABC transporter, ATP-binding protein                  68.6    5e-12   
ref|WP_031890270.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031810962.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602063.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602065.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602066.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602070.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031922825.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_033861301.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031890118.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031910067.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031907102.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031860867.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602058.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602055.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602069.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602078.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602047.1|  ABC transporter ATP-binding protein              68.6    5e-12   
gb|EFH25320.1|  ABC transporter, ATP-binding protein                  68.6    5e-12   
ref|WP_025788666.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602074.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031795288.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031895243.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031770580.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031923400.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031793169.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_001631918.1|  ABC transporter, ATP-binding protein             68.6    5e-12   
ref|WP_001618433.1|  ABC transporter, ATP-binding protein             68.6    5e-12   
ref|WP_031921509.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031811624.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031898453.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031923657.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031909254.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_033858637.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031910794.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031792782.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602056.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602062.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602064.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602077.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602076.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602057.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031893435.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602073.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_001789598.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031921191.1|  ABC transporter ATP-binding protein              68.6    5e-12   
emb|CEF82159.1|  Uncharacterized ABC transporter ATP-binding prot...  68.6    5e-12   
ref|WP_029550169.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602061.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_031911538.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602079.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602060.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_000602053.1|  ABC transporter ATP-binding protein              68.6    5e-12   
ref|WP_001573370.1|  ABC transporter, ATP-binding protein             68.6    5e-12   
ref|WP_001595398.1|  ABC transporter, ATP-binding protein             68.6    5e-12   
ref|WP_031826489.1|  ABC transporter ATP-binding protein              68.2    5e-12   
ref|WP_033844820.1|  ABC transporter ATP-binding protein              68.6    6e-12   
ref|WP_000602046.1|  ABC transporter ATP-binding protein              68.6    6e-12   
ref|WP_001825889.1|  ABC transporter ATP-binding protein              68.6    6e-12   
ref|WP_011302722.1|  ABC transporter ATP-binding protein              68.2    6e-12   
ref|WP_002482774.1|  ABC transporter ATP-binding protein              68.2    7e-12   
ref|WP_000602052.1|  ABC transporter ATP-binding protein              67.4    1e-11   
ref|WP_016425581.1|  hypothetical protein                             67.0    2e-11   
ref|WP_031807291.1|  ABC transporter ATP-binding protein              66.6    2e-11   
ref|WP_002471759.1|  ABC transporter ATP-binding protein              66.6    3e-11   
ref|WP_000602059.1|  ABC transporter ATP-binding protein              66.2    3e-11   
ref|WP_002464779.1|  ABC transporter ATP-binding protein              66.2    3e-11   
ref|WP_033857038.1|  ABC transporter ATP-binding protein              66.2    4e-11   
ref|WP_017723424.1|  ABC transporter ATP-binding protein              65.9    5e-11   
ref|WP_019167549.1|  ABC transporter ATP-binding protein              65.5    7e-11   
ref|WP_021339964.1|  ABC transporter ATP-binding protein              65.1    7e-11   
ref|WP_002511410.1|  ABC transporter ATP-binding protein              65.1    7e-11   
ref|WP_002507132.1|  ABC transporter ATP-binding protein              65.1    8e-11   
ref|WP_019166396.1|  ABC transporter ATP-binding protein              65.1    8e-11   
ref|WP_014613402.1|  ABC transporter ATP-binding protein              65.1    8e-11   
ref|WP_037542574.1|  ABC transporter ATP-binding protein              65.1    9e-11   
ref|WP_015729418.1|  ABC transporter ATP-binding protein              65.1    9e-11   
ref|WP_039069573.1|  ABC transporter ATP-binding protein              63.2    3e-10   
ref|WP_019469548.1|  ABC transporter ATP-binding protein              62.8    5e-10   
gb|AID42292.1|  ABC transporter ATP-binding protein uup               61.6    1e-09   
emb|CEF18301.1|  ABC transporter ATP-binding protein                  61.6    1e-09   
ref|WP_029378917.1|  ABC transporter ATP-binding protein              61.6    1e-09   
ref|WP_002509108.1|  ABC transporter ATP-binding protein              60.8    3e-09   
ref|WP_015900799.1|  ABC transporter ATP-binding protein              60.8    3e-09   
ref|WP_021459246.1|  ABC transporter ATP-binding protein              60.8    3e-09   
ref|WP_002481728.1|  hypothetical protein                             58.9    1e-08   
ref|WP_018366120.1|  multidrug ABC transporter ATP-binding protein    58.5    1e-08   
ref|WP_015912221.1|  ABC transporter ATP-binding protein              58.2    2e-08   
ref|WP_010781254.1|  ABC transporter ATP-binding protein              58.2    2e-08   
ref|WP_016911757.1|  hypothetical protein                             57.8    3e-08   
ref|WP_003102737.1|  multidrug ABC transporter ATP-binding protein    57.8    3e-08   
ref|WP_003107120.1|  ABC transporter ATP-binding protein              57.4    4e-08   
ref|WP_013794068.1|  multidrug ABC transporter ATP-binding protein    57.4    4e-08   
ref|WP_003108273.1|  ABC transporter ATP-binding protein              57.4    4e-08   
ref|WP_026161864.1|  multidrug ABC transporter ATP-binding protein    57.0    5e-08   
gb|EUJ41778.1|  putative ABC transporter                              54.7    6e-08   
ref|WP_016181962.1|  ABC transporter ATP-binding protein              56.2    9e-08   
ref|WP_010744454.1|  ABC transporter ATP-binding protein              56.2    9e-08   
ref|WP_037575659.1|  ABC transporter ATP-binding protein              56.2    9e-08   
ref|WP_028274238.1|  multidrug ABC transporter ATP-binding protein    56.2    1e-07   
ref|WP_004633385.1|  ABC transporter ATP-binding protein              56.2    1e-07   
ref|WP_010739686.1|  ABC transporter ATP-binding protein              56.2    1e-07   
ref|WP_003099245.1|  multidrug ABC transporter ATP-binding protein    55.8    1e-07   
ref|WP_018379778.1|  multidrug ABC transporter ATP-binding protein    55.8    1e-07   
ref|WP_016177053.1|  ABC transporter ATP-binding protein              55.8    2e-07   
ref|WP_005878083.1|  ABC transporter ATP-binding protein              55.8    2e-07   
ref|WP_010755860.1|  ABC transporter ATP-binding protein              55.5    2e-07   
ref|WP_028984078.1|  multidrug ABC transporter ATP-binding protein    55.5    2e-07   
ref|WP_028977642.1|  multidrug ABC transporter ATP-binding protein    55.5    2e-07   
ref|WP_010025038.1|  multidrug ABC transporter ATP-binding protein    55.1    2e-07   
ref|WP_004231185.1|  multidrug ABC transporter ATP-binding protein    55.1    2e-07   
ref|WP_035030050.1|  multidrug ABC transporter ATP-binding protein    55.1    2e-07   
gb|ESU75081.1|  ABC transporter ATP-binding protein                   54.7    3e-07   
gb|KFN90629.1|  ATP-binding component of an ABC superfamily trans...  51.6    3e-07   
ref|WP_017001153.1|  hypothetical protein                             55.1    3e-07   
ref|WP_033152327.1|  multidrug ABC transporter ATP-binding protein    55.1    3e-07   
ref|WP_039690940.1|  multidrug ABC transporter ATP-binding protein    55.1    3e-07   
ref|WP_027968212.1|  multidrug ABC transporter ATP-binding protein    55.1    3e-07   
ref|WP_006532445.1|  multidrug ABC transporter ATP-binding protein    55.1    3e-07   
ref|WP_003088737.1|  multidrug ABC transporter ATP-binding protein    55.1    3e-07   
ref|WP_039697109.1|  multidrug ABC transporter ATP-binding protein    55.1    3e-07   
ref|WP_024344673.1|  multidrug ABC transporter ATP-binding protein    55.1    3e-07   
ref|WP_021142065.1|  ABC transporter ATP-binding protein              55.1    3e-07   
ref|WP_003096911.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_003092731.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_033592812.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002374213.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_034643373.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_010783196.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_010821052.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_010713167.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_002410270.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002381483.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002379727.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_033598506.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_033600532.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_016616094.1|  ABC transporter, ATP-binding protein             54.7    3e-07   
ref|WP_010717109.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_010712730.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_002397084.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002384138.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002367169.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
gb|EET95449.1|  ABC transporter                                       54.7    3e-07   Enterococcus faecalis T1
ref|WP_033918770.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_016629928.1|  MULTISPECIES: ABC transporter, ATP-binding p...  54.7    3e-07   
ref|WP_010716226.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_002399494.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002365037.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_010816692.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_010826627.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_010776041.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_002395501.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002392797.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002376569.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002389813.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_016625999.1|  ABC transporter, ATP-binding protein             54.7    3e-07   
ref|WP_010827661.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_010817560.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_010777871.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_002413448.1|  ABC superfamily ATP binding cassette transpo...  54.7    3e-07   
ref|WP_002409486.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002394106.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002401883.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002380661.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002368879.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_002362558.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
gb|EET98505.1|  ABC transporter                                       54.7    3e-07   Enterococcus faecalis T2
ref|WP_016634831.1|  ABC transporter, ATP-binding protein             54.7    3e-07   
ref|WP_002404856.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_021149325.1|  ABC transporter ATP-binding protein uup          54.7    3e-07   
ref|WP_005471765.1|  MULTISPECIES: multidrug ABC transporter ATP-...  54.7    3e-07   
ref|WP_027976679.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_010821774.1|  MULTISPECIES: ABC transporter ATP-binding pr...  54.7    3e-07   
ref|WP_010823097.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_023077418.1|  ABC transporter, ATP-binding protein             53.9    3e-07   
gb|ETJ03871.1|  ABC superfamily ATP binding cassette transporter,...  52.0    3e-07   
ref|WP_003127491.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_039043681.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_014334540.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_007504458.1|  multidrug ABC transporter ATP-binding protein    54.7    3e-07   
ref|WP_020916535.1|  ABC transporter ATP-binding protein              54.7    3e-07   
ref|WP_023609666.1|  ABC transporter, ATP-binding protein             53.9    4e-07   
ref|WP_025782794.1|  multidrug ABC transporter ATP-binding protein    54.7    4e-07   
gb|EZN32801.1|  ABC transporter ATP-binding protein                   53.9    4e-07   
ref|WP_015017104.1|  multidrug ABC transporter ATP-binding protein    54.7    4e-07   
ref|WP_013658009.1|  ABC transporter                                  54.3    4e-07   
ref|WP_003056216.1|  multidrug ABC transporter ATP-binding protein    54.3    4e-07   
ref|WP_008088880.1|  multidrug ABC transporter ATP-binding protein    54.3    4e-07   
ref|WP_006908337.1|  multidrug ABC transporter ATP-binding protein    54.3    4e-07   
ref|WP_016174487.1|  ABC transporter ATP-binding protein              54.3    5e-07   
ref|WP_014612345.1|  multidrug ABC transporter ATP-binding protein    54.3    5e-07   
ref|WP_003051187.1|  multidrug ABC transporter ATP-binding protein    54.3    5e-07   
ref|WP_005234229.1|  multidrug ABC transporter ATP-binding protein    54.3    5e-07   
ref|WP_016182267.1|  ABC transporter ATP-binding protein              54.3    5e-07   
ref|WP_027130070.1|  ABC transporter ATP-binding protein              54.3    5e-07   
gb|KFN90271.1|  ATP-binding component of an ABC superfamily trans...  51.2    5e-07   
ref|WP_016608823.1|  ABC transporter, ATP-binding protein             54.3    5e-07   
ref|WP_010749852.1|  ABC transporter ATP-binding protein              54.3    5e-07   
ref|WP_006596918.1|  multidrug ABC transporter ATP-binding protein    54.3    5e-07   
ref|WP_016612686.1|  ABC transporter, ATP-binding protein             54.3    5e-07   
ref|WP_006596614.1|  multidrug ABC transporter ATP-binding protein    54.3    5e-07   
ref|WP_038538779.1|  multidrug ABC transporter ATP-binding protein    54.3    5e-07   
ref|WP_008380786.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
gb|EOT93577.1|  ABC transporter ATP-binding protein                   53.9    6e-07   
ref|WP_032463750.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_016619815.1|  putative ATP synthase F1, epsilon subunit        53.9    6e-07   
ref|WP_005228548.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_003134717.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_015510226.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_011284734.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_011054404.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_002411885.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_032462944.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_012767118.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_034767848.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_010922237.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_003139666.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
emb|CEF52236.1|  putative ABC transporter ATP-binding protein YheS    53.9    6e-07   
ref|WP_019292718.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_002946467.1|  ABC transporter ATP-binding protein              53.5    6e-07   
ref|WP_032461041.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_023611138.1|  ABC transporter, ATP-binding protein             53.9    6e-07   
ref|WP_014635426.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_002984869.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_032460147.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_032464973.1|  multidrug ABC transporter ATP-binding protein    53.9    6e-07   
ref|WP_030127491.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_030125973.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_023079227.1|  ABC transporter, ATP-binding protein             53.9    7e-07   
ref|WP_002991985.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_002989985.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_002388392.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_003147864.1|  ABC transporter ATP-binding protein              53.9    7e-07   
ref|WP_039238091.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_038433464.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_038434054.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_038431301.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_012560665.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_011184455.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_011017710.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_023609858.1|  ABC transporter, ATP-binding protein             53.9    7e-07   
ref|WP_021340477.1|  ABC transporter, ATP-binding protein             53.9    7e-07   
ref|WP_020833438.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_011888920.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_014407529.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_023613165.1|  ABC transporter, ATP-binding protein             53.9    7e-07   
gb|KIF98777.1|  ABC transporter ATP-binding protein uup               53.9    7e-07   
gb|KIF98759.1|  ABC transporter ATP-binding protein uup               53.9    7e-07   
ref|WP_004257582.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_014024695.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_010753065.1|  ABC transporter ATP-binding protein              53.9    7e-07   
ref|WP_017369283.1|  multidrug ABC transporter ATP-binding protein    53.9    7e-07   
ref|WP_023080004.1|  ABC transporter, ATP-binding protein             53.5    8e-07   
ref|WP_008300603.1|  putative ABC transporter ATP-binding protein...  53.5    8e-07   
ref|WP_019335863.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_029092377.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_034698765.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_003144743.1|  ABC transporter                                  52.0    8e-07   
ref|WP_019293485.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_034866355.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_010719829.1|  ABC transporter ATP-binding protein              53.5    8e-07   
ref|WP_004636938.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_034654816.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_013081430.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_016762763.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_010751539.1|  ABC transporter ATP-binding protein              53.5    8e-07   
ref|WP_024704256.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
gb|ETE40909.1|  multidrug ABC transporter ATP-binding protein         53.5    8e-07   
ref|WP_033580896.1|  MULTISPECIES: multidrug ABC transporter ATP-...  53.5    8e-07   
ref|WP_004182707.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_013990775.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_017769292.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_013055020.1|  MULTISPECIES: multidrug ABC transporter ATP-...  53.5    8e-07   
ref|WP_014461960.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_010738279.1|  multidrug ABC transporter ATP-binding protein    53.5    8e-07   
ref|WP_019792918.1|  hypothetical protein                             53.1    9e-07   
ref|WP_028412698.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_022554814.1|  ABC transporter ATP-binding protein              53.5    9e-07   
ref|WP_025753307.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_028410377.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_007893074.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_002951089.1|  ABC transporter ATP binding protein              53.5    9e-07   
ref|WP_002890689.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_014294359.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_014621724.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_014608440.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_037600964.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_011226162.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
gb|EWM58465.1|  multidrug ABC transporter ATP-binding protein         53.5    9e-07   
gb|ETW89014.1|  multidrug ABC transporter ATP-binding protein         53.5    9e-07   
ref|WP_014633287.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_038675747.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
gb|ETW89944.1|  multidrug ABC transporter ATP-binding protein         53.5    9e-07   
ref|WP_014634266.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
gb|EWM56171.1|  multidrug ABC transporter ATP-binding protein         53.5    9e-07   
ref|WP_011681294.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_002884075.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_002888890.1|  multidrug ABC transporter ATP-binding protein    53.5    9e-07   
ref|WP_021144355.1|  MULTISPECIES: ABC transporter ATP-binding pr...  53.5    1e-06   
ref|WP_024635854.1|  multidrug ABC transporter ATP-binding protein    53.5    1e-06   
ref|WP_039693133.1|  multidrug ABC transporter ATP-binding protein    53.5    1e-06   
ref|WP_017150415.1|  multidrug ABC transporter ATP-binding protein    53.5    1e-06   
ref|WP_018363463.1|  multidrug ABC transporter ATP-binding protein    53.5    1e-06   
ref|WP_039807377.1|  multidrug ABC transporter ATP-binding protein    53.5    1e-06   
ref|WP_019778652.1|  hypothetical protein                             53.1    1e-06   
ref|WP_014620027.1|  multidrug ABC transporter ATP-binding protein    53.5    1e-06   
ref|WP_034300461.1|  multidrug ABC transporter ATP-binding protein    53.5    1e-06   
ref|WP_002312181.1|  multidrug ABC transporter ATP-binding protein    53.5    1e-06   
ref|WP_002346095.1|  ABC transporter ATP-binding protein              53.5    1e-06   
ref|WP_002338516.1|  ABC transporter ATP-binding protein              53.5    1e-06   
ref|WP_022096723.1|  aBC transporter drug resistance ATPase-1 (Dr...  53.1    1e-06   
ref|WP_029485851.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002290874.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002334889.1|  ABC transporter ATP-binding protein              53.1    1e-06   
ref|WP_002333769.1|  ABC transporter ATP-binding protein              53.1    1e-06   
ref|WP_002345292.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002308435.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002304011.1|  putative ABC transporter, ATP-binding protein    53.1    1e-06   
ref|WP_024635592.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002320241.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002295038.1|  MULTISPECIES: multidrug ABC transporter ATP-...  53.1    1e-06   
ref|WP_002314624.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
gb|EOH57184.1|  ABC transporter ATP-binding protein                   53.1    1e-06   
ref|WP_002336010.1|  ABC transporter ATP-binding protein              53.1    1e-06   
ref|WP_033656900.1|  ABC transporter ATP-binding protein              51.6    1e-06   
ref|WP_010098017.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002317924.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_010727482.1|  ABC transporter ATP-binding protein              53.1    1e-06   
ref|WP_002323592.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_003043875.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002300760.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002326311.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002306128.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002271993.1|  putative ABC transporter ATP-binding protein     53.1    1e-06   
ref|WP_039670662.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_012961806.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_013642978.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_009853975.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_003064305.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002302987.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_011065057.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_033705646.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_010731172.1|  ABC transporter ATP-binding protein              53.1    1e-06   
ref|WP_010728839.1|  ABC transporter ATP-binding protein              53.1    1e-06   
ref|WP_002339029.1|  ABC transporter ATP-binding protein              53.1    1e-06   
ref|WP_002332574.1|  ABC transporter ATP-binding protein              53.1    1e-06   
ref|WP_034537269.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_013851685.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_004227713.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002311250.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002287747.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019785727.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_020063197.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_023178772.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_018376589.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_032797229.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_021145609.1|  MULTISPECIES: ABC transporter ATP-binding pr...  53.1    1e-06   
ref|WP_022495746.1|  MULTISPECIES: aBC transporter ATP binding pr...  53.1    1e-06   
ref|WP_008534309.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019781178.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019785003.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019788942.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019779809.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019774177.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019786086.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002268930.1|  putative ABC transporter, ATP-binding protein    53.1    1e-06   
ref|WP_002288440.1|  putative ABC transporter, ATP-binding protein    53.1    1e-06   
ref|WP_019771623.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_024781524.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002266192.1|  putative ABC transporter ATP-binding protein     53.1    1e-06   
ref|WP_019780361.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019776686.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019775098.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019769569.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_024786063.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019315956.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019315382.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019314805.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019313664.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002267734.1|  putative ABC transporter, ATP-binding protein    53.1    1e-06   
ref|WP_002284313.1|  putative ABC transporter, ATP-binding protein    53.1    1e-06   
ref|WP_002280698.1|  putative ABC transporter, ATP-binding protein    53.1    1e-06   
ref|WP_014677899.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_024786442.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019318888.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_019317916.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002312954.1|  ABC transporter ATP-binding protein              53.1    1e-06   
ref|WP_002264605.1|  putative ABC transporter, ATP-binding protein    53.1    1e-06   
ref|WP_002283088.1|  putative ABC transporter ATP-binding protein     53.1    1e-06   
ref|WP_019802765.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002299429.1|  putative ABC transporter, ATP-binding protein    53.1    1e-06   
gb|AIA67417.1|  multidrug ABC transporter ATP-binding protein         53.1    1e-06   
ref|WP_012679726.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_024781904.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_018368674.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_002270400.1|  putative ABC transporter, ATP-binding protein    53.1    1e-06   
ref|WP_002269434.1|  putative ABC transporter ATP-binding protein     53.1    1e-06   
ref|WP_002290964.1|  putative ABC transporter, ATP-binding protein    53.1    1e-06   
ref|WP_019804837.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   
ref|WP_024782454.1|  multidrug ABC transporter ATP-binding protein    53.1    1e-06   



>ref|WP_016898680.1| ABC transporter ATP-binding protein [Staphylococcus capitis]
Length=645

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  533



>ref|WP_002453667.1| ABC transporter ATP-binding protein [Staphylococcus capitis]
 gb|EFS16990.1| ABC transporter, ATP-binding protein [Staphylococcus capitis 
C87]
Length=645

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  533



>ref|WP_023349998.1| putative ABC transporter (ATP-binding protein) [Staphylococcus 
capitis]
 emb|CDI71236.1| putative ABC transporter (ATP-binding protein) [Staphylococcus 
capitis CR01]
Length=645

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLNHEGGQ+YLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNHEGGQIYLGDYQYYIE  533



>ref|WP_037551070.1| ABC transporter ATP-binding protein [Staphylococcus sp. TE8]
 gb|KDE94533.1| ABC transporter ATP-binding protein [Staphylococcus sp. TE8]
Length=645

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLNHEGGQ+YLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNHEGGQIYLGDYQYYIE  533



>ref|WP_002436907.1| ABC transporter ATP-binding protein [Staphylococcus capitis]
 gb|EEE48266.1| ABC transporter, ATP-binding protein [Staphylococcus capitis 
SK14]
 gb|EGS41203.1| ABC transporter, ATP-binding protein [Staphylococcus capitis 
VCU116]
Length=645

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLNHEGGQ+YLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNHEGGQIYLGDYQYYIE  533



>ref|WP_002445315.1| ABC transporter ATP-binding protein [Staphylococcus caprae]
 gb|EES42178.1| ABC transporter, ATP-binding protein [Staphylococcus caprae M23864:W1]
Length=643

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN++GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNYQGGQMYLGDYQYYIE  533



>ref|WP_037551266.1| ABC transporter ATP-binding protein [Staphylococcus haemolyticus]
 gb|KGF27040.1| ABC transporter ATP-binding protein [Staphylococcus haemolyticus 
DNF00585]
Length=647

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN++GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNNDGGQMYLGDYQYYIE  533



>ref|WP_037538049.1| ABC transporter ATP-binding protein [Staphylococcus haemolyticus]
 gb|KGJ27251.1| ABC transporter ATP-binding protein [Staphylococcus haemolyticus]
 gb|KGJ27954.1| ABC transporter ATP-binding protein [Staphylococcus haemolyticus]
Length=647

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN++GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNNDGGQMYLGDYQYYIE  533



>ref|WP_016931065.1| MULTISPECIES: ABC transporter ATP-binding protein [Staphylococcus]
 gb|KDP56004.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CO-98]
Length=647

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN++GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNYDGGQMYLGDYQYYIE  533



>ref|WP_011275293.1| ABC transporter ATP-binding protein [Staphylococcus haemolyticus]
 ref|YP_252900.1| hypothetical protein SH0985 [Staphylococcus haemolyticus JCSC1435]
 dbj|BAE04294.1| vga [Staphylococcus haemolyticus JCSC1435]
 gb|EZI36492.1| vga protein [Staphylococcus haemolyticus]
Length=647

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN++GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNYDGGQMYLGDYQYYIE  533



>ref|WP_002452016.1| ABC transporter ATP-binding protein [Staphylococcus warneri]
 gb|EEQ79162.1| ABC transporter, ATP-binding protein [Staphylococcus warneri 
L37603]
Length=644

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL+H+GG+MYLGDYQYYIE
Sbjct  500  VSHDRYFINQLANKVFDLDHDGGKMYLGDYQYYIE  534



>ref|WP_002466276.1| ABC transporter ATP-binding protein [Staphylococcus warneri]
 ref|YP_007384603.1| ABC transporter ATP-binding protein [Staphylococcus warneri SG1]
 gb|EGG97096.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU121]
 gb|AGC90159.1| ABC transporter ATP-binding protein [Staphylococcus warneri SG1]
 gb|KEK48621.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus warneri 
Lyso 1 2011]
 gb|KEK54942.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus warneri 
Lyso 2 2011]
Length=644

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL+H+GG+MYLGDYQYYIE
Sbjct  500  VSHDRYFINQLANKVFDLDHDGGKMYLGDYQYYIE  534



>ref|WP_023373254.1| ABC transporter ATP-binding protein [Staphylococcus pasteuri]
 ref|YP_008759013.1| ABC transporter ATP-binding protein [Staphylococcus pasteuri 
SP1]
 gb|AGZ24801.1| ABC transporter ATP-binding protein [Staphylococcus pasteuri 
SP1]
Length=644

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL+H+GG+MYLGDYQYYIE
Sbjct  500  VSHDRYFINQLANKVFDLDHDGGKMYLGDYQYYIE  534



>ref|WP_031891512.1| ABC transporter ATP-binding protein, partial [Staphylococcus 
aureus]
 gb|EVQ17056.1| hypothetical protein P530_02423, partial [Staphylococcus aureus 
M1383]
Length=145

 Score = 68.9 bits (167),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  2    VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  36



>ref|WP_002490363.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EHR98414.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU128]
Length=644

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNRNGGQMYLGDYQYYIE  533



>gb|EWC64685.1| hypothetical protein W893_14740, partial [Staphylococcus aureus 
subsp. aureus ST 1413]
Length=190

 Score = 68.9 bits (167),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  47   VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  81



>ref|WP_002475024.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EHM73874.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
14.1.R1.SE]
Length=644

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNPNGGQMYLGDYQYYIE  533



>gb|EVZ50145.1| hypothetical protein U377_01022 [Staphylococcus aureus F32119]
 gb|EWW72006.1| hypothetical protein V297_01264 [Staphylococcus aureus W70568]
Length=222

 Score = 68.9 bits (167),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  79   VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  113



>ref|WP_002498145.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EJE01083.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM040]
Length=644

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_002474166.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EHM67216.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU071]
Length=644

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>gb|EZI13025.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU050]
Length=342

 Score = 69.7 bits (169),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQM+LGDYQYYIE
Sbjct  197  VSHDRYFINQLANKVFDLNINGGQMFLGDYQYYIE  231



>ref|WP_017464896.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
Length=644

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_002457907.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EFV88931.1| ABC transporter family protein [Staphylococcus epidermidis FRI909]
Length=644

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNLNGGQMYLGDYQYYIE  533



>ref|WP_002477472.1| hypothetical protein [Staphylococcus epidermidis]
 gb|EKS31522.1| hypothetical protein HMPREF9281_01777 [Staphylococcus epidermidis 
BVS058A4]
Length=644

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_038398563.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|AIR83163.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus epidermidis]
Length=644

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_002468338.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EGG62458.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU144]
Length=644

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_002501549.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EJE12203.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM031]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNLNGGQMYLGDYQYYIE  533



>ref|WP_002499952.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EJE04871.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM023]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNLNGGQMYLGDYQYYIE  533



>ref|WP_002487330.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EHR81575.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU118]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNLNGGQMYLGDYQYYIE  533



>ref|WP_002447524.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EES37043.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
W23144]
 gb|EJD90675.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM061]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNLNGGQMYLGDYQYYIE  533



>ref|WP_038812489.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|KEI47913.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
UC7032]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNLNGGQMYLGDYQYYIE  533



>ref|WP_020360110.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EPP69921.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
Scl22]
 gb|ESR05438.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
CIM28]
 gb|ESR21880.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
APO35]
 gb|ESU02706.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
CIM37]
 gb|ESV11177.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
MC28]
 gb|ESV14909.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
WI05]
 gb|ESV20056.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
WI09]
 gb|ESV24251.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
CIM40]
 gb|ESV30142.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
APO27]
 gb|ESV39114.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
MC16]
 gb|ESV42577.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
MC19]
 gb|ESV47004.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
Scl19]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNLNGGQMYLGDYQYYIE  533



>ref|WP_032606591.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|KEA34049.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_002503802.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EJE21465.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM001]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_002497206.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EJD90853.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM057]
 gb|EJD91716.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM053]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNLNGGQMYLGDYQYYIE  533



>ref|WP_002494076.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EJD77757.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM095]
 gb|EJD77883.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM087]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_002491501.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EHS00779.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU129]
 gb|EJE03247.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM037]
 gb|EJE16290.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM015]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNLNGGQMYLGDYQYYIE  533



>ref|WP_038399518.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 emb|CDM14201.1| Hypothetical ABC transporter ATP-binding protein vga [Staphylococcus 
epidermidis PM221]
Length=644

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_001830004.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 ref|NP_765203.1| vga protein [Staphylococcus epidermidis ATCC 12228]
 gb|AAO05247.1|AE016749_193 vga protein [Staphylococcus epidermidis ATCC 12228]
 gb|EFE58461.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
M23864:W2(grey)]
 gb|EGG73143.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU045]
 gb|EGS80157.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU037]
 gb|EHQ77623.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU057]
 gb|EHR79904.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU117]
 gb|EHR82550.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU120]
 gb|EHR94964.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU126]
 gb|EHR95221.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU127]
 gb|EID37132.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
IS-250]
 gb|EID40622.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
IS-K]
 gb|EJD83794.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM070]
 gb|EJE07241.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM021]
 gb|EJE09130.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM020]
 gb|EJE13868.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM018]
 gb|EJE19079.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM008]
 gb|EJE22118.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM003]
 gb|EJE26907.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIH05005]
 gb|EJE31286.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIH08001]
 gb|EJE34768.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIH05001]
 gb|EJE36480.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIH06004]
 gb|EJE38365.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIH05003]
 gb|EJE39678.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIH04003]
 gb|EJE45384.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIH051475]
 gb|EKC81996.1| vga protein [Staphylococcus epidermidis AU12-03]
 gb|ENL48968.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
M0881]
 gb|EPZ43609.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
E13A]
 gb|EST93737.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
Scl31]
 gb|ESU00082.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
Scl25]
 gb|EUR97394.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
M0026]
 gb|EZI06666.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU014]
 gb|KDP67484.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU013]
 gb|KDP67968.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU111]
 gb|KEA36442.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
Length=644

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_010959251.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 ref|YP_189223.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis 
RP62A]
 gb|AAW54986.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
RP62A]
 gb|KGY36905.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
Length=644

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_000318406.1| hypothetical protein, partial [Staphylococcus aureus]
 gb|EHS80381.1| ABC transporter, ATP-binding protein, partial [Staphylococcus 
aureus subsp. aureus IS-160]
Length=271

 Score = 68.6 bits (166),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  128  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  162



>ref|WP_002470297.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EGS78139.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU105]
 gb|EHR92444.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU123]
 gb|EJD85733.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM067]
 gb|EJE02447.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM039]
 gb|KDP67066.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU036]
 gb|KEA32436.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
Length=644

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_002440362.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EES59272.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
BCM-HMP0060]
 gb|EFA89147.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
SK135]
 gb|EGS80796.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU109]
Length=644

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQMYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIE  533



>ref|WP_017175285.1| MULTISPECIES: ABC transporter ATP-binding protein [Staphylococcus]
 gb|EUZ67908.1| ABC transporter, ATP-binding protein [Staphylococcus sp. M0480]
Length=645

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN +GGQ+YLGDYQY+IE
Sbjct  499  VSHDRYFINQLANKVFDLNKDGGQLYLGDYQYFIE  533



>ref|WP_002455083.1| ABC transporter ATP-binding protein [Staphylococcus hominis]
 gb|EFS19556.1| ABC transporter, ATP-binding protein [Staphylococcus hominis 
subsp. hominis C80]
Length=645

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN +GGQ+YLGDYQY+IE
Sbjct  499  VSHDRYFINQLANKVFDLNKDGGQLYLGDYQYFIE  533



>ref|WP_002448285.1| ABC transporter ATP-binding protein [Staphylococcus hominis]
 gb|EEK12931.1| ABC transporter, ATP-binding protein [Staphylococcus hominis 
SK119]
 gb|EHR90530.1| ABC transporter, ATP-binding protein [Staphylococcus hominis 
VCU122]
Length=645

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN +GGQ+YLGDYQY+IE
Sbjct  499  VSHDRYFINQLANKVFDLNKDGGQLYLGDYQYFIE  533



>ref|WP_019835812.1| ABC transporter ATP-binding protein [Staphylococcus sp. MDS7B]
Length=645

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN +GGQ+YLGDYQY+IE
Sbjct  499  VSHDRYFINQLANKVFDLNKDGGQLYLGDYQYFIE  533



>ref|WP_033860767.1| ABC transporter ATP-binding protein, partial [Staphylococcus 
aureus]
Length=297

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  154  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  188



>ref|WP_002492298.1| ABC transporter ATP-binding protein [Staphylococcus lugdunensis]
 gb|EHS04725.1| ABC transporter, ATP-binding protein [Staphylococcus lugdunensis 
VCU139]
 gb|EVI48252.1| ABC transporter, ATP-binding protein [Staphylococcus lugdunensis 
UCIM6116]
 gb|KAK62065.1| ABC transporter, ATP-binding protein [Staphylococcus lugdunensis 
VCU148]
Length=647

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLNH+GG++YLG+YQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNHDGGKIYLGNYQYYIE  533



>ref|WP_002477916.1| ABC transporter ATP-binding protein [Staphylococcus lugdunensis]
 ref|YP_003471234.1| ABC transporter ATP-binding protein [Staphylococcus lugdunensis 
HKU09-01]
 ref|YP_005760132.1| ABC transporter ATP-binding protein [Staphylococcus lugdunensis 
N920143]
 gb|ADC87107.1| Hypothetical ABC transporter ATP-binding protein vga [Staphylococcus 
lugdunensis HKU09-01]
 emb|CCB53481.1| ABC transporter ATP-binding protein [Staphylococcus lugdunensis 
N920143]
 gb|EKS25876.1| hypothetical protein HMPREF9308_00017 [Staphylococcus lugdunensis 
ACS-027-V-Sch2]
Length=647

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLNH+GG++YLG+YQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNHDGGKIYLGNYQYYIE  533



>ref|WP_037544451.1| ABC transporter ATP-binding protein [Staphylococcus lugdunensis]
 gb|KAK57643.1| ABC transporter, ATP-binding protein [Staphylococcus lugdunensis 
VCU150]
Length=647

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLNH+GG++YLG+YQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNHDGGKIYLGNYQYYIE  533



>ref|WP_031893062.1| ABC transporter ATP-binding protein, partial [Staphylococcus 
aureus]
 gb|EVQ76167.1| ABC transporter, ATP-binding protein, partial [Staphylococcus 
aureus M1415]
Length=322

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  179  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  213



>ref|WP_002461427.1| ABC transporter ATP-binding protein [Staphylococcus lugdunensis]
 gb|EFU83113.1| putative ATP synthase F1, epsilon subunit [Staphylococcus lugdunensis 
M23590]
Length=647

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            +SHDRYFINQLANKVFDLNH+GG++YLG+YQYYIE
Sbjct  499  ISHDRYFINQLANKVFDLNHDGGKIYLGNYQYYIE  533



>gb|ENN11977.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1463]
Length=332

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  197  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  231



>emb|CDR54369.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTQDGGKMYLGDYQYYIE  533



>ref|WP_031810969.1| ABC transporter ATP-binding protein, partial [Staphylococcus 
aureus]
 gb|EUY94163.1| ABC transporter, ATP-binding protein, partial [Staphylococcus 
aureus M0435]
Length=369

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  226  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  260



>emb|CDR29021.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTQDGGKMYLGDYQYYIE  533



>ref|WP_031826493.1| ABC transporter ATP-binding protein, partial [Staphylococcus 
aureus]
 gb|EUS11188.1| ABC transporter, ATP-binding protein, partial [Staphylococcus 
aureus M0036]
Length=334

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  191  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  225



>ref|WP_002504805.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EJE30293.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIH04008]
Length=644

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQM+LGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMFLGDYQYYIE  533



>emb|CDR61786.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTQDGGKMYLGDYQYYIE  533



>gb|ETJ12471.1| ABC transporter, ATP-binding protein [Staphylococcus sp. DORA_6_22]
Length=644

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQM+LGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMFLGDYQYYIE  533



>ref|WP_002468991.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
 gb|EGG71731.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU028]
 gb|EHQ72683.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU041]
 gb|EHQ80479.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU065]
 gb|EHQ81563.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU081]
 gb|EHR89167.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
VCU125]
 gb|EJD95788.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis 
NIHLM049]
 gb|EON79948.1| vga protein [Staphylococcus epidermidis 41tr]
 gb|EON80515.1| vga protein [Staphylococcus epidermidis 528m]
 gb|EON84912.1| vga protein [Staphylococcus epidermidis 36-1]
 gb|KGJ27753.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis]
Length=644

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDLN  GGQM+LGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLNINGGQMFLGDYQYYIE  533



>ref|WP_031921197.1| ABC transporter ATP-binding protein, partial [Staphylococcus 
aureus]
 gb|EWB16167.1| ABC transporter, ATP-binding protein, partial [Staphylococcus 
aureus W12628]
Length=384

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  241  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  275



>ref|WP_031774945.1| ABC transporter ATP-binding protein, partial [Staphylococcus 
aureus]
Length=405

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  262  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  296



>emb|CDR24650.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTKDGGKMYLGDYQYYIE  533



>emb|CDR64929.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTKDGGKMYLGDYQYYIE  533



>gb|KEK68996.1| ABC transporter family protein [Staphylococcus aureus 1801-2 
2011]
Length=407

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  264  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  298



>emb|CDR60036.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTKDGGKMYLGDYQYYIE  533



>ref|WP_000602048.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_005326373.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus MSHR1132]
 emb|CCE59704.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus MSHR1132]
Length=642

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTKDGGKMYLGDYQYYIE  533



>emb|CDR24649.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTKDGGKMYLGDYQYYIE  533



>ref|WP_031787865.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EYG90277.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F87619]
 gb|EYL84666.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M21126]
 emb|CDR57429.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTKDGGKMYLGDYQYYIE  533



>ref|WP_029056072.1| ABC transporter ATP-binding protein [Staphylococcus sp. URHA0057]
Length=644

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL+H+GG+MYLG+YQYYI+
Sbjct  500  VSHDRYFINQLANKVFDLDHDGGKMYLGNYQYYID  534



>ref|WP_017638107.1| ABC transporter ATP-binding protein [Staphylococcus sp. E463]
Length=644

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL+H+GG+MYLG+YQYYI+
Sbjct  500  VSHDRYFINQLANKVFDLDHDGGKMYLGNYQYYID  534



>gb|ETO56811.1| ABC transporter ATP-binding protein [Staphylococcus aureus MUM270]
Length=463

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  320  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  354



>ref|WP_031895551.1| ABC transporter ATP-binding protein, partial [Staphylococcus 
aureus]
 gb|EVR06429.1| ABC transporter, ATP-binding protein, partial [Staphylococcus 
aureus M1430]
Length=457

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  314  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  348



>ref|WP_001011594.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EFB57223.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus WW2703/97]
Length=490

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  347  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  381



>emb|CDR67401.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTLDGGKMYLGDYQYYIE  533



>emb|CDR26379.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTLDGGKMYLGDYQYYIE  533



>gb|EGL86004.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21305]
Length=654

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>emb|CDR51807.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTLDGGKMYLGDYQYYIE  533



>ref|WP_031890890.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EWN56049.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1334]
 gb|EWN59300.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1333]
 gb|EWN66424.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1329]
 gb|EWO32797.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1290]
 gb|EWO41136.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1289]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031775474.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EZT84853.1| hypothetical protein U927_02392 [Staphylococcus aureus 12S00972]
 gb|EZT87862.1| hypothetical protein U922_02485 [Staphylococcus aureus 11S01420]
 gb|EZU15475.1| hypothetical protein U910_02164 [Staphylococcus aureus 07-03450]
 gb|EZU27954.1| hypothetical protein U908_01300 [Staphylococcus aureus 08-02906]
 gb|EZU68523.1| hypothetical protein U988_02099 [Staphylococcus aureus 1111000175]
 gb|EZU71177.1| hypothetical protein U989_02010 [Staphylococcus aureus 1111000177]
 gb|EZU71957.1| hypothetical protein U991_01977 [Staphylococcus aureus 1111100370]
 gb|EZU95489.1| hypothetical protein U919_02133 [Staphylococcus aureus 11S00605]
 gb|EZV02052.1| hypothetical protein U921_02248 [Staphylococcus aureus 11S01415]
 gb|EZV13154.1| hypothetical protein U924_02226 [Staphylococcus aureus 12S00040]
 gb|EZV26286.1| hypothetical protein U930_02122 [Staphylococcus aureus 12-ST01564]
 gb|EZV31971.1| hypothetical protein U932_02067 [Staphylococcus aureus 13-ST00049]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031833635.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EWW21764.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H38215]
 gb|EYM00634.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M91652]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031924352.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVY22224.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W73060]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_020978280.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_008492199.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus CN1]
 gb|AGU62151.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus CN1]
Length=651

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  508  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  542



>ref|WP_000602049.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_494651.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus USA300_FPR3757]
 gb|ABD21834.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus USA300_FPR3757]
 gb|EFG40149.1| ATP-binding cassette-containing protein [Staphylococcus aureus 
A9754]
 gb|EFU27091.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CGS01]
 gb|EFW31453.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus MRSA131]
 gb|EFW35404.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus MRSA177]
 gb|EHS12671.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-24]
 gb|EHS18731.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-91]
 gb|EHS26567.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-88]
 gb|EHS32216.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-111]
 gb|EID88540.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CO-23]
 gb|ENI23931.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HI010B]
 gb|ENI26344.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HI010]
 gb|ENI29757.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HI013]
 gb|ENI30359.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HI022]
 gb|ENI36103.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HI049B]
 gb|ENI41167.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HI049C]
 gb|ENI43406.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HI111]
 gb|ENI46068.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HI049]
 gb|ENI47585.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HI168]
 gb|ENK55758.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0531]
 gb|EUP42692.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6057]
 gb|EUP50127.1| ABC transporter, ATP-binding protein [Staphylococcus aureus PLAC6058]
 gb|EUP51881.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6081]
 gb|EUP54092.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6146]
 gb|EUP60159.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6061]
 gb|EUP61915.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6062]
 gb|EUP64036.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6138]
 gb|EUP67583.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6123]
 gb|EUP69695.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6100]
 gb|EUP82349.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6091]
 gb|EUP86184.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6134]
 gb|EUP88387.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6126]
 gb|EUP90330.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6108]
 gb|EUP95330.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6084]
 gb|EUQ02056.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6095]
 gb|EUQ02374.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6180]
 gb|EUQ03808.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC6094]
 gb|EUQ07493.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6076]
 gb|EUQ10945.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6085]
 gb|EUQ10975.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6139]
 gb|EUQ19910.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINB6009]
 gb|EUQ21125.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC6066]
 gb|EUQ27328.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6065]
 gb|EUQ32609.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6087]
 gb|EUQ34854.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HSOU6002]
 gb|EUQ40249.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6057]
 gb|EUQ47661.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6022]
 gb|EUQ53998.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AGEN6010]
 gb|EUQ55109.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCLE6005]
 gb|EUQ68822.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6001]
 gb|EUQ82469.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6098]
 gb|EUQ86708.1| ABC transporter, ATP-binding protein [Staphylococcus aureus CHOC6045]
 gb|EUQ86973.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6039]
 gb|EUQ92981.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6019]
 gb|EUQ98913.1| ABC transporter, ATP-binding protein [Staphylococcus aureus TUSH6001]
 gb|EUR00381.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6059]
 gb|EUR00583.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6007]
 gb|EUR09627.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCOA6012]
 gb|EUR12264.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC0037]
 gb|EUR19721.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6056]
 gb|EUR22599.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6064]
 gb|EUR26673.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6025]
 gb|EUR28235.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6007]
 gb|EUR30109.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6061]
 gb|EUR33712.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6008]
 gb|EUR40376.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6051]
 gb|EVC14676.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC0024]
 gb|EVC25343.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6040]
 gb|EVC28781.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6051]
 gb|EVC48200.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC0005]
 gb|EVC49704.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6041]
 gb|EVC55309.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6010]
 gb|EVC57321.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6063]
 gb|EVC63324.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6017]
 gb|EVC82686.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6076]
 gb|EVC83128.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6037]
 gb|EVC83637.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCOA6011]
 gb|EVC89839.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6013]
 gb|EVC99963.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6018]
 gb|EVD12200.1| ABC transporter, ATP-binding protein [Staphylococcus aureus PLAC6017]
 gb|EVD13423.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6086]
 gb|EVD22613.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6087]
 gb|EVD22797.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6038]
 gb|EVD40720.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6039]
 gb|EVD44425.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LPIH6021]
 gb|EVD50551.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6045]
 gb|EVD55918.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6071]
 gb|EVD61955.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6070]
 gb|EVD63567.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6075]
 gb|EVD64207.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6072]
 gb|EVD71342.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6110]
 gb|EVD72677.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC0050]
 gb|EVD94836.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6084]
 gb|EVE08992.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6001]
 gb|EVE10954.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6002]
 gb|EVE18259.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6011]
 gb|EVE18477.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6003]
 gb|EVE24328.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6008]
 gb|EVE29556.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC0001]
 gb|EVE48688.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6015]
 gb|EVE58145.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6017]
 gb|EVE66681.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC0013]
 gb|EVE72661.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6015]
 gb|EVE82235.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HBHO6002]
 gb|EVE88757.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LPIH6001]
 gb|EVF05649.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6009]
 gb|EVF13739.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCOA6006]
 gb|EVF23197.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6049]
 gb|EVF27534.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6003]
 gb|EVF40922.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6033]
 gb|EVF46344.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COLL6021]
 gb|EVF53500.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6040]
 gb|EVF59896.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LPIH6011]
 gb|EVF70974.1| ABC transporter, ATP-binding protein [Staphylococcus aureus PLAC6004]
 gb|EVF71323.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCLE6011]
 gb|EVF85390.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6125]
 gb|EVF94032.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6056]
 gb|EVG00369.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCOA6048]
 gb|EVG06003.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6052]
 gb|EVG24471.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6110]
 gb|EVG35158.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6119]
 gb|EVG41203.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6055]
 gb|EVG49130.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6059]
 gb|EVG52252.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6055]
 gb|EVG55734.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6049]
 gb|EVG82118.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6021]
 gb|EVG95016.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6071]
 gb|EVG98341.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6075]
 gb|EVH04826.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6015]
 gb|EVH17653.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6025]
 gb|EVH64893.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6052]
 gb|EVH75511.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6057]
 gb|EVH76245.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCLE6029]
 gb|EVH82887.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6079]
 gb|EVH91846.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6101]
 gb|EVH96207.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6067]
 gb|EVH96896.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6074]
 gb|EVI02883.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6018]
 gb|EVI07189.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCLE6035]
 gb|EVI08325.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6087]
 gb|EVI31677.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6043]
 gb|EVI37074.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6102]
 gb|EVI73893.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6092]
 gb|EVI78358.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6027]
 gb|EVI86316.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC6115]
 gb|EVI86848.1| ABC transporter, ATP-binding protein [Staphylococcus aureus PLAC6043]
 gb|EVI95862.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6131]
 gb|EVJ03545.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6112]
 gb|EVJ05332.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6114]
 gb|EVJ09782.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6132]
 gb|EVJ12225.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6140]
 gb|EVJ12920.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6137]
 gb|EVJ19279.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6060]
 gb|EVJ21375.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6036]
 gb|EVJ24686.1| ABC transporter, ATP-binding protein [Staphylococcus aureus CHAP6035]
 gb|EVJ30219.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HBHO6022]
 gb|EVJ41363.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6144]
 gb|EVJ42181.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6145]
 gb|EVJ50309.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6147]
 gb|EVJ56589.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6080]
 gb|EVJ67630.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6129]
 gb|EVJ69729.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6118]
 gb|EVJ75045.1| ABC transporter, ATP-binding protein [Staphylococcus aureus CHAP6022]
 gb|EVM86704.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0945]
 gb|EVN45097.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0982]
 gb|EVO22046.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1035]
 gb|EVU22688.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M81490]
 gb|EVU30281.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T45974]
 gb|EVU30749.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W28469]
 gb|EVU36736.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F41886]
 gb|EVU46935.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M85201]
 gb|EVU60070.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F45300]
 gb|EVU74859.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M92086]
 gb|EVU81037.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T56203]
 gb|EVU81937.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W38597]
 gb|EVU89569.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M13316]
 gb|EVU89769.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M13384]
 gb|EVU97807.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W35356]
 gb|EVV03913.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H19520]
 gb|EVV13064.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F54461]
 gb|EVV28146.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M52055]
 gb|EVV30389.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W85047]
 gb|EVV33216.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H60145]
 gb|EVV45276.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T66282]
 gb|EVV47844.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T66286]
 gb|EVV50463.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W48872]
 gb|EVV55792.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F90608]
 gb|EVV55946.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M45245]
 gb|EVV67700.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M64164]
 gb|EVV72968.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M67290]
 gb|EVV75841.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H75198]
 gb|EVV79879.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M64191]
 gb|EVV84232.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M70590]
 gb|EVV85558.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T34696]
 gb|EVV89043.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T34703]
 gb|EVV92847.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W21472]
 gb|EVV96936.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W24216]
 gb|EVV98841.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H81437]
 gb|EVW12526.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H84492]
 gb|EVW23456.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F43676]
 gb|EVW28283.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W33796]
 gb|EVW30374.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T47181]
 gb|EVW31441.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F46632]
 gb|EVW50281.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W42929]
 gb|EVW56911.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W42932]
 gb|EVW74270.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H21935]
 gb|EVW78207.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H21924]
 gb|EVW80291.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F59156]
 gb|EVW83923.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W48906]
 gb|EVW91373.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H24884]
 gb|EVX03953.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W51776]
 gb|EVX12248.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H27761]
 gb|EVX18952.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M24400]
 gb|EVX28675.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T71868]
 gb|EVX30760.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T71872]
 gb|EVX34557.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H33602]
 gb|EVX40160.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H33636]
 gb|EVX46632.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W60774]
 gb|EVX54539.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W60801]
 gb|EVX58130.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F74139]
 gb|EVX70534.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F76996]
 gb|EVX75605.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H42737]
 gb|EVX87819.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F80381]
 gb|EVY03860.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H45765]
 gb|EVY15754.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F83272]
 gb|EVY18014.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T87526]
 gb|EVY24933.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H48646]
 gb|EVY40898.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T12923]
 gb|EVY66144.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H71785]
 gb|EVY72551.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H71781]
 gb|EVY75286.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T45945]
 gb|EVZ01422.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H37776]
 gb|EVZ06133.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H37781]
 gb|EVZ14737.1| ABC transporter, ATP-binding protein [Staphylococcus aureus S39407]
 gb|EVZ20498.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F81035]
 gb|EVZ21218.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T12805]
 gb|EVZ24241.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T12818]
 gb|EVZ26493.1| ABC transporter, ATP-binding protein [Staphylococcus aureus S39411]
 gb|EVZ31615.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F19383]
 gb|EVZ39224.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F26088]
 gb|EVZ46815.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F63154]
 gb|EVZ60727.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F74220]
 gb|EVZ81821.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H31290]
 gb|EVZ85470.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H40575]
 gb|EVZ89632.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H40583]
 gb|EWA06848.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H64303]
 gb|EWA11605.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H70821]
 gb|EWA22318.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H77094]
 gb|EWA34686.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M31588]
 gb|EWA42228.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M65003]
 gb|EWA46234.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M68467]
 gb|EWA52102.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M71813]
 gb|EWA56101.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M74952]
 gb|EWA57067.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T26751]
 gb|EWA61458.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T30033]
 gb|EWA64550.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T33147]
 gb|EWA68003.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T39328]
 gb|EWA73592.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T62346]
 gb|EWA85006.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T69716]
 gb|EWA99012.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T76030]
 gb|EWB21553.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W15997]
 gb|EWB62196.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W85440]
 gb|EWB65692.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W88555]
 gb|EWB75568.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W31947]
 gb|EWB77741.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H12822]
 gb|EWB81452.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T59609]
 gb|EWB87844.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T66292]
 gb|EWB88856.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T66243]
 gb|EWB94305.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W12461]
 gb|EWB95114.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M80329]
 gb|EWB97620.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F46600]
 gb|EWC01676.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F55987]
 gb|EWC06862.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T74602]
 gb|EWC10760.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F86379]
 gb|EWC16138.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T72814]
 gb|EWC20643.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M44988]
 gb|EWC22804.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F12856]
 gb|EWC24707.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H37235]
 gb|EWC30017.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M24487]
 gb|EWC30101.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T23068]
 gb|AHJ07871.1| ABC transporter ATP-binding protein [Staphylococcus aureus USA300-ISMMS1]
 gb|EWH43779.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T60795]
 gb|EWH45734.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W39826]
 gb|EWH46220.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T54283]
 gb|EWH49426.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M16597]
 gb|EWH51109.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M13048]
 gb|EWH59226.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H85008]
 gb|EWH59733.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H81885]
 gb|EWH62376.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H81809]
 gb|EWH63816.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F50126]
 gb|EWH70242.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H81800]
 gb|EWH70389.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F50076]
 gb|EWH70593.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F36670]
 gb|EWH77524.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W92052]
 gb|EWH78712.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W92100]
 gb|EWH78827.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W85326]
 gb|EWH85768.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W64921]
 gb|EWH87326.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W75132]
 gb|EWH87522.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T37849]
 gb|EWH92773.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T30569]
 gb|EWI01292.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M49691]
 gb|EWI05164.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H58177]
 gb|EWI06740.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H58198]
 gb|EWI08158.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H51158]
 gb|EWI15605.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F26873]
 gb|EWI19506.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F23347]
 gb|EWI24214.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F23336]
 gb|EWI24472.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F20105]
 gb|EWI30053.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W50092]
 gb|EWI32411.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W46883]
 gb|EWI33567.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W36570]
 gb|EWI38151.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W36553]
 gb|EWI40796.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W33592]
 gb|EWI43531.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W33578]
 gb|EWI50207.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W23225]
 gb|EWI54355.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W23207]
 gb|EWI68612.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T54294]
 gb|EWI78232.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T54280]
 gb|EWI79357.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T51022]
 gb|EWI86466.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T44811]
 gb|EWJ01392.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M91141]
 gb|EWJ18694.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M77229]
 gb|EWJ22084.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M77225]
 gb|EWJ23145.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M77210]
 gb|EWJ25999.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M20180]
 gb|EWJ28393.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M20198]
 gb|EWJ57837.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H12930]
 gb|EWJ86543.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F36699]
 gb|EWJ88430.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F36687]
 gb|EWJ93212.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W81816]
 gb|EWK17149.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T92889]
 gb|EWK30985.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T34036]
 gb|EWK38861.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T30565]
 gb|EWK42959.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T20142]
 gb|EWK56045.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T16669]
 gb|EWK58927.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T16664]
 gb|EWK63270.1| ABC transporter, ATP-binding protein [Staphylococcus aureus S56450]
 gb|EWK65609.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M73703]
 gb|EWK67068.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M73702]
 gb|EWK71232.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M70073]
 gb|EWK80862.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M66661]
 gb|EWK84588.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M56985]
 gb|EWK85734.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M53327]
 gb|EWK90505.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M46077]
 gb|EWL04597.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H71553]
 gb|EWL04784.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H71538]
 gb|EWL23179.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H58183]
 gb|EWL25248.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H58165]
 gb|EWL29152.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H47671]
 gb|EWL33638.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F88387]
 gb|EWL51295.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F81381]
 gb|EWL71102.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F26884]
 gb|EWL77670.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F26858]
 gb|EWL89385.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F16432]
 gb|EWL98710.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W29641]
 gb|EWM07958.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6114]
 gb|EWM09582.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6049]
 gb|EWR45261.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6055]
 gb|EWR48230.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6126]
 gb|EWR49551.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HBHO6021]
 gb|EWR55116.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6114]
 gb|EWR56661.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6115]
 gb|EWR58231.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6115]
 gb|EWR63666.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6086]
 gb|EWR68273.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6079]
 gb|EWR71321.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6066]
 gb|EWR77100.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6040]
 gb|EWR80042.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6131]
 gb|EWR89643.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6145]
 gb|EWR99424.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6014]
 gb|EWS07968.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6049]
 gb|EWS13942.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6016]
 gb|EWS22067.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LPIH6004]
 gb|EWS22481.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HBHO6050]
 gb|EWS35304.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCOA6009]
 gb|EWS35556.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6085]
 gb|EWS41050.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6044]
 gb|EWS43876.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LPIH6010]
 gb|EWT08544.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T70944]
 gb|EWT13908.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T74154]
 gb|EWT18045.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T74060]
 gb|EWT19203.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T74141]
 gb|EWT23996.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F63730]
 gb|EWT26434.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H32126]
 gb|EWT30572.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M32688]
 gb|EWT32942.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W60060]
 gb|EWT33756.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H35283]
 gb|EWT38640.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W57390]
 gb|EWT39856.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W62934]
 gb|EWT53470.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H41070]
 gb|EWT54405.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W65865]
 gb|EWT59584.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H41109]
 gb|EWT61844.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F76239]
 gb|EWT62970.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H43996]
 gb|EWT67736.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W70659]
 gb|EWT68559.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H47169]
 gb|EWT74273.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F85184]
 gb|EWT81906.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F85609]
 gb|EWT82090.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F89046]
 gb|EWT83800.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F89062]
 gb|EWT89842.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F92105_080312]
 gb|EWT90026.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F92073]
 gb|EWT91010.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F89073]
 gb|EWT98251.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F92125]
 gb|EWT98875.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F92127]
 gb|EWU00839.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F92128]
 gb|EWU05908.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H65830]
 gb|EWU07412.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H72115]
 gb|EWU11556.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M52622]
 gb|EWU15954.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T18851]
 gb|EWU19630.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T18865]
 gb|EWU24391.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T39082]
 gb|EWU28035.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W73649]
 gb|EWU33567.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W83133]
 gb|EWU34555.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W89268]
 gb|EWU42725.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F41902]
 gb|EWU51495.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F80354]
 gb|EWU52545.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M36089]
 gb|EWU60072.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T45940]
 gb|EWU66598.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M44986]
 gb|EWU70037.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M44987]
 gb|EWU81233.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F74039]
 gb|EWU82145.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F74035]
 gb|EWU89155.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F31094]
 gb|EWU93124.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F46780]
 gb|EWU96485.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F46785]
 gb|EWU97964.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F50093]
 gb|EWV03854.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F53393]
 gb|EWV12925.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H16097]
 gb|EWV17272.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H25869]
 gb|EWV27118.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T67319]
 gb|EWV29539.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W29625]
 gb|EWV36556.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W46839]
 gb|EWV37056.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W50110]
 gb|EWV42779.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F60357]
 gb|EWV44882.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F60360]
 gb|EWV49699.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F63750]
 gb|EWV52558.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F63687]
 gb|EWV59901.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M28487]
 gb|EWV60878.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M29068]
 gb|EWV72708.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H32166]
 gb|EWV77624.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H32181]
 gb|EWV78477.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F63786]
 gb|EWV84670.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F66778]
 gb|EWV84973.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M32679]
 gb|EWV90831.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T77618]
 gb|EWW03910.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W62972]
 gb|EWW16158.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F73229]
 gb|EWW22911.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M39265]
 gb|EWW27508.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W65910]
 gb|EWW30572.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W65904]
 gb|EWW36265.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H41079]
 gb|EWW48371.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H43986]
 gb|EWW53542.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H44015]
 gb|EWW57497.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T89906]
 gb|EWW62907.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W70590]
 gb|EWW79341.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F82568]
 gb|EWW88749.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M49455]
 gb|EWW93703.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M49474]
 gb|EWX05087.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H49922]
 gb|EWX15652.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F26021]
 gb|EWX24763.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F85711]
 gb|EWX29091.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F89053]
 gb|EWX31566.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F89078]
 gb|EWX34952.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F92047]
 gb|EWX40162.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F92119_080312]
 gb|EWX42293.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H49831]
 gb|EWX48911.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H56219]
 gb|EWX54189.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H59298]
 gb|EWX55294.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H56227]
 gb|EWX61930.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H75423]
 gb|EWX63317.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H75425]
 gb|EWX63502.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H65794]
 gb|EWX69422.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M55878]
 gb|EWX72236.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M49501]
 gb|EWX75231.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M55902]
 gb|EWX79445.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M59248]
 gb|EWX83234.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M59257]
 gb|EWX98034.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T28640]
 gb|EWY05036.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T36111]
 gb|EWY07307.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T39093]
 gb|EWY10112.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W15951]
 gb|EWY19421.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W76930]
 gb|EWY24491.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W79968]
 gb|EXO69057.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W12586]
 gb|EXO74805.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T86792]
 gb|EXO78601.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T39102]
 gb|EXO79365.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T32092]
 gb|EXO85058.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T24515]
 gb|EXO87997.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T13127]
 gb|EXO91382.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T13126]
 gb|EXO92280.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T13125]
 gb|EXO92779.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M79684]
 gb|EXO97081.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H84958]
 gb|EXP00166.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H84956]
 gb|EXP03134.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H75430]
 gb|EXP06087.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H72152]
 gb|EXP07079.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H71778]
 gb|EXP13194.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H31085]
 gb|EXP15977.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F64897]
 gb|EXP20840.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F45779]
 gb|EXP33798.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W28921]
 gb|EXP55532.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W12583]
 gb|EXP67666.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T35622]
 gb|EXP73797.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T32086]
 gb|EXP76835.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M86943]
 gb|EXP79790.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M86940]
 gb|EXP81605.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M79686]
 gb|EXP88503.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M79256]
 gb|EXP89587.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M79254]
 gb|EXP96438.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M70018]
 gb|EXP97972.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M70017]
 gb|EXQ03618.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M67938]
 gb|EXQ13080.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H84959]
 gb|EXQ14161.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H75421]
 gb|EXQ19823.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H68996]
 gb|EXQ35892.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H31086]
 gb|EXQ36498.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H31084]
 gb|EXQ43936.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H22656]
 gb|EXQ44094.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F64896]
 gb|EXQ63783.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F26032]
 gb|EYF09302.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F16108]
 gb|EYF28623.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H59329]
 gb|EYF31855.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M62794]
 gb|EYF35822.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M66468]
 gb|EYF40510.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T25283]
 gb|EYF41494.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T35596]
 gb|EYF46832.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W12538]
 gb|EYF70690.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F91072]
 gb|EYF72472.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F91077]
 gb|EYF77008.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M72054]
 gb|EYF88738.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W75229]
 gb|EYF93253.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W82215]
 gb|EYF97591.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W85837]
 gb|EYG08527.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F48959]
 gb|EYG15027.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F71576]
 gb|EYG18583.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F74820]
 gb|EYG22857.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H19398]
 gb|EYG28168.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H19420]
 gb|EYG28726.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H43694]
 gb|EYG35661.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H47117]
 gb|EYG39675.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M20726]
 gb|EYG45966.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M42212]
 gb|EYG46174.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M57729]
 gb|EYG49610.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M79667]
 gb|EYG53863.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T42550]
 gb|EYG56175.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T47161]
 gb|EYG59703.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W19225]
 gb|EYG60997.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W35455]
 gb|EYG66234.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W42270]
 gb|EYG70964.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W52298]
 gb|EYG74028.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F31078]
 gb|EYG76315.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F48607]
 gb|EYG76593.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F48611]
 gb|EYG83785.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H12890]
 gb|EYG87148.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H20315]
 gb|EYG90211.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H50411]
 gb|EYG97235.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M67929_020413]
 gb|EYG97708.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M67957]
 gb|EYH07147.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W24177]
 gb|EYH11065.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W41765]
 gb|EYH13497.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W80041]
 gb|EYH17581.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W80042]
 gb|EYH22133.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F71592]
 gb|EYJ03577.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F63712]
 gb|EYJ19407.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H72119]
 gb|EYJ27356.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T28653]
 gb|EYJ30097.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T35615]
 gb|EYJ58052.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F80972]
 gb|EYJ64384.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H12662]
 gb|EYJ75576.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H22637]
 gb|EYJ89247.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H88170]
 gb|EYJ96192.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M13099]
 gb|EYK05617.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M24416]
 gb|EYK09984.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M24418]
 gb|EYK36442.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T13128]
 gb|EYK41243.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T42547]
 gb|EYK44875.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T45839]
 gb|EYK54284.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T52642]
 gb|EYK57675.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T52649]
 gb|EYK61038.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T55950]
 gb|EYK66086.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T66622]
 gb|EYK72122.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T83543]
 gb|EYK72791.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T66632]
 gb|EYK72957.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T70161]
 gb|EYK79795.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T83563]
 gb|EYK80585.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T86825]
 gb|EYK96615.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W42255]
 gb|EYL01771.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W45750]
 gb|EYL09435.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W52294]
 gb|EYL10994.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W55536]
 gb|EYL17049.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F16533]
 gb|EYL28377.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F38211]
 gb|EYL29891.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F48420]
 gb|EYL35553.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F48422]
 gb|EYL37634.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F48603]
 gb|EYL43574.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F92121]
 gb|EYL47805.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F76253]
 gb|EYL51409.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H32175]
 gb|EYL59543.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H50387]
 gb|EYL60965.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H59325]
 gb|EYL61150.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H50403]
 gb|EYL65796.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H64570]
 gb|EYL91272.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M67953]
 gb|EYM08840.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T31892]
 gb|EYM13108.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T59813]
 gb|EYM18774.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W13012_022013]
 gb|EYM24822.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W27852]
 gb|EYM41331.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W45421]
 gb|EYM45150.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W75262]
 gb|EZI21543.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CO-49]
 gb|EZI24145.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CO-85]
 gb|AIA28545.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 emb|CDP56562.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
subsp. aureus]
 gb|KDP47727.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CO-86]
 gb|KFA42972.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus]
 gb|KFB80165.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CO-06]
 gb|AJC29421.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|AJC32266.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|AJC35109.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|AJC37959.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|AJC40798.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|AJC43643.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031873740.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EWS18468.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LPIH6008]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602067.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EES95768.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus TCH130]
 gb|EGS90996.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21259]
 gb|EUG79349.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0139]
 gb|EVF83994.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6020]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602071.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_186853.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus COL]
 ref|YP_001332988.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus str. Newman]
 ref|YP_005745419.1| putative ABC transporter ATP-binding protein [Staphylococcus 
aureus subsp. aureus str. JKD6008]
 ref|YP_005753312.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus T0131]
 ref|YP_005732159.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus TW20]
 ref|YP_007869111.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
M1]
 ref|YP_008169162.1| ATP-binding cassette, sub-family F, member 3 [Staphylococcus 
aureus Bmb9393]
 ref|YP_008716737.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
subsp. aureus Z172]
 gb|AAW36999.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus COL]
 dbj|BAF68226.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus str. Newman]
 gb|EEV82822.1| ABC transporter ATP-binding protein [Staphylococcus aureus A5948]
 gb|EEW46466.1| hypothetical ABC transporter ATP-binding protein [Staphylococcus 
aureus D30]
 emb|CBI50055.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus TW20]
 gb|EFB97733.1| ATP-binding cassette, sub-family F [Staphylococcus aureus A9765]
 gb|ADL66105.1| putative ABC transporter ATP-binding protein [Staphylococcus 
aureus subsp. aureus str. JKD6008]
 gb|AEB89146.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus T0131]
 gb|EHM59260.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21209]
 gb|EHM62248.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21178]
 gb|EHM83221.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21232]
 gb|EHP02613.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21283]
 gb|EHS70213.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-125]
 gb|EHS75578.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-189]
 gb|EHS80855.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-157]
 gb|EHT18217.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1114]
 gb|EHT61087.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1612]
 gb|EHT64256.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1770]
 gb|EHT65597.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG2018]
 gb|EKU08042.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
CN79]
 gb|ELP41804.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21282]
 gb|ENI49262.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HIF003_B2N-C]
 gb|ENI65522.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0055]
 gb|ENJ25722.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0221]
 gb|ENJ58981.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0312]
 gb|ENJ69971.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0340]
 gb|ENK06724.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0424]
 gb|ENK30680.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0468]
 gb|ENK88658.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0633]
 gb|ENL38016.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0831]
 gb|ENL74673.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1007]
 gb|ENM05687.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1064]
 gb|ENM45858.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1223]
 gb|ENN10747.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1462]
 emb|CCW22376.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
M1]
 gb|EOR42056.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus MRGR3]
 gb|AGP28998.1| ATP-binding cassette, sub-family F, member 3 [Staphylococcus 
aureus Bmb9393]
 gb|AGY90252.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
subsp. aureus Z172]
 gb|ESR28488.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus PSP1996]
 gb|EUD78487.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0630]
 gb|EUD89421.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0636]
 gb|EUE04385.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0645]
 gb|EUE23093.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0658]
 gb|EUE34390.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0668]
 gb|EUE47509.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0671]
 gb|EUF15093.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0709]
 gb|EUF44298.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0729]
 gb|EUF47332.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0730]
 gb|EUF97799.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0524]
 gb|EUF98026.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0511]
 gb|EUG51319.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0284]
 gb|EUG70692.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0352]
 gb|EUH00061.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0002]
 gb|EUH10407.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0047]
 gb|EUH13637.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0059]
 gb|EUH19846.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0088]
 gb|EUH26152.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0113]
 gb|EUI05307.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1375]
 gb|EUI20504.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1427]
 gb|EUI57756.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1183]
 gb|EUI70164.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1294]
 gb|EUI91340.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1346]
 gb|EUR05788.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6015]
 gb|EUR49040.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0007]
 gb|EUR55582.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0008]
 gb|EUS16789.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0037]
 gb|EUS84447.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0080]
 gb|EUT19256.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0097]
 gb|EUT32908.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0100]
 gb|EUT33690.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0107]
 gb|EUT34868.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0101]
 gb|EUT43850.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0109]
 gb|EUT46235.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0111]
 gb|EUT71666.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0123]
 gb|EUU99337.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0186]
 gb|EUX42559.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0337]
 gb|EUX68056.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0353]
 gb|EUZ29464.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0453]
 gb|EUZ32543.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0454]
 gb|EUZ38318.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0457]
 gb|EUZ53428.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0469]
 gb|EVA37706.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0527]
 gb|EVA59406.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0542]
 gb|EVA99967.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0563]
 gb|EVB02546.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0564]
 gb|EVB08314.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0567]
 gb|EVB21310.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0577]
 gb|EVB53285.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0593]
 gb|EVB91485.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0615]
 gb|EVC15920.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6050]
 gb|EVC26299.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6053]
 gb|EVC42478.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6072]
 gb|EVD36745.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6100]
 gb|EVD48428.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6048]
 gb|EVD85289.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6002]
 gb|EVE66493.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC0011]
 gb|EVF50290.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6042]
 gb|EVF82830.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6057]
 gb|EVG22259.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6111]
 gb|EVG66468.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6065]
 gb|EVI54433.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6102]
 gb|EVI84753.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6124]
 gb|EVI92182.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6130]
 gb|EVJ77518.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6048]
 gb|EVK44377.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0800]
 gb|EVK45701.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0801]
 gb|EVK97851.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0833]
 gb|EVL35374.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0853]
 gb|EVL42015.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0858]
 gb|EVL95951.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0893]
 gb|EVL97744.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0894]
 gb|EVM25726.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0910]
 gb|EVN90385.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1017]
 gb|EVO49596.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1056]
 gb|EVP04809.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1094]
 gb|EVP08266.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1101]
 gb|EVP71401.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0760]
 gb|EVP83999.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0766]
 gb|EVP96756.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0771]
 gb|EVQ50487.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1400]
 gb|EVQ57355.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1408]
 gb|EVR25494.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1436]
 gb|EVR44518.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1447]
 gb|EVR55547.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1453]
 gb|EVS16931.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1348]
 gb|EVS20930.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1351]
 gb|EVU23840.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W25097]
 gb|EVU89978.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M13403]
 gb|EVV41167.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T62328]
 gb|EVV45935.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M20676]
 gb|EVW13319.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H84507]
 gb|EVX82082.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H42759]
 gb|EVY52592.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F92765]
 gb|EVY82723.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H79477]
 gb|EVZ32709.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F22893]
 gb|EVZ43111.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F22898]
 gb|EWB86471.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M16486]
 gb|EWH95171.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M53356]
 gb|EWI13262.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F77942]
 gb|EWI60720.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T64318]
 gb|EWI80816.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T51001]
 gb|EWI83764.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T44834]
 gb|EWJ36726.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H91384]
 gb|EWK95160.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H75143]
 gb|EWL15843.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H64962]
 gb|EWN83353.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1319]
 gb|EWO11650.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1304]
 gb|EWO22685.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1297]
 gb|EWO73879.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1270]
 gb|EWO82789.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1263]
 gb|EWO91974.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1262]
 gb|EWQ62969.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1153]
 gb|EWQ99527.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1132]
 gb|EWR14672.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1124]
 gb|EWS25820.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6047]
 gb|EWU21417.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T36127]
 gb|EWU44929.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F52754]
 gb|EWU84599.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H41336]
 gb|EWW57737.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M45704]
 gb|EWW73222.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M42514]
 gb|EWX84551.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M70006]
 gb|EXP83081.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M90388]
 gb|EXQ08812.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M42184]
 gb|EXQ21938.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H65883]
 gb|EXQ26265.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H65882]
 gb|EXQ27863.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H65881]
 gb|EXQ67064.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F26051]
 gb|EYJ05801.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M32669]
 gb|EYJ48710.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F48950]
 gb|EYJ74011.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H43687]
 gb|EYL23260.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F27233]
 gb|AHW66598.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus]
 gb|KAK59545.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21205]
 gb|AID40731.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus]
 gb|KEK30756.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
LysK 1 2010]
 gb|KEK31366.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
Lyso 1 2010]
 gb|KEK34193.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
Lyso 2 2010]
 gb|KEK40153.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
1101-2 2010]
 gb|KEK42113.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
LysK 2 2010]
 gb|KEK45971.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
1101-1 2010]
 gb|KEK47327.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
1801-2 2010]
 gb|KEK52084.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
1801-1 2010]
 gb|KEK53878.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
LysK 1 2011]
 gb|KEK59751.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
LysK 2 2011]
 gb|KEK65401.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
1101-1 2011]
 gb|KEK67277.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
1101-2 2011]
 gb|KEK68101.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
1801-1 2011]
 gb|KFL07831.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus]
 gb|AIL58555.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031775880.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EZS99869.1| hypothetical protein W458_01909 [Staphylococcus aureus VET0136R]
 gb|EZU32592.1| hypothetical protein V159_02283 [Staphylococcus aureus 08142-8]
 gb|EZU35531.1| hypothetical protein V160_02137 [Staphylococcus aureus 08143-5]
 gb|EZY77706.1| hypothetical protein V098_02042 [Staphylococcus aureus Rd.3]
 gb|KAB50210.1| hypothetical protein W464_02298 [Staphylococcus aureus VET0152R]
 gb|KAB52478.1| hypothetical protein W466_01840 [Staphylococcus aureus VET0155R]
 gb|KAC23853.1| hypothetical protein W511_01912 [Staphylococcus aureus VET0216R]
 gb|KAC25998.1| hypothetical protein W512_01989 [Staphylococcus aureus VET0217R]
 gb|KAD93058.1| hypothetical protein W587_01919 [Staphylococcus aureus VET0325R]
 gb|KAD94213.1| hypothetical protein W588_01901 [Staphylococcus aureus VET0326R]
 gb|KAF60063.1| hypothetical protein W666_01950 [Staphylococcus aureus VET0451R]
 gb|KAF62216.1| hypothetical protein W667_01902 [Staphylococcus aureus VET0452R]
 gb|KAH87219.1| hypothetical protein W721_01890 [Staphylococcus aureus VET1871R]
 gb|KAH90065.1| hypothetical protein W722_01943 [Staphylococcus aureus VET1872R]
 gb|KAI31026.1| hypothetical protein W741_01979 [Staphylococcus aureus VET1906R]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031916430.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EZS33371.1| hypothetical protein W603_01649 [Staphylococcus aureus VET0353R]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031921830.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EXP40669.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W25797]
 gb|EYH40855.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W25799]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031877706.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVY84094.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H23829]
 gb|EVY87660.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H23830]
 gb|EWY20789.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W76994_072512]
 gb|EXP62771.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T62976]
 gb|EXP94735.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M72097]
 gb|EYL95858.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M72095_021113]
 gb|EYM47132.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W76995]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031784420.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVX23755.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M24390]
 gb|EVX79297.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M36077]
 gb|EVZ03526.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F74023]
 gb|EWA16548.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H70826]
 gb|EWJ44079.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H87628]
 gb|EWK06471.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W75113]
 gb|EWW72411.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H47171]
 gb|EXQ49241.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F64894]
 gb|EXQ51593.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F36099]
 gb|EXQ53423.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F36097]
 gb|EXQ68153.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F23613]
 gb|EXQ69980.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F23610]
 gb|EYG27517.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H19404]
 gb|EYH25161.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F64891]
 gb|EYJ89477.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H88149]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031836416.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVJ94880.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0773]
 gb|EVP65421.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0758]
 gb|EVP88538.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0768]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031911007.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVH06416.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6080]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602072.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EHT45469.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG547]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602068.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EHQ64944.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21343]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602050.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_005298385.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
subsp. aureus M013]
 ref|YP_008585981.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus SA957]
 ref|YP_008588446.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus SA40]
 gb|AEV79010.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
subsp. aureus M013]
 gb|AGW34382.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus SA957]
 gb|AGW36847.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus SA40]
 gb|EVG59470.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6067]
 gb|EVG62043.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6066]
 gb|EVI08441.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6095]
 gb|EVX48818.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F70893]
 gb|EVX69090.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F77047]
 gb|EVZ15184.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H48052]
 gb|EVZ18593.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H48054]
 gb|EWB27210.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W21932]
 gb|EWL67557.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F77917]
 gb|EWX01409.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H81433]
 gb|EWY22072.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W73738]
 gb|EYF22277.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F19490]
 gb|EYK06344.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M17033]
 gb|EYL86323.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M64056]
 gb|EYM18337.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T63897]
 gb|EYM23120.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T63898]
 gb|KAG93987.1| hypothetical protein W793_00947 [Staphylococcus aureus VET1518S]
 gb|KDP64820.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21321]
 gb|AII56525.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus SA268]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602075.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EGS90814.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21269]
 gb|EZI10286.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21337]
 gb|KDP62444.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21320]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>gb|EFM08088.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus ATCC BAA-39]
 gb|AIU85986.1| ATP-binding cassette, sub-family F, member 3 [Staphylococcus 
aureus subsp. aureus]
Length=651

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  508  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  542



>ref|WP_031890270.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVR92526.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1472]
Length=634

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031810962.1| ABC transporter ATP-binding protein, partial [Staphylococcus 
aureus]
 gb|EUY94418.1| ABC transporter, ATP-binding protein, partial [Staphylococcus 
aureus M0435]
Length=620

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602063.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_005734845.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus ST398]
 ref|YP_006710753.1| ABC transporter ATP-binding protein [Staphylococcus aureus 08BA02176]
 emb|CAQ50473.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus ST398]
 gb|EHM79872.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21331]
 gb|AFR74005.1| ABC transporter ATP-binding protein [Staphylococcus aureus 08BA02176]
 gb|EOR49534.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus 112808A]
 gb|EPZ08019.1| ABC transporter ATP-binding protein [Staphylococcus aureus S130]
 gb|EPZ09011.1| ABC transporter ATP-binding protein [Staphylococcus aureus S123]
 gb|EPZ09097.1| ABC transporter ATP-binding protein [Staphylococcus aureus S100]
 gb|EPZ12712.1| ABC transporter ATP-binding protein [Staphylococcus aureus S94]
 gb|EQM92515.1| ABC transporter ATP-binding protein [Staphylococcus aureus S1]
 gb|EZR31537.1| hypothetical protein V138_02529 [Staphylococcus aureus ZTA11/03130-3ST]
 gb|EZR31760.1| hypothetical protein V143_02365 [Staphylococcus aureus ZTA09/03739-9HSA]
 gb|EZR33289.1| hypothetical protein V135_01639 [Staphylococcus aureus ZTA09/03576-9HST]
 gb|EZR40254.1| hypothetical protein W750_01794 [Staphylococcus aureus VET1915R]
 gb|EZR41762.1| hypothetical protein W805_01551 [Staphylococcus aureus VET1918S]
 gb|EZR43396.1| hypothetical protein W745_02385 [Staphylococcus aureus VET1910R]
 gb|EZR45071.1| hypothetical protein W742_02435 [Staphylococcus aureus VET1907R]
 gb|EZR49371.1| hypothetical protein W736_02138 [Staphylococcus aureus VET1898R]
 gb|EZR50604.1| hypothetical protein W734_02265 [Staphylococcus aureus VET1896R]
 gb|EZR55733.1| hypothetical protein W725_01566 [Staphylococcus aureus VET1876R]
 gb|EZR58002.1| hypothetical protein W720_01799 [Staphylococcus aureus VET1869R]
 gb|EZR58903.1| hypothetical protein W712_02396 [Staphylococcus aureus VET1858R]
 gb|EZR60836.1| hypothetical protein W698_02048 [Staphylococcus aureus VET1842R]
 gb|EZR65853.1| hypothetical protein W693_01866 [Staphylococcus aureus VET1833R]
 gb|EZR66498.1| hypothetical protein W792_02412 [Staphylococcus aureus VET1515S]
 gb|EZR67409.1| hypothetical protein W787_02470 [Staphylococcus aureus VET1422S]
 gb|EZR73054.1| hypothetical protein W786_01876 [Staphylococcus aureus VET1419S]
 gb|EZR78039.1| hypothetical protein W778_01784 [Staphylococcus aureus VET1103S]
 gb|EZR83727.1| hypothetical protein W761_01943 [Staphylococcus aureus VET0798S]
 gb|EZR87065.1| hypothetical protein W752_01932 [Staphylococcus aureus VET0612S]
 gb|EZR87184.1| hypothetical protein W758_01559 [Staphylococcus aureus VET0765S]
 gb|EZR91939.1| hypothetical protein W689_01884 [Staphylococcus aureus VET0489R]
 gb|EZR93126.1| hypothetical protein W682_01790 [Staphylococcus aureus VET0472R]
 gb|EZR93846.1| hypothetical protein W683_02372 [Staphylococcus aureus VET0473R]
 gb|EZR99905.1| hypothetical protein W679_01428 [Staphylococcus aureus VET0469R]
 gb|EZS02160.1| hypothetical protein W681_01569 [Staphylococcus aureus VET0471R]
 gb|EZS04082.1| hypothetical protein W658_02364 [Staphylococcus aureus VET0437R]
 gb|EZS04637.1| hypothetical protein W677_01706 [Staphylococcus aureus VET0467R]
 gb|EZS08815.1| hypothetical protein W649_02368 [Staphylococcus aureus VET0426R]
 gb|EZS12400.1| hypothetical protein W647_01671 [Staphylococcus aureus VET0424R]
 gb|EZS15364.1| hypothetical protein W645_01592 [Staphylococcus aureus VET0422R]
 gb|EZS17112.1| hypothetical protein W640_02208 [Staphylococcus aureus VET0414R]
 gb|EZS17162.1| hypothetical protein W657_02205 [Staphylococcus aureus VET0436R]
 gb|EZS23078.1| hypothetical protein W630_01737 [Staphylococcus aureus VET0400R]
 gb|EZS25719.1| hypothetical protein W609_01747 [Staphylococcus aureus VET0361R]
 gb|EZS27709.1| hypothetical protein W614_01618 [Staphylococcus aureus VET0368R]
 gb|EZS31166.1| hypothetical protein W606_01265 [Staphylococcus aureus VET0358R]
 gb|EZS33446.1| hypothetical protein W601_02261 [Staphylococcus aureus VET0343R]
 gb|EZS36265.1| hypothetical protein W600_02293 [Staphylococcus aureus VET0342R]
 gb|EZS40110.1| hypothetical protein W591_01930 [Staphylococcus aureus VET0332R]
 gb|EZS44584.1| hypothetical protein W583_00995 [Staphylococcus aureus VET0319R]
 gb|EZS45446.1| hypothetical protein W572_02190 [Staphylococcus aureus VET0306R]
 gb|EZS45955.1| hypothetical protein W567_02487 [Staphylococcus aureus VET0301R]
 gb|EZS50742.1| hypothetical protein W564_01791 [Staphylococcus aureus VET0298R]
 gb|EZS53787.1| hypothetical protein W531_02423 [Staphylococcus aureus VET0251R]
 gb|EZS53919.1| hypothetical protein W559_01814 [Staphylococcus aureus VET0293R]
 gb|EZS55400.1| hypothetical protein W528_02360 [Staphylococcus aureus VET0244R]
 gb|EZS60907.1| hypothetical protein W523_01890 [Staphylococcus aureus VET0235R]
 gb|EZS61768.1| hypothetical protein W522_02471 [Staphylococcus aureus VET0232R]
 gb|EZS65473.1| hypothetical protein W520_01961 [Staphylococcus aureus VET0229R]
 gb|EZS69603.1| hypothetical protein W514_01875 [Staphylococcus aureus VET0219R]
 gb|EZS69991.1| hypothetical protein W502_01875 [Staphylococcus aureus VET0203R]
 gb|EZS74230.1| hypothetical protein W496_01820 [Staphylococcus aureus VET0197R]
 gb|EZS76358.1| hypothetical protein W490_02368 [Staphylococcus aureus VET0191R]
 gb|EZS77951.1| hypothetical protein W484_01753 [Staphylococcus aureus VET0184R]
 gb|EZS82104.1| hypothetical protein W483_01797 [Staphylococcus aureus VET0183R]
 gb|EZS84350.1| hypothetical protein W469_02153 [Staphylococcus aureus VET0158R]
 gb|EZS89024.1| hypothetical protein W468_01696 [Staphylococcus aureus VET0157R]
 gb|EZS89188.1| hypothetical protein W470_01179 [Staphylococcus aureus VET0159R]
 gb|EZS92439.1| hypothetical protein W465_01856 [Staphylococcus aureus VET0154R]
 gb|EZS95370.1| hypothetical protein W462_01721 [Staphylococcus aureus VET0150R]
 gb|EZS98188.1| hypothetical protein W460_01497 [Staphylococcus aureus VET0141R]
 gb|EZT03140.1| hypothetical protein W449_01762 [Staphylococcus aureus VET0125R]
 gb|EZT05486.1| hypothetical protein W446_01792 [Staphylococcus aureus VET0120R]
 gb|EZT08662.1| hypothetical protein W438_02431 [Staphylococcus aureus VET0111R]
 gb|EZT08829.1| hypothetical protein W440_01398 [Staphylococcus aureus VET0113R]
 gb|EZT11039.1| hypothetical protein W432_02242 [Staphylococcus aureus VET0102R]
 gb|EZT15752.1| hypothetical protein W414_02092 [Staphylococcus aureus VET0081R]
 gb|EZT17872.1| hypothetical protein W412_02164 [Staphylococcus aureus VET0078R]
 gb|EZT19300.1| hypothetical protein W396_01788 [Staphylococcus aureus VET0058R]
 gb|EZT24052.1| hypothetical protein W389_01781 [Staphylococcus aureus VET0050R]
 gb|EZT25865.1| hypothetical protein V010_01892 [Staphylococcus aureus VE08/02242ST1]
 gb|EZT28139.1| hypothetical protein V163_01848 [Staphylococcus aureus USA_6]
 gb|EZT31770.1| hypothetical protein V126_01906 [Staphylococcus aureus Tur-5]
 gb|EZT32482.1| hypothetical protein V113_02110 [Staphylococcus aureus Tur-4]
 gb|EZT34960.1| hypothetical protein V047_02077 [Staphylococcus aureus S64_POEL]
 gb|EZT39487.1| hypothetical protein V125_02021 [Staphylococcus aureus Rd.290]
 gb|EZT41958.1| hypothetical protein V046_02058 [Staphylococcus aureus S63_POEL]
 gb|EZT44662.1| hypothetical protein V054_02022 [Staphylococcus aureus MSSA-47]
 gb|EZT47629.1| hypothetical protein V053_01826 [Staphylococcus aureus MSSA-37]
 gb|EZT50129.1| hypothetical protein V056_02162 [Staphylococcus aureus MSSA-123]
 gb|EZT52126.1| hypothetical protein V096_01882 [Staphylococcus aureus GD2010-169]
 gb|EZT52648.1| hypothetical protein V095_02466 [Staphylococcus aureus GD2010-159]
 gb|EZT58239.1| hypothetical protein V033_01899 [Staphylococcus aureus C3452]
 gb|EZT59319.1| hypothetical protein V071_02205 [Staphylococcus aureus C0676]
 gb|EZT62027.1| hypothetical protein V067_01846 [Staphylococcus aureus C0626]
 gb|EZT65651.1| hypothetical protein U885_02165 [Staphylococcus aureus 81629]
 gb|EZT68066.1| hypothetical protein U903_02020 [Staphylococcus aureus 63-D10]
 gb|EZT69260.1| hypothetical protein U948_01964 [Staphylococcus aureus 53180-1]
 gb|EZT74186.1| hypothetical protein V104_02283 [Staphylococcus aureus 28(3K2-5)]
 gb|EZT74500.1| hypothetical protein V107_01588 [Staphylococcus aureus 45(2607)]
 gb|EZT79286.1| hypothetical protein V103_01660 [Staphylococcus aureus 22(2K81-5)]
 gb|EZT82931.1| hypothetical protein U954_01706 [Staphylococcus aureus 1484-9]
 gb|EZT83040.1| hypothetical protein V082_01553 [Staphylococcus aureus 2011-60-2275-7]
 gb|EZT89969.1| hypothetical protein U990_01855 [Staphylococcus aureus 1111001578]
 gb|EZT95379.1| hypothetical protein U917_01228 [Staphylococcus aureus 10S00488]
 gb|EZT97105.1| hypothetical protein V120_01985 [Staphylococcus aureus 1(04GN_04-02-52-07)]
 gb|EZT97319.1| hypothetical protein U916_02387 [Staphylococcus aureus 09S01694]
 gb|EZU03456.1| hypothetical protein U909_01208 [Staphylococcus aureus 09-00736]
 gb|EZU05509.1| hypothetical protein U906_01314 [Staphylococcus aureus 08-01229]
 gb|EZU07885.1| hypothetical protein U904_02347 [Staphylococcus aureus 08-01059]
 gb|EZU08051.1| hypothetical protein U905_01483 [Staphylococcus aureus 08-01062]
 gb|EZU16213.1| hypothetical protein U912_02117 [Staphylococcus aureus 08-01084]
 gb|EZU16423.1| hypothetical protein U913_01557 [Staphylococcus aureus 08-01085]
 gb|EZU21312.1| hypothetical protein U907_02457 [Staphylococcus aureus 08-01728]
 gb|EZU25606.1| hypothetical protein V157_01965 [Staphylococcus aureus 08134-6]
 gb|EZU29589.1| hypothetical protein V158_02217 [Staphylococcus aureus 08139-6]
 gb|EZU34814.1| hypothetical protein U915_02327 [Staphylococcus aureus 09S00475]
 gb|EZU41021.1| hypothetical protein U918_01904 [Staphylococcus aureus 10S01493]
 gb|EZU43254.1| hypothetical protein U983_01837 [Staphylococcus aureus 110802495]
 gb|EZU45347.1| hypothetical protein U978_01912 [Staphylococcus aureus 1110601704]
 gb|EZU49015.1| hypothetical protein U979_01471 [Staphylococcus aureus 1110601896]
 gb|EZU49725.1| hypothetical protein U980_02082 [Staphylococcus aureus 1110700562]
 gb|EZU53307.1| hypothetical protein U981_01791 [Staphylococcus aureus 1110700610]
 gb|EZU56215.1| hypothetical protein U982_02109 [Staphylococcus aureus 1110701127]
 gb|EZU57347.1| hypothetical protein U984_01735 [Staphylococcus aureus 1110802883]
 gb|EZU62429.1| hypothetical protein U986_01546 [Staphylococcus aureus 1110807699]
 gb|EZU65457.1| hypothetical protein U987_01606 [Staphylococcus aureus 1110904178]
 gb|EZU75898.1| hypothetical protein U992_01787 [Staphylococcus aureus 1111101949]
 gb|EZU78503.1| hypothetical protein U993_02302 [Staphylococcus aureus 1111102620]
 gb|EZU81541.1| hypothetical protein U994_02060 [Staphylococcus aureus 1111200013]
 gb|EZU82755.1| hypothetical protein U995_02044 [Staphylococcus aureus 1111203374]
 gb|EZU84716.1| hypothetical protein U996_02500 [Staphylococcus aureus 1111205429]
 gb|EZU89425.1| hypothetical protein U997_01605 [Staphylococcus aureus 1111206270]
 gb|EZU91553.1| hypothetical protein V147_01601 [Staphylococcus aureus 11P4]
 gb|EZU95158.1| hypothetical protein V148_01616 [Staphylococcus aureus 11P8]
 gb|EZU95901.1| hypothetical protein U920_02257 [Staphylococcus aureus 11S00627]
 gb|EZV04081.1| hypothetical protein U923_01203 [Staphylococcus aureus 11S01586]
 gb|EZV12261.1| hypothetical protein V051_00386 [Staphylococcus aureus 122]
 gb|EZV12373.1| hypothetical protein U976_01905 [Staphylococcus aureus 12464]
 gb|EZV16068.1| hypothetical protein U925_02219 [Staphylococcus aureus 12S00579]
 gb|EZV16847.1| hypothetical protein U926_02363 [Staphylococcus aureus 12S00881]
 gb|EZV22456.1| hypothetical protein U928_02227 [Staphylococcus aureus 12S01153]
 gb|EZV23398.1| hypothetical protein U929_02210 [Staphylococcus aureus 12S01399]
 gb|EZV31162.1| hypothetical protein U931_01340 [Staphylococcus aureus 12-ST01988]
 gb|EZV34929.1| hypothetical protein V122_01626 [Staphylococcus aureus 14(11MN_17-08-66-05)]
 gb|EZV38456.1| hypothetical protein U961_01636 [Staphylococcus aureus 150211/pool 
1]
 gb|EZV40704.1| hypothetical protein U962_02115 [Staphylococcus aureus 18439-17]
 gb|EZV42341.1| hypothetical protein V118_01873 [Staphylococcus aureus 16(11S1S4-09)]
 gb|EZV45784.1| hypothetical protein U965_01979 [Staphylococcus aureus 18439-62]
 gb|EZV49983.1| hypothetical protein U893_01534 [Staphylococcus aureus 19571]
 gb|EZV52301.1| hypothetical protein V121_02026 [Staphylococcus aureus 2(04HN_17-03-52-05)]
 gb|EZV56291.1| hypothetical protein V079_02067 [Staphylococcus aureus 2009-60-561-1]
 gb|EZV58388.1| hypothetical protein U888_01797 [Staphylococcus aureus 2010-60-6063-29]
 gb|EZV61651.1| hypothetical protein V074_01652 [Staphylococcus aureus 2010-60-1240-1]
 gb|EZV64561.1| hypothetical protein V076_01669 [Staphylococcus aureus 2010-60-6063-39]
 gb|EZV66711.1| hypothetical protein V075_02065 [Staphylococcus aureus 2010-60-6511-10]
 gb|EZV69103.1| hypothetical protein V077_01976 [Staphylococcus aureus 2010-60-6511-39]
 gb|EZV72177.1| hypothetical protein V078_02024 [Staphylococcus aureus 2010-60-6511-5]
 gb|EZV74959.1| hypothetical protein U889_01388 [Staphylococcus aureus 2010-60-7626-19]
 gb|EZV77020.1| hypothetical protein V084_02519 [Staphylococcus aureus 2011-60-1490-31]
 gb|EZV77615.1| hypothetical protein V083_02107 [Staphylococcus aureus 2011-60-2078-5]
 gb|EZV79521.1| hypothetical protein U890_02208 [Staphylococcus aureus 2011-60-2256-5]
 gb|EZV86213.1| hypothetical protein U894_01511 [Staphylococcus aureus 22825]
 gb|EZV87551.1| hypothetical protein V081_01765 [Staphylococcus aureus 2011-60-2275-1]
 gb|EZV90295.1| hypothetical protein U896_01666 [Staphylococcus aureus 22835]
 gb|EZV94314.1| hypothetical protein U897_01257 [Staphylococcus aureus 22837]
 gb|EZV95384.1| hypothetical protein U898_01661 [Staphylococcus aureus 22838]
 gb|EZV98240.1| hypothetical protein U899_01456 [Staphylococcus aureus 22841]
 gb|EZW01122.1| hypothetical protein U900_01591 [Staphylococcus aureus 22843]
 gb|EZW03231.1| hypothetical protein U998_02337 [Staphylococcus aureus 22P79]
 gb|EZW03882.1| hypothetical protein U901_01433 [Staphylococcus aureus 22846]
 gb|EZW08998.1| hypothetical protein U902_01278 [Staphylococcus aureus 23237]
 gb|EZW12719.1| hypothetical protein U974_00856 [Staphylococcus aureus 2393-15]
 gb|EZW14559.1| hypothetical protein U975_01141 [Staphylococcus aureus 2393-19]
 gb|EZW18078.1| hypothetical protein U966_01903 [Staphylococcus aureus 27999-3]
 gb|EZW19990.1| hypothetical protein V149_02468 [Staphylococcus aureus 36P1]
 gb|EZW21339.1| hypothetical protein V117_02002 [Staphylococcus aureus 28(18S1K13-24-05)]
 gb|EZW25191.1| hypothetical protein V150_02175 [Staphylococcus aureus 36P5]
 gb|EZW28597.1| hypothetical protein V152_02210 [Staphylococcus aureus 40P10]
 gb|EZW31584.1| hypothetical protein V119_01748 [Staphylococcus aureus 37(18S2S5-05)]
 gb|EZW34742.1| hypothetical protein V151_01549 [Staphylococcus aureus 40P5 1_1]
 gb|EZW34843.1| hypothetical protein V153_02003 [Staphylococcus aureus 43P3]
 gb|EZW38935.1| hypothetical protein V154_01878 [Staphylococcus aureus 43P8]
 gb|EZW42191.1| hypothetical protein V155_01809 [Staphylococcus aureus 47P5]
 gb|EZW42826.1| hypothetical protein V106_01843 [Staphylococcus aureus 44(2608)]
 gb|EZW47183.1| hypothetical protein V156_01511 [Staphylococcus aureus 47P9]
 gb|EZW49292.1| hypothetical protein U944_01997 [Staphylococcus aureus 5670-1]
 gb|EZW51723.1| hypothetical protein U971_02420 [Staphylococcus aureus 56824-15]
 gb|EZW52174.1| hypothetical protein U970_01982 [Staphylococcus aureus 56824-10]
 gb|EZW57512.1| hypothetical protein U967_01412 [Staphylococcus aureus 56824-2]
 gb|EZW59601.1| hypothetical protein U972_02337 [Staphylococcus aureus 56824-21]
 gb|EZW60075.1| hypothetical protein U968_01888 [Staphylococcus aureus 56824-5]
 gb|EZW64877.1| hypothetical protein U969_01917 [Staphylococcus aureus 56824-7]
 gb|EZW68217.1| hypothetical protein U945_01963 [Staphylococcus aureus 6665-5]
 gb|EZW73114.1| hypothetical protein U955_01659 [Staphylococcus aureus 75495-3]
 gb|EZW73287.1| hypothetical protein U956_02172 [Staphylococcus aureus 76669-6]
 gb|EZW78240.1| hypothetical protein U884_02175 [Staphylococcus aureus 81070]
 gb|EZW80482.1| hypothetical protein U957_02031 [Staphylococcus aureus 84069-2]
 gb|EZW85333.1| hypothetical protein U958_02134 [Staphylococcus aureus 86770-7]
 gb|EZW86532.1| hypothetical protein U950_02461 [Staphylococcus aureus 87807-11]
 gb|EZW86830.1| hypothetical protein U949_02010 [Staphylococcus aureus 87807-1]
 gb|EZW92725.1| hypothetical protein U953_02439 [Staphylococcus aureus 87807-16]
 gb|EZW93996.1| hypothetical protein U952_01520 [Staphylococcus aureus 87807-12]
 gb|EZW97569.1| hypothetical protein U951_02075 [Staphylococcus aureus 87807-9]
 gb|EZX00929.1| hypothetical protein U959_02063 [Staphylococcus aureus 88088-1]
 gb|EZX02008.1| hypothetical protein V146_02470 [Staphylococcus aureus 9P9]
 gb|EZX03766.1| hypothetical protein U960_01707 [Staphylococcus aureus 88088-2]
 gb|EZX09772.1| hypothetical protein U943_01635 [Staphylococcus aureus BG407]
 gb|EZX11327.1| hypothetical protein V068_01537 [Staphylococcus aureus C0630]
 gb|EZX12722.1| hypothetical protein V069_01832 [Staphylococcus aureus C0637]
 gb|EZX16511.1| hypothetical protein V026_02188 [Staphylococcus aureus C1655]
 gb|EZX18808.1| hypothetical protein V030_02178 [Staphylococcus aureus C1673]
 gb|EZX22943.1| hypothetical protein V021_02244 [Staphylococcus aureus C1842]
 gb|EZX27413.1| hypothetical protein V018_01698 [Staphylococcus aureus C1891]
 gb|EZX29159.1| hypothetical protein V041_02174 [Staphylococcus aureus C2549]
 gb|EZX30433.1| hypothetical protein V019_02019 [Staphylococcus aureus C1894]
 gb|EZX32487.1| hypothetical protein V042_02256 [Staphylococcus aureus C2679]
 gb|EZX37618.1| hypothetical protein V027_01882 [Staphylococcus aureus C2706]
 gb|EZX38838.1| hypothetical protein V034_02123 [Staphylococcus aureus C2928]
 gb|EZX41674.1| hypothetical protein V032_01913 [Staphylococcus aureus C2930]
 gb|EZX45327.1| hypothetical protein V014_02326 [Staphylococcus aureus C3489]
 gb|EZX46468.1| hypothetical protein V035_01789 [Staphylococcus aureus C2942]
 gb|EZX47978.1| hypothetical protein V036_02090 [Staphylococcus aureus C3672]
 gb|EZX52905.1| hypothetical protein V043_02226 [Staphylococcus aureus C3965]
 gb|EZX53135.1| hypothetical protein V016_02229 [Staphylococcus aureus C3865]
 gb|EZX57728.1| hypothetical protein V037_01990 [Staphylococcus aureus C4151]
 gb|EZX61636.1| hypothetical protein V031_01389 [Staphylococcus aureus C4155]
 gb|EZX61924.1| hypothetical protein V017_02089 [Staphylococcus aureus C4668]
 gb|EZX65087.1| hypothetical protein V040_02529 [Staphylococcus aureus C5453]
 gb|EZX66711.1| hypothetical protein V015_00950 [Staphylococcus aureus C5086]
 gb|EZX71795.1| hypothetical protein V108_01778 [Staphylococcus aureus Chi-4]
 gb|EZX71914.1| hypothetical protein V109_01907 [Staphylococcus aureus Chi-10]
 gb|EZX76305.1| hypothetical protein V110_01998 [Staphylococcus aureus Chi-8]
 gb|EZX79193.1| hypothetical protein V140_01887 [Staphylococcus aureus DICM09/01587-13HST]
 gb|EZX79850.1| hypothetical protein V137_02283 [Staphylococcus aureus DICM09/00997-9HST2]
 gb|EZX84223.1| hypothetical protein U999_01920 [Staphylococcus aureus FP_N239]
 gb|EZX86934.1| hypothetical protein V000_01843 [Staphylococcus aureus FP_N5203 
OX]
 gb|EZX88270.1| hypothetical protein V001_02216 [Staphylococcus aureus FP_N5208 
OX]
 gb|EZX91455.1| hypothetical protein V127_01855 [Staphylococcus aureus GD2010-052]
 gb|EZX94734.1| hypothetical protein V128_01733 [Staphylococcus aureus GD2010-061]
 gb|EZX97701.1| hypothetical protein V129_02161 [Staphylococcus aureus GD2010-102]
 gb|EZX97799.1| hypothetical protein V086_01658 [Staphylococcus aureus GD2010-090]
 gb|EZY01255.1| hypothetical protein V088_01974 [Staphylococcus aureus GD2010-107]
 gb|EZY05133.1| hypothetical protein V087_01846 [Staphylococcus aureus GD2010-110]
 gb|EZY05874.1| hypothetical protein V090_02155 [Staphylococcus aureus GD2010-112]
 gb|EZY08351.1| hypothetical protein V089_02199 [Staphylococcus aureus GD2010-115]
 gb|EZY12560.1| hypothetical protein V091_02155 [Staphylococcus aureus GD2010-131]
 gb|EZY14923.1| hypothetical protein V092_01601 [Staphylococcus aureus GD2010-147]
 gb|EZY16552.1| hypothetical protein V093_01804 [Staphylococcus aureus GD2010-155]
 gb|EZY19088.1| hypothetical protein V094_02568 [Staphylococcus aureus GD2010-158]
 gb|EZY21463.1| hypothetical protein V097_02031 [Staphylococcus aureus GD2010-168]
 gb|EZY22975.1| hypothetical protein V085_02277 [Staphylococcus aureus GD2010-177]
 gb|EZY27344.1| hypothetical protein U883_02280 [Staphylococcus aureus M118-B]
 gb|EZY28202.1| hypothetical protein V002_02319 [Staphylococcus aureus M267-1]
 gb|EZY29985.1| hypothetical protein V003_02422 [Staphylococcus aureus M357]
 gb|EZY36238.1| hypothetical protein V004_01654 [Staphylococcus aureus M457-1]
 gb|EZY37957.1| hypothetical protein V005_01677 [Staphylococcus aureus M520-1]
 gb|EZY38772.1| hypothetical protein V055_02352 [Staphylococcus aureus MRSA-118]
 gb|EZY42860.1| hypothetical protein V057_02530 [Staphylococcus aureus MRSA-136]
 gb|EZY48190.1| hypothetical protein V058_01722 [Staphylococcus aureus N0426]
 gb|EZY52451.1| hypothetical protein V059_01406 [Staphylococcus aureus N1343]
 gb|EZY53238.1| hypothetical protein V049_02260 [Staphylococcus aureus PA11]
 gb|EZY53691.1| hypothetical protein V072_01611 [Staphylococcus aureus P0218]
 gb|EZY58938.1| hypothetical protein V050_01884 [Staphylococcus aureus PA57]
 gb|EZY61559.1| hypothetical protein V061_02408 [Staphylococcus aureus R0353]
 gb|EZY61606.1| hypothetical protein V060_02186 [Staphylococcus aureus R0294]
 gb|EZY64638.1| hypothetical protein V062_02456 [Staphylococcus aureus R0357]
 gb|EZY69625.1| hypothetical protein V064_02350 [Staphylococcus aureus R0545]
 gb|EZY71117.1| hypothetical protein V063_01662 [Staphylococcus aureus R0487]
 gb|EZY75449.1| hypothetical protein V065_01567 [Staphylococcus aureus R0611]
 gb|EZY79799.1| hypothetical protein V066_01687 [Staphylococcus aureus R0615]
 gb|EZY82735.1| hypothetical protein V100_01695 [Staphylococcus aureus Rd.40]
 gb|EZY85584.1| hypothetical protein V101_02026 [Staphylococcus aureus Rd.51]
 gb|EZY88991.1| hypothetical protein V123_01613 [Staphylococcus aureus Rd.545]
 gb|EZY89841.1| hypothetical protein V102_01783 [Staphylococcus aureus Rd.60]
 gb|EZY93883.1| hypothetical protein V124_01673 [Staphylococcus aureus Rd.614]
 gb|EZY95456.1| hypothetical protein V099_02230 [Staphylococcus aureus Rd.9]
 gb|EZY99201.1| hypothetical protein V044_01720 [Staphylococcus aureus S56_POEL]
 gb|EZZ00338.1| hypothetical protein V045_02123 [Staphylococcus aureus S62_POEL]
 gb|EZZ04193.1| hypothetical protein V006_02364 [Staphylococcus aureus SARM C4155]
 gb|EZZ04616.1| hypothetical protein V048_01856 [Staphylococcus aureus S69_POEL]
 gb|EZZ07795.1| hypothetical protein V007_02008 [Staphylococcus aureus SARM C5621]
 gb|EZZ11863.1| hypothetical protein U942_02290 [Staphylococcus aureus Sau 194]
 gb|EZZ12863.1| hypothetical protein U934_01824 [Staphylococcus aureus Sau 44]
 gb|EZZ15489.1| hypothetical protein U935_01779 [Staphylococcus aureus Sau 46]
 gb|EZZ19787.1| hypothetical protein U937_02166 [Staphylococcus aureus Sau 74]
 gb|EZZ20597.1| hypothetical protein U936_01802 [Staphylococcus aureus Sau 47]
 gb|EZZ25067.1| hypothetical protein U938_01602 [Staphylococcus aureus Sau 93]
 gb|EZZ25833.1| hypothetical protein U940_02472 [Staphylococcus aureus Sau 98]
 gb|EZZ27893.1| hypothetical protein U939_02108 [Staphylococcus aureus Sau 95]
 gb|EZZ32418.1| hypothetical protein U941_01885 [Staphylococcus aureus Sau 99]
 gb|EZZ35581.1| hypothetical protein V115_02109 [Staphylococcus aureus Tur-12]
 gb|EZZ35912.1| hypothetical protein V116_01806 [Staphylococcus aureus Tur-15]
 gb|EZZ39840.1| hypothetical protein U933_01724 [Staphylococcus aureus Tur-16]
 gb|EZZ43612.1| hypothetical protein V111_01887 [Staphylococcus aureus Tur-20]
 gb|EZZ44840.1| hypothetical protein V112_01688 [Staphylococcus aureus Tur-22]
 gb|EZZ48053.1| hypothetical protein V114_01691 [Staphylococcus aureus Tur-6]
 gb|EZZ51546.1| hypothetical protein U891_01697 [Staphylococcus aureus UB 08-116]
 gb|EZZ54361.1| hypothetical protein U892_01216 [Staphylococcus aureus UB 08-172]
 gb|EZZ55298.1| hypothetical protein V162_01945 [Staphylococcus aureus USA_1]
 gb|EZZ58462.1| hypothetical protein V167_02015 [Staphylococcus aureus USA_11]
 gb|EZZ59454.1| hypothetical protein V168_01945 [Staphylococcus aureus USA_12]
 gb|EZZ63053.1| hypothetical protein V169_02167 [Staphylococcus aureus USA_15]
 gb|EZZ66375.1| hypothetical protein V166_01789 [Staphylococcus aureus USA_9]
 gb|EZZ68081.1| hypothetical protein V164_02349 [Staphylococcus aureus USA7]
 gb|EZZ67984.1| hypothetical protein V165_01836 [Staphylococcus aureus USA_8]
 gb|EZZ74023.1| hypothetical protein V008_01967 [Staphylococcus aureus VE07/03048STA]
 gb|EZZ75305.1| hypothetical protein V009_01888 [Staphylococcus aureus VE08/02126ST1]
 gb|EZZ76800.1| hypothetical protein V011_01779 [Staphylococcus aureus VE08/02244ST1]
 gb|EZZ81545.1| hypothetical protein W390_01993 [Staphylococcus aureus VET0051R]
 gb|EZZ84324.1| hypothetical protein W392_01862 [Staphylococcus aureus VET0053R]
 gb|EZZ85258.1| hypothetical protein W391_01687 [Staphylococcus aureus VET0052R]
 gb|EZZ89433.1| hypothetical protein W393_01786 [Staphylococcus aureus VET0054R]
 gb|EZZ92078.1| hypothetical protein W395_01993 [Staphylococcus aureus VET0057R]
 gb|EZZ95064.1| hypothetical protein W394_01474 [Staphylococcus aureus VET0055R]
 gb|EZZ95123.1| hypothetical protein W397_02252 [Staphylococcus aureus VET0059R]
 gb|EZZ99477.1| hypothetical protein W398_02244 [Staphylococcus aureus VET0060R]
 gb|KAA05271.1| hypothetical protein W399_02123 [Staphylococcus aureus VET0061R]
 gb|KAA05658.1| hypothetical protein W400_01920 [Staphylococcus aureus VET0062R]
 gb|KAA11717.1| hypothetical protein W402_02298 [Staphylococcus aureus VET0065R]
 gb|KAA13541.1| hypothetical protein W403_02119 [Staphylococcus aureus VET0066R]
 gb|KAA14973.1| hypothetical protein W401_01559 [Staphylococcus aureus VET0063R]
 gb|KAA19907.1| hypothetical protein W404_02375 [Staphylococcus aureus VET0067R]
 gb|KAA20778.1| hypothetical protein W405_02217 [Staphylococcus aureus VET0069R]
 gb|KAA24213.1| hypothetical protein W406_01380 [Staphylococcus aureus VET0070R]
 gb|KAA28248.1| hypothetical protein W407_02065 [Staphylococcus aureus VET0072R]
 gb|KAA29585.1| hypothetical protein W408_02085 [Staphylococcus aureus VET0073R]
 gb|KAA30137.1| hypothetical protein W409_01681 [Staphylococcus aureus VET0075R]
 gb|KAA35693.1| hypothetical protein W410_01898 [Staphylococcus aureus VET0076R]
 gb|KAA37781.1| hypothetical protein W411_01980 [Staphylococcus aureus VET0077R]
 gb|KAA40197.1| hypothetical protein W413_01546 [Staphylococcus aureus VET0080R]
 gb|KAA43590.1| hypothetical protein W415_01693 [Staphylococcus aureus VET0083R]
 gb|KAA44311.1| hypothetical protein W416_02450 [Staphylococcus aureus VET0084R]
 gb|KAA49181.1| hypothetical protein W417_01527 [Staphylococcus aureus VET0085R]
 gb|KAA51448.1| hypothetical protein W418_01630 [Staphylococcus aureus VET0086R]
 gb|KAA53771.1| hypothetical protein W419_01818 [Staphylococcus aureus VET0087R]
 gb|KAA55565.1| hypothetical protein W421_02429 [Staphylococcus aureus VET0089R]
 gb|KAA57601.1| hypothetical protein W420_02129 [Staphylococcus aureus VET0088R]
 gb|KAA59231.1| hypothetical protein W422_02508 [Staphylococcus aureus VET0090R]
 gb|KAA63082.1| hypothetical protein W423_02195 [Staphylococcus aureus VET0091R]
 gb|KAA67409.1| hypothetical protein W424_01560 [Staphylococcus aureus VET0092R]
 gb|KAA69530.1| hypothetical protein W425_01665 [Staphylococcus aureus VET0093R]
 gb|KAA72083.1| hypothetical protein W426_02105 [Staphylococcus aureus VET0094R]
 gb|KAA73991.1| hypothetical protein W427_02223 [Staphylococcus aureus VET0095R]
 gb|KAA77366.1| hypothetical protein W428_01675 [Staphylococcus aureus VET0097R]
 gb|KAA78975.1| hypothetical protein W429_02184 [Staphylococcus aureus VET0098R]
 gb|KAA82082.1| hypothetical protein W430_02187 [Staphylococcus aureus VET0099R]
 gb|KAA83403.1| hypothetical protein W431_02209 [Staphylococcus aureus VET0101R]
 gb|KAA85176.1| hypothetical protein W433_02382 [Staphylococcus aureus VET0103R]
 gb|KAA90658.1| hypothetical protein W434_01688 [Staphylococcus aureus VET0104R]
 gb|KAA92909.1| hypothetical protein W436_02391 [Staphylococcus aureus VET0107R]
 gb|KAA93880.1| hypothetical protein W435_01795 [Staphylococcus aureus VET0105R]
 gb|KAA97795.1| hypothetical protein W437_01799 [Staphylococcus aureus VET0110R]
 gb|KAB01464.1| hypothetical protein W439_01533 [Staphylococcus aureus VET0112R]
 gb|KAB02379.1| hypothetical protein W441_02272 [Staphylococcus aureus VET0114R]
 gb|KAB04940.1| hypothetical protein W442_02070 [Staphylococcus aureus VET0115R]
 gb|KAB08807.1| hypothetical protein W443_01941 [Staphylococcus aureus VET0116R]
 gb|KAB11737.1| hypothetical protein W444_01682 [Staphylococcus aureus VET0117R]
 gb|KAB12587.1| hypothetical protein W445_01927 [Staphylococcus aureus VET0119R]
 gb|KAB16969.1| hypothetical protein W447_01716 [Staphylococcus aureus VET0123R]
 gb|KAB19728.1| hypothetical protein W450_02112 [Staphylococcus aureus VET0126R]
 gb|KAB20057.1| hypothetical protein W448_01632 [Staphylococcus aureus VET0124R]
 gb|KAB24581.1| hypothetical protein W451_01735 [Staphylococcus aureus VET0127R]
 gb|KAB25082.1| hypothetical protein W452_02553 [Staphylococcus aureus VET0128R]
 gb|KAB25596.1| hypothetical protein W453_02635 [Staphylococcus aureus VET0129R]
 gb|KAB32580.1| hypothetical protein W454_01809 [Staphylococcus aureus VET0130R]
 gb|KAB35180.1| hypothetical protein W455_01763 [Staphylococcus aureus VET0132R]
 gb|KAB38905.1| hypothetical protein W457_01692 [Staphylococcus aureus VET0134R]
 gb|KAB39317.1| hypothetical protein W456_01391 [Staphylococcus aureus VET0133R]
 gb|KAB40205.1| hypothetical protein W459_02520 [Staphylococcus aureus VET0140R]
 gb|KAB43362.1| hypothetical protein W461_02488 [Staphylococcus aureus VET0148R]
 gb|KAB47129.1| hypothetical protein W463_01686 [Staphylococcus aureus VET0151R]
 gb|KAB55595.1| hypothetical protein W467_01566 [Staphylococcus aureus VET0156R]
 gb|KAB58748.1| hypothetical protein W471_01811 [Staphylococcus aureus VET0161R]
 gb|KAB60650.1| hypothetical protein W472_01784 [Staphylococcus aureus VET0162R]
 gb|KAB63043.1| hypothetical protein W473_02027 [Staphylococcus aureus VET0164R]
 gb|KAB67159.1| hypothetical protein W474_01421 [Staphylococcus aureus VET0165R]
 gb|KAB68444.1| hypothetical protein W475_01873 [Staphylococcus aureus VET0166R]
 gb|KAB70037.1| hypothetical protein W476_02056 [Staphylococcus aureus VET0167R]
 gb|KAB73955.1| hypothetical protein W477_02001 [Staphylococcus aureus VET0171R]
 gb|KAB77055.1| hypothetical protein W478_01551 [Staphylococcus aureus VET0176R]
 gb|KAB79002.1| hypothetical protein W479_01777 [Staphylococcus aureus VET0177R]
 gb|KAB81950.1| hypothetical protein W480_01794 [Staphylococcus aureus VET0178R]
 gb|KAB85169.1| hypothetical protein W481_01738 [Staphylococcus aureus VET0179R]
 gb|KAB85999.1| hypothetical protein W482_01610 [Staphylococcus aureus VET0180R]
 gb|KAB89109.1| hypothetical protein W487_02343 [Staphylococcus aureus VET0188R]
 gb|KAB91217.1| hypothetical protein W488_02291 [Staphylococcus aureus VET0189R]
 gb|KAB92944.1| hypothetical protein W489_02223 [Staphylococcus aureus VET0190R]
 gb|KAB98153.1| hypothetical protein W491_01722 [Staphylococcus aureus VET0192R]
 gb|KAB99984.1| hypothetical protein W492_01562 [Staphylococcus aureus VET0193R]
 gb|KAC02054.1| hypothetical protein W493_02133 [Staphylococcus aureus VET0194R]
 gb|KAC06046.1| hypothetical protein W494_01487 [Staphylococcus aureus VET0195R]
 gb|KAC07478.1| hypothetical protein W497_01916 [Staphylococcus aureus VET0198R]
 gb|KAC11124.1| hypothetical protein W499_01543 [Staphylococcus aureus VET0200R]
 gb|KAC13451.1| hypothetical protein W507_01681 [Staphylococcus aureus VET0212R]
 gb|KAC15522.1| hypothetical protein W508_01935 [Staphylococcus aureus VET0213R]
 gb|KAC18995.1| hypothetical protein W509_01653 [Staphylococcus aureus VET0214R]
 gb|KAC20734.1| hypothetical protein W510_01965 [Staphylococcus aureus VET0215R]
 gb|KAC28540.1| hypothetical protein W513_01888 [Staphylococcus aureus VET0218R]
 gb|KAC30656.1| hypothetical protein W515_02283 [Staphylococcus aureus VET0221R]
 gb|KAC34615.1| hypothetical protein W516_01764 [Staphylococcus aureus VET0222R]
 gb|KAC35495.1| hypothetical protein W517_02180 [Staphylococcus aureus VET0224R]
 gb|KAC38410.1| hypothetical protein W518_01753 [Staphylococcus aureus VET0227R]
 gb|KAC41739.1| hypothetical protein W519_02204 [Staphylococcus aureus VET0228R]
 gb|KAC42876.1| hypothetical protein W521_02353 [Staphylococcus aureus VET0230R]
 gb|KAC45416.1| hypothetical protein W524_01931 [Staphylococcus aureus VET0236R]
 gb|KAC50480.1| hypothetical protein W525_01827 [Staphylococcus aureus VET0237R]
 gb|KAC52025.1| hypothetical protein W526_01698 [Staphylococcus aureus VET0241R]
 gb|KAC52921.1| hypothetical protein W527_02217 [Staphylococcus aureus VET0243R]
 gb|KAC58294.1| hypothetical protein W529_01791 [Staphylococcus aureus VET0247R]
 gb|KAC58955.1| hypothetical protein W530_02066 [Staphylococcus aureus VET0249R]
 gb|KAC62938.1| hypothetical protein W532_02065 [Staphylococcus aureus VET0252R]
 gb|KAC64762.1| hypothetical protein W533_02092 [Staphylococcus aureus VET0253R]
 gb|KAC67119.1| hypothetical protein W534_01925 [Staphylococcus aureus VET0254R]
 gb|KAC70199.1| hypothetical protein W536_02569 [Staphylococcus aureus VET0259R]
 gb|KAC71637.1| hypothetical protein W535_02373 [Staphylococcus aureus VET0256R]
 gb|KAC73998.1| hypothetical protein W537_02161 [Staphylococcus aureus VET0260R]
 gb|KAC78411.1| hypothetical protein W538_02152 [Staphylococcus aureus VET0261R]
 gb|KAC81021.1| hypothetical protein W539_02122 [Staphylococcus aureus VET0263R]
 gb|KAC81743.1| hypothetical protein W540_01939 [Staphylococcus aureus VET0267R]
 gb|KAC86863.1| hypothetical protein W541_01600 [Staphylococcus aureus VET0268R]
 gb|KAC88173.1| hypothetical protein W543_02371 [Staphylococcus aureus VET0270R]
 gb|KAC89645.1| hypothetical protein W542_01946 [Staphylococcus aureus VET0269R]
 gb|KAC94483.1| hypothetical protein W544_01582 [Staphylococcus aureus VET0271R]
 gb|KAC97054.1| hypothetical protein W545_01928 [Staphylococcus aureus VET0275R]
 gb|KAC99310.1| hypothetical protein W546_01753 [Staphylococcus aureus VET0278R]
 gb|KAD01316.1| hypothetical protein W547_01585 [Staphylococcus aureus VET0279R]
 gb|KAD04599.1| hypothetical protein W548_01883 [Staphylococcus aureus VET0280R]
 gb|KAD06673.1| hypothetical protein W549_02034 [Staphylococcus aureus VET0282R]
 gb|KAD08855.1| hypothetical protein W550_01764 [Staphylococcus aureus VET0283R]
 gb|KAD13410.1| hypothetical protein W551_01474 [Staphylococcus aureus VET0284R]
 gb|KAD13738.1| hypothetical protein W552_01989 [Staphylococcus aureus VET0286R]
 gb|KAD17325.1| hypothetical protein W553_01656 [Staphylococcus aureus VET0287R]
 gb|KAD20176.1| hypothetical protein W555_02370 [Staphylococcus aureus VET0289R]
 gb|KAD20660.1| hypothetical protein W554_01806 [Staphylococcus aureus VET0288R]
 gb|KAD24336.1| hypothetical protein W556_02069 [Staphylococcus aureus VET0290R]
 gb|KAD27756.1| hypothetical protein W557_02017 [Staphylococcus aureus VET0291R]
 gb|KAD29531.1| hypothetical protein W560_02515 [Staphylococcus aureus VET0294R]
 gb|KAD30071.1| hypothetical protein W558_01919 [Staphylococcus aureus VET0292R]
 gb|KAD35629.1| hypothetical protein W561_01723 [Staphylococcus aureus VET0295R]
 gb|KAD38438.1| hypothetical protein W563_01894 [Staphylococcus aureus VET0297R]
 gb|KAD38474.1| hypothetical protein W562_02186 [Staphylococcus aureus VET0296R]
 gb|KAD43143.1| hypothetical protein W565_01570 [Staphylococcus aureus VET0299R]
 gb|KAD45749.1| hypothetical protein W566_01925 [Staphylococcus aureus VET0300R]
 gb|KAD49105.1| hypothetical protein W569_01582 [Staphylococcus aureus VET0303R]
 gb|KAD50332.1| hypothetical protein W568_01747 [Staphylococcus aureus VET0302R]
 gb|KAD53026.1| hypothetical protein W570_02206 [Staphylococcus aureus VET0304R]
 gb|KAD55491.1| hypothetical protein W571_02235 [Staphylococcus aureus VET0305R]
 gb|KAD57325.1| hypothetical protein W573_02226 [Staphylococcus aureus VET0307R]
 gb|KAD60750.1| hypothetical protein W574_01916 [Staphylococcus aureus VET0308R]
 gb|KAD64265.1| hypothetical protein W576_02441 [Staphylococcus aureus VET0312R]
 gb|KAD64565.1| hypothetical protein W575_01819 [Staphylococcus aureus VET0309R]
 gb|KAD70039.1| hypothetical protein W577_01758 [Staphylococcus aureus VET0313R]
 gb|KAD70099.1| hypothetical protein W578_02295 [Staphylococcus aureus VET0314R]
 gb|KAD70975.1| hypothetical protein W579_01970 [Staphylococcus aureus VET0315R]
 gb|KAD78767.1| hypothetical protein W581_01380 [Staphylococcus aureus VET0317R]
 gb|KAD80182.1| hypothetical protein W580_01473 [Staphylococcus aureus VET0316R]
 gb|KAD82886.1| hypothetical protein W582_01588 [Staphylococcus aureus VET0318R]
 gb|KAD85784.1| hypothetical protein W584_01845 [Staphylococcus aureus VET0320R]
 gb|KAD86399.1| hypothetical protein W585_01914 [Staphylococcus aureus VET0322R]
 gb|KAD91202.1| hypothetical protein W586_01676 [Staphylococcus aureus VET0323R]
 gb|KAD97830.1| hypothetical protein W589_02411 [Staphylococcus aureus VET0329R]
 gb|KAE00116.1| hypothetical protein W590_01756 [Staphylococcus aureus VET0331R]
 gb|KAE03340.1| hypothetical protein W592_02048 [Staphylococcus aureus VET0333R]
 gb|KAE06352.1| hypothetical protein W594_01964 [Staphylococcus aureus VET0336R]
 gb|KAE06822.1| hypothetical protein W593_02076 [Staphylococcus aureus VET0335R]
 gb|KAE08852.1| hypothetical protein W595_02331 [Staphylococcus aureus VET0337R]
 gb|KAE13401.1| hypothetical protein W596_02193 [Staphylococcus aureus VET0338R]
 gb|KAE15624.1| hypothetical protein W597_02127 [Staphylococcus aureus VET0339R]
 gb|KAE17270.1| hypothetical protein W598_02188 [Staphylococcus aureus VET0340R]
 gb|KAE22238.1| hypothetical protein W599_01809 [Staphylococcus aureus VET0341R]
 gb|KAE23545.1| hypothetical protein W602_01950 [Staphylococcus aureus VET0352R]
 gb|KAE26134.1| hypothetical protein W604_02184 [Staphylococcus aureus VET0354R]
 gb|KAE29740.1| hypothetical protein W605_01806 [Staphylococcus aureus VET0357R]
 gb|KAE31792.1| hypothetical protein W607_01659 [Staphylococcus aureus VET0359R]
 gb|KAE34594.1| hypothetical protein W608_02105 [Staphylococcus aureus VET0360R]
 gb|KAE37671.1| hypothetical protein W610_01877 [Staphylococcus aureus VET0363R]
 gb|KAE38499.1| hypothetical protein W612_02066 [Staphylococcus aureus VET0366R]
 gb|KAE41920.1| hypothetical protein W613_02050 [Staphylococcus aureus VET0367R]
 gb|KAE45785.1| hypothetical protein W615_01684 [Staphylococcus aureus VET0369R]
 gb|KAE45915.1| hypothetical protein W616_02075 [Staphylococcus aureus VET0373R]
 gb|KAE49986.1| hypothetical protein W617_02282 [Staphylococcus aureus VET0376R]
 gb|KAE52857.1| hypothetical protein W618_01782 [Staphylococcus aureus VET0382R]
 gb|KAE55950.1| hypothetical protein W620_02214 [Staphylococcus aureus VET0384R]
 gb|KAE57428.1| hypothetical protein W619_01321 [Staphylococcus aureus VET0383R]
 gb|KAE60969.1| hypothetical protein W621_01888 [Staphylococcus aureus VET0387R]
 gb|KAE62240.1| hypothetical protein W622_02413 [Staphylococcus aureus VET0388R]
 gb|KAE64134.1| hypothetical protein W623_01883 [Staphylococcus aureus VET0389R]
 gb|KAE69222.1| hypothetical protein W624_01778 [Staphylococcus aureus VET0390R]
 gb|KAE71800.1| hypothetical protein W625_01436 [Staphylococcus aureus VET0393R]
 gb|KAE74284.1| hypothetical protein W626_01490 [Staphylococcus aureus VET0394R]
 gb|KAE77511.1| hypothetical protein W628_01678 [Staphylococcus aureus VET0396R]
 gb|KAE78011.1| hypothetical protein W627_01707 [Staphylococcus aureus VET0395R]
 gb|KAE82252.1| hypothetical protein W631_02530 [Staphylococcus aureus VET0401R]
 gb|KAE82676.1| hypothetical protein W629_01343 [Staphylococcus aureus VET0399R]
 gb|KAE84610.1| hypothetical protein W632_02073 [Staphylococcus aureus VET0402R]
 gb|KAE89883.1| hypothetical protein W633_01899 [Staphylococcus aureus VET0403R]
 gb|KAE90012.1| hypothetical protein W634_02260 [Staphylococcus aureus VET0406R]
 gb|KAE93162.1| hypothetical protein W635_02137 [Staphylococcus aureus VET0407R]
 gb|KAE97825.1| hypothetical protein W636_01622 [Staphylococcus aureus VET0410R]
 gb|KAF00750.1| hypothetical protein W637_01831 [Staphylococcus aureus VET0411R]
 gb|KAF00849.1| hypothetical protein W638_01844 [Staphylococcus aureus VET0412R]
 gb|KAF05123.1| hypothetical protein W639_01921 [Staphylococcus aureus VET0413R]
 gb|KAF07978.1| hypothetical protein W642_01900 [Staphylococcus aureus VET0417R]
 gb|KAF09642.1| hypothetical protein W641_02002 [Staphylococcus aureus VET0415R]
 gb|KAF12772.1| hypothetical protein W643_02015 [Staphylococcus aureus VET0418R]
 gb|KAF15720.1| hypothetical protein W644_01780 [Staphylococcus aureus VET0421R]
 gb|KAF16448.1| hypothetical protein W646_02374 [Staphylococcus aureus VET0423R]
 gb|KAF21521.1| hypothetical protein W650_01931 [Staphylococcus aureus VET0427R]
 gb|KAF22451.1| hypothetical protein W648_01538 [Staphylococcus aureus VET0425R]
 gb|KAF26688.1| hypothetical protein W651_01664 [Staphylococcus aureus VET0428R]
 gb|KAF29556.1| hypothetical protein W653_01679 [Staphylococcus aureus VET0432R]
 gb|KAF30113.1| hypothetical protein W652_01822 [Staphylococcus aureus VET0431R]
 gb|KAF33226.1| hypothetical protein W654_02238 [Staphylococcus aureus VET0433R]
 gb|KAF35391.1| hypothetical protein W655_02184 [Staphylococcus aureus VET0434R]
 gb|KAF39525.1| hypothetical protein W656_01799 [Staphylococcus aureus VET0435R]
 gb|KAF39997.1| hypothetical protein W659_02375 [Staphylococcus aureus VET0438R]
 gb|KAF42017.1| hypothetical protein W660_02315 [Staphylococcus aureus VET0439R]
 gb|KAF47981.1| hypothetical protein W661_01594 [Staphylococcus aureus VET0440R]
 gb|KAF49073.1| hypothetical protein W662_01550 [Staphylococcus aureus VET0442R]
 gb|KAF52014.1| hypothetical protein W663_02066 [Staphylococcus aureus VET0443R]
 gb|KAF54924.1| hypothetical protein W665_01949 [Staphylococcus aureus VET0446R]
 gb|KAF56220.1| hypothetical protein W664_01648 [Staphylococcus aureus VET0444R]
 gb|KAF65596.1| hypothetical protein W668_01638 [Staphylococcus aureus VET0454R]
 gb|KAF67424.1| hypothetical protein W669_01978 [Staphylococcus aureus VET0455R]
 gb|KAF70526.1| hypothetical protein W670_01883 [Staphylococcus aureus VET0456R]
 gb|KAF71735.1| hypothetical protein W671_02173 [Staphylococcus aureus VET0459R]
 gb|KAF75475.1| hypothetical protein W672_02120 [Staphylococcus aureus VET0460R]
 gb|KAF76762.1| hypothetical protein W673_02258 [Staphylococcus aureus VET0462R]
 gb|KAF80043.1| hypothetical protein W674_02117 [Staphylococcus aureus VET0463R]
 gb|KAF83604.1| hypothetical protein W675_02062 [Staphylococcus aureus VET0464R]
 gb|KAF84623.1| hypothetical protein W676_02081 [Staphylococcus aureus VET0465R]
 gb|KAF87977.1| hypothetical protein W678_02075 [Staphylococcus aureus VET0468R]
 gb|KAF90529.1| hypothetical protein W684_02473 [Staphylococcus aureus VET0478R]
 gb|KAF92375.1| hypothetical protein W680_01785 [Staphylococcus aureus VET0470R]
 gb|KAF96866.1| hypothetical protein W685_02150 [Staphylococcus aureus VET0481R]
 gb|KAF97140.1| hypothetical protein W687_02232 [Staphylococcus aureus VET0486R]
 gb|KAF97711.1| hypothetical protein W686_02050 [Staphylococcus aureus VET0485R]
 gb|KAG04247.1| hypothetical protein W688_02071 [Staphylococcus aureus VET0488R]
 gb|KAG05647.1| hypothetical protein W751_01784 [Staphylococcus aureus VET0519S]
 gb|KAG09880.1| hypothetical protein W690_01484 [Staphylococcus aureus VET0596R]
 gb|KAG13547.1| hypothetical protein W754_01407 [Staphylococcus aureus VET0645S]
 gb|KAG15322.1| hypothetical protein W755_01909 [Staphylococcus aureus VET0657S]
 gb|KAG19776.1| hypothetical protein W759_02472 [Staphylococcus aureus VET0779S]
 gb|KAG27272.1| hypothetical protein W760_01995 [Staphylococcus aureus VET0787S]
 gb|KAG30134.1| hypothetical protein W762_01776 [Staphylococcus aureus VET0809S]
 gb|KAG32850.1| hypothetical protein W763_01642 [Staphylococcus aureus VET0810S]
 gb|KAG37404.1| hypothetical protein W765_01372 [Staphylococcus aureus VET0919S]
 gb|KAG40050.1| hypothetical protein W766_01617 [Staphylococcus aureus VET0920S]
 gb|KAG52514.1| hypothetical protein W771_01725 [Staphylococcus aureus VET1035S]
 gb|KAG55915.1| hypothetical protein W772_01738 [Staphylococcus aureus VET1048S]
 gb|KAG57202.1| hypothetical protein W774_02159 [Staphylococcus aureus VET1054S]
 gb|KAG60070.1| hypothetical protein W773_02144 [Staphylococcus aureus VET1052S]
 gb|KAG60735.1| hypothetical protein W776_02461 [Staphylococcus aureus VET1068S]
 gb|KAG64919.1| hypothetical protein W777_01921 [Staphylococcus aureus VET1088S]
 gb|KAG67300.1| hypothetical protein W779_02437 [Staphylococcus aureus VET1104S]
 gb|KAG70192.1| hypothetical protein W780_01917 [Staphylococcus aureus VET1168S]
 gb|KAG73992.1| hypothetical protein W782_02427 [Staphylococcus aureus VET1245S]
 gb|KAG74303.1| hypothetical protein W781_01458 [Staphylococcus aureus VET1181S]
 gb|KAG77467.1| hypothetical protein W785_01823 [Staphylococcus aureus VET1411S]
 gb|KAG80612.1| hypothetical protein W788_02480 [Staphylococcus aureus VET1434S]
 gb|KAG82743.1| hypothetical protein W789_01909 [Staphylococcus aureus VET1468S]
 gb|KAG85251.1| hypothetical protein W790_02049 [Staphylococcus aureus VET1495S]
 gb|KAG89655.1| hypothetical protein W791_01542 [Staphylococcus aureus VET1499S]
 gb|KAG92046.1| hypothetical protein W794_02290 [Staphylococcus aureus VET1519S]
 gb|KAG96530.1| hypothetical protein W795_01687 [Staphylococcus aureus VET1526S]
 gb|KAH02124.1| hypothetical protein W798_01779 [Staphylococcus aureus VET1727S]
 gb|KAH07641.1| hypothetical protein W799_01499 [Staphylococcus aureus VET1738S]
 gb|KAH08049.1| hypothetical protein W801_02007 [Staphylococcus aureus VET1816S]
 gb|KAH09502.1| hypothetical protein W800_02291 [Staphylococcus aureus VET1779S]
 gb|KAH15111.1| hypothetical protein W802_01678 [Staphylococcus aureus VET1817S]
 gb|KAH16339.1| hypothetical protein W803_01922 [Staphylococcus aureus VET1822S]
 gb|KAH20508.1| hypothetical protein W691_01704 [Staphylococcus aureus VET1831R]
 gb|KAH22040.1| hypothetical protein W692_01840 [Staphylococcus aureus VET1832R]
 gb|KAH22470.1| hypothetical protein W694_02219 [Staphylococcus aureus VET1834R]
 gb|KAH28041.1| hypothetical protein W695_02068 [Staphylococcus aureus VET1835R]
 gb|KAH28595.1| hypothetical protein W696_01986 [Staphylococcus aureus VET1838R]
 gb|KAH32232.1| hypothetical protein W697_02066 [Staphylococcus aureus VET1839R]
 gb|KAH35223.1| hypothetical protein W699_02248 [Staphylococcus aureus VET1843R]
 gb|KAH38793.1| hypothetical protein W700_01553 [Staphylococcus aureus VET1844R]
 gb|KAH41162.1| hypothetical protein W701_01878 [Staphylococcus aureus VET1845R]
 gb|KAH41871.1| hypothetical protein W702_01984 [Staphylococcus aureus VET1846R]
 gb|KAH46345.1| hypothetical protein W703_01816 [Staphylococcus aureus VET1848R]
 gb|KAH48392.1| hypothetical protein W704_01877 [Staphylococcus aureus VET1849R]
 gb|KAH49087.1| hypothetical protein W705_02438 [Staphylococcus aureus VET1850R]
 gb|KAH53819.1| hypothetical protein W706_02149 [Staphylococcus aureus VET1851R]
 gb|KAH57633.1| hypothetical protein W707_01362 [Staphylococcus aureus VET1852R]
 gb|KAH58559.1| hypothetical protein W708_01922 [Staphylococcus aureus VET1853R]
 gb|KAH62000.1| hypothetical protein W709_01819 [Staphylococcus aureus VET1854R]
 gb|KAH64550.1| hypothetical protein W710_01900 [Staphylococcus aureus VET1855R]
 gb|KAH67297.1| hypothetical protein W711_01819 [Staphylococcus aureus VET1856R]
 gb|KAH67622.1| hypothetical protein W713_02461 [Staphylococcus aureus VET1859R]
 gb|KAH71750.1| hypothetical protein W714_01809 [Staphylococcus aureus VET1860R]
 gb|KAH75545.1| hypothetical protein W715_01775 [Staphylococcus aureus VET1861R]
 gb|KAH76814.1| hypothetical protein W716_01992 [Staphylococcus aureus VET1865R]
 gb|KAH77810.1| hypothetical protein W717_02110 [Staphylococcus aureus VET1866R]
 gb|KAH82578.1| hypothetical protein W718_02012 [Staphylococcus aureus VET1867R]
 gb|KAH85507.1| hypothetical protein W719_01937 [Staphylococcus aureus VET1868R]
 gb|KAH92445.1| hypothetical protein W723_01932 [Staphylococcus aureus VET1873R]
 gb|KAH95463.1| hypothetical protein W724_02218 [Staphylococcus aureus VET1875R]
 gb|KAH96697.1| hypothetical protein W726_01871 [Staphylococcus aureus VET1877R]
 gb|KAI01109.1| hypothetical protein W727_01979 [Staphylococcus aureus VET1880R]
 gb|KAI03364.1| hypothetical protein W728_02038 [Staphylococcus aureus VET1884R]
 gb|KAI04048.1| hypothetical protein W729_01853 [Staphylococcus aureus VET1886R]
 gb|KAI09238.1| hypothetical protein W730_01717 [Staphylococcus aureus VET1890R]
 gb|KAI10060.1| hypothetical protein W731_02182 [Staphylococcus aureus VET1892R]
 gb|KAI14113.1| hypothetical protein W732_01958 [Staphylococcus aureus VET1893R]
 gb|KAI16409.1| hypothetical protein W733_01861 [Staphylococcus aureus VET1895R]
 gb|KAI16661.1| hypothetical protein W735_02431 [Staphylococcus aureus VET1897R]
 gb|KAI20599.1| hypothetical protein W737_02265 [Staphylococcus aureus VET1899R]
 gb|KAI22213.1| hypothetical protein W738_02266 [Staphylococcus aureus VET1901R]
 gb|KAI27386.1| hypothetical protein W739_01698 [Staphylococcus aureus VET1904R]
 gb|KAI29780.1| hypothetical protein W740_02114 [Staphylococcus aureus VET1905R]
 gb|KAI35594.1| hypothetical protein W743_01419 [Staphylococcus aureus VET1908R]
 gb|KAI38027.1| hypothetical protein W746_02176 [Staphylococcus aureus VET1911R]
 gb|KAI38156.1| hypothetical protein W744_01855 [Staphylococcus aureus VET1909R]
 gb|KAI42504.1| hypothetical protein W747_02113 [Staphylococcus aureus VET1912R]
 gb|KAI45419.1| hypothetical protein W748_01780 [Staphylococcus aureus VET1913R]
 gb|KAI46946.1| hypothetical protein W749_01847 [Staphylococcus aureus VET1914R]
 gb|KAI50657.1| hypothetical protein W808_02469 [Staphylococcus aureus VET1949S]
 gb|KAI50782.1| hypothetical protein W804_01844 [Staphylococcus aureus VET1917S]
 gb|KAI52144.1| hypothetical protein W806_02104 [Staphylococcus aureus VET1923S]
 gb|KAI58187.1| hypothetical protein W809_01768 [Staphylococcus aureus VET1950S]
 gb|KAI63209.1| hypothetical protein W812_01645 [Staphylococcus aureus VET1959S]
 gb|KAI63256.1| hypothetical protein W811_00015 [Staphylococcus aureus VET1956S]
 gb|KAI65642.1| hypothetical protein V142_02438 [Staphylococcus aureus ZTA09/03734-9HSA]
 gb|KAI65903.1| hypothetical protein V136_01832 [Staphylococcus aureus ZTA09/03576-8HST]
 gb|KAI69831.1| hypothetical protein V144_02243 [Staphylococcus aureus ZTA09/03745-9HSA]
 gb|KAI71893.1| hypothetical protein V130_02190 [Staphylococcus aureus ZTA10/00045-9HST]
 gb|KAI75859.1| hypothetical protein V134_01901 [Staphylococcus aureus ZTA10/00047-8HST]
 gb|KAI77196.1| hypothetical protein V132_02163 [Staphylococcus aureus ZTA10/00058-8HST]
 gb|KAI78908.1| hypothetical protein V141_02367 [Staphylococcus aureus ZTA10/02412-8HSA]
 gb|KAI83250.1| hypothetical protein V145_02232 [Staphylococcus aureus ZTA11/00189-8HSA]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602065.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EFC06896.1| ATP-binding cassette sub-family F member 3 [Staphylococcus aureus 
subsp. aureus H19]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602066.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EFB49101.1| ATP-binding cassette, sub-family F, member 3 [Staphylococcus 
aureus subsp. aureus D139]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602070.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EEW44394.1| hypothetical ABC transporter ATP-binding protein [Staphylococcus 
aureus 930918-3]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031922825.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EWV32853.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W39821]
 gb|EYG63712.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W42196]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_033861301.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVZ07653.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F77710]
 gb|EWC10914.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F27253]
 gb|EWC15844.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F27254]
 gb|EWU75510.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F77709]
 gb|EXP12869.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H65853]
 gb|EXP22817.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F36091]
 gb|EXQ54814.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F36090]
 gb|EXQ60259.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F27252]
 gb|EYH22522.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F91084]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031890118.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVW44960.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M12714]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031910067.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVH84202.1| ABC transporter, ATP-binding protein [Staphylococcus aureus TUSH6007]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031907102.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EUQ23381.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6114]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031860867.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EUH98839.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1098]
 gb|EUI00493.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1104]
 gb|EWQ99670.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1130]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602058.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_417390.1| ATP-binding ABC transporter protein [Staphylococcus aureus RF122]
 emb|CAI81620.1| ATP-binding ABC transporter protein [Staphylococcus aureus RF122]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602055.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_008485845.1| ABC transporter, ATP-binding protein with duplicated ATPase domains 
[Staphylococcus aureus subsp. aureus 6850]
 gb|EHO89746.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21262]
 gb|AGU55652.1| ABC transporter, ATP-binding protein with duplicated ATPase domains 
[Staphylococcus aureus subsp. aureus 6850]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602069.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EHM80062.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21334]
 gb|EHM83949.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21340]
 gb|EHS22117.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-55]
 gb|EJE55375.1| ATP-binding ABC transporter protein [Staphylococcus aureus subsp. 
aureus str. Newbould 305]
 gb|ELS63855.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21196]
 gb|ELY18380.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KT/Y21]
 gb|ENJ33302.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0239]
 gb|ENN60882.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1216]
 gb|ERE94075.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CO-08]
 gb|ETD08413.1| hypothetical protein HMPREF1276_02385 [Staphylococcus aureus 
subsp. aureus KPL1845]
 gb|EUG32803.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0443]
 gb|EUZ75520.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0483]
 gb|EWP71081.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1217]
 gb|EZU10163.1| hypothetical protein U911_02406 [Staphylococcus aureus 07-03451]
 gb|EZU61549.1| hypothetical protein U985_02063 [Staphylococcus aureus 1110803248]
 gb|EZV04231.1| hypothetical protein U914_02244 [Staphylococcus aureus 12-03481]
 gb|EZV48199.1| hypothetical protein U947_02285 [Staphylococcus aureus 18754-2]
 gb|EZW67583.1| hypothetical protein U973_02072 [Staphylococcus aureus 56864-11]
 gb|EZW76159.1| hypothetical protein U887_02530 [Staphylococcus aureus 7-B-1]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602078.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_005740097.1| putative ABC transporter ATP-binding protein [Staphylococcus 
aureus subsp. aureus JKD6159]
 gb|ADL23887.1| putative ABC transporter ATP-binding protein [Staphylococcus 
aureus subsp. aureus JKD6159]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602047.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_005737526.1| ATP-binding ABC transporter protein [Staphylococcus aureus subsp. 
aureus ED133]
 gb|ADI98544.1| ATP-binding ABC transporter protein [Staphylococcus aureus subsp. 
aureus ED133]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>gb|EFH25320.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus ATCC 51811]
Length=651

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  508  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  542



>ref|WP_025788666.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602074.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_500755.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus NCTC 8325]
 gb|ABD31312.1| ABC transporter, ATP-binding protein, putative [Staphylococcus 
aureus subsp. aureus NCTC 8325]
 gb|EGG61442.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21189]
 gb|EHM66450.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus VCU006]
 gb|EHT85534.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIGC345D]
 gb|EHT92279.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIGC93]
 gb|ELP28134.1| ABC superfamily ATP binding cassette transporter, ABC protein 
[Staphylococcus aureus subsp. aureus DSM 20231]
 gb|ENJ97728.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0396]
 gb|ETD10676.1| hypothetical protein HMPREF1269_01098 [Staphylococcus aureus 
subsp. aureus KPL1828]
 gb|EUY60880.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0413]
 gb|EUZ78274.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0486]
 gb|EVQ16863.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1382]
 gb|EWK02766.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W75119]
 gb|EZH87145.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21267]
 gb|EZI04255.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21311]
 gb|KAJ46247.1| ABC transporter, ATP-binding protein [Staphylococcus aureus 880]
 gb|KFD37483.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus]
 gb|KIE14194.1| ABC transporter, ATP-binding protein [Staphylococcus aureus 917]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031795288.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EZW16265.1| hypothetical protein V105_01606 [Staphylococcus aureus 25(2889)]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031895243.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EYR52258.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5870]
 gb|EYR57040.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5869]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031770580.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EYO52588.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3901]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031923400.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EWU66402.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W48969]
 gb|EWU77521.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W48973]
 gb|EXP27007.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W82239]
 gb|EYH41841.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W45758]
 gb|EYM55214.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W80013]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031793169.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EUG64017.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0343]
 gb|EUW33093.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0272]
 gb|EUW41231.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0276]
 gb|EUW81044.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0301]
 gb|EUX50652.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0341]
 gb|EUZ84113.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0490]
 gb|EWP84236.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1207]
 gb|EWQ03997.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1197]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_001631918.1| ABC transporter, ATP-binding protein [Staphylococcus aureus]
 gb|ENN40337.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1578]
 gb|EVP48869.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1580]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_001618433.1| ABC transporter, ATP-binding protein [Staphylococcus aureus]
 gb|ENM68023.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1277]
 gb|ENN58408.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1215]
 gb|EUI15836.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1399]
 gb|EVQ35809.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1396]
 gb|EVQ59706.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1409]
 gb|EVQ93256.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1424]
 gb|EVR32932.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1443]
 gb|EVS73267.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1491]
 gb|EVS75644.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1496]
 gb|EVT08255.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1514]
 gb|EVT18741.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1519]
 gb|EVT24381.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1524]
 gb|EWB08111.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T86006]
 gb|EWN93686.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1314]
 gb|EWN95677.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1312]
 gb|EWO43982.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1285]
 gb|EWO75614.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1269]
 gb|EWO97594.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1258]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031921509.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EXP58073.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W12582]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031811624.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EXN73389.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5833]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031898453.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EWT49269.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M39274]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031923657.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EWK09092.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W64958]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031909254.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EWI66615.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T57415]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_033858637.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVY59865.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W82303]
 gb|EWA02504.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H61003]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031910794.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVD80696.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6053]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031792782.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EUG56754.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0311]
 gb|EUW93155.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0307]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602056.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EHT79111.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIGC340D]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602062.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EHM58666.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21202]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602064.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_006238284.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus HO 5096 0412]
 gb|EGL93991.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21310]
 gb|EHS28086.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-105]
 emb|CCG16666.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus HO 5096 0412]
 gb|EMZ01990.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1228]
 gb|EWB65293.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W85432]
 gb|EWI46822.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W33563]
 gb|EWP20416.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1242]
 gb|AHZ99878.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus]
 gb|KDP58787.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21251]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602077.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EGA99100.1| ATP-binding ABC transporter protein [Staphylococcus aureus O46]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602076.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EGA97630.1| ATP-binding ABC transporter protein [Staphylococcus aureus O11]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602057.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|NP_372571.1| ABC transporter [Staphylococcus aureus subsp. aureus Mu50]
 ref|NP_375155.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus N315]
 ref|YP_001247442.1| ABC transporter [Staphylococcus aureus subsp. aureus JH9]
 ref|YP_001317237.1| ABC transporter [Staphylococcus aureus subsp. aureus JH1]
 ref|YP_001442622.1| ABC transporter [Staphylococcus aureus subsp. aureus Mu3]
 ref|YP_005750591.1| ABC transporter family protein [Staphylococcus aureus subsp. 
aureus ECT-R 2]
 ref|YP_005742737.1| ABC transporter ATP-binding protein [Staphylococcus aureus 04-02981]
 ref|YP_007578067.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 ref|YP_007580075.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 ref|YP_007582040.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 ref|YP_007584054.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 ref|YP_007586021.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 ref|YP_007619783.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 ref|YP_007621767.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 ref|YP_007623756.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 dbj|BAB43134.1| hypothetical ABC transporter ATP-binding protein [Staphylococcus 
aureus subsp. aureus N315]
 dbj|BAB58209.1| putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus Mu50]
 gb|ABQ49866.1| ABC transporter related [Staphylococcus aureus subsp. aureus 
JH9]
 gb|ABR52950.1| ABC transporter related [Staphylococcus aureus subsp. aureus 
JH1]
 dbj|BAF78915.1| hypothetical ABC transporter [Staphylococcus aureus subsp. aureus 
Mu3]
 gb|EEV25566.1| ABC transporter ATP-binding protein [Staphylococcus aureus A9781]
 gb|EEV64126.1| ABC transporter ATP-binding protein [Staphylococcus aureus A9763]
 gb|EEV68607.1| ABC transporter ATP-binding protein [Staphylococcus aureus A9719]
 gb|EEV73218.1| ABC transporter [Staphylococcus aureus A9299]
 gb|EEV74289.1| ABC transporter [Staphylococcus aureus A8115]
 gb|EEV78823.1| ABC transporter ATP-binding protein [Staphylococcus aureus A6300]
 gb|EEV81774.1| ABC transporter [Staphylococcus aureus A6224]
 gb|EEV86060.1| ABC transporter ATP-binding protein [Staphylococcus aureus A5937]
 gb|EFB94651.1| ATP-binding cassette, sub-family F [Staphylococcus aureus A10102]
 gb|EFC02596.1| ATP-binding cassette, sub-family F [Staphylococcus aureus A8117]
 gb|ADC38199.1| Hypothetical ABC transporter ATP-binding protein [Staphylococcus 
aureus 04-02981]
 gb|EFG43829.1| ATP-binding cassette-containing protein [Staphylococcus aureus 
A8819]
 gb|EFH35964.1| ATP-binding cassette-containing protein [Staphylococcus aureus 
A8796]
 emb|CBX35241.1| ABC transporter family protein [Staphylococcus aureus subsp. 
aureus ECT-R 2]
 gb|EFT84667.1| hypothetical ABC transporter [Staphylococcus aureus subsp. aureus 
CGS03]
 gb|EGG62527.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21172]
 gb|EGL94185.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21318]
 gb|EGS93082.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21201]
 gb|EHO98210.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21272]
 gb|EHS12151.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-3]
 gb|EHS13551.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-99]
 gb|EHS31413.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-122]
 gb|EHT17574.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1165]
 gb|EHT17643.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1057]
 gb|EHT35831.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1750]
 gb|EHT44626.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1769]
 gb|EHT45789.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1096]
 gb|EHT46384.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1150]
 gb|EHT54297.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1213]
 gb|EHT90564.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIGC348]
 gb|EID40489.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus IS-M]
 gb|EIK04681.1| hypothetical protein MQC_02348 [Staphylococcus aureus subsp. 
aureus VRS2]
 gb|EIK05135.1| hypothetical protein MQE_02438 [Staphylococcus aureus subsp. 
aureus VRS3a]
 gb|EIK05265.1| hypothetical protein MQA_01919 [Staphylococcus aureus subsp. 
aureus VRS1]
 gb|EIK11617.1| hypothetical protein MQG_02128 [Staphylococcus aureus subsp. 
aureus VRS4]
 gb|EIK13201.1| ABC transporter like ATP-binding cassette, sub-family F, member 
3 [Staphylococcus aureus subsp. aureus VRS5]
 gb|EIK16485.1| ABC transporter like ATP-binding cassette, sub-family F, member 
3 [Staphylococcus aureus subsp. aureus VRS6]
 gb|EIK20955.1| ABC transporter like ATP-binding cassette, sub-family F, member 
3 [Staphylococcus aureus subsp. aureus VRS8]
 gb|EIK22191.1| hypothetical protein MQM_02143 [Staphylococcus aureus subsp. 
aureus VRS7]
 gb|EIK22557.1| ABC transporter like ATP-binding cassette, sub-family F, member 
3 [Staphylococcus aureus subsp. aureus VRS9]
 gb|EIK29649.1| ABC transporter like ATP-binding cassette, sub-family F, member 
3 [Staphylococcus aureus subsp. aureus VRS10]
 gb|EIK30418.1| ABC transporter like ATP-binding cassette, sub-family F, member 
3 [Staphylococcus aureus subsp. aureus VRS11a]
 gb|EIK32057.1| ABC transporter like ATP-binding cassette, sub-family F, member 
3 [Staphylococcus aureus subsp. aureus VRS11b]
 gb|EJU83076.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CM05]
 emb|CCJ11425.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 emb|CCJ13390.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 emb|CCJ15354.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 emb|CCJ27145.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 emb|CCJ19281.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 emb|CCJ21246.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 emb|CCJ23213.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 emb|CCJ25179.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus ST228]
 gb|ELS65076.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21236]
 gb|EMY95850.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0075]
 gb|EMY98795.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1060]
 gb|EMY99472.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0294]
 gb|EMZ04544.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1193]
 gb|EMZ10227.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1407]
 gb|EMZ10522.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1466]
 gb|ENI15570.1| ABC transporter, ATP-binding protein [Staphylococcus aureus B40723]
 gb|ENI15955.1| ABC transporter, ATP-binding protein [Staphylococcus aureus B40950]
 gb|ENI17389.1| ABC transporter, ATP-binding protein [Staphylococcus aureus B147830]
 gb|ENI23186.1| ABC transporter, ATP-binding protein [Staphylococcus aureus B53639]
 gb|ENI50100.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0001]
 gb|ENI56243.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0029]
 gb|ENI60530.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0006]
 gb|ENI61073.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0035]
 gb|ENI64861.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0060]
 gb|ENI66053.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0045]
 gb|ENI66973.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0066]
 gb|ENI73316.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0077]
 gb|ENI74456.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0103]
 gb|ENI74753.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0102]
 gb|ENI83401.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0108]
 gb|ENI88024.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0104]
 gb|ENI89079.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0144]
 gb|ENI90550.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0154]
 gb|ENI90808.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0171]
 gb|ENI95519.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0150]
 gb|ENI99896.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0177]
 gb|ENJ00301.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0173]
 gb|ENJ02270.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0192]
 gb|ENJ08792.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0200]
 gb|ENJ12046.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0197]
 gb|ENJ13990.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0212]
 gb|ENJ18330.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0216]
 gb|ENJ22089.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0213]
 gb|ENJ23112.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0235]
 gb|ENJ24131.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0237]
 gb|ENJ33272.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0240]
 gb|ENJ33834.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0250]
 gb|ENJ39555.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0252]
 gb|ENJ40184.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0270]
 gb|ENJ43461.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0279]
 gb|ENJ47998.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0273]
 gb|ENJ50953.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0306]
 gb|ENJ51672.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0280]
 gb|ENJ52075.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0288]
 gb|ENJ58194.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0326]
 gb|ENJ62238.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0328]
 gb|ENJ64697.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0330]
 gb|ENJ64874.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0329]
 gb|ENJ71206.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0347]
 gb|ENJ77872.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0350]
 gb|ENJ78887.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0351]
 gb|ENJ79058.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0334]
 gb|ENJ82606.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0363]
 gb|ENJ87427.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0364]
 gb|ENJ92898.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0367]
 gb|ENJ92948.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0374]
 gb|ENJ93416.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0375]
 gb|ENK02134.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0404]
 gb|ENK06880.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0415]
 gb|ENK13872.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0427]
 gb|ENK16703.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0438]
 gb|ENK18421.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0450]
 gb|ENK20056.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0455]
 gb|ENK25473.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0460]
 gb|ENK26497.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0467]
 gb|ENK30711.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0478]
 gb|ENK34910.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0489]
 gb|ENK37297.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0493]
 gb|ENK39763.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0494]
 gb|ENK40534.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0510]
 gb|ENK47760.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0528]
 gb|ENK53282.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0529]
 gb|ENK54551.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0536]
 gb|ENK63524.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0539]
 gb|ENK63584.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0562]
 gb|ENK65618.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0547]
 gb|ENK66550.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0565]
 gb|ENK72414.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0571]
 gb|ENK74473.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0584]
 gb|ENK75197.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0580]
 gb|ENK81012.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0622]
 gb|ENK81471.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0602]
 gb|ENK83960.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0586]
 gb|ENK88047.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0628]
 gb|ENK91512.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0648]
 gb|ENK93299.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0646]
 gb|ENK94662.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0660]
 gb|ENK98371.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0663]
 gb|ENL00666.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0673]
 gb|ENL06430.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0687]
 gb|ENL07763.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0692]
 gb|ENL12263.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0695]
 gb|ENL12362.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0719]
 gb|ENL16789.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0769]
 gb|ENL22973.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0792]
 gb|ENL23432.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0780]
 gb|ENL26316.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0770]
 gb|ENL29304.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0822]
 gb|ENL33161.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0823]
 gb|ENL35694.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0799]
 gb|ENL36771.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0844]
 gb|ENL49405.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0892]
 gb|ENL52715.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0900]
 gb|ENL55320.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0927]
 gb|ENL60261.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0953]
 gb|ENL63261.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0964]
 gb|ENL64156.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0934]
 gb|ENL66465.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0978]
 gb|ENL70098.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0994]
 gb|ENL72640.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0998]
 gb|ENL74949.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0999]
 gb|ENL80511.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1010]
 gb|ENL81797.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1015]
 gb|ENL84526.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1016]
 gb|ENL89850.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1037]
 gb|ENL91224.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1036]
 gb|ENL96728.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1061]
 gb|ENL97434.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1044]
 gb|ENL97632.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1062]
 gb|ENM05266.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1068]
 gb|ENM12315.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1063]
 gb|ENM12714.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1076]
 gb|ENM15149.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1092]
 gb|ENM18542.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1093]
 gb|ENM23609.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1095]
 gb|ENM24202.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1109]
 gb|ENM28795.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1103]
 gb|ENM31285.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1119]
 gb|ENM32367.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1126]
 gb|ENM38607.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1167]
 gb|ENM45580.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1188]
 gb|ENM45620.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1170]
 gb|ENM50058.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1224]
 gb|ENM53190.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1229]
 gb|ENM56012.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1244]
 gb|ENM58161.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1257]
 gb|ENM65304.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1275]
 gb|ENM66303.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1286]
 gb|ENM71492.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1291]
 gb|ENM74371.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1309]
 gb|ENM80853.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1320]
 gb|ENM81151.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1321]
 gb|ENM83782.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1322]
 gb|ENM89222.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1367]
 gb|ENM89714.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1373]
 gb|ENM92941.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1359]
 gb|ENM94262.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1374]
 gb|ENN00341.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1394]
 gb|ENN02352.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1450]
 gb|ENN02624.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1405]
 gb|ENN03594.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1451]
 gb|ENN10978.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1481]
 gb|ENN17531.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1510]
 gb|ENN17758.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1520]
 gb|ENN18636.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1521]
 gb|ENN26309.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1531]
 gb|ENN28076.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1533]
 gb|ENN28243.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1544]
 gb|ENN32896.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1556]
 gb|ENN33569.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1563]
 gb|ENN41773.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1565]
 gb|ENN45113.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0943]
 gb|ENN45595.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0944]
 gb|ENN53632.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1198]
 gb|ENN58025.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1199]
 gb|ENN62371.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1248]
 gb|ENN66700.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1253]
 gb|ENN68158.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1255]
 gb|EOR36025.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus 091751]
 gb|EOR91319.1| Putative ABC transporter ATP-binding potein [Staphylococcus aureus 
subsp. aureus CBD-635]
 gb|EPR24222.1| ABC transporter ATP-binding protein [Staphylococcus aureus SA_ST125_MupR]
 gb|EPX91876.1| ABC transporter ATP-binding protein [Staphylococcus aureus SA16]
 gb|EUD20601.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0662]
 gb|EUD21476.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0741]
 gb|EUD23722.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0732]
 gb|EUD26482.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0728]
 gb|EUD28108.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0725]
 gb|EUD33502.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0710]
 gb|EUD33580.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0723]
 gb|EUD37436.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0704]
 gb|EUD38251.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0696]
 gb|EUD42715.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0691]
 gb|EUD44897.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0626]
 gb|EUD48104.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0644]
 gb|EUD50995.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0642]
 gb|EUD54539.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0651]
 gb|EUD56758.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0655]
 gb|EUD59382.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0661]
 gb|EUD62409.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0667]
 gb|EUD75572.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0627]
 gb|EUD78452.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0631]
 gb|EUD79790.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0632]
 gb|EUD85306.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0634]
 gb|EUD89472.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0637]
 gb|EUD93490.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0638]
 gb|EUD97355.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0640]
 gb|EUD97786.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0643]
 gb|EUE03961.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0647]
 gb|EUE07354.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0649]
 gb|EUE10285.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0652]
 gb|EUE12106.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0654]
 gb|EUE14269.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0653]
 gb|EUE18431.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0656]
 gb|EUE21270.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0657]
 gb|EUE25082.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0659]
 gb|EUE30587.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0664]
 gb|EUE35261.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0666]
 gb|EUE38806.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0669]
 gb|EUE45004.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0670]
 gb|EUE48055.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0672]
 gb|EUE51541.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0674]
 gb|EUE54006.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0677]
 gb|EUE57459.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0678]
 gb|EUE60556.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0679]
 gb|EUE62939.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0680]
 gb|EUE66600.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0681]
 gb|EUE67652.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0682]
 gb|EUE71440.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0683]
 gb|EUE75798.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0685]
 gb|EUE77465.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0686]
 gb|EUE82434.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0689]
 gb|EUE86637.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0693]
 gb|EUE90903.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0697]
 gb|EUE93873.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0699]
 gb|EUE95468.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0698]
 gb|EUE96763.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0700]
 gb|EUF01434.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0701]
 gb|EUF02312.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0703]
 gb|EUF06735.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0706]
 gb|EUF09873.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0707]
 gb|EUF09915.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0708]
 gb|EUF17817.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0711]
 gb|EUF18708.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0713]
 gb|EUF24923.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0716]
 gb|EUF29512.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0718]
 gb|EUF29556.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0720]
 gb|EUF33203.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0721]
 gb|EUF35591.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0722]
 gb|EUF39278.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0724]
 gb|EUF43194.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0727]
 gb|EUF48739.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0731]
 gb|EUF53152.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0733]
 gb|EUF54852.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0734]
 gb|EUF57467.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0736]
 gb|EUF61389.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0739]
 gb|EUF61430.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0737]
 gb|EUF66527.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0625]
 gb|EUF67435.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0742]
 gb|EUF67890.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0635]
 gb|EUF74489.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0650]
 gb|EUF75172.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0675]
 gb|EUF77594.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0688]
 gb|EUF82685.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0702]
 gb|EUF86231.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0726]
 gb|EUF89933.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0714]
 gb|EUF91885.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0735]
 gb|EUF92255.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0498]
 gb|EUF98515.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0538]
 gb|EUG06120.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0551]
 gb|EUG11662.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0570]
 gb|EUG16285.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0608]
 gb|EUG21368.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0379]
 gb|EUG25680.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0371]
 gb|EUG26069.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0395]
 gb|EUG27989.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0407]
 gb|EUG30112.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0418]
 gb|EUG32863.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0432]
 gb|EUG41331.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0473]
 gb|EUG46080.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0492]
 gb|EUG49439.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0253]
 gb|EUG51936.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0268]
 gb|EUG56280.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0299]
 gb|EUG63249.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0332]
 gb|EUG71831.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0365]
 gb|EUG73919.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0121]
 gb|EUG74877.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0130]
 gb|EUG81604.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0152]
 gb|EUG85427.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0167]
 gb|EUG87902.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0190]
 gb|EUG90886.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0176]
 gb|EUG92724.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0195]
 gb|EUG92783.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0222]
 gb|EUG98560.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0238]
 gb|EUH03430.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0015]
 gb|EUH04984.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0023]
 gb|EUH11766.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0032]
 gb|EUH15270.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0078]
 gb|EUH23675.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0105]
 gb|EUH29407.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0776]
 gb|EUH33607.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0787]
 gb|EUH39326.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0803]
 gb|EUH42071.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0816]
 gb|EUH44803.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0827]
 gb|EUH45633.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0849]
 gb|EUH47421.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0860]
 gb|EUH48360.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0864]
 gb|EUH50788.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0874]
 gb|EUH55460.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0884]
 gb|EUH62310.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0915]
 gb|EUH64177.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0908]
 gb|EUH66253.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0950]
 gb|EUH68418.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0962]
 gb|EUH71189.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0938]
 gb|EUH73890.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0973]
 gb|EUH76064.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0977]
 gb|EUH80489.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0986]
 gb|EUH83606.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1001]
 gb|EUH85276.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1020]
 gb|EUH85358.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1042]
 gb|EUH88739.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1052]
 gb|EUH92993.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1072]
 gb|EUH93625.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1086]
 gb|EUI07308.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1376]
 gb|EUI08557.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1381]
 gb|EUI12108.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1389]
 gb|EUI20103.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1426]
 gb|EUI23864.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1439]
 gb|EUI30455.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1442]
 gb|EUI32157.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1114]
 gb|EUI33581.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1440]
 gb|EUI34374.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1125]
 gb|EUI37034.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1131]
 gb|EUI37961.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1134]
 gb|EUI39304.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1135]
 gb|EUI43794.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1155]
 gb|EUI51585.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1163]
 gb|EUI52610.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1176]
 gb|EUI52760.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1175]
 gb|EUI55812.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1177]
 gb|EUI58513.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1184]
 gb|EUI64947.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1196]
 gb|EUI68022.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1194]
 gb|EUI72309.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1240]
 gb|EUI74804.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1287]
 gb|EUI77289.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1299]
 gb|EUI80730.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1300]
 gb|EUI83952.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1342]
 gb|EUI85915.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1479]
 gb|EUI89779.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1475]
 gb|EUI93144.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1480]
 gb|EUI94409.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1486]
 gb|EUI94944.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1485]
 gb|EUJ04934.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1499]
 gb|EUJ06010.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1492]
 gb|EUJ08525.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1502]
 gb|EUJ50447.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR948]
 gb|EUJ53314.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1199]
 gb|EUJ55827.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1280]
 gb|EUJ59295.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1366]
 gb|EUJ62183.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1503]
 gb|EUJ66676.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3170]
 gb|EUJ69251.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3165]
 gb|EUJ70429.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3172]
 gb|EUJ72408.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5897]
 gb|EUJ74793.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5898]
 gb|EUJ80117.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5896]
 gb|EUJ82585.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5893]
 gb|EUJ84590.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5894]
 gb|EUJ85261.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5895]
 gb|EUJ91718.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5892]
 gb|EUJ95033.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5891]
 gb|EUJ96719.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5882]
 gb|EUJ98103.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5883]
 gb|EUK01311.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5876]
 gb|EUK04914.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5866]
 gb|EUK07372.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5844]
 gb|EUK08858.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5860]
 gb|EUK12805.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5842]
 gb|EUK15518.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5810]
 gb|EUK20302.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0018]
 gb|EUK22382.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0039]
 gb|EUK22595.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0050]
 gb|EUK29215.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0062]
 gb|EUK29940.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0056]
 gb|EUK30754.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0067]
 gb|EUK37075.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0068]
 gb|EUK39166.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0126]
 gb|EUK39653.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0114]
 gb|EUK40218.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0073]
 gb|EUK46784.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0133]
 gb|EUK49095.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0158]
 gb|EUK53548.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0180]
 gb|EUK55784.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0267]
 gb|EUK57496.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0248]
 gb|EUK58190.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0259]
 gb|EUK63339.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0277]
 gb|EUK66808.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0269]
 gb|EUK68016.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0291]
 gb|EUK71105.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0304]
 gb|EUK73757.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0298]
 gb|EUK75114.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0316]
 gb|EUK78492.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0324]
 gb|EUK82595.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0354]
 gb|EUK83798.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0358]
 gb|EUK87502.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0370]
 gb|EUK87805.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0366]
 gb|EUK93681.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0397]
 gb|EUK98021.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0394]
 gb|EUL01793.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0410]
 gb|EUL02728.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0429]
 gb|EUL06545.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0434]
 gb|EUL09088.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0444]
 gb|EUL10167.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0459]
 gb|EUL13612.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0488]
 gb|EUL17210.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0495]
 gb|EUL19801.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0499]
 gb|EUL21729.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0535]
 gb|EUL22744.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0502]
 gb|EUL28655.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0560]
 gb|EUN41244.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0832]
 gb|EUN43229.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0846]
 gb|EUN44739.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0743]
 gb|EUN48194.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0848]
 gb|EUN52177.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0854]
 gb|EUN53603.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0857]
 gb|EUN55532.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0867]
 gb|EUN60224.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0873]
 gb|EUN60449.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0870]
 gb|EUN62370.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0882]
 gb|EUN69301.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0886]
 gb|EUN70259.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0904]
 gb|EUN71980.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0888]
 gb|EUN76765.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0906]
 gb|EUN79487.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0921]
 gb|EUN81544.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0923]
 gb|EUN83841.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0939]
 gb|EUN86198.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0949]
 gb|EUN91776.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0980]
 gb|EUN92474.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0959]
 gb|EUN95077.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0991]
 gb|EUO01619.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0992]
 gb|EUO01897.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0996]
 gb|EUO06669.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1008]
 gb|EUO08484.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1018]
 gb|EUO09807.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1024]
 gb|EUO13976.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1028]
 gb|EUO14355.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1029]
 gb|EUO19276.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1039]
 gb|EUO22146.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1047]
 gb|EUO25011.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1051]
 gb|EUO25785.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1055]
 gb|EUO29660.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1057]
 gb|EUO33827.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1071]
 gb|EUO41104.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1075]
 gb|EUO44881.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1097]
 gb|EUO45791.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1099]
 gb|EUO46730.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1100]
 gb|EUO50741.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1561]
 gb|EUO53542.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0755]
 gb|EUO55313.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1579]
 gb|EUO58676.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0765]
 gb|EUO60343.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1379]
 gb|EUO65116.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1368]
 gb|EUO66822.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1385]
 gb|EUO70798.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1384]
 gb|EUO74640.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1388]
 gb|EUO77439.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1468]
 gb|EUO77690.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1418]
 gb|EUO82062.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1404]
 gb|EUO82455.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1473]
 gb|EUO86470.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1343]
 gb|EUO87807.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1339]
 gb|EUO91810.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1357]
 gb|EUO92575.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1358]
 gb|EUO97174.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1362]
 gb|EUO99414.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1488]
 gb|EUP01802.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1494]
 gb|EUP05488.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1509]
 gb|EUP08617.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1522]
 gb|EUP09586.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1527]
 gb|EUP10739.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1503]
 gb|EUP15584.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1536]
 gb|EUP19058.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1543]
 gb|EUP21109.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1547]
 gb|EUP22462.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1539]
 gb|EUP26549.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1548]
 gb|EUP28554.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1549]
 gb|EUP31110.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1554]
 gb|EUP34835.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1558]
 gb|EUP35959.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1555]
 gb|EUP37189.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0805]
 gb|EUP43052.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCLE6100]
 gb|EUP48870.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6046]
 gb|EUP70558.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6117]
 gb|EUP74743.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6125]
 gb|EUP79213.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6121]
 gb|EUP80637.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC6117]
 gb|EUP97580.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6110]
 gb|EUQ21338.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6118]
 gb|EUQ36628.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6104]
 gb|EUQ41787.1| ABC transporter, ATP-binding protein [Staphylococcus aureus PLAC6024]
 gb|EUQ43437.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6106]
 gb|EUQ50118.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6034]
 gb|EUQ50485.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6042]
 gb|EUQ56779.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AGEN6009]
 gb|EUQ64888.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6003]
 gb|EUQ66528.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6004]
 gb|EUQ70275.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC0016]
 gb|EUQ72045.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6030]
 gb|EUQ72847.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6001]
 gb|EUQ77097.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6073]
 gb|EUQ83797.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6047]
 gb|EUQ91975.1| ABC transporter, ATP-binding protein [Staphylococcus aureus PLAC6019]
 gb|EUR08918.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6051]
 gb|EUR16945.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6020]
 gb|EUR30820.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6050]
 gb|EUR49392.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0004]
 gb|EUR49509.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0005]
 gb|EUR57304.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0009]
 gb|EUR61307.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0010]
 gb|EUR63692.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0012]
 gb|EUR66061.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0011]
 gb|EUR73509.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0013]
 gb|EUR75459.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0016]
 gb|EUR75886.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0014]
 gb|EUR83902.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0017]
 gb|EUR84995.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0022]
 gb|EUR89603.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0021]
 gb|EUR91770.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0024]
 gb|EUR91806.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0025]
 gb|EUR99549.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0028]
 gb|EUS00030.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0027]
 gb|EUS05956.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0030]
 gb|EUS06960.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0031]
 gb|EUS08258.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0034]
 gb|EUS17744.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0038]
 gb|EUS21064.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0040]
 gb|EUS22762.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0041]
 gb|EUS26912.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0042]
 gb|EUS29401.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0043]
 gb|EUS29528.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0044]
 gb|EUS31667.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0046]
 gb|EUS37288.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0049]
 gb|EUS38928.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0048]
 gb|EUS41928.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0051]
 gb|EUS45308.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0052]
 gb|EUS45827.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0054]
 gb|EUS51456.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0057]
 gb|EUS52776.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0058]
 gb|EUS54105.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0061]
 gb|EUS59557.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0063]
 gb|EUS60285.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0064]
 gb|EUS62034.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0065]
 gb|EUS68301.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0069]
 gb|EUS70944.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0071]
 gb|EUS70994.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0070]
 gb|EUS76014.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0074]
 gb|EUS79134.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0079]
 gb|EUS81747.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0076]
 gb|EUS83971.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0081]
 gb|EUS89305.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0082]
 gb|EUS90491.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0084]
 gb|EUS94303.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0083]
 gb|EUS97450.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0086]
 gb|EUS98707.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0087]
 gb|EUT00306.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0089]
 gb|EUT07294.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0092]
 gb|EUT13212.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0094]
 gb|EUT14576.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0095]
 gb|EUT17516.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0096]
 gb|EUT20735.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0098]
 gb|EUT21180.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0099]
 gb|EUT42955.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0110]
 gb|EUT51435.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0112]
 gb|EUT54024.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0115]
 gb|EUT57709.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0116]
 gb|EUT57811.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0118]
 gb|EUT59443.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0117]
 gb|EUT61939.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0119]
 gb|EUT65679.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0120]
 gb|EUT66969.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0122]
 gb|EUT71779.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0124]
 gb|EUT76945.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0125]
 gb|EUT78522.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0127]
 gb|EUT85873.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0128]
 gb|EUT89830.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0131]
 gb|EUT90259.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0132]
 gb|EUT94121.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0134]
 gb|EUT99394.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0136]
 gb|EUT99718.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0135]
 gb|EUU06295.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0137]
 gb|EUU06753.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0138]
 gb|EUU10663.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0141]
 gb|EUU13789.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0142]
 gb|EUU14787.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0143]
 gb|EUU18256.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0145]
 gb|EUU19971.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0147]
 gb|EUU22033.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0146]
 gb|EUU25940.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0148]
 gb|EUU28740.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0149]
 gb|EUU33021.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0155]
 gb|EUU33320.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0153]
 gb|EUU37056.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0156]
 gb|EUU39254.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0157]
 gb|EUU40807.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0159]
 gb|EUU44220.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0160]
 gb|EUU47629.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0161]
 gb|EUU50011.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0162]
 gb|EUU53274.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0163]
 gb|EUU57245.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0164]
 gb|EUU60162.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0165]
 gb|EUU60549.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0166]
 gb|EUU64224.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0168]
 gb|EUU66903.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0169]
 gb|EUU67646.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0170]
 gb|EUU73249.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0172]
 gb|EUU75749.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0174]
 gb|EUU76606.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0175]
 gb|EUU80682.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0178]
 gb|EUU82957.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0181]
 gb|EUU86927.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0182]
 gb|EUU91459.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0184]
 gb|EUU92336.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0183]
 gb|EUV00831.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0187]
 gb|EUV04947.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0188]
 gb|EUV08600.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0191]
 gb|EUV10413.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0193]
 gb|EUV13100.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0194]
 gb|EUV16054.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0196]
 gb|EUV16846.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0198]
 gb|EUV21756.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0199]
 gb|EUV24633.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0203]
 gb|EUV25824.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0201]
 gb|EUV28965.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0202]
 gb|EUV32368.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0204]
 gb|EUV34056.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0205]
 gb|EUV37347.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0207]
 gb|EUV39178.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0209]
 gb|EUV41307.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0208]
 gb|EUV44973.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0211]
 gb|EUV49326.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0215]
 gb|EUV50098.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0214]
 gb|EUV53547.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0218]
 gb|EUV56939.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0219]
 gb|EUV58028.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0220]
 gb|EUV62440.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0224]
 gb|EUV64478.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0225]
 gb|EUV64883.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0226]
 gb|EUV70319.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0227]
 gb|EUV71978.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0229]
 gb|EUV78117.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0230]
 gb|EUV78151.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0231]
 gb|EUV83206.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0232]
 gb|EUV87259.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0234]
 gb|EUV91339.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0241]
 gb|EUV93499.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0242]
 gb|EUV97023.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0244]
 gb|EUV99350.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0246]
 gb|EUW03216.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0245]
 gb|EUW03939.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0247]
 gb|EUW08040.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0249]
 gb|EUW08288.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0251]
 gb|EUW15602.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0254]
 gb|EUW18167.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0256]
 gb|EUW24474.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0258]
 gb|EUW26597.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0264]
 gb|EUW27183.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0263]
 gb|EUW35276.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0271]
 gb|EUW40408.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0275]
 gb|EUW46061.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0278]
 gb|EUW47840.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0281]
 gb|EUW47892.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0283]
 gb|EUW53761.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0286]
 gb|EUW54566.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0285]
 gb|EUW57090.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0287]
 gb|EUW59592.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0289]
 gb|EUW64507.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0292]
 gb|EUW66021.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0290]
 gb|EUW68184.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0295]
 gb|EUW68828.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0293]
 gb|EUW74908.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0296]
 gb|EUW75154.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0297]
 gb|EUW80334.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0300]
 gb|EUW85106.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0302]
 gb|EUW89943.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0303]
 gb|EUW91854.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0305]
 gb|EUW94069.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0309]
 gb|EUW98351.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0310]
 gb|EUX00913.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0313]
 gb|EUX02782.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0314]
 gb|EUX08815.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0317]
 gb|EUX10659.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0319]
 gb|EUX15030.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0321]
 gb|EUX15208.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0320]
 gb|EUX20097.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0322]
 gb|EUX23040.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0325]
 gb|EUX26023.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0323]
 gb|EUX28292.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0327]
 gb|EUX30391.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0331]
 gb|EUX33185.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0333]
 gb|EUX35145.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0335]
 gb|EUX39708.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0336]
 gb|EUX42896.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0338]
 gb|EUX46530.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0339]
 gb|EUX54089.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0342]
 gb|EUX54140.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0344]
 gb|EUX59575.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0345]
 gb|EUX60154.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0346]
 gb|EUX64646.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0348]
 gb|EUX66248.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0349]
 gb|EUX71160.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0355]
 gb|EUX73002.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0356]
 gb|EUX83219.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0360]
 gb|EUX85343.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0361]
 gb|EUX89182.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0368]
 gb|EUX92537.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0369]
 gb|EUX96348.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0372]
 gb|EUX97246.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0373]
 gb|EUY01921.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0376]
 gb|EUY04670.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0378]
 gb|EUY05492.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0377]
 gb|EUY09822.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0380]
 gb|EUY14223.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0383]
 gb|EUY17887.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0384]
 gb|EUY20720.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0386]
 gb|EUY21425.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0385]
 gb|EUY26445.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0388]
 gb|EUY30856.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0390]
 gb|EUY31314.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0398]
 gb|EUY35211.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0399]
 gb|EUY35767.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0400]
 gb|EUY41262.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0402]
 gb|EUY42604.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0403]
 gb|EUY42912.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0405]
 gb|EUY48480.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0406]
 gb|EUY51169.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0409]
 gb|EUY51289.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0411]
 gb|EUY55789.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0412]
 gb|EUY61798.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0414]
 gb|EUY64982.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0416]
 gb|EUY67424.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0419]
 gb|EUY67893.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0417]
 gb|EUY72133.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0420]
 gb|EUY75011.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0421]
 gb|EUY77600.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0425]
 gb|EUY80191.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0423]
 gb|EUY82876.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0428]
 gb|EUY88065.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0430]
 gb|EUY88717.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0431]
 gb|EUY94084.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0433]
 gb|EUZ00109.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0439]
 gb|EUZ02520.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0440]
 gb|EUZ08348.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0442]
 gb|EUZ08851.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0441]
 gb|EUZ12882.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0445]
 gb|EUZ14019.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0447]
 gb|EUZ17964.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0448]
 gb|EUZ21813.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0451]
 gb|EUZ22139.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0449]
 gb|EUZ28809.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0452]
 gb|EUZ35853.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0458]
 gb|EUZ42120.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0463]
 gb|EUZ42231.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0462]
 gb|EUZ45855.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0464]
 gb|EUZ49793.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0466]
 gb|EUZ54889.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0471]
 gb|EUZ59697.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0472]
 gb|EUZ63332.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0475]
 gb|EUZ65560.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0476]
 gb|EUZ71618.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0481]
 gb|EUZ72182.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0482]
 gb|EUZ76451.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0484]
 gb|EUZ85138.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0487]
 gb|EUZ88205.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0491]
 gb|EUZ90448.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0496]
 gb|EUZ95024.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0501]
 gb|EUZ96332.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0503]
 gb|EUZ97911.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0505]
 gb|EVA03006.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0506]
 gb|EVA04800.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0508]
 gb|EVA09745.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0512]
 gb|EVA11966.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0514]
 gb|EVA16237.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0515]
 gb|EVA18168.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0516]
 gb|EVA23811.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0518]
 gb|EVA25002.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0519]
 gb|EVA26556.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0520]
 gb|EVA30306.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0523]
 gb|EVA33921.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0525]
 gb|EVA39680.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0530]
 gb|EVA41457.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0532]
 gb|EVA46051.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0533]
 gb|EVA49512.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0534]
 gb|EVA51154.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0537]
 gb|EVA53695.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0540]
 gb|EVA65140.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0544]
 gb|EVA67554.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0545]
 gb|EVA71101.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0546]
 gb|EVA72968.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0548]
 gb|EVA76262.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0550]
 gb|EVA76929.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0549]
 gb|EVA82944.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0554]
 gb|EVA89159.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0556]
 gb|EVA90870.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0558]
 gb|EVA91773.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0557]
 gb|EVA97556.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0559]
 gb|EVB03871.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0566]
 gb|EVB09866.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0569]
 gb|EVB10930.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0568]
 gb|EVB17460.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0572]
 gb|EVB18489.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0573]
 gb|EVB24528.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0579]
 gb|EVB28171.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0581]
 gb|EVB31570.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0582]
 gb|EVB32372.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0583]
 gb|EVB34612.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0587]
 gb|EVB36129.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0585]
 gb|EVB40719.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0588]
 gb|EVB46024.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0589]
 gb|EVB48362.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0591]
 gb|EVB52949.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0592]
 gb|EVB54962.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0595]
 gb|EVB60037.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0598]
 gb|EVB63177.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0601]
 gb|EVB63427.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0599]
 gb|EVB68263.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0603]
 gb|EVB70659.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0604]
 gb|EVB72502.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0605]
 gb|EVB77427.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0609]
 gb|EVB78632.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0607]
 gb|EVB83714.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0610]
 gb|EVB84929.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0611]
 gb|EVB85912.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0612]
 gb|EVB88848.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0613]
 gb|EVB97585.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0617]
 gb|EVC00458.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0619]
 gb|EVC02914.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0618]
 gb|EVC06714.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0621]
 gb|EVC08620.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0623]
 gb|EVC13128.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0624]
 gb|EVC14737.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6052]
 gb|EVC25515.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6071]
 gb|EVC38026.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6010]
 gb|EVC39530.1| ABC transporter, ATP-binding protein [Staphylococcus aureus CHAP6049]
 gb|EVC41119.1| ABC transporter, ATP-binding protein [Staphylococcus aureus PLAC6012]
 gb|EVC42599.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6054]
 gb|EVC46260.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6011]
 gb|EVC55994.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HBHO6042]
 gb|EVC65052.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6053]
 gb|EVC68063.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6019]
 gb|EVC71748.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6012]
 gb|EVC74417.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6054]
 gb|EVC81320.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6057]
 gb|EVC94609.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6016]
 gb|EVC96930.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6040]
 gb|EVC98802.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6068]
 gb|EVD02114.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6014]
 gb|EVD06360.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6068]
 gb|EVD16829.1| ABC transporter, ATP-binding protein [Staphylococcus aureus CHOC6056]
 gb|EVD22856.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6095]
 gb|EVD28311.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6067]
 gb|EVD29590.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6074]
 gb|EVD33143.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6072]
 gb|EVD37351.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6038]
 gb|EVD48990.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6046]
 gb|EVD62908.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6049]
 gb|EVD69248.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6074]
 gb|EVD78737.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6055]
 gb|EVD79002.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC0047]
 gb|EVD87310.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6097]
 gb|EVD92638.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AGEN6033]
 gb|EVE00371.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6003]
 gb|EVE01786.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6052]
 gb|EVE05922.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6002]
 gb|EVE09415.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6004]
 gb|EVE16852.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6005]
 gb|EVE23058.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6007]
 gb|EVE28873.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6016]
 gb|EVE35867.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6037]
 gb|EVE36861.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6034]
 gb|EVE39909.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6038]
 gb|EVE44172.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCLE6003]
 gb|EVE45262.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6014]
 gb|EVE47952.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6010]
 gb|EVE53327.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6003]
 gb|EVE53642.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6018]
 gb|EVE58179.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6002]
 gb|EVE65392.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC0010]
 gb|EVE76217.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6013]
 gb|EVE78136.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6014]
 gb|EVE80477.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6001]
 gb|EVE89951.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6048]
 gb|EVE90567.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6012]
 gb|EVE91119.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6042]
 gb|EVE96411.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6022]
 gb|EVE98121.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6027]
 gb|EVF02906.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6004]
 gb|EVF07161.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6001]
 gb|EVF09847.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6002]
 gb|EVF18946.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCOA6008]
 gb|EVF21153.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6025]
 gb|EVF22998.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6003]
 gb|EVF28900.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6050]
 gb|EVF29978.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6015]
 gb|EVF33625.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6047]
 gb|EVF36334.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6046]
 gb|EVF38785.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6022]
 gb|EVF44201.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6010]
 gb|EVF53779.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6028]
 gb|EVF64000.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6021]
 gb|EVF66518.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCLE6010]
 gb|EVF66879.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6041]
 gb|EVF73964.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6011]
 gb|EVF76945.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6034]
 gb|EVF92135.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6011]
 gb|EVF95322.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6016]
 gb|EVF97997.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6092]
 gb|EVG04894.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6124]
 gb|EVG05027.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6105]
 gb|EVG13478.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6125]
 gb|EVG14710.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6118]
 gb|EVG19033.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6053]
 gb|EVG19494.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6107]
 gb|EVG29068.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6101]
 gb|EVG31480.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6126]
 gb|EVG36635.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6109]
 gb|EVG43134.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6076]
 gb|EVG44234.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6085]
 gb|EVG54524.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6104]
 gb|EVG64024.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6052]
 gb|EVG71151.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6066]
 gb|EVG74413.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6069]
 gb|EVG76270.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6144]
 gb|EVG76644.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6070]
 gb|EVG80190.1| ABC transporter, ATP-binding protein [Staphylococcus aureus COAS6060]
 gb|EVG84565.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6026]
 gb|EVG87155.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6019]
 gb|EVG88710.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6022]
 gb|EVG97189.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6077]
 gb|EVG98891.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6134]
 gb|EVH08395.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6076]
 gb|EVH13410.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6120]
 gb|EVH16263.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6124]
 gb|EVH16750.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6024]
 gb|EVH22509.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6106]
 gb|EVH26279.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6023]
 gb|EVH29479.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6027]
 gb|EVH33279.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINB6023]
 gb|EVH33874.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINB6024]
 gb|EVH34128.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6084]
 gb|EVH38740.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6111]
 gb|EVH38904.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6108]
 gb|EVH44290.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6075]
 gb|EVH49171.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6035]
 gb|EVH52631.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6030]
 gb|EVH54345.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6033]
 gb|EVH55125.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6081]
 gb|EVH55259.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC6078]
 gb|EVH59841.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AMMC6119]
 gb|EVH61816.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6085]
 gb|EVH67910.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6090]
 gb|EVH67967.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC6084]
 gb|EVH83092.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SMMC6121]
 gb|EVH86522.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCLE6032]
 gb|EVH88659.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6036]
 gb|EVI04927.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6096]
 gb|EVI14383.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6104]
 gb|EVI14446.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6087]
 gb|EVI15457.1| ABC transporter, ATP-binding protein [Staphylococcus aureus AGEN6042]
 gb|EVI25055.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6105]
 gb|EVI25730.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6092]
 gb|EVI30344.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6065]
 gb|EVI38135.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6024]
 gb|EVI42597.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6115]
 gb|EVI44002.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6040]
 gb|EVI49693.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC6106]
 gb|EVI55069.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6114]
 gb|EVI60686.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6123]
 gb|EVI61864.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6117]
 gb|EVI64369.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6026]
 gb|EVI68164.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6078]
 gb|EVI69946.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6123]
 gb|EVI71054.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6080]
 gb|EVI83433.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCLE6040]
 gb|EVI93118.1| ABC transporter, ATP-binding protein [Staphylococcus aureus FVRH6129]
 gb|EVJ02136.1| ABC transporter, ATP-binding protein [Staphylococcus aureus PLAC6044]
 gb|EVJ26921.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6062]
 gb|EVJ27978.1| ABC transporter, ATP-binding protein [Staphylococcus aureus CHAP6102]
 gb|EVJ30773.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6071]
 gb|EVJ35524.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HBHO6024]
 gb|EVJ37802.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6058]
 gb|EVJ52041.1| ABC transporter, ATP-binding protein [Staphylococcus aureus PLAC6055]
 gb|EVJ58996.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6043]
 gb|EVJ60757.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WAMC6086]
 gb|EVJ63139.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6053]
 gb|EVJ78274.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6047]
 gb|EVJ82916.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0746]
 gb|EVJ84767.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0744]
 gb|EVJ90239.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0772]
 gb|EVJ90386.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0752]
 gb|EVJ95993.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0774]
 gb|EVK00302.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0775]
 gb|EVK04964.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0779]
 gb|EVK08403.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0782]
 gb|EVK11232.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0783]
 gb|EVK12476.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0784]
 gb|EVK17474.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0785]
 gb|EVK18425.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0786]
 gb|EVK21392.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0788]
 gb|EVK25012.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0789]
 gb|EVK30150.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0791]
 gb|EVK33763.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0793]
 gb|EVK33861.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0794]
 gb|EVK38656.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0796]
 gb|EVK39730.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0798]
 gb|EVK49988.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0804]
 gb|EVK51775.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0802]
 gb|EVK54681.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0806]
 gb|EVK56993.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0807]
 gb|EVK60295.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0808]
 gb|EVK63073.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0810]
 gb|EVK63114.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0809]
 gb|EVK68558.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0811]
 gb|EVK69608.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0814]
 gb|EVK69681.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0812]
 gb|EVK77654.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0817]
 gb|EVK79340.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0818]
 gb|EVK86612.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0824]
 gb|EVK92188.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0826]
 gb|EVK94135.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0830]
 gb|EVL01317.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0836]
 gb|EVL04376.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0837]
 gb|EVL08772.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0838]
 gb|EVL09964.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0839]
 gb|EVL12848.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0840]
 gb|EVL15984.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0841]
 gb|EVL18154.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0842]
 gb|EVL21325.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0843]
 gb|EVL23779.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0845]
 gb|EVL28287.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0850]
 gb|EVL30211.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0851]
 gb|EVL31933.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0852]
 gb|EVL37625.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0855]
 gb|EVL42633.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0861]
 gb|EVL47495.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0862]
 gb|EVL54128.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0865]
 gb|EVL58516.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0868]
 gb|EVL58850.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0869]
 gb|EVL62291.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0872]
 gb|EVL63574.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0875]
 gb|EVL67190.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0876]
 gb|EVL72190.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0879]
 gb|EVL75691.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0878]
 gb|EVL76812.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0880]
 gb|EVL80780.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0885]
 gb|EVL82145.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0883]
 gb|EVL84486.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0887]
 gb|EVL88360.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0889]
 gb|EVL90885.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0890]
 gb|EVL94932.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0891]
 gb|EVL99738.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0895]
 gb|EVM03988.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0897]
 gb|EVM05848.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0899]
 gb|EVM06011.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0898]
 gb|EVM11891.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0902]
 gb|EVM17580.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0903]
 gb|EVM19318.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0901]
 gb|EVM21688.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0905]
 gb|EVM23544.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0909]
 gb|EVM32305.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0911]
 gb|EVM34324.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0914]
 gb|EVM39664.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0917]
 gb|EVM43467.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0918]
 gb|EVM46933.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0920]
 gb|EVM47021.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0919]
 gb|EVM52619.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0922]
 gb|EVM54933.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0924]
 gb|EVM58585.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0929]
 gb|EVM60033.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0928]
 gb|EVM63107.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0930]
 gb|EVM66998.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0932]
 gb|EVM67048.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0931]
 gb|EVM71811.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0935]
 gb|EVM72182.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0936]
 gb|EVM79999.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0940]
 gb|EVM81486.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0941]
 gb|EVM84553.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0942]
 gb|EVM87755.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0947]
 gb|EVM93641.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0948]
 gb|EVM95057.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0954]
 gb|EVN00800.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0951]
 gb|EVN02634.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0956]
 gb|EVN05209.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0957]
 gb|EVN08771.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0960]
 gb|EVN10178.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0961]
 gb|EVN15620.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0965]
 gb|EVN18202.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0966]
 gb|EVN20029.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0967]
 gb|EVN20250.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0968]
 gb|EVN21386.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0969]
 gb|EVN27444.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0970]
 gb|EVN30287.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0972]
 gb|EVN32162.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0971]
 gb|EVN35721.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0974]
 gb|EVN40894.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0979]
 gb|EVN41402.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0975]
 gb|EVN43200.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0983]
 gb|EVN46181.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0984]
 gb|EVN52143.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0988]
 gb|EVN54299.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0985]
 gb|EVN60650.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0989]
 gb|EVN64661.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0993]
 gb|EVN64908.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1002]
 gb|EVN68118.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1000]
 gb|EVN73379.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1003]
 gb|EVN76475.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1006]
 gb|EVN80889.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1009]
 gb|EVN82439.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1012]
 gb|EVN83487.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1011]
 gb|EVN87074.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1013]
 gb|EVN89870.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1019]
 gb|EVN90968.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1014]
 gb|EVN98452.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1021]
 gb|EVO01583.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1023]
 gb|EVO05965.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1025]
 gb|EVO07851.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1026]
 gb|EVO09624.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1027]
 gb|EVO13756.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1030]
 gb|EVO15961.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1031]
 gb|EVO19404.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1033]
 gb|EVO23947.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1041]
 gb|EVO27664.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1043]
 gb|EVO30695.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1046]
 gb|EVO31544.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1045]
 gb|EVO35405.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1048]
 gb|EVO36580.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1049]
 gb|EVO40956.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1050]
 gb|EVO42055.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1053]
 gb|EVO45825.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1054]
 gb|EVO51025.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1058]
 gb|EVO53903.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1059]
 gb|EVO57747.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1066]
 gb|EVO59723.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1067]
 gb|EVO61844.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1069]
 gb|EVO65991.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1074]
 gb|EVO68207.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1077]
 gb|EVO69461.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1070]
 gb|EVO73562.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1079]
 gb|EVO76296.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1080]
 gb|EVO78388.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1081]
 gb|EVO81950.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1082]
 gb|EVO82013.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1084]
 gb|EVO88663.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1085]
 gb|EVO89902.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1087]
 gb|EVO90383.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1088]
 gb|EVO95217.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1089]
 gb|EVO97808.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1091]
 gb|EVO99911.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1090]
 gb|EVP04010.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1096]
 gb|EVP11278.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1102]
 gb|EVP14088.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1560]
 gb|EVP16416.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1562]
 gb|EVP17942.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1566]
 gb|EVP22127.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1567]
 gb|EVP25813.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1569]
 gb|EVP26347.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1570]
 gb|EVP30819.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1571]
 gb|EVP33403.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1572]
 gb|EVP33957.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1573]
 gb|EVP39928.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1575]
 gb|EVP40164.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1574]
 gb|EVP40955.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1576]
 gb|EVP47451.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1577]
 gb|EVP49604.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0747]
 gb|EVP54478.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0749]
 gb|EVP56142.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0753]
 gb|EVP59193.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0754]
 gb|EVP60567.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0757]
 gb|EVP66107.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0759]
 gb|EVP75377.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0762]
 gb|EVP78854.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0763]
 gb|EVP80691.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0764]
 gb|EVP85278.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0767]
 gb|EVP92526.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1369]
 gb|EVP93055.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1366]
 gb|EVQ00533.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1371]
 gb|EVQ02088.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1372]
 gb|EVQ02779.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1370]
 gb|EVQ08036.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1378]
 gb|EVQ10548.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1380]
 gb|EVQ10630.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1377]
 gb|EVQ20080.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1386]
 gb|EVQ24099.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1387]
 gb|EVQ24656.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1390]
 gb|EVQ27170.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1391]
 gb|EVQ34105.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1392]
 gb|EVQ36507.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1395]
 gb|EVQ38552.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1397]
 gb|EVQ42060.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1398]
 gb|EVQ46858.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1401]
 gb|EVQ50807.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1402]
 gb|EVQ52861.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1403]
 gb|EVQ54505.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1406]
 gb|EVQ64197.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1410]
 gb|EVQ66060.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1411]
 gb|EVQ69118.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1412]
 gb|EVQ71088.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1413]
 gb|EVQ77514.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1414]
 gb|EVQ81902.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1416]
 gb|EVQ82393.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1417]
 gb|EVQ86437.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1420]
 gb|EVQ87500.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1421]
 gb|EVQ90850.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1422]
 gb|EVQ97202.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1423]
 gb|EVQ98902.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1425]
 gb|EVQ99042.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1428]
 gb|EVR02273.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1429]
 gb|EVR06043.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1430]
 gb|EVR07569.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1431]
 gb|EVR09726.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1432]
 gb|EVR13013.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1433]
 gb|EVR17096.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1434]
 gb|EVR20211.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1435]
 gb|EVR21767.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1437]
 gb|EVR28968.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1438]
 gb|EVR30538.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1441]
 gb|EVR36680.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1444]
 gb|EVR39204.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1445]
 gb|EVR39935.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1446]
 gb|EVR45707.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1449]
 gb|EVR48351.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1448]
 gb|EVR52557.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1452]
 gb|EVR56085.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1454]
 gb|EVR60318.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1455]
 gb|EVR63197.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1456]
 gb|EVR63976.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1457]
 gb|EVR67164.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1458]
 gb|EVR70898.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1459]
 gb|EVR74385.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1460]
 gb|EVR75579.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1461]
 gb|EVR78824.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1464]
 gb|EVR82972.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1467]
 gb|EVR83288.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1469]
 gb|EVR84897.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1465]
 gb|EVR90218.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1471]
 gb|EVR90588.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1470]
 gb|EVR98283.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1474]
 gb|EVR99530.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1344]
 gb|EVS04076.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1345]
 gb|EVS05558.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1338]
 gb|EVS08777.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1347]
 gb|EVS14096.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1349]
 gb|EVS17395.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1350]
 gb|EVS22266.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1352]
 gb|EVS26298.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1353]
 gb|EVS26477.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1354]
 gb|EVS30566.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1355]
 gb|EVS31675.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1356]
 gb|EVS36653.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1361]
 gb|EVS36837.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1360]
 gb|EVS40762.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1363]
 gb|EVS44158.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1365]
 gb|EVS46449.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1476]
 gb|EVS47166.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1477]
 gb|EVS51533.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1478]
 gb|EVS54785.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1482]
 gb|EVS57472.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1484]
 gb|EVS58419.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1483]
 gb|EVS63510.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1490]
 gb|EVS63617.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1489]
 gb|EVS63744.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1487]
 gb|EVS72735.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1493]
 gb|EVS78141.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1500]
 gb|EVS78188.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1497]
 gb|EVS84821.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1501]
 gb|EVS85607.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1504]
 gb|EVS86086.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1505]
 gb|EVS92227.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1507]
 gb|EVS96586.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1508]
 gb|EVS98216.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1506]
 gb|EVT03173.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1512]
 gb|EVT03406.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1513]
 gb|EVT03634.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1511]
 gb|EVT12306.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1515]
 gb|EVT16771.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1516]
 gb|EVT18540.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1518]
 gb|EVT22908.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1523]
 gb|EVT27562.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1525]
 gb|EVT30281.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1528]
 gb|EVT33400.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1529]
 gb|EVT35278.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1530]
 gb|EVT37909.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1532]
 gb|EVT38640.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1534]
 gb|EVT43261.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1535]
 gb|EVT46556.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1538]
 gb|EVT47617.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1541]
 gb|EVT50244.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1542]
 gb|EVT54788.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1545]
 gb|EVT56745.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1551]
 gb|EVT57236.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1550]
 gb|EVT58399.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1552]
 gb|EVT64241.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1553]
 gb|EVT68716.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1559]
 gb|EVT69837.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1557]
 gb|EVU23014.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M81424]
 gb|EVU34704.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M81493]
 gb|EVU39883.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F41906]
 gb|EVU42355.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F41913]
 gb|EVU42521.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F41882]
 gb|EVU53038.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T49441]
 gb|EVU53290.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W31852]
 gb|EVU55644.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W31936]
 gb|EVU60002.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W31862]
 gb|EVU63845.1| ABC transporter, ATP-binding protein [Staphylococcus aureus S30087]
 gb|EVU67897.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F84093]
 gb|EVU68178.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H83536]
 gb|EVU72245.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F48584]
 gb|EVU76083.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M92071]
 gb|EVU83668.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W35325]
 gb|EVU98216.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T59607]
 gb|EVV02200.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W41914]
 gb|EVV08085.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W41918]
 gb|EVV08909.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M41648]
 gb|EVV13307.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F54452]
 gb|EVV18301.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F54467]
 gb|EVV21614.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F54494]
 gb|EVV21951.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F54471]
 gb|EVV29607.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H12818]
 gb|EVV37160.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F16077]
 gb|EVV38013.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F25913]
 gb|EVV61206.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F12874]
 gb|EVV61375.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H57070]
 gb|EVV62672.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T25611]
 gb|EVV71809.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H69239]
 gb|EVV77877.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W18443]
 gb|EVV93585.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M73849]
 gb|EVW04607.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T41081]
 gb|EVW04924.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T28847]
 gb|EVW06597.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H84489]
 gb|EVW17285.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F40814]
 gb|EVW18295.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T28854]
 gb|EVW21130.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M80333]
 gb|EVW35798.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W39902]
 gb|EVW38549.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H15665]
 gb|EVW39115.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F52748]
 gb|EVW42772.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M12703]
 gb|EVW49549.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H87658]
 gb|EVW49600.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M12717]
 gb|EVW60084.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H18808]
 gb|EVW60517.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H18813]
 gb|EVW64308.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H18809]
 gb|EVW68237.1| ABC transporter, ATP-binding protein [Staphylococcus aureus S72396]
 gb|EVW68414.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M16220]
 gb|EVW71902.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H18811]
 gb|EVW88052.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T62848]
 gb|EVW88495.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T62854]
 gb|EVW94618.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F62007]
 gb|EVW95935.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F62010]
 gb|EVW96876.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M20894]
 gb|EVX02519.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M20913]
 gb|EVX06718.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M20916]
 gb|EVX10795.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H27739]
 gb|EVX13631.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H27777]
 gb|EVX20329.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F65057]
 gb|EVX25438.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M27449]
 gb|EVX32540.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T71888]
 gb|EVX42740.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H33594]
 gb|EVX52250.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W60784]
 gb|EVX55328.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H30732]
 gb|EVX61247.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T78544]
 gb|EVX61891.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F77005]
 gb|EVX70568.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H30737]
 gb|EVX74809.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F68118]
 gb|EVX85598.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F80358]
 gb|EVX86298.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F80349]
 gb|EVX93236.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F80375]
 gb|EVX93847.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T84594]
 gb|EVX96569.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T84592]
 gb|EVY01066.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T84595]
 gb|EVY02904.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H45755]
 gb|EVY09152.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H45760]
 gb|EVY11057.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F83251]
 gb|EVY13646.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F83269]
 gb|EVY29174.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H48649]
 gb|EVY31338.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T81559]
 gb|EVY31784.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T87965]
 gb|EVY35655.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T87972]
 gb|EVY37398.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F89441]
 gb|EVY40535.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F89468]
 gb|EVY45813.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W79328]
 gb|EVY48330.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H54403]
 gb|EVY51243.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F92753]
 gb|EVY56844.1| ABC transporter, ATP-binding protein [Staphylococcus aureus S11444]
 gb|EVY60167.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T16281]
 gb|EVY65036.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W76127]
 gb|EVY66178.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H57815]
 gb|EVY79388.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W20433]
 gb|EVY81382.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T49833]
 gb|EVY91642.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T72838]
 gb|EVZ31216.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T16117]
 gb|EVZ44266.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F35307]
 gb|EVZ52194.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F63179]
 gb|EVZ56831.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F66300]
 gb|EVZ58392.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F66307]
 gb|EVZ62111.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F77930]
 gb|EVZ65749.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H24637]
 gb|EVZ67548.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H24662]
 gb|EVZ70313.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H27858]
 gb|EVZ73571.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H27862]
 gb|EVZ73893.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H27872]
 gb|EVZ80497.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H31276]
 gb|EVZ86979.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H34245]
 gb|EVZ91803.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H40569]
 gb|EVZ94831.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H57821]
 gb|EVZ95654.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H57822]
 gb|EVZ99684.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H57823]
 gb|EWA04086.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H64299]
 gb|EWA13788.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H67656]
 gb|EWA16886.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H70834]
 gb|EWA21647.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H74056]
 gb|EWA26463.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H77098]
 gb|EWA27946.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H77102]
 gb|EWA33325.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M16438]
 gb|EWA35042.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M28112]
 gb|EWA39299.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M39841]
 gb|EWA46597.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M59498]
 gb|EWA51083.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M68475]
 gb|EWA65641.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T33139]
 gb|EWA73798.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T39363]
 gb|EWA76827.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T42722]
 gb|EWA81149.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T69703]
 gb|EWA82040.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T69686]
 gb|EWA88422.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T69721]
 gb|EWA89976.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T72889]
 gb|EWA91725.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T72876]
 gb|EWA97422.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T76010]
 gb|EWB01406.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T76018]
 gb|EWB04249.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T79159]
 gb|EWB09041.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T82627]
 gb|EWB10980.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T86045]
 gb|EWB15082.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T86048]
 gb|EWB16515.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T86055]
 gb|EWB25616.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W16013]
 gb|EWB25797.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W16001]
 gb|EWB33120.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W21940]
 gb|EWB36119.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W21945]
 gb|EWB38108.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W52117]
 gb|EWB38624.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W52104]
 gb|EWB43353.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W52120]
 gb|EWB46029.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W55442]
 gb|EWB48149.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W55446]
 gb|EWB51700.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W55451]
 gb|EWB53848.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W58473]
 gb|EWB55943.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W64953]
 gb|EWB60010.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W68479]
 gb|EWB70627.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W88551]
 gb|EWB72853.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W91963]
 gb|EWB80457.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H90284]
 gb|EWC03228.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F62013]
 gb|EWH49690.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M80992]
 gb|EWH96665.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M77202]
 gb|EWI03742.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M46058]
 gb|EWI26819.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W50101]
 gb|EWI46599.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W29651]
 gb|EWI58138.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W23214]
 gb|EWI59987.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T67327]
 gb|EWI67046.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T60805]
 gb|EWI70978.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T57397]
 gb|EWI86116.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T44830]
 gb|EWI92615.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T44461]
 gb|EWI93636.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T40867]
 gb|EWI98022.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M91160]
 gb|EWJ05152.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M91155]
 gb|EWJ08803.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M87641]
 gb|EWJ10662.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M87665]
 gb|EWJ11927.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M80979]
 gb|EWJ16584.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M77238]
 gb|EWJ32372.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M13065]
 gb|EWJ36434.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M13060]
 gb|EWJ36657.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M16586]
 gb|EWJ42027.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H87668]
 gb|EWJ43552.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H85003]
 gb|EWJ50024.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H84980]
 gb|EWJ54184.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H84973]
 gb|EWJ55178.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H25872]
 gb|EWJ60867.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H12893]
 gb|EWJ62721.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F60346]
 gb|EWJ65888.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F57036]
 gb|EWJ70496.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F57021]
 gb|EWJ71048.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F57033]
 gb|EWJ73973.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F53388]
 gb|EWJ75559.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F43252]
 gb|EWJ77741.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F43221]
 gb|EWJ81936.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F43199]
 gb|EWJ87490.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F43212]
 gb|EWJ93272.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F36683]
 gb|EWJ96992.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W92106]
 gb|EWK01975.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W75539]
 gb|EWK08738.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W75098]
 gb|EWK17329.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W20096]
 gb|EWK18027.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W16028]
 gb|EWK22832.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T89467]
 gb|EWK24128.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T92876]
 gb|EWK28643.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T37840]
 gb|EWK28926.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T89463]
 gb|EWK40282.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T34011]
 gb|EWK40518.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T23868]
 gb|EWK46498.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T20118]
 gb|EWK50326.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T17131]
 gb|EWK51068.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T17141]
 gb|EWK55345.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T16676]
 gb|EWK73922.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M70099]
 gb|EWK75814.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M66673]
 gb|EWK82310.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M62699]
 gb|EWK94250.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M46066]
 gb|EWK95296.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M46070]
 gb|EWL06065.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H68256]
 gb|EWL10389.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H68252]
 gb|EWL10489.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H68244]
 gb|EWL13449.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H64967]
 gb|EWL19697.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H64941]
 gb|EWL24412.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H58191]
 gb|EWL33439.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F88375]
 gb|EWL37899.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F88405]
 gb|EWL39188.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F88369]
 gb|EWL42987.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F84763]
 gb|EWL45096.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F84732]
 gb|EWL53749.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F81389]
 gb|EWL54657.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F77974]
 gb|EWL56550.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F77967]
 gb|EWL59999.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F77919]
 gb|EWL60047.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F77960]
 gb|EWL67980.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F29997]
 gb|EWL70848.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F29993]
 gb|EWL73562.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F29982]
 gb|EWL82073.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F23368]
 gb|EWL83223.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F20115]
 gb|EWL85860.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F23353]
 gb|EWL87811.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F16470]
 gb|EWL94579.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F13027]
 gb|EWL95501.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F13022]
 gb|EWM81247.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1306]
 gb|EWM83585.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1316]
 gb|EWM85552.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1332]
 gb|EWM87003.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1265]
 gb|EWM91485.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1281]
 gb|EWM93104.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1259]
 gb|EWM93829.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1226]
 gb|EWM94741.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1251]
 gb|EWN01249.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1212]
 gb|EWN01564.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1202]
 gb|EWN04818.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1205]
 gb|EWN09361.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1191]
 gb|EWN09565.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1190]
 gb|EWN15056.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1179]
 gb|EWN18091.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1161]
 gb|EWN20712.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1178]
 gb|EWN21819.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1157]
 gb|EWN25420.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1154]
 gb|EWN29146.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1150]
 gb|EWN31119.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1143]
 gb|EWN32794.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1145]
 gb|EWN36990.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1123]
 gb|EWN39005.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1115]
 gb|EWN39936.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1111]
 gb|EWN45591.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1106]
 gb|EWN47741.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1105]
 gb|EWN50126.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1337]
 gb|EWN52171.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1336]
 gb|EWN60635.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1331]
 gb|EWN60685.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1330]
 gb|EWN66958.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1328]
 gb|EWN69743.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1326]
 gb|EWN76065.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1323]
 gb|EWN76984.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1324]
 gb|EWN77380.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1325]
 gb|EWN83411.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1318]
 gb|EWN83636.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1317]
 gb|EWN90378.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1315]
 gb|EWN94267.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1313]
 gb|EWO00853.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1310]
 gb|EWO02410.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1305]
 gb|EWO04173.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1308]
 gb|EWO09106.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1303]
 gb|EWO13093.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1302]
 gb|EWO15388.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1301]
 gb|EWO19837.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1298]
 gb|EWO23602.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1296]
 gb|EWO26294.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1295]
 gb|EWO31628.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1293]
 gb|EWO39256.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1288]
 gb|EWO47140.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1283]
 gb|EWO48955.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1282]
 gb|EWO52662.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1280]
 gb|EWO55849.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1279]
 gb|EWO60622.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1274]
 gb|EWO61184.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1276]
 gb|EWO65819.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1273]
 gb|EWO68766.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1271]
 gb|EWO75409.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1268]
 gb|EWO82931.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1264]
 gb|EWO83020.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1267]
 gb|EWO90367.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1261]
 gb|EWP00503.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1254]
 gb|EWP01472.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1252]
 gb|EWP04615.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1250]
 gb|EWP08901.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1247]
 gb|EWP09346.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1249]
 gb|EWP11245.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1246]
 gb|EWP16989.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1245]
 gb|EWP20343.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1243]
 gb|EWP25028.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1241]
 gb|EWP27650.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1239]
 gb|EWP29954.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1238]
 gb|EWP35777.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1235]
 gb|EWP36685.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1236]
 gb|EWP41138.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1234]
 gb|EWP44125.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1233]
 gb|EWP45426.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1232]
 gb|EWP49774.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1231]
 gb|EWP51589.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1230]
 gb|EWP55206.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1227]
 gb|EWP56963.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1222]
 gb|EWP62896.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1221]
 gb|EWP65760.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1219]
 gb|EWP66317.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1220]
 gb|EWP72097.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1218]
 gb|EWP76297.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1214]
 gb|EWP81241.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1209]
 gb|EWP88276.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1206]
 gb|EWP92015.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1204]
 gb|EWP93200.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1203]
 gb|EWP97407.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1201]
 gb|EWQ02111.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1200]
 gb|EWQ02388.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1195]
 gb|EWQ07052.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1192]
 gb|EWQ10942.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1189]
 gb|EWQ13784.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1186]
 gb|EWQ14557.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1187]
 gb|EWQ19484.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1181]
 gb|EWQ21093.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1182]
 gb|EWQ24248.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1180]
 gb|EWQ28213.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1172]
 gb|EWQ29694.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1174]
 gb|EWQ32098.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1171]
 gb|EWQ37827.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1166]
 gb|EWQ38337.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1168]
 gb|EWQ43314.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1165]
 gb|EWQ46295.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1162]
 gb|EWQ46627.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1164]
 gb|EWQ51632.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1160]
 gb|EWQ53548.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1159]
 gb|EWQ55670.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1158]
 gb|EWQ59903.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1156]
 gb|EWQ63850.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1152]
 gb|EWQ70686.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1149]
 gb|EWQ71484.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1148]
 gb|EWQ76131.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1147]
 gb|EWQ79785.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1146]
 gb|EWQ81443.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1144]
 gb|EWQ83456.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1141]
 gb|EWQ86185.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1140]
 gb|EWQ89835.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1138]
 gb|EWQ89883.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1139]
 gb|EWQ93351.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1137]
 gb|EWR01319.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1136]
 gb|EWR04453.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1129]
 gb|EWR08645.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1128]
 gb|EWR10980.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1127]
 gb|EWR15624.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1122]
 gb|EWR16846.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1121]
 gb|EWR22155.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1120]
 gb|EWR26906.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1116]
 gb|EWR30730.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1113]
 gb|EWR31656.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1112]
 gb|EWR36095.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1110]
 gb|EWR38698.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1108]
 gb|EWR39152.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1107]
 gb|EWR60922.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6109]
 gb|EWR64404.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6103]
 gb|EWR75421.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6176]
 gb|EWR83281.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6025]
 gb|EWR85009.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6132]
 gb|EWR89713.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJOS6123]
 gb|EWR95365.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SJUD6098]
 gb|EWR96784.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6047]
 gb|EWR99483.1| ABC transporter, ATP-binding protein [Staphylococcus aureus HOAG6043]
 gb|EWS02882.1| ABC transporter, ATP-binding protein [Staphylococcus aureus SCLE6012]
 gb|EWS11081.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6017]
 gb|EWS16324.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6037]
 gb|EWS27293.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCA6006]
 gb|EWS31747.1| ABC transporter, ATP-binding protein [Staphylococcus aureus GGMC6004]
 gb|EWT13662.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F63704]
 gb|EWT17219.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T74005]
 gb|EWT39559.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F70051]
 gb|EWT46465.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M39260]
 gb|EWT47650.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T83715]
 gb|EWT73375.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H47224]
 gb|EWT79442.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T12849]
 gb|EWU11369.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H72129_090612]
 gb|EWU25762.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T28649]
 gb|EWU33225.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W79990_080112]
 gb|EWU45590.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W21479]
 gb|EWU48909.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M12709]
 gb|EWU55671.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W82310]
 gb|EWU61352.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H79484]
 gb|EWU89414.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H44713]
 gb|EWV01206.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F50121]
 gb|EWV01266.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F46798]
 gb|EWV08860.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F53404]
 gb|EWV10422.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F53399]
 gb|EWV15514.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H19476]
 gb|EWV20622.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M16552]
 gb|EWV30640.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T57402]
 gb|EWV36700.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F60349]
 gb|EWV52994.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W18442]
 gb|EWV58200.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F63787]
 gb|EWV66054.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M28485]
 gb|EWV69524.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T74091]
 gb|EWV70016.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W56912]
 gb|EWV74227.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H32135]
 gb|EWV91196.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T77565]
 gb|EWV95534.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F70077]
 gb|EWV97229.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M35933]
 gb|EWV97755.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M35938]
 gb|EWW03435.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M35955]
 gb|EWW08142.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M35965]
 gb|EWW10585.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H38226]
 gb|EWW13113.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H38239]
 gb|EWW19582.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F73187]
 gb|EWW28355.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T83705]
 gb|EWW39282.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F76218]
 gb|EWW39511.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W65885]
 gb|EWW43751.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M42507]
 gb|EWW49165.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M42485]
 gb|EWW58439.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M42496]
 gb|EWW67862.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W70599]
 gb|EWW78434.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H47183]
 gb|EWW82943.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M42518]
 gb|EWW86979.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F82573]
 gb|EWW99330.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W73676]
 gb|EWX02028.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W73592]
 gb|EWX06433.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H49917]
 gb|EWX08855.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F16106]
 gb|EWX09086.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F16107]
 gb|EWX18418.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F85414]
 gb|EWX21289.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F85691]
 gb|EWX21413.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F85660]
 gb|EWX35199.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F89075]
 gb|EWX40280.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F92089]
 gb|EWX48812.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H49864]
 gb|EWX53529.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H53188]
 gb|EWX77199.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M55890]
 gb|EWX86145.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M59255]
 gb|EWX89852.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M70013]
 gb|EWX93739.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T15889]
 gb|EWX96272.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T22051]
 gb|EWX96849.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T22071_080712]
 gb|EWY07050.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T32070]
 gb|EWY15676.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W73601]
 gb|EWY28802.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W83140]
 gb|EWY29641.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W83137]
 gb|EWY32149.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W86063]
 gb|EXM42216.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5852]
 gb|EXM43537.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5814]
 gb|EXM43552.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5855]
 gb|EXM49541.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR126]
 gb|EXM52691.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR133]
 gb|EXM52889.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR116]
 gb|EXM59948.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR104]
 gb|EXM62063.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR26]
 gb|EXM62853.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5789]
 gb|EXM64130.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5790]
 gb|EXM67647.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5791]
 gb|EXM71519.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5792]
 gb|EXM72011.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5793]
 gb|EXM74682.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5794]
 gb|EXM79461.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5795]
 gb|EXM79971.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5796]
 gb|EXM83664.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5797]
 gb|EXM88074.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5799]
 gb|EXM89109.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5798]
 gb|EXM91772.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5800]
 gb|EXM95817.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5801]
 gb|EXM96237.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5802]
 gb|EXN01044.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5803]
 gb|EXN03592.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5804]
 gb|EXN05694.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5805]
 gb|EXN07934.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5806]
 gb|EXN11955.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5807]
 gb|EXN13104.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5808]
 gb|EXN16072.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5809]
 gb|EXN20173.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5811]
 gb|EXN21636.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5812]
 gb|EXN24943.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5813]
 gb|EXN27725.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5815]
 gb|EXN29119.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5816]
 gb|EXN33717.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5817]
 gb|EXN35297.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5819]
 gb|EXN37528.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5820]
 gb|EXN42149.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5821]
 gb|EXN43064.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5822]
 gb|EXN45674.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5823]
 gb|EXN50281.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5824]
 gb|EXN51270.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5825]
 gb|EXN55228.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5826]
 gb|EXN57349.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5827]
 gb|EXN58849.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5828]
 gb|EXN63559.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5829]
 gb|EXN64679.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5830]
 gb|EXN67988.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5831]
 gb|EXN71005.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5832]
 gb|EXN76083.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5834]
 gb|EXN78637.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5835]
 gb|EXN80689.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5836]
 gb|EXN83592.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5837]
 gb|EXN86941.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5838]
 gb|EXN90072.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5839]
 gb|EXN92072.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5840]
 gb|EXN94916.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5841]
 gb|EXN99088.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5843]
 gb|EXO00765.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5846]
 gb|EXO02476.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5845]
 gb|EXO06518.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5847]
 gb|EXO09437.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5848]
 gb|EXO10393.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5849]
 gb|EXO15013.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5850]
 gb|EXO16080.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5851]
 gb|EXO18584.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5853]
 gb|EXO23033.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5854]
 gb|EXO25259.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5856]
 gb|EXO26713.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5857]
 gb|EXO31362.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5858]
 gb|EXO34170.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5859]
 gb|EXO34856.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5861]
 gb|EXO38792.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5862]
 gb|EXO42076.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5863]
 gb|EXO43634.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5864]
 gb|EXO47893.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5865]
 gb|EXO48802.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3515]
 gb|EXO55978.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3508]
 gb|EXO56444.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3512]
 gb|EXO62949.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3505]
 gb|EXO64149.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3507]
 gb|EXO66210.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3504]
 gb|EXO70181.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W19276]
 gb|EXO72195.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W45757]
 gb|EXP40019.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W19270]
 gb|EXP43078.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W19256]
 gb|EXP46788.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W15995]
 gb|EXP48500.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W15990]
 gb|EXP49814.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W15976]
 gb|EXP55030.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W15974]
 gb|EXP65938.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T55959]
 gb|EXP66410.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T55960]
 gb|EXP87342.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M79671]
 gb|EXQ06689.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M17074]
 gb|EXQ10001.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H88185]
 gb|EXQ22573.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H72131]
 gb|EXQ35741.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H65863]
 gb|EXQ71736.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F22648]
 gb|AHM70389.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EXX97158.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3769]
 gb|EXY01246.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3907]
 gb|EXY02757.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR2070]
 gb|EYF12887.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F16104]
 gb|EYF17864.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F19470]
 gb|EYF22175.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F29447]
 gb|EYF24134.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H59303_080912]
 gb|EYF29755.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H59312_080912]
 gb|EYF43588.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T35594]
 gb|EYF48183.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T35604]
 gb|EYF53252.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W31983]
 gb|EYF54667.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F45749]
 gb|EYF58401.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F12749]
 gb|EYF60328.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W45755_111412]
 gb|EYF63704.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F12753]
 gb|EYF67085.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F19955]
 gb|EYF71613.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F87602]
 gb|EYF79940.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M72087]
 gb|EYF83364.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T16615]
 gb|EYF88265.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T16619]
 gb|EYF92582.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W75234]
 gb|EYG02346.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F32629]
 gb|EYG04722.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W89581]
 gb|EYG08937.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F42559]
 gb|EYG14223.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F52326]
 gb|EYG21173.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H15899]
 gb|EYG36519.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H81898]
 gb|EYG53666.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M90383]
 gb|EYG76272.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F34824]
 gb|EYG98227.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M66407]
 gb|EYH02596.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M79654]
 gb|EYH04282.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T22073]
 gb|EYH16462.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W80011]
 gb|EYH30198.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H47139]
 gb|EYH33378.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H88188]
 gb|EYH33645.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H65856]
 gb|EYH38440.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T39105]
 gb|EYH46087.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W82238]
 gb|EYJ00719.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W53395]
 gb|EYJ06111.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M32567]
 gb|EYJ11225.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M35954]
 gb|EYJ12362.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F12915]
 gb|EYJ16408.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F12917]
 gb|EYJ19744.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F19466]
 gb|EYJ30668.1| ABC transporter, ATP-binding protein [Staphylococcus aureus S29036]
 gb|EYJ34732.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W86059]
 gb|EYJ39099.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F42568]
 gb|EYJ43073.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F42579]
 gb|EYJ43362.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F42580]
 gb|EYJ47253.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F42582]
 gb|EYJ54720.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F45759]
 gb|EYJ56407.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F59332]
 gb|EYJ62735.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F59335]
 gb|EYJ67138.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H19392]
 gb|EYJ67742.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H15911]
 gb|EYJ69114.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H22632]
 gb|EYJ80256.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H43690]
 gb|EYJ80929.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H81901]
 gb|EYJ82618.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H43700]
 gb|EYJ89295.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H88163]
 gb|EYJ99146.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M13074]
 gb|EYK00324.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M17027]
 gb|EYK12361.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M35158]
 gb|EYK14256.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M45726]
 gb|EYK15048.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M24419]
 gb|EYK21020.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M54162]
 gb|EYK22560.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M57746]
 gb|EYK25737.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M79664]
 gb|EYK27018.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M79673]
 gb|EYK31950.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M83332]
 gb|EYK32424.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M90396]
 gb|EYK35967.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T13096]
 gb|EYK44929.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T45836]
 gb|EYK48454.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T49198]
 gb|EYK51098.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T49201]
 gb|EYK66274.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T59618]
 gb|EYK84915.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W19220]
 gb|EYK87833.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W25787]
 gb|EYK89991.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W25814]
 gb|EYK90875.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W32014]
 gb|EYK98285.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W38532]
 gb|EYL02557.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W45747]
 gb|EYL12683.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W62344]
 gb|EYL17822.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W62354]
 gb|EYL22357.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F23585]
 gb|EYL28255.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F29214]
 gb|EYL41014.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F56969]
 gb|EYL49942.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H20322]
 gb|EYL50102.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H20321]
 gb|EYL69320.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H89941]
 gb|EYL69451.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H89939]
 gb|EYL71827.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H83025]
 gb|EYL76970.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M13559]
 gb|EYL77846.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M17299]
 gb|EYL78119.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M17301]
 gb|EYL88375.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M25139]
 gb|EYL95009.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M66410]
 gb|EYM01555.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T15928]
 gb|EYM05380.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T15898]
 gb|EYM10793.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T22074]
 gb|EYM26443.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W34837]
 gb|EYM29097.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W34839]
 gb|EYM32497.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W34841]
 gb|EYM35122.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W34848]
 gb|EYM36181.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W41757]
 gb|EYM44434.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W75242]
 gb|EYM51827.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W89577]
 gb|EYM52466.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W82228]
 gb|EYM58752.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W89579]
 gb|EYM64890.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3519]
 gb|EYM67482.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3518]
 gb|EYM67537.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3525]
 gb|EYM72854.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3529]
 gb|EYM73105.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3548]
 gb|EYM73930.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3534]
 gb|EYM79597.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3551]
 gb|EYM80390.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3555]
 gb|EYM85028.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3562]
 gb|EYM87826.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3565]
 gb|EYM87913.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3567]
 gb|EYM88211.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3574]
 gb|EYM95473.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3576]
 gb|EYM98166.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3575]
 gb|EYM98486.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3578]
 gb|EYN02229.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3583]
 gb|EYN06530.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3581]
 gb|EYN08180.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3584]
 gb|EYN13884.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3586]
 gb|EYN14404.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3590]
 gb|EYN15366.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3587]
 gb|EYN18623.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3591]
 gb|EYN20187.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3596]
 gb|EYN23373.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3592]
 gb|EYN26621.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3599]
 gb|EYN28788.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3608]
 gb|EYN28858.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3609]
 gb|EYN34347.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3612]
 gb|EYN41927.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3617]
 gb|EYN41977.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3613]
 gb|EYN43421.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3616]
 gb|EYN44731.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3624]
 gb|EYN46918.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3627]
 gb|EYN52073.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3628]
 gb|EYN53945.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3752]
 gb|EYN55446.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3632]
 gb|EYN57272.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3629]
 gb|EYN61245.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3758]
 gb|EYN64807.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3760]
 gb|EYN65144.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3761]
 gb|EYN66976.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3762]
 gb|EYN68413.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3765]
 gb|EYN75888.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3772]
 gb|EYN76270.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3776]
 gb|EYN78777.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3767]
 gb|EYN82994.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3779]
 gb|EYN84319.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3782]
 gb|EYN85099.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3781]
 gb|EYN89782.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3788]
 gb|EYN94657.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3790]
 gb|EYN95334.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3796]
 gb|EYN96938.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3794]
 gb|EYO01108.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3799]
 gb|EYO01556.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3840]
 gb|EYO02053.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3842]
 gb|EYO10092.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3847]
 gb|EYO11841.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3845]
 gb|EYO14749.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3844]
 gb|EYO18215.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3859]
 gb|EYO19603.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3861]
 gb|EYO22397.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3862]
 gb|EYO22830.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3864]
 gb|EYO27594.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3868]
 gb|EYO32106.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3870]
 gb|EYO34332.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3871]
 gb|EYO36812.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3886]
 gb|EYO37299.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3885]
 gb|EYO44226.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3894]
 gb|EYO44930.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3892]
 gb|EYO46547.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3891]
 gb|EYO53995.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3897]
 gb|EYO54455.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3902]
 gb|EYO59157.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3911]
 gb|EYO59379.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3913]
 gb|EYO62701.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3918]
 gb|EYO64963.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3919]
 gb|EYO65470.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3924]
 gb|EYO68441.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3928]
 gb|EYO73147.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3930]
 gb|EYO78469.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR22]
 gb|EYO80521.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3933]
 gb|EYO82819.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5880]
 gb|EYO84163.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5878]
 gb|EYO85129.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5875]
 gb|EYO89977.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5877]
 gb|EYO92012.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5874]
 gb|EYO95070.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5873]
 gb|EYO98307.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR951]
 gb|EYP02690.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR966]
 gb|EYP04550.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1065]
 gb|EYP05737.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1082]
 gb|EYP08426.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1083]
 gb|EYP10358.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1067]
 gb|EYP14821.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1084]
 gb|EYP15501.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1086]
 gb|EYP21124.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1090]
 gb|EYP22943.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1161]
 gb|EYP26462.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1157]
 gb|EYP27883.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1158]
 gb|EYP30530.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1174]
 gb|EYP31915.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1176]
 gb|EYP37239.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1183]
 gb|EYP38879.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1275]
 gb|EYP39596.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1200]
 gb|EYP44401.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1291]
 gb|EYP44453.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1278]
 gb|EYP49181.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1276]
 gb|EYP51289.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1293]
 gb|EYP53047.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1295]
 gb|EYP55147.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1310]
 gb|EYP61401.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1311]
 gb|EYP62565.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1369]
 gb|EYP64446.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1313]
 gb|EYP65421.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1370]
 gb|EYP66707.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1490]
 gb|EYP72367.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1492]
 gb|EYP75609.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1692]
 gb|EYP78947.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1698]
 gb|EYP79858.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1507]
 gb|EYP84010.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1810]
 gb|EYP85649.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1800]
 gb|EYP90718.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1811]
 gb|EYP91720.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1813]
 gb|EYP94209.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1815]
 gb|EYP94869.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1814]
 gb|EYP98321.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1842]
 gb|EYQ03444.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1859]
 gb|EYQ05226.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1874]
 gb|EYQ06597.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1862]
 gb|EYQ10648.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1885]
 gb|EYQ10780.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1883]
 gb|EYQ16058.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1936]
 gb|EYQ17662.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1890]
 gb|EYQ18258.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1926]
 gb|EYQ23850.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1937]
 gb|EYQ26789.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1938]
 gb|EYQ30600.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1941]
 gb|EYQ30782.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1942]
 gb|EYQ33929.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1939]
 gb|EYQ36538.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1954]
 gb|EYQ41287.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1956]
 gb|EYQ42939.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1955]
 gb|EYQ46073.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1961]
 gb|EYQ46967.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1995]
 gb|EYQ50418.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR1980]
 gb|EYQ52617.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR2000]
 gb|EYQ55198.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR2002]
 gb|EYQ57285.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR2018]
 gb|EYQ58778.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR2019]
 gb|EYQ60879.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR2026]
 gb|EYQ64631.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR2067]
 gb|EYQ65591.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR2068]
 gb|EYQ69780.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR2072]
 gb|EYQ73325.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR2075]
 gb|EYQ76417.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3144]
 gb|EYQ76910.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3143]
 gb|EYQ81218.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3148]
 gb|EYQ84190.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3150]
 gb|EYQ86487.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3152]
 gb|EYQ90762.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3153]
 gb|EYQ92944.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3156]
 gb|EYQ93827.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3157]
 gb|EYQ99304.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3162]
 gb|EYR01278.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3163]
 gb|EYR02460.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3166]
 gb|EYR07735.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3177]
 gb|EYR08153.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3176]
 gb|EYR11699.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3175]
 gb|EYR13799.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3178]
 gb|EYR17238.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3179]
 gb|EYR17548.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3183]
 gb|EYR21483.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3198]
 gb|EYR23062.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR3236]
 gb|EYR24471.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5889]
 gb|EYR26838.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5890]
 gb|EYR35489.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5888]
 gb|EYR35670.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5887]
 gb|EYR38217.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5886]
 gb|EYR39694.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5885]
 gb|EYR44719.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5881]
 gb|EYR45252.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5884]
 gb|EYR50140.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5872]
 gb|EYR54556.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5871]
 gb|EYR59221.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5868]
 gb|EZI12744.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CO-30]
 gb|KDA08756.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|KDA08913.1| ABC transporter ATP-binding protein [Staphylococcus aureus MM66]
 emb|CDP43433.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
subsp. aureus]
 emb|CDP45067.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
subsp. aureus]
 emb|CDP59778.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
subsp. aureus]
 gb|KDP50531.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CO-99]
 emb|CDP41487.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
subsp. aureus]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031893435.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVC86201.1| ABC transporter, ATP-binding protein [Staphylococcus aureus OCMM6035]
 gb|EVD93186.1| ABC transporter, ATP-binding protein [Staphylococcus aureus LAMC6065]
 gb|EVF83444.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6027]
 gb|EWS45776.1| ABC transporter, ATP-binding protein [Staphylococcus aureus MISS6103]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602073.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_005291410.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus VC40]
 gb|AEZ37976.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus VC40]
 gb|EZH85756.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21239]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_001789598.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EES95201.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus USA300_TCH959]
Length=651

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  508  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  542



>ref|WP_031921191.1| ABC transporter ATP-binding protein, partial [Staphylococcus 
aureus]
 gb|EWB16952.1| ABC transporter, ATP-binding protein, partial [Staphylococcus 
aureus W12628]
Length=597

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>emb|CEF82159.1| Uncharacterized ABC transporter ATP-binding protein YdiF [Staphylococcus 
aureus]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_029550169.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602061.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_008128934.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
CA-347]
 gb|EEV70990.1| ABC transporter ATP-binding protein [Staphylococcus aureus A9635]
 gb|EGS95801.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21200]
 gb|EHM86872.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21194]
 gb|EHT67341.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG290]
 gb|EHT75587.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1524]
 gb|ENL45104.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0877]
 gb|ENM77178.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1311]
 gb|AGO30429.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
CA-347]
 gb|EUE73883.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0684]
 gb|EUE84591.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0690]
 gb|EUF22977.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0715]
 gb|EUH26401.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0745]
 gb|EUH56278.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0896]
 gb|EUN36986.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus 301-188]
 gb|EUN40195.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus 300-169]
 gb|EUV87421.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0236]
 gb|EUX08329.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0318]
 gb|EVJ81495.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0750]
 gb|EVK03351.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0777]
 gb|EVK25095.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0790]
 gb|EVK84599.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0820]
 gb|EVK85652.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0821]
 gb|EVL53437.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0866]
 gb|EVM38755.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0916]
 gb|EVM75435.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0937]
 gb|EVP72174.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0761]
 gb|EVY91583.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W56227]
 gb|EVY93748.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W56243]
 gb|EVY97432.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W56246]
 gb|EWO31077.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1292]
 gb|EWO56681.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1278]
 gb|EWO68847.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1272]
 gb|EWO93852.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1260]
 gb|EWP28599.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1237]
 gb|EWP58147.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1225]
 gb|EWP76364.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1213]
 gb|EWP84924.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1208]
 gb|EWQ34852.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1169]
 gb|EWQ66832.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1151]
 gb|EXP28073.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W85810]
 gb|EXP30099.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W85807]
 gb|EXP38156.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W42304]
 gb|EYF13465.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F12926_081012]
 gb|EYG01192.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W85806_020613]
 gb|EYJ25031.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F29450_091412]
 gb|EYL05611.1| ABC transporter, ATP-binding protein [Staphylococcus aureus W42298_110712]
 gb|EZI01317.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21314]
 gb|KFD30591.1| putative ABC transporter ATP-binding protein YheS [Staphylococcus 
aureus subsp. aureus SK1585]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031911538.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EVI28499.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6106]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602079.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|NP_646788.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus MW2]
 ref|YP_044063.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus MSSA476]
 dbj|BAB95836.1| hypothetical ABC transporter ATP-binding protein [Staphylococcus 
aureus subsp. aureus MW2]
 emb|CAG43759.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus MSSA476]
 gb|EFK80866.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus TCH70]
 gb|EHT40432.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1835]
 gb|EHT93280.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIGC128]
 gb|ELY15978.1| ABC transporter ATP-binding protein [Staphylococcus aureus KT/314250]
 gb|ETO52031.1| ABC transporter ATP-binding protein [Staphylococcus aureus MUF256]
 gb|ETO57625.1| ABC transporter ATP-binding protein [Staphylococcus aureus MUM475]
 gb|EZH96629.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21304]
 gb|EZI15074.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus CO-41]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602060.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EHO87137.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21252]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602053.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_005758458.1| heme ABC transporter ATP-binding protein CcmA [Staphylococcus 
aureus subsp. aureus 11819-97]
 gb|EGG67828.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21193]
 gb|EGS82569.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21235]
 gb|EGS84397.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21266]
 gb|AEW66026.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus 11819-97]
 gb|EHO99672.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21333]
 gb|EMS37333.1| ABC transporter ATP-binding protein [Staphylococcus aureus KLT6]
 gb|EOR34906.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus 103564]
 gb|EWG57025.1| ABC transporter ATP-binding protein [Staphylococcus aureus MUF168]
 gb|EZI07125.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21338]
 gb|EZR75570.1| hypothetical protein W784_02346 [Staphylococcus aureus VET1373S]
 gb|EZR76215.1| hypothetical protein W783_02349 [Staphylococcus aureus VET1368S]
 gb|KAG16516.1| hypothetical protein W753_00951 [Staphylococcus aureus VET0632S]
 gb|KAG19138.1| hypothetical protein W756_02470 [Staphylococcus aureus VET0678S]
 gb|KAG21941.1| hypothetical protein W757_02175 [Staphylococcus aureus VET0679S]
 gb|KAG42409.1| hypothetical protein W767_02319 [Staphylococcus aureus VET1020S]
 gb|KAG42930.1| hypothetical protein W768_02423 [Staphylococcus aureus VET1024S]
 gb|KAG45186.1| hypothetical protein W769_02372 [Staphylococcus aureus VET1025S]
 gb|KAG49071.1| hypothetical protein W770_02443 [Staphylococcus aureus VET1026S]
 gb|KAG98007.1| hypothetical protein W796_02429 [Staphylococcus aureus VET1646S]
 gb|KAH00141.1| hypothetical protein W797_02104 [Staphylococcus aureus VET1653S]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_001573370.1| ABC transporter, ATP-binding protein [Staphylococcus aureus]
 gb|ENJ93936.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0391]
 gb|EUG08361.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0561]
 gb|EUG36712.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0456]
 gb|EUK90325.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0389]
 gb|EUX77309.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0357]
 gb|EUX88240.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0362]
 gb|EUY13057.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0382]
 gb|EVA07585.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0509]
 gb|EVA62125.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0543]
 gb|EVA84296.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0555]
 gb|EVB94232.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0616]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_001595398.1| ABC transporter, ATP-binding protein [Staphylococcus aureus]
 gb|EMZ01910.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1078]
 gb|ENJ09577.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0210]
 gb|ENL04616.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0676]
 gb|ENL43820.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0871]
 gb|ENM15122.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1083]
 gb|ENM35370.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1142]
 gb|EUG18986.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0620]
 gb|EUG44466.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0243]
 gb|EUN96017.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0981]
 gb|EUO38211.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1073]
 gb|EUT07109.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0093]
 gb|EUU86976.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0179]
 gb|EUU95472.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0185]
 gb|EUV73260.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0228]
 gb|EUW14162.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0255]
 gb|EUW22268.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0262]
 gb|EUW31722.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0265]
 gb|EVK80349.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0819]
 gb|EVL01166.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0834]
 gb|EVL47327.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0863]
 gb|EVM24974.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0907]
 gb|EVM32558.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0913]
 gb|EVM99727.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0955]
 gb|EVN57767.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0987]
 gb|EVN67160.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0997]
 gb|EVN99819.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1022]
Length=642

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_031826489.1| ABC transporter ATP-binding protein, partial [Staphylococcus 
aureus]
 gb|EUS11877.1| ABC transporter, ATP-binding protein, partial [Staphylococcus 
aureus M0036]
Length=572

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_033844820.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
Length=642

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_000602046.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_041497.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus MRSA252]
 ref|YP_005747234.1| ABC superfamily ATP binding cassette transporter, ABC protein 
[Staphylococcus aureus subsp. aureus TCH60]
 ref|YP_008449937.1| ABC transporter [Staphylococcus aureus subsp. aureus 55/2053]
 emb|CAG41115.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus MRSA252]
 gb|EEV03259.1| ABC transporter [Staphylococcus aureus subsp. aureus 55/2053]
 gb|EEV05998.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus 65-1322]
 gb|EEV08562.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus 68-397]
 gb|EEV11232.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus E1410]
 gb|EEV13795.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus M876]
 gb|EFB43420.1| ATP-binding cassette, sub-family F protein [Staphylococcus aureus 
subsp. aureus C101]
 gb|EFB46619.1| ATP-binding cassette, sub-family F protein [Staphylococcus aureus 
subsp. aureus C427]
 gb|EFB51613.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus M899]
 gb|EFB54933.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus WBG10049]
 gb|EFB60104.1| ATP-binding cassette sub-family F member 3 [Staphylococcus aureus 
subsp. aureus Btn1260]
 gb|EFB99935.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus C160]
 gb|EFC28685.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus A017934/97]
 gb|EFD96858.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus M1015]
 gb|EFE25232.1| ATP-binding cassette, sub-family F, member 3 [Staphylococcus 
aureus subsp. aureus 58-424]
 gb|EFF08873.1| ATP-binding cassette, sub-family F, member 3 [Staphylococcus 
aureus subsp. aureus M809]
 gb|EFG57253.1| ATP-binding cassette-containing protein [Staphylococcus aureus 
subsp. aureus EMRSA16]
 gb|EFH95733.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus MN8]
 gb|ADQ76614.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus TCH60]
 gb|EFU23478.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus CGS00]
 gb|EGS97479.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21195]
 gb|EHO94567.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21264]
 gb|EHQ66750.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21345]
 gb|EHQ67408.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21342]
 gb|EHT26143.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1242]
 gb|EHT27240.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1500]
 gb|EHT30343.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1214]
 gb|EHT33529.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1605]
 gb|EHT57397.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1233]
 gb|EHT57498.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1176]
 gb|EHT73345.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG1267]
 gb|EHT82070.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIG149]
 gb|EHT84465.1| heme ABC exporter, ATP-binding protein CcmA [Staphylococcus aureus 
subsp. aureus CIGC341D]
 gb|ENK06254.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0408]
 gb|ENK45128.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0513]
 gb|ENL93410.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1034]
 gb|ENM60822.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M1256]
 gb|ENN50293.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0946]
 gb|EOR42525.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus 122051]
 gb|EUG11186.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0594]
 gb|EUX79681.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0359]
 gb|EUY87091.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0426]
 gb|EUY99876.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0437]
 gb|EUZ51029.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0465]
 gb|EVA29958.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0522]
 gb|EVA54546.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0541]
 gb|EVA80720.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0552]
 gb|EVB45272.1| ABC transporter, ATP-binding protein [Staphylococcus aureus M0590]
 gb|EVD06181.1| ABC transporter, ATP-binding protein [Staphylococcus aureus WMCS6019]
 gb|EVI43922.1| ABC transporter, ATP-binding protein [Staphylococcus aureus UCIM6119]
 gb|EVJ38708.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6056]
 gb|EVJ51637.1| ABC transporter, ATP-binding protein [Staphylococcus aureus KINW6066]
 gb|EWI96479.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T44444]
 gb|EWW48507.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T86574]
 gb|EWW93406.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F82600]
 gb|EXO50330.1| ABC transporter, ATP-binding protein [Staphylococcus aureus DAR5867]
 gb|EYF83157.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T16600]
 gb|EYJ38206.1| ABC transporter, ATP-binding protein [Staphylococcus aureus F42556]
 gb|EYK67332.1| ABC transporter, ATP-binding protein [Staphylococcus aureus T55954]
 gb|EZH91486.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21230]
 gb|EZH99448.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus 21275]
 gb|KAG35141.1| hypothetical protein W764_02065 [Staphylococcus aureus VET0889S]
 gb|AIO21679.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus]
 emb|CEH26789.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus]
 gb|AIW27738.1| ABC transporter ATP-binding protein uup [Staphylococcus aureus 
subsp. aureus]
 gb|KHF79103.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus]
Length=642

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_001825889.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_006196117.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus 71193]
 gb|EIA14013.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus DR10]
 gb|AFH70274.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus 71193]
Length=651

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  508  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIE  542



>ref|WP_011302722.1| ABC transporter ATP-binding protein [Staphylococcus saprophyticus]
 ref|YP_300922.1| ABC transporter ATPase [Staphylococcus saprophyticus subsp. saprophyticus 
ATCC 15305]
 dbj|BAE17977.1| ATPase component of ABC transporter with duplicated ATPase domains 
[Staphylococcus saprophyticus subsp. saprophyticus ATCC 
15305]
Length=642

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKV+DLN++GG MYLGDYQY+IE
Sbjct  499  VSHDRYFINQLANKVYDLNYDGGTMYLGDYQYFIE  533



>ref|WP_002482774.1| ABC transporter ATP-binding protein [Staphylococcus saprophyticus]
 gb|EHY92948.1| ABC transporter ATPase [Staphylococcus saprophyticus subsp. saprophyticus 
KACC 16562]
Length=642

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKV+DLN++GG MYLGDYQY+IE
Sbjct  499  VSHDRYFINQLANKVYDLNYDGGTMYLGDYQYFIE  533



>ref|WP_000602052.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_005755826.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus LGA251]
 emb|CCC88614.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. 
aureus LGA251]
Length=642

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG+MYLGDYQY+IE
Sbjct  499  VSHDRYFINQLANKVFDLTIDGGKMYLGDYQYFIE  533



>ref|WP_016425581.1| hypothetical protein [Staphylococcus sp. HGB0015]
 gb|EPD50480.1| hypothetical protein HMPREF1208_01359 [Staphylococcus sp. HGB0015]
Length=647

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLAN++FDLN +GG +YLGDYQYY+E
Sbjct  499  VSHDRYFINQLANRIFDLNEKGGTLYLGDYQYYLE  533



>ref|WP_031807291.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EXQ29624.1| ABC transporter, ATP-binding protein [Staphylococcus aureus H65878]
Length=642

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDR+FINQLANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRHFINQLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_002471759.1| ABC transporter ATP-binding protein [Staphylococcus pettenkoferi]
 gb|EHM70824.1| ABC transporter, ATP-binding protein [Staphylococcus pettenkoferi 
VCU012]
Length=644

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL+  GG +YLGDYQYY+E
Sbjct  500  VSHDRYFINQLANKVFDLDTSGGSLYLGDYQYYVE  534



>ref|WP_000602059.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 ref|YP_003282950.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus ED98]
 gb|ACY11944.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. 
aureus ED98]
Length=642

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  + G+MYLGDYQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTIDSGKMYLGDYQYYIE  533



>ref|WP_002464779.1| ABC transporter ATP-binding protein [Staphylococcus simiae]
 gb|EHJ07206.1| ATP-binding ABC transporter protein [Staphylococcus simiae CCM 
7213]
Length=643

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFDL  +GG MYLG+YQYYIE
Sbjct  499  VSHDRYFINQLANKVFDLTADGGTMYLGNYQYYIE  533



>ref|WP_033857038.1| ABC transporter ATP-binding protein [Staphylococcus aureus]
 gb|EZY43088.1| hypothetical protein V052_02508 [Staphylococcus aureus MSSA-93]
Length=642

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN LANKVFDL  +GG+MYLGDYQYYIE
Sbjct  499  VSHDRYFINHLANKVFDLTIDGGKMYLGDYQYYIE  533



>ref|WP_017723424.1| ABC transporter ATP-binding protein [Staphylococcus xylosus]
Length=642

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LANKV+DL+ EGG MYLG+YQYYIE
Sbjct  499  VSHDRYFINELANKVYDLDSEGGTMYLGNYQYYIE  533



>ref|WP_019167549.1| ABC transporter ATP-binding protein [Staphylococcus intermedius]
Length=650

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LAN++FDLN  GG +YLGDYQYY+E
Sbjct  499  VSHDRYFINELANRIFDLNESGGHLYLGDYQYYLE  533



>ref|WP_021339964.1| ABC transporter ATP-binding protein [Staphylococcus equorum]
 gb|ERH34026.1| ABC transporter ATP-binding protein [Staphylococcus equorum UMC-CNS-924]
Length=642

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LANKV+DL+  GG MYLGDYQYYIE
Sbjct  499  VSHDRYFINELANKVYDLDTTGGTMYLGDYQYYIE  533



>ref|WP_002511410.1| ABC transporter ATP-binding protein [Staphylococcus equorum]
 emb|CCI58588.1| putative drug resistance ATP-binding protein [Staphylococcus 
equorum subsp. equorum Mu2]
Length=642

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LANKV+DL+  GG MYLGDYQYYIE
Sbjct  499  VSHDRYFINELANKVYDLDTTGGTMYLGDYQYYIE  533



>ref|WP_002507132.1| ABC transporter ATP-binding protein [Staphylococcus sp. OJ82]
 gb|EJX18116.1| ABC transporter ATPase [Staphylococcus sp. OJ82]
Length=642

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LANKV+DL+  GG MYLGDYQYYIE
Sbjct  499  VSHDRYFINELANKVYDLDTTGGTMYLGDYQYYIE  533



>ref|WP_019166396.1| ABC transporter ATP-binding protein [Staphylococcus delphini]
Length=650

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LAN++FDLN  GG +YLGDYQYY+E
Sbjct  499  VSHDRYFINELANRIFDLNETGGHLYLGDYQYYLE  533



>ref|WP_014613402.1| ABC transporter ATP-binding protein [Staphylococcus pseudintermedius]
 ref|YP_006014937.1| ABC transporter ATP-binding protein [Staphylococcus pseudintermedius 
ED99]
 gb|ADX76098.1| ABC transporter, ATP-binding protein [Staphylococcus pseudintermedius 
ED99]
Length=650

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LAN++FDLN  GG +YLGDYQYY+E
Sbjct  499  VSHDRYFINELANRIFDLNKTGGHLYLGDYQYYLE  533



>ref|WP_037542574.1| ABC transporter ATP-binding protein [Staphylococcus pseudintermedius]
Length=650

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LAN++FDLN  GG +YLGDYQYY+E
Sbjct  499  VSHDRYFINELANRIFDLNKTGGHLYLGDYQYYLE  533



>ref|WP_015729418.1| ABC transporter ATP-binding protein [Staphylococcus pseudintermedius]
 ref|YP_004149876.1| ABC transporter ATP-binding protein [Staphylococcus pseudintermedius 
HKU10-03]
 gb|ADV06240.1| ABC transporter ATP-binding protein uup [Staphylococcus pseudintermedius 
HKU10-03]
Length=650

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LAN++FDLN  GG +YLGDYQYY+E
Sbjct  499  VSHDRYFINELANRIFDLNKTGGHLYLGDYQYYLE  533



>ref|WP_039069573.1| ABC transporter ATP-binding protein [Staphylococcus xylosus]
Length=642

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LANKV+DL+++GG MYLG+YQY+IE
Sbjct  499  VSHDRYFINELANKVYDLDYDGGTMYLGNYQYFIE  533



>ref|WP_019469548.1| ABC transporter ATP-binding protein [Staphylococcus sp. AL1]
Length=642

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKV+DL+  GG MYLG+YQY+IE
Sbjct  499  VSHDRYFINQLANKVYDLDTHGGTMYLGNYQYFIE  533



>gb|AID42292.1| ABC transporter ATP-binding protein uup [Staphylococcus xylosus]
Length=642

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LANKV+DL+ +GG MYLG+YQYYI+
Sbjct  499  VSHDRYFINELANKVYDLDLDGGTMYLGNYQYYID  533



>emb|CEF18301.1| ABC transporter ATP-binding protein [Staphylococcus xylosus]
Length=642

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LANKV+DL+ +GG MYLG+YQYYI+
Sbjct  499  VSHDRYFINELANKVYDLDLDGGTMYLGNYQYYID  533



>ref|WP_029378917.1| ABC transporter ATP-binding protein [Staphylococcus xylosus]
 gb|AID01914.1| ABC transporter ATP-binding protein [Staphylococcus xylosus]
Length=642

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LANKV+DL+ +GG MYLG+YQYYI+
Sbjct  499  VSHDRYFINELANKVYDLDLDGGTMYLGNYQYYID  533



>ref|WP_002509108.1| ABC transporter ATP-binding protein [Staphylococcus arlettae]
 gb|EJY96581.1| ABC transporter ATPase [Staphylococcus arlettae CVD059]
Length=639

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKV +++  GGQ+YLGDYQY+++
Sbjct  499  VSHDRYFINQLANKVLNIDESGGQLYLGDYQYFLD  533



>ref|WP_015900799.1| ABC transporter ATP-binding protein [Staphylococcus carnosus]
 ref|YP_002634644.1| putative ABC transporter ATP-binding protein [Staphylococcus 
carnosus subsp. carnosus TM300]
 emb|CAL28459.1| putative ABC transporter ATP-binding protein [Staphylococcus 
carnosus subsp. carnosus TM300]
Length=642

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANK+FD++  GG +Y GDYQYY++
Sbjct  500  VSHDRYFINQLANKIFDMDETGGTIYAGDYQYYLD  534



>ref|WP_021459246.1| ABC transporter ATP-binding protein [Staphylococcus sp. EGD-HP3]
 gb|ERF48829.1| ABC transporter ATP-binding protein [Staphylococcus sp. EGD-HP3]
Length=639

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKV +++  GGQ+YLGDYQY+++
Sbjct  499  VSHDRYFINQLANKVLNIDESGGQLYLGDYQYFLD  533



>ref|WP_002481728.1| hypothetical protein [Staphylococcus simulans]
 gb|EKS23385.1| hypothetical protein HMPREF9310_02238 [Staphylococcus simulans 
ACS-120-V-Sch1]
 gb|ERS92982.1| ABC transporter ATP-binding protein [Staphylococcus simulans 
UMC-CNS-990]
Length=641

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFINQLANKVFD+  +GG +Y G+YQYY++
Sbjct  499  VSHDRYFINQLANKVFDMQPDGGTVYAGNYQYYLD  533



>ref|WP_018366120.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
didelphis]
Length=637

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LA KV +++ EG Q+YLGDY YY+E
Sbjct  496  VSHDRYFINRLATKVLEISQEGSQLYLGDYDYYLE  530



>ref|WP_015912221.1| ABC transporter ATP-binding protein [Macrococcus caseolyticus]
 ref|YP_002561125.1| ABC transporter ATP-binding protein [Macrococcus caseolyticus 
JCSC5402]
 dbj|BAH18429.1| ABC transporter ATP-binding protein [Macrococcus caseolyticus 
JCSC5402]
Length=639

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LA KVF ++ +GG+M+LGDY Y+IE
Sbjct  499  VSHDRYFINKLATKVFHMDKDGGRMFLGDYSYFIE  533



>ref|WP_010781254.1| ABC transporter ATP-binding protein [Enterococcus gilvus]
 gb|EOI54850.1| ABC transporter ATP-binding protein [Enterococcus gilvus ATCC 
BAA-350]
 gb|EOW81774.1| ABC transporter ATP-binding protein [Enterococcus gilvus ATCC 
BAA-350]
Length=639

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++ANKV +L+ EG ++YLGDY YY+E
Sbjct  497  VSHDRYFINRIANKVIELSPEGSKLYLGDYDYYLE  531



>ref|WP_016911757.1| hypothetical protein [Staphylococcus vitulinus]
Length=640

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LANKVF +  EG +++ GDYQYY+E
Sbjct  499  VSHDRYFINELANKVFHITQEGNELFQGDYQYYLE  533



>ref|WP_003102737.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
parauberis]
 gb|EGE53232.1| ABC transporter, ATP-binding protein [Streptococcus parauberis 
NCFD 2020]
Length=636

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV ++  EG Q+YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEITEEGSQLYLGDYDYYVE  530



>ref|WP_003107120.1| ABC transporter ATP-binding protein [Streptococcus parauberis]
 gb|EMF50060.1| ABC transporter ATP-binding protein [Streptococcus parauberis 
KRS-02109]
Length=636

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV ++  EG Q+YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEITEEGSQLYLGDYDYYVE  530



>ref|WP_013794068.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
parauberis]
 ref|YP_004479075.1| ABC transporter ATP-binding protein [Streptococcus parauberis 
KCTC 11537]
 gb|AEF25403.1| ABC transporter ATP-binding protein [Streptococcus parauberis 
KCTC 11537]
 dbj|GAJ61813.1| ABC transporter ATP-binding protein [Streptococcus parauberis]
Length=636

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV ++  EG Q+YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEITEEGSQLYLGDYDYYVE  530



>ref|WP_003108273.1| ABC transporter ATP-binding protein [Streptococcus parauberis]
 gb|EMG25645.1| ABC transporter ATP-binding protein [Streptococcus parauberis 
KRS-02083]
Length=636

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV ++  EG Q+YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEITEEGSQLYLGDYDYYVE  530



>ref|WP_026161864.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
ferus]
Length=634

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++ANKV +++  G Q+YLGDY YY+E
Sbjct  496  VSHDRYFINRVANKVLEISQSGSQLYLGDYDYYLE  530



>gb|EUJ41778.1| putative ABC transporter [Brochothrix campestris FSL F6-1037]
Length=196

 Score = 54.7 bits (130),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++ANKV +L+ +G   YLGDY YY+E
Sbjct  54   VSHDRYFINRIANKVIELSADGAVTYLGDYDYYVE  88



>ref|WP_016181962.1| ABC transporter ATP-binding protein [Enterococcus avium]
 gb|EOT39483.1| ABC transporter ATP-binding protein [Enterococcus avium ATCC 
14025]
 gb|EOU19753.1| ABC transporter ATP-binding protein [Enterococcus avium ATCC 
14025]
Length=639

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYI  102
            VSHDRYFIN++ANKV +L+ EG ++YLGDY YY+
Sbjct  497  VSHDRYFINRIANKVIELSPEGSKLYLGDYDYYL  530



>ref|WP_010744454.1| ABC transporter ATP-binding protein [Enterococcus raffinosus]
 gb|EOH79992.1| ABC transporter ATP-binding protein [Enterococcus raffinosus 
ATCC 49464]
 gb|EOT74300.1| ABC transporter ATP-binding protein [Enterococcus raffinosus 
ATCC 49464]
Length=639

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYI  102
            VSHDRYFIN++ANKV +L+ EG ++YLGDY YY+
Sbjct  497  VSHDRYFINRIANKVIELSPEGSKLYLGDYDYYL  530



>ref|WP_037575659.1| ABC transporter ATP-binding protein [Staphylococcus chromogenes]
 gb|KDP12427.1| ABC transporter ATP-binding protein [Staphylococcus chromogenes 
MU 970]
Length=646

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN LANK+FDL+  GGQ   GDY YY+E
Sbjct  499  VSHDRYFINALANKIFDLDANGGQFIQGDYAYYLE  533



>ref|WP_028274238.1| multidrug ABC transporter ATP-binding protein [Atopococcus tabaci]
Length=652

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++ANKV DL+ +G  +YLGDY Y+I+
Sbjct  500  VSHDRYFINRIANKVVDLSEDGATLYLGDYDYFIQ  534



>ref|WP_004633385.1| ABC transporter ATP-binding protein [Gemella morbillorum]
 gb|EFV35114.1| ABC transporter [Gemella morbillorum M424]
Length=637

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++ANKVFD+  EG  +YLG+Y YY+E
Sbjct  494  VSHDRYFINKIANKVFDITEEGYNIYLGNYDYYLE  528



>ref|WP_010739686.1| ABC transporter ATP-binding protein [Enterococcus malodoratus]
 gb|EOH80769.1| ABC transporter ATP-binding protein [Enterococcus malodoratus 
ATCC 43197]
 gb|EOT69278.1| hypothetical protein I585_00741 [Enterococcus malodoratus ATCC 
43197]
Length=639

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYI  102
            VSHDRYFIN++ANKV +L+ EG ++YLGDY YY+
Sbjct  497  VSHDRYFINRIANKVIELSPEGSKLYLGDYDYYL  530



>ref|WP_003099245.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
iniae]
 ref|YP_008056495.1| ABC transporter, ATP-binding protein [Streptococcus iniae SF1]
 gb|EKB52519.1| ABC superfamily ATP binding cassette transporter, ABC protein 
[Streptococcus iniae 9117]
 gb|AGM98558.1| ABC transporter, ATP-binding protein [Streptococcus iniae SF1]
 gb|ESR10611.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
iniae IUSA1]
 gb|AHY15590.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
iniae]
 gb|AHY17458.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
iniae]
Length=634

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV ++  EG Q++LGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEITEEGSQLFLGDYDYYLE  530



>ref|WP_018379778.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
thoraltensis]
Length=639

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +++ EG  +YLGDY YY+E
Sbjct  496  VSHDRYFINRIATKVLEISEEGSTLYLGDYDYYVE  530



>ref|WP_016177053.1| ABC transporter ATP-binding protein [Enterococcus durans]
 gb|EOT34256.1| ABC transporter ATP-binding protein [Enterococcus durans ATCC 
6056]
 gb|EOU26038.1| ABC transporter ATP-binding protein [Enterococcus durans ATCC 
6056]
Length=645

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+  G +MYLGDY YY+E
Sbjct  498  VSHDRYFINRIATKVIELSENGSKMYLGDYDYYLE  532



>ref|WP_005878083.1| ABC transporter ATP-binding protein [Enterococcus durans]
 gb|EMS75763.1| ABC transporter ATP-binding protein [Enterococcus durans IPLA 
655]
Length=645

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+  G +MYLGDY YY+E
Sbjct  498  VSHDRYFINRIATKVIELSENGSKMYLGDYDYYLE  532



>ref|WP_010755860.1| ABC transporter ATP-binding protein [Enterococcus pallens]
 gb|EOH98129.1| ABC transporter ATP-binding protein [Enterococcus pallens ATCC 
BAA-351]
 gb|EOU14623.1| ABC transporter ATP-binding protein [Enterococcus pallens ATCC 
BAA-351]
Length=644

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ EG ++YLGDY YY+E
Sbjct  497  VSHDRYFINRIATKVIELSPEGSKLYLGDYDYYLE  531



>ref|WP_028984078.1| multidrug ABC transporter ATP-binding protein [Sporolactobacillus 
terrae]
Length=650

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN LA++VF+L+ EG   YLGDY YYI+
Sbjct  501  VSHDRYFINNLASRVFELSREGITEYLGDYDYYID  535



>ref|WP_028977642.1| multidrug ABC transporter ATP-binding protein [Sporolactobacillus 
terrae]
Length=650

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN LA++VF+L+ EG   YLGDY YYI+
Sbjct  501  VSHDRYFINNLASRVFELSREGITEYLGDYDYYID  535



>ref|WP_010025038.1| multidrug ABC transporter ATP-binding protein [Sporolactobacillus 
inulinus]
Length=650

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN LA++VF+L+ EG   YLGDY YYI+
Sbjct  501  VSHDRYFINNLASRVFELSREGITEYLGDYDYYID  535



>ref|WP_004231185.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
equinus]
 gb|EFW89637.1| ABC transporter, ATP-binding protein [Streptococcus equinus ATCC 
9812]
Length=639

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +++ EG  +YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEISEEGSTLYLGDYDYYLE  530



>ref|WP_035030050.1| multidrug ABC transporter ATP-binding protein [Carnobacterium 
mobile]
Length=651

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LA  V +L+ EG  +YLGDY YYIE
Sbjct  500  VSHDRYFINRLATAVVELSEEGSTLYLGDYDYYIE  534



>gb|ESU75081.1| ABC transporter ATP-binding protein [Enterococcus faecalis CBRD01]
Length=471

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  322  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  356



>gb|KFN90629.1| ATP-binding component of an ABC superfamily transporter [Tetragenococcus 
muriaticus PMC-11-5]
Length=82

 Score = 51.6 bits (122),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+ A KV +L+ +G  +YLGDY YY+E
Sbjct  23   VSHDRYFINRTATKVVELSEDGSHLYLGDYDYYLE  57



>ref|WP_017001153.1| hypothetical protein [Staphylococcus lentus]
Length=640

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            V+HDRYFIN+LANK+F++  +G +++ GDYQYY+E
Sbjct  499  VTHDRYFINELANKIFNITADGNELFQGDYQYYLE  533



>ref|WP_033152327.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
equinus]
Length=639

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +++ EG  +YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEISEEGSTLYLGDYDYYLE  530



>ref|WP_039690940.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
equinus]
 gb|KEY48317.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
equinus]
 gb|KFN85632.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
equinus ATCC 33317]
Length=639

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +++ EG  +YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEISEEGSTLYLGDYDYYLE  530



>ref|WP_027968212.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
equinus]
Length=639

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +++ EG  +YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEISEEGSTLYLGDYDYYLE  530



>ref|WP_006532445.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
infantarius]
 gb|EDT47284.1| ABC transporter, ATP-binding protein [Streptococcus infantarius 
subsp. infantarius ATCC BAA-102]
Length=639

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +++ EG  +YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEISEEGSTLYLGDYDYYLE  530



>ref|WP_003088737.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
ratti]
 gb|EJN94124.1| ABC transporter ATPase [Streptococcus ratti FA-1 = DSM 20564]
 gb|EMP68970.1| ABC transporter ATP-binding protein [Streptococcus ratti FA-1 
= DSM 20564]
Length=634

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN+LA KV +++  G ++YLGDY YY+E
Sbjct  496  VSHDRYFINRLATKVLEISESGSKLYLGDYDYYLE  530



>ref|WP_039697109.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
equinus]
 gb|KFN87301.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
equinus JB1]
Length=639

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +++ EG  +YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEISEEGSTLYLGDYDYYLE  530



>ref|WP_024344673.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
equinus]
Length=639

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +++ EG  +YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEISEEGSTLYLGDYDYYLE  530



>ref|WP_021142065.1| ABC transporter ATP-binding protein [Streptococcus sp. HSISB1]
 gb|EQC69984.1| ABC transporter ATP-binding protein [Streptococcus sp. HSISB1]
Length=639

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +++ EG  +YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVLEISEEGSTLYLGDYDYYLE  530



>ref|WP_003096911.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
vestibularis]
 gb|EFX96281.1| ABC transporter, ATP-binding protein [Streptococcus vestibularis 
ATCC 49124]
Length=639

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +++ EG  +YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVMEISEEGATIYLGDYDYYLE  530



>ref|WP_003092731.1| multidrug ABC transporter ATP-binding protein [Streptococcus 
vestibularis]
 gb|EFQ59878.1| ABC transporter, ATP-binding protein [Streptococcus vestibularis 
F0396]
Length=639

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +++ EG  +YLGDY YY+E
Sbjct  496  VSHDRYFINRVATKVMEISEEGATIYLGDYDYYLE  530



>ref|WP_033592812.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|KAJ71460.1| ABC transporter ATP-binding protein uup [Enterococcus faecalis 
MD6]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_002374213.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EEU77176.1| ABC transporter [Enterococcus faecalis E1Sol]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_034643373.1| ABC transporter ATP-binding protein [Bacillus manliponensis]
 gb|KEK17435.1| ABC transporter ATP-binding protein [Bacillus manliponensis]
Length=659

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G Q YLGDY YY+E
Sbjct  518  VSHDRYFINRVATKVIELSTDGAQEYLGDYDYYVE  552



>ref|WP_010783196.1| ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EOL81252.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0303]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_010821052.1| ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EOJ70682.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0337]
 gb|KAJ57670.1| ABC transporter ATP-binding protein uup [Enterococcus faecalis 
GA2]
 gb|KAJ66500.1| ABC transporter ATP-binding protein uup [Enterococcus faecalis 
MN16]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_010713167.1| ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EOE34466.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0084]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_002410270.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EFU12641.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX1341]
 gb|EOJ89791.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0368]
 gb|EOK53128.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0066]
 gb|EOL98626.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0233]
 gb|EOM13723.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0234]
 gb|ETU13138.1| ABC transporter ATP-binding protein [Enterococcus faecalis B312]
 gb|KGJ33500.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_002381483.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EEU93568.1| ABC transporter [Enterococcus faecalis X98]
 gb|EFQ71560.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0470]
 gb|EFT99531.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0043]
 gb|EOI99168.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0291]
 gb|EOJ99733.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0360]
 gb|ETU60860.1| ABC transporter ATP-binding protein [Enterococcus faecalis B382]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_002379727.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 ref|NP_816277.1| ABC transporter ATP-binding protein [Enterococcus faecalis V583]
 gb|AAO82347.1| ABC transporter, ATP-binding protein [Enterococcus faecalis V583]
 gb|EEI57729.1| ABC transporter, ATP-binding protein [Enterococcus faecalis EnGen0297]
 gb|EEU91825.1| ABC transporter ATP-binding protein [Enterococcus faecalis T11]
 gb|EOD88802.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0065]
 gb|EOE37717.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0106]
 gb|EOE40104.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0070]
 gb|EOE42823.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0067]
 gb|EOE45649.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0088]
 gb|EOE51437.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0120]
 gb|EOE51799.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0089]
 gb|EOE54741.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0090]
 gb|EOE58393.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0109]
 gb|EOE61685.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0110]
 gb|EOE62002.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0091]
 gb|EOE68483.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0092]
 gb|EOE70691.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0085]
 gb|EOE72285.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0111]
 gb|EOE79063.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0119]
 gb|EOE81438.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0094]
 gb|EOE87560.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0095]
 gb|EOE89625.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0096]
 gb|EOE93550.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0097]
 gb|EOE96700.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0098]
 gb|EOE99554.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0112]
 gb|EOF03603.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0099]
 gb|EOF07126.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0113]
 gb|EOF07740.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0114]
 gb|EOF13181.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0100]
 gb|EOF16125.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0107]
 gb|EOF18126.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0087]
 gb|EOF23213.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0108]
 gb|EOF37162.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0101]
 gb|EOG32237.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0194]
 gb|EOG40872.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0196]
 gb|EOG41700.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0195]
 gb|EOG45949.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0197]
 gb|EOG52537.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0199]
 gb|EOG55627.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0200]
 gb|EOG59575.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0204]
 gb|EOG59954.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0207]
 gb|EOG64176.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0205]
 gb|EOG68889.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0228]
 gb|EOG71937.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0206]
 gb|EOG72616.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0374]
 gb|EOG77612.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0208]
 gb|EOG81568.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0209]
 gb|EOG84522.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0211]
 gb|EOG85330.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0210]
 gb|EOG93947.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0213]
 gb|EOG94934.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0214]
 gb|EOG99417.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0215]
 gb|EOH03964.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0216]
 gb|EOH04778.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0217]
 gb|EOH07809.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0218]
 gb|EOH14169.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0220]
 gb|EOH14938.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0219]
 gb|EOH15777.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0221]
 gb|EOH23717.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0223]
 gb|EOH26409.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0224]
 gb|EOH26763.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0222]
 gb|EOH33859.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0226]
 gb|EOH34910.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0225]
 gb|EOH61126.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0235]
 gb|EOI08847.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0242]
 gb|EOI18212.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0248]
 gb|EOI20831.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0252]
 gb|EOI27523.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0231]
 gb|EOI79524.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0310]
 gb|EOI79841.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0297]
 gb|EOI87057.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0294]
 gb|EOK20430.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0338]
 gb|EOK56190.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0064]
 gb|EOK61124.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0068]
 gb|EOK64759.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0069]
 gb|EOL13429.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0339]
 gb|EOL52730.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0239]
 gb|EOL74459.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0307]
 gb|EOL74756.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0280]
 gb|EOM47694.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0201]
 gb|EOM48049.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0202]
 gb|EOM54360.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0203]
 gb|EOT52311.1| ABC transporter ATP-binding protein [Enterococcus faecalis V583]
 gb|EOT85774.1| ABC transporter ATP-binding protein [Enterococcus faecalis V583]
 gb|EPI29810.1| ABC transporter, ATP-binding protein [Enterococcus faecalis UP2S-6]
 gb|EPI38086.1| ABC transporter, ATP-binding protein [Enterococcus faecalis SLO2C-1]
 gb|EPR46138.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis 
10244]
 gb|ERT24159.1| ABC transporter ATP-binding protein [Enterococcus faecalis BM4654]
 gb|ETU07257.1| ABC transporter ATP-binding protein [Enterococcus faecalis B301]
 gb|ETU44522.1| ABC transporter ATP-binding protein [Enterococcus faecalis B345]
 gb|ETU45807.1| ABC transporter ATP-binding protein [Enterococcus faecalis B347]
 gb|ETU66884.1| ABC transporter ATP-binding protein [Enterococcus faecalis B388]
 gb|KDE16007.1| ABC transporter, ATP-binding protein [Enterococcus faecalis 918]
 gb|KGQ74541.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_033598506.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|KAJ75573.1| ABC transporter ATP-binding protein uup [Enterococcus faecalis 
MTUP9]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_033600532.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|KAJ65400.1| ABC transporter ATP-binding protein uup [Enterococcus faecalis 
KS19]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_016616094.1| ABC transporter, ATP-binding protein [Enterococcus faecalis]
 gb|EPH71056.1| ABC transporter, ATP-binding protein [Enterococcus faecalis 20-SD-BW-06]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_010717109.1| ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EOF26696.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0115]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_010712730.1| ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EOE11764.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0079]
 gb|EOL37051.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0348]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_002397084.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EFU14134.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX1342]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_002384138.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EEN75876.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX1322]
 gb|EFT93999.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0012]
 gb|EOJ45411.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0361]
 gb|EOJ77698.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0356]
 gb|EOK35632.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0330]
 gb|EOK39126.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0335]
 gb|EOK40966.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0332]
 gb|EOL89482.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0366]
 gb|EOL92446.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0344]
 gb|EOL95258.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0341]
 gb|ERL07339.1| ABC transporter, ATP-binding protein [Enterococcus faecalis E12]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_002367169.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EEI10866.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0104]
 gb|EEU88610.1| ABC transporter [Enterococcus faecalis ARO1/DG]
 gb|EJU88923.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV103]
 gb|EJU89428.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV116]
 gb|EJU94942.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV129]
 gb|EJU97725.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV31]
 gb|EJU98295.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV25]
 gb|EJV05874.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV41]
 gb|EJV06533.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV62]
 gb|EJV06711.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV37]
 gb|EJV13125.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV63]
 gb|EJV18231.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV68]
 gb|EJV21115.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV65]
 gb|EJV27574.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV81]
 gb|EJV29407.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV72]
 gb|EJV29955.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV73]
 gb|EJV38294.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV85]
 gb|EJV38722.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ERV93]
 gb|EJV38860.1| ABC transporter, ATP-binding protein [Enterococcus faecalis R508]
 gb|EOE78460.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0093]
 gb|EOG49562.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0198]
 gb|EOI01298.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0237]
 gb|EOI12575.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0243]
 gb|EOJ86884.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0358]
 gb|EOL46788.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0238]
 gb|EPH67368.1| ABC transporter, ATP-binding protein [Enterococcus faecalis KI-6-1-110608-1]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>gb|EET95449.1| ABC transporter [Enterococcus faecalis T1]
 gb|EEU24217.1| ABC transporter [Enterococcus faecalis T3]
Length=649

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  500  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  534



>ref|WP_033918770.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_016629928.1| MULTISPECIES: ABC transporter, ATP-binding protein [Enterococcus]
 gb|EPI26375.1| ABC transporter, ATP-binding protein [Enterococcus faecium SB2C-2]
 gb|EPI30931.1| ABC transporter, ATP-binding protein [Enterococcus faecalis WKS-26-18-2]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_010716226.1| ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EOG90584.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0212]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_002399494.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EFU88429.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0309B]
 gb|EFU95145.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0309A]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_002365037.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
 ref|YP_005709068.1| ABC superfamily ATP binding cassette transporter, ABC protein 
[Enterococcus faecalis OG1RF]
 ref|YP_005706741.1| ABC transporter family protein [Enterococcus faecalis 62]
 ref|YP_006538558.1| ABC transporter family protein [Enterococcus faecalis D32]
 ref|YP_007153900.1| ABC transporter, ATP-binding protein [Enterococcus faecalis str. 
Symbioflor 1]
 gb|EEN71474.1| ABC transporter, ATP-binding protein [Enterococcus faecalis ATCC 
29200]
 gb|EEU65001.1| ABC transporter [Enterococcus faecalis DS5]
 gb|EEU70880.1| ABC transporter [Enterococcus faecalis HIP11704]
 gb|EEU75142.1| ABC transporter [Enterococcus faecalis JH1]
 gb|EEU82947.1| ABC transporter [Enterococcus faecalis D6]
 gb|EFG19954.1| ABC transporter, ATP-binding protein [Enterococcus faecalis PC1.1]
 gb|EFK77070.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TUSoD 
Ef11]
 gb|EFM70583.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0109]
 gb|EFM80576.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0855]
 gb|EFM81602.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX4248]
 gb|EFT44698.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0017]
 gb|EFT47707.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0027]
 gb|EFT87751.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX2141]
 gb|EFU03205.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX0312]
 gb|EFU08956.1| ABC transporter, ATP-binding protein [Enterococcus faecalis TX1302]
 gb|ADX81008.1| ABC transporter family protein [Enterococcus faecalis 62]
 gb|AEA94698.1| ABC superfamily ATP binding cassette transporter, ABC protein 
[Enterococcus faecalis OG1RF]
 gb|AFO45081.1| ABC transporter family protein [Enterococcus faecalis D32]
 gb|EJU91932.1| ABC transporter, ATP-binding protein [Enterococcus faecalis 599]
 emb|CCO73186.1| ABC transporter, ATP-binding protein [Enterococcus faecalis str. 
Symbioflor 1]
 gb|EOD91168.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0076]
 gb|EOE01668.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0075]
 gb|EOE08698.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0078]
 gb|EOE16050.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0080]
 gb|EOE16889.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0060]
 gb|EOE23317.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0081]
 gb|EOE24277.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0082]
 gb|EOE26362.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0083]
 gb|EOE28215.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0071]
 gb|EOE35288.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0072]
 gb|EOF23862.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0086]
 gb|EOF32235.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0102]
 gb|EOF32720.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0103]
 gb|EOF38833.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0104]
 gb|EOF40225.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0105]
 gb|EOF46009.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0116]
 gb|EOF48188.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0118]
 gb|EOF49277.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0117]
 gb|EOI31808.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0250]
 gb|EOJ03773.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0282]
 gb|EOJ07945.1| ABC transporter ATP-binding protein [Enterococcus faecalis ATCC 
29200]
 gb|EOJ10651.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0304]
 gb|EOJ11123.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0279]
 gb|EOJ16120.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0281]
 gb|EOJ24259.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0286]
 gb|EOJ30954.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0293]
 gb|EOJ32883.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0290]
 gb|EOJ36067.1| ABC transporter ATP-binding protein [Enterococcus faecalis ATCC 
27275]
 gb|EOJ39131.1| ABC transporter ATP-binding protein [Enterococcus faecalis ATCC 
27959]
 gb|EOJ41454.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0289]
 gb|EOJ45927.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0285]
 gb|EOJ49368.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0345]
 gb|EOJ54603.1| ABC transporter ATP-binding protein [Enterococcus faecalis ATCC 
35038]
 gb|EOJ58811.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0364]
 gb|EOJ61502.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0350]
 gb|EOJ61772.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0336]
 gb|EOJ67755.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0351]
 gb|EOJ81286.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0369]
 gb|EOJ84277.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0357]
 gb|EOK07655.1| ABC transporter ATP-binding protein [Enterococcus faecalis ATCC 
10100]
 gb|EOK11451.1| ABC transporter ATP-binding protein [Enterococcus faecalis ATCC 
6055]
 gb|EOK19862.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0326]
 gb|EOK20780.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0329]
 gb|EOK28123.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0333]
 gb|EOK28868.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0328]
 gb|EOK29301.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0334]
 gb|EOK47966.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0062]
 gb|EOL14258.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0327]
 gb|EOL17789.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0331]
 gb|EOL29424.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0346]
 gb|EOL33242.1| ABC transporter ATP-binding protein [Enterococcus faecalis ATCC 
19433]
 gb|EOL52457.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0240]
 gb|EOM23078.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0253]
 gb|EOM30067.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0232]
 gb|EPH74624.1| ABC transporter, ATP-binding protein [Enterococcus faecalis 02-MB-P-10]
 gb|EPH74908.1| ABC transporter, ATP-binding protein [Enterococcus faecalis D811610-10]
 gb|EPH80197.1| ABC transporter, ATP-binding protein [Enterococcus faecalis B83616-1]
 gb|EPH83822.1| ABC transporter, ATP-binding protein [Enterococcus faecalis 02-MB-BW-10]
 gb|EPH87710.1| ABC transporter, ATP-binding protein [Enterococcus faecalis 06-MB-S-10]
 gb|EPH92515.1| ABC transporter, ATP-binding protein [Enterococcus faecalis 06-MB-S-04]
 gb|EPI09618.1| ABC transporter, ATP-binding protein [Enterococcus faecalis RP2S-4]
 gb|EPI32766.1| ABC transporter, ATP-binding protein [Enterococcus faecalis VC1B-1]
 gb|ERT22481.1| ABC transporter ATP-binding protein [Enterococcus faecalis BM4539]
 gb|ETT89589.1| ABC transporter ATP-binding protein [Enterococcus faecalis B284]
 gb|ETT97096.1| ABC transporter ATP-binding protein [Enterococcus faecalis B289]
 gb|ETT98225.1| ABC transporter ATP-binding protein [Enterococcus faecalis B291]
 gb|ETU03392.1| ABC transporter ATP-binding protein [Enterococcus faecalis B292]
 gb|ETU05894.1| ABC transporter ATP-binding protein [Enterococcus faecalis B293]
 gb|ETU10674.1| ABC transporter ATP-binding protein [Enterococcus faecalis B294]
 gb|ETU16271.1| ABC transporter ATP-binding protein [Enterococcus faecalis B302]
 gb|ETU20996.1| ABC transporter ATP-binding protein [Enterococcus faecalis B316]
 gb|ETU23125.1| ABC transporter ATP-binding protein [Enterococcus faecalis B318]
 gb|ETU26547.1| ABC transporter ATP-binding protein [Enterococcus faecalis B319]
 gb|ETU27859.1| ABC transporter ATP-binding protein [Enterococcus faecalis B320]
 gb|ETU33427.1| ABC transporter ATP-binding protein [Enterococcus faecalis B324]
 gb|ETU40829.1| ABC transporter ATP-binding protein [Enterococcus faecalis B338]
 gb|ETU50827.1| ABC transporter ATP-binding protein [Enterococcus faecalis B348]
 gb|ETU56084.1| ABC transporter ATP-binding protein [Enterococcus faecalis B373]
 gb|ETU58502.1| ABC transporter ATP-binding protein [Enterococcus faecalis B363]
 gb|AHI41452.1| ABC transporter, ATP-binding protein [Enterococcus faecalis DENG1]
 gb|KAJ65591.1| ABC transporter ATP-binding protein uup [Enterococcus faecalis 
FL2]
 gb|KAJ71749.1| ABC transporter ATP-binding protein uup [Enterococcus faecalis 
MTmid8]
 gb|KAJ75738.1| ABC transporter ATP-binding protein uup [Enterococcus faecalis 
AZ19]
 gb|KAJ76318.1| ABC transporter ATP-binding protein uup [Enterococcus faecalis 
GAN13]
 gb|KAJ82695.1| ABC transporter ATP-binding protein uup [Enterococcus faecalis 
NJ44]
 gb|KAJ86239.1| ABC transporter ATP-binding protein uup [Enterococcus faecalis 
NY9]
 gb|KDN90251.1| multidrug ABC transporter ATP-binding protein [Enterococcus faecalis]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_010816692.1| ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EOL35438.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0362]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



>ref|WP_010826627.1| ABC transporter ATP-binding protein [Enterococcus faecalis]
 gb|EOJ96355.1| ABC transporter ATP-binding protein [Enterococcus faecalis EnGen0359]
Length=648

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    VSHDRYFINQLANKVFDLNHEGGQMYLGDYQYYIE  105
            VSHDRYFIN++A KV +L+ +G ++YLGDY YY+E
Sbjct  499  VSHDRYFINRIATKVVELSEKGSKLYLGDYDYYLE  533



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525703048884