BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9406_g1_i1 len=394 path=[1:0-393]

Length=394
                                                                      Score     E

emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               256   2e-82   Capsicum annuum
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   4e-82   
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    259   5e-82   Ricinus communis
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   7e-82   
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   8e-82   
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   9e-82   
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   9e-82   
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   1e-81   
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   2e-81   
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             258   2e-81   Populus trichocarpa [western balsam poplar]
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    257   3e-81   
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    257   3e-81   
emb|CDP07271.1|  unnamed protein product                                258   3e-81   
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    257   3e-81   
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    257   4e-81   
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    257   4e-81   
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              257   4e-81   
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    256   7e-81   
gb|KDO85177.1|  hypothetical protein CISIN_1g012940mg                   251   7e-81   
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    255   9e-81   
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   9e-81   
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             256   1e-80   
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    255   1e-80   
ref|XP_003603852.1|  Glyceraldehyde-3-phosphate dehydrogenase           250   2e-80   
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             254   2e-80   
gb|KDO85176.1|  hypothetical protein CISIN_1g012940mg                   251   2e-80   
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    255   3e-80   Populus trichocarpa [western balsam poplar]
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   3e-80   
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   3e-80   
emb|CDY69523.1|  BnaC08g46180D                                          253   3e-80   
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   4e-80   
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   4e-80   
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    254   5e-80   
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               254   5e-80   
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   6e-80   
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   6e-80   
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   6e-80   
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    253   7e-80   Nicotiana tabacum [American tobacco]
gb|ACU20783.1|  unknown                                                 254   7e-80   Glycine max [soybeans]
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   7e-80   
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   9e-80   
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   9e-80   
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   1e-79   
ref|XP_006435407.1|  hypothetical protein CICLE_v10001114mg             249   1e-79   
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   1e-79   
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    249   2e-79   Oryza sativa Japonica Group [Japonica rice]
emb|CAN69459.1|  hypothetical protein VITISV_021576                     253   2e-79   Vitis vinifera
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             252   2e-79   
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    252   2e-79   Vitis vinifera
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    252   3e-79   
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    252   3e-79   
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    252   3e-79   
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              249   3e-79   
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    252   3e-79   
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    252   3e-79   
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              252   3e-79   
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   251   4e-79   
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   4e-79   
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   5e-79   
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   7e-79   
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              247   8e-79   
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    248   1e-78   
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          249   1e-78   
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              249   1e-78   
ref|NP_001048847.1|  Os03g0129300                                       251   1e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             251   1e-78   
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    250   1e-78   
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         250   2e-78   
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    250   2e-78   Spinacia oleracea
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    250   2e-78   
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                248   2e-78   
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    249   2e-78   
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    249   3e-78   
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             249   5e-78   
gb|ACJ84309.1|  unknown                                                 249   5e-78   Medicago truncatula
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           249   5e-78   
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      247   5e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   6e-78   
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   7e-78   
dbj|BAJ86633.1|  predicted protein                                      248   8e-78   
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            248   8e-78   Arabidopsis thaliana [mouse-ear cress]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    248   1e-77   Pisum sativum [garden pea]
gb|EPS70760.1|  hypothetical protein M569_03997                         248   1e-77   
dbj|BAJ87214.1|  predicted protein                                      248   1e-77   
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             248   1e-77   
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    248   2e-77   
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           249   2e-77   
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   2e-77   
ref|NP_001240080.1|  uncharacterized protein LOC100806482               248   2e-77   
gb|ACN40006.1|  unknown                                                 248   2e-77   Picea sitchensis
gb|ABK24645.1|  unknown                                                 248   2e-77   Picea sitchensis
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    248   2e-77   
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             246   2e-77   
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             246   3e-77   
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    245   3e-77   
gb|ACN40526.1|  unknown                                                 247   3e-77   Picea sitchensis
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    247   3e-77   
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         259   4e-77   
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    246   4e-77   
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    246   5e-77   
ref|XP_006383782.1|  hypothetical protein POPTR_0005s27550g             241   9e-77   
emb|CAA33262.1|  unnamed protein product                                244   2e-76   Pisum sativum [garden pea]
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   4e-76   
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               239   1e-75   Coleochaete scutata
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    241   2e-75   Marchantia polymorpha
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               242   2e-75   Marchantia polymorpha
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   4e-75   
gb|KDO85181.1|  hypothetical protein CISIN_1g012940mg                   233   5e-74   
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               234   3e-72   Chara vulgaris
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      229   2e-70   Chlorokybus atmophyticus
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    226   6e-70   Mesostigma viride
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      224   6e-70   Spirogyra sp. SAG 170.80
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      227   7e-70   Mesostigma viride
ref|XP_001415434.1|  predicted protein                                  218   3e-66   Ostreococcus lucimarinus CCE9901
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         217   3e-66   Micromonas commoda
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             213   2e-64   
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    211   6e-64   
ref|XP_001779769.1|  predicted protein                                  211   9e-64   
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              210   1e-63   
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    211   1e-63   Ostreococcus tauri
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    211   1e-63   
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      210   2e-63   Scherffelia dubia
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           210   2e-63   
ref|XP_001779753.1|  predicted protein                                  210   2e-63   
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           209   2e-63   Chlamydomonas reinhardtii
ref|XP_005843104.1|  hypothetical protein CHLNCDRAFT_49269              206   3e-63   
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      206   7e-63   Chlorella sp. JP-2005
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    206   9e-63   Scenedesmus vacuolatus
ref|XP_001771209.1|  predicted protein                                  208   9e-63   
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase               204   1e-62   Sphagnum cuspidatum
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    206   1e-62   Chlamydomonas incerta
ref|XP_001771246.1|  predicted protein                                  208   1e-62   
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    208   1e-62   Botryococcus braunii
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    207   1e-62   Chlamydomonas incerta
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     207   2e-62   Physcomitrella patens
ref|XP_001753934.1|  predicted protein                                  207   2e-62   
ref|XP_001766703.1|  predicted protein                                  206   3e-62   
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      207   4e-62   Cyanophora paradoxa
gb|ADU04763.1|  glyceraldehyde-3-phosphate dehydrogenase                199   1e-61   
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                204   1e-61   
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase                201   2e-61   
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     202   2e-61   Physcomitrella patens
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    202   2e-61   Mesostigma viride
emb|CBI21236.3|  unnamed protein product                                201   3e-61   
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           203   5e-61   
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    204   5e-61   
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    201   7e-61   
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    201   8e-61   
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    201   8e-61
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                201   8e-61   
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      201   8e-61   Mesostigma viride
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    201   9e-61   
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase                199   1e-60   
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase               199   2e-60   Klebsormidium flaccidum
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                201   2e-60   Dunaliella salina
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    202   2e-60   Spinacia oleracea
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    202   2e-60   
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase                199   2e-60   
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    201   3e-60   
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               199   4e-60   Spirogyra sp.
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    201   4e-60   Vitis vinifera
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    201   4e-60   
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               199   6e-60   Sphagnum cuspidatum
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             200   9e-60   
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             200   9e-60   
emb|CAN78872.1|  hypothetical protein VITISV_021726                     200   1e-59   Vitis vinifera
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    200   1e-59   
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    200   1e-59   
gb|ACU21011.1|  unknown                                                 200   2e-59   Glycine max [soybeans]
gb|ADB81484.1|  glyceraldehyde-3-phosphate dehydrogenase                196   2e-59   
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    199   2e-59   
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    199   2e-59   
gb|ADB81488.1|  glyceraldehyde-3-phosphate dehydrogenase                196   2e-59   
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      198   3e-59   Cladophora rupestris
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      196   3e-59   Coleochaete scutata
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             199   3e-59   
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    199   4e-59   
gb|ADB81485.1|  glyceraldehyde-3-phosphate dehydrogenase                195   4e-59   
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    199   4e-59   
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    198   4e-59   Dunaliella viridis
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    199   5e-59   Chondrus crispus [carageen]
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           199   5e-59   
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                196   8e-59   
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    198   8e-59   
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase                195   9e-59   
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    197   1e-58   
gb|ADB81487.1|  glyceraldehyde-3-phosphate dehydrogenase                194   1e-58   
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    197   2e-58   
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase                194   2e-58   
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    194   3e-58   
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    196   3e-58   
gb|KFM26247.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    196   4e-58   
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    195   5e-58   Ostreococcus tauri
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    195   5e-58   
ref|XP_001420043.1|  predicted protein                                  194   6e-58   Ostreococcus lucimarinus CCE9901
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    194   6e-58   Chlorokybus atmophyticus
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    195   6e-58   Ostreococcus 'lucimarinus'
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase                194   7e-58   
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           194   1e-57   
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               193   1e-57   
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    195   1e-57   
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    193   2e-57   Marchantia polymorpha
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      193   2e-57   Chlorokybus atmophyticus
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   2e-57   
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   2e-57   
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               194   2e-57   
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    193   2e-57   Micromonas commoda
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   2e-57   
gb|EPS59235.1|  hypothetical protein M569_15573                         194   3e-57   
emb|CDY19412.1|  BnaC05g09210D                                          194   3e-57   
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              194   3e-57   
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               191   4e-57   Capsicum annuum
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     192   4e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDP18560.1|  unnamed protein product                                193   4e-57   
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              192   4e-57   
dbj|BAH57068.1|  AT1G12900                                              192   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   6e-57   
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        193   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             192   6e-57   
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    193   7e-57   
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             191   7e-57   
gb|AGJ50596.1|  GAPDH                                                   192   8e-57   
gb|KDO85183.1|  hypothetical protein CISIN_1g012940mg                   189   8e-57   
ref|XP_002892719.1|  GAPA-2                                             192   9e-57   
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   9e-57   
emb|CDY16038.1|  BnaC08g40850D                                          192   1e-56   
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             192   1e-56   
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   1e-56   
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    190   1e-56   
emb|CDY26599.1|  BnaA09g46780D                                          192   1e-56   
ref|XP_010458726.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   1e-56   
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   1e-56   
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   1e-56   
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             192   1e-56   
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   1e-56   
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    193   2e-56   
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          192   2e-56   
gb|KDO85179.1|  hypothetical protein CISIN_1g012940mg                   187   2e-56   
gb|ABK00066.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    188   2e-56   Chara vulgaris
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         192   2e-56   
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             192   2e-56   
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      189   2e-56   Chara vulgaris
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                192   2e-56   
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    190   2e-56   
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             191   3e-56   
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    190   3e-56   
gb|KDO85175.1|  hypothetical protein CISIN_1g012940mg                   188   3e-56   
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               189   3e-56   Capsicum annuum
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    191   3e-56   
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             191   4e-56   
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   4e-56   
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    191   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   4e-56   
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   4e-56   
ref|XP_002875330.1|  gapa                                               191   4e-56   
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      191   4e-56   Pyropia yezoensis
gb|ADB81486.1|  glyceraldehyde-3-phosphate dehydrogenase                189   4e-56   
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   4e-56   
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         191   4e-56   
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   4e-56   
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   4e-56   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   4e-56   
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   5e-56   
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                191   5e-56   
dbj|BAJ90530.1|  predicted protein                                      191   5e-56   
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   6e-56   
dbj|BAJ90885.1|  predicted protein                                      191   6e-56   
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             190   6e-56   
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    191   6e-56   
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       191   6e-56   Medicago sativa [alfalfa]
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               190   6e-56   Marchantia polymorpha
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    191   6e-56   Ricinus communis
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      189   6e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   7e-56   
ref|NP_001052984.1|  Os04g0459500                                       190   9e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   9e-56   
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                190   9e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   9e-56   
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    190   1e-55   Pisum sativum [garden pea]
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         190   1e-55   
emb|CAA33264.1|  unnamed protein product                                190   1e-55   
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    189   1e-55   
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         189   2e-55   
emb|CAA30152.1|  GADPH (383 AA)                                         189   2e-55   
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    189   2e-55   
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                191   2e-55   
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    189   2e-55   
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          188   2e-55   
gb|ABK96233.1|  unknown                                                 189   2e-55   
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   2e-55   
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             189   3e-55   
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             189   3e-55   
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   4e-55   
gb|AAB66887.1|  glyceraldehyde-3-phosphate dehydrogenase                184   4e-55   
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   4e-55   
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   5e-55   
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  188   6e-55   
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           186   8e-55   
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    187   8e-55   
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             187   1e-54   
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    187   1e-54   
gb|ABK96725.1|  unknown                                                 187   1e-54   
gb|ACN39951.1|  unknown                                                 185   2e-54   
gb|ABK94956.1|  unknown                                                 186   2e-54   
gb|ACN40537.1|  unknown                                                 187   2e-54   
gb|ABK24313.1|  unknown                                                 186   2e-54   
gb|ABK25233.1|  unknown                                                 186   2e-54   
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             186   3e-54   
ref|XP_006573127.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    177   4e-54   
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              186   5e-54   
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           184   5e-54   
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    185   6e-54   
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    185   7e-54   
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    185   7e-54   
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    183   1e-53   
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    183   1e-53   
gb|ACN40000.1|  unknown                                                 184   1e-53   
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   2e-53   
emb|CAB41845.1|  glyceraldehyde-3-phosphate dehydrogenase               181   2e-53   
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   2e-53   
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    184   2e-53   
ref|XP_006573126.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    175   4e-53   
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           181   4e-53   
dbj|BAJ34149.1|  unnamed protein product                                182   5e-53   
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   183   7e-53   
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    181   8e-53   
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase           182   9e-53   
ref|WP_006099248.1|  glyceraldehyde-3-phosphate dehydrogenase           179   3e-52   
gb|AAB82133.1|  glyceralehyde-3-phosphate dehydrogenase subunit         179   3e-52   
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    179   4e-52   
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    178   5e-52   
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                180   6e-52   
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    178   1e-51   
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    177   3e-51   
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           176   3e-51   
ref|WP_023068106.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    175   4e-51   
ref|WP_008180745.1|  glyceraldehyde-3-phosphate dehydrogenase           176   4e-51   
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         176   7e-51   
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase           175   9e-51   
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           175   1e-50   
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2              174   1e-50   
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           175   1e-50   
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    175   1e-50   
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    174   2e-50   
gb|AIE73346.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    174   2e-50   
emb|CAC80999.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    174   2e-50   
tpg|DAA37468.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         172   2e-50   
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           174   3e-50   
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           174   3e-50   
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           174   3e-50   
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           174   3e-50   
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           174   3e-50   
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    174   3e-50   
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           174   4e-50   
ref|WP_002760704.1|  glyceraldehyde-3-phosphate dehydrogenase           174   4e-50   
ref|WP_002752737.1|  glyceraldehyde-3-phosphate dehydrogenase           174   4e-50   
ref|WP_002789220.1|  glyceraldehyde-3-phosphate dehydrogenase           174   4e-50   
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           173   5e-50   
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    175   5e-50   
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    173   6e-50   
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           173   7e-50   
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    174   7e-50   
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    173   7e-50   
emb|CAC81003.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    172   9e-50   
ref|WP_008205912.1|  glyceraldehyde-3-phosphate dehydrogenase           173   1e-49   
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           172   1e-49   
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    172   1e-49   
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    172   2e-49   
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                172   2e-49   
gb|KEI65516.1|  Gap2                                                    172   2e-49   
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           171   3e-49   
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   173   5e-49   
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      169   5e-49   
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    171   5e-49   
ref|WP_011378166.1|  glyceraldehyde-3-phosphate dehydrogenase           171   6e-49   
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           170   8e-49   
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    170   8e-49   
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           170   1e-48   
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    170   1e-48   
emb|CAC85938.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    169   1e-48   
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    170   2e-48   
emb|CAC81001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    168   2e-48   
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    169   3e-48   
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    171   3e-48   
ref|WP_007286779.1|  glyceraldehyde-3-phosphate dehydrogenase           169   3e-48   
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase           168   4e-48   
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           168   5e-48   
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase           168   6e-48   
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    168   7e-48   
ref|WP_003423731.1|  glyceraldehyde-3-phosphate dehydrogenase           168   7e-48   
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase           168   7e-48   
gb|EQE50035.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        167   9e-48   
ref|WP_021381095.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    167   1e-47   
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    167   1e-47   
ref|WP_021363565.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    167   1e-47   
ref|WP_003430259.1|  glyceraldehyde-3-phosphate dehydrogenase           167   1e-47   
ref|WP_021366683.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    167   1e-47   
ref|WP_011861329.1|  glyceraldehyde-3-phosphate dehydrogenase           167   1e-47   
ref|WP_021396121.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    167   1e-47   
ref|WP_021387925.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    167   1e-47   
ref|WP_021359263.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    167   1e-47   
pdb|2D2I|A  Chain A, Crystal Structure Of Nadp-Dependent Glyceral...    168   1e-47   
ref|WP_021384519.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    167   1e-47   
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    167   2e-47   
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           166   2e-47   
ref|WP_014274525.1|  glyceraldehyde-3-phosphate dehydrogenase           166   2e-47   
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           166   2e-47   
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           166   3e-47   
ref|WP_021375375.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    166   3e-47   
gb|EDX87031.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        166   3e-47   
ref|WP_022071170.1|  glyceraldehyde-3-phosphate dehydrogenase type I    166   3e-47   
ref|WP_024037572.1|  hypothetical protein                               166   3e-47   
ref|WP_009889722.1|  glyceraldehyde-3-phosphate dehydrogenase           166   3e-47   
ref|WP_006669576.1|  glyceraldehyde-3-phosphate dehydrogenase           166   4e-47   
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    166   4e-47   
ref|WP_021403216.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    166   5e-47   
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           166   5e-47   
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           166   6e-47   
ref|WP_015224818.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    165   6e-47   
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           165   6e-47   
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    165   7e-47   
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    165   7e-47   
ref|WP_003361055.1|  glyceraldehyde-3-phosphate dehydrogenase           165   7e-47   
ref|WP_024932293.1|  glyceraldehyde-3-phosphate dehydrogenase           165   8e-47   
ref|WP_027702179.1|  glyceraldehyde-3-phosphate dehydrogenase [         165   9e-47   
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           165   1e-46   
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           165   1e-46   
ref|WP_024621443.1|  glyceraldehyde-3-phosphate dehydrogenase [         165   1e-46   
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           164   2e-46   
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    164   2e-46   
dbj|BAN09110.1|  glyceraldehyde-3-phosphate dehydrogenase               161   2e-46   
ref|WP_026901073.1|  glyceraldehyde-3-phosphate dehydrogenase           164   2e-46   
ref|WP_013360861.1|  glyceraldehyde-3-phosphate dehydrogenase [         164   3e-46   
gb|AJD29572.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        164   3e-46   
emb|CAC79672.1|  glyceraldehyde-3-phosphate dehydrogenase               162   3e-46   
ref|WP_030034234.1|  glyceraldehyde-3-phosphate dehydrogenase           163   3e-46   
ref|WP_003405140.1|  glyceraldehyde-3-phosphate dehydrogenase           163   3e-46   
ref|WP_025776489.1|  glyceraldehyde-3-phosphate dehydrogenase           163   3e-46   
ref|WP_033065220.1|  glyceraldehyde-3-phosphate dehydrogenase           163   4e-46   
ref|WP_003489534.1|  glyceraldehyde-3-phosphate dehydrogenase           163   5e-46   
ref|WP_003490186.1|  glyceraldehyde-3-phosphate dehydrogenase           163   5e-46   
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           163   5e-46   
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           163   5e-46   
ref|WP_021135254.1|  glyceraldehyde-3-phosphate dehydrogenase           163   5e-46   
ref|WP_012343874.1|  glyceraldehyde-3-phosphate dehydrogenase           163   5e-46   
ref|WP_011948756.1|  glyceraldehyde-3-phosphate dehydrogenase           163   5e-46   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           163   5e-46   
ref|WP_003357063.1|  glyceraldehyde-3-phosphate dehydrogenase           163   6e-46   
ref|WP_033064345.1|  glyceraldehyde-3-phosphate dehydrogenase           163   6e-46   
ref|WP_003398731.1|  glyceraldehyde-3-phosphate dehydrogenase           163   6e-46   
dbj|GAK09708.1|  NAD-dependent glyceraldehyde-3-phosphate dehydro...    162   7e-46   
ref|WP_015126379.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    163   8e-46   
ref|WP_012389052.1|  glyceraldehyde-3-phosphate dehydrogenase           162   8e-46   
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           162   9e-46   
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    162   1e-45   
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase           162   2e-45   
ref|WP_014520297.1|  glyceraldehyde-3-phosphate dehydrogenase           161   2e-45   
dbj|GAK12488.1|  NAD-dependent glyceraldehyde-3-phosphate dehydro...    161   2e-45   
dbj|GAK02948.1|  NAD-dependent glyceraldehyde-3-phosphate dehydro...    161   2e-45   
ref|WP_002973650.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    161   2e-45   
ref|WP_039728353.1|  glyceraldehyde-3-phosphate dehydrogenase           161   2e-45   
ref|WP_004783923.1|  glyceraldehyde-3-phosphate dehydrogenase           161   2e-45   
dbj|GAJ99357.1|  NAD-dependent glyceraldehyde-3-phosphate dehydro...    161   3e-45   
ref|WP_022867829.1|  glyceraldehyde-3-phosphate dehydrogenase           160   3e-45   
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           161   3e-45   
ref|WP_027771336.1|  glyceraldehyde-3-phosphate dehydrogenase           160   4e-45   
ref|WP_026427191.1|  glyceraldehyde-3-phosphate dehydrogenase           160   5e-45   
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    160   6e-45   
ref|WP_038089676.1|  glyceraldehyde-3-phosphate dehydrogenase           160   7e-45   
ref|WP_026894821.1|  glyceraldehyde-3-phosphate dehydrogenase           160   7e-45   
emb|CAC41001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    159   8e-45   
ref|WP_015678258.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    160   8e-45   
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           160   9e-45   
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase           159   1e-44   
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           159   1e-44   
ref|WP_027753567.1|  glyceraldehyde-3-phosphate dehydrogenase           159   1e-44   
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    159   1e-44   
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           159   2e-44   
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           159   2e-44   
ref|WP_010312655.1|  glyceraldehyde-3-phosphate dehydrogenase           159   2e-44   
ref|WP_012283622.1|  glyceraldehyde-3-phosphate dehydrogenase           159   2e-44   
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    159   2e-44   
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           159   2e-44   
ref|WP_010313976.1|  glyceraldehyde-3-phosphate dehydrogenase           159   3e-44   
ref|WP_035163541.1|  glyceraldehyde-3-phosphate dehydrogenase           158   3e-44   
ref|WP_011098686.1|  glyceraldehyde-3-phosphate dehydrogenase           158   3e-44   
ref|WP_039260564.1|  glyceraldehyde-3-phosphate dehydrogenase           158   3e-44   
ref|WP_039629836.1|  glyceraldehyde-3-phosphate dehydrogenase           158   3e-44   
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase           158   4e-44   
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase           158   4e-44   
ref|WP_011433307.1|  glyceraldehyde-3-phosphate dehydrogenase           158   4e-44   
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    158   4e-44   
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           158   4e-44   
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase    157   5e-44   
ref|WP_018921696.1|  hypothetical protein                               157   6e-44   
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           157   6e-44   
emb|CDF47293.1|  glyceraldehyde 3-phosphate dehydrogenase               155   7e-44   
ref|WP_027447573.1|  glyceraldehyde-3-phosphate dehydrogenase           157   7e-44   
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           157   7e-44   
ref|YP_002049068.1|  Glyceraldehyde 3-phosphate dehydrogenase NAD...    157   8e-44   



>emb|CAC80374.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=317

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  47   LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  106

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQ+Y+HEV+NIVSNASCTTNCLAPF K++DEEF
Sbjct  107  IQAGAKKVIITAPAKGADIPTYVVGVNEQEYTHEVANIVSNASCTTNCLAPFAKILDEEF  166

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  167  GIVKGTMTTTH  177



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEV+NI+SNASCTTNCLAPFVKVMDEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIISNASCTTNCLAPFVKVMDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   259 bits (662),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDN TISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNTTISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DYSHEV+NIVSNASCTTNCLAPFVKVMDEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYSHEVANIVSNASCTTNCLAPFVKVMDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   259 bits (661),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEVSNIVSNASCTTNCLAPFVKVMDEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVSNIVSNASCTTNCLAPFVKVMDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   259 bits (661),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  133  LGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  192

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY HE SNIVSNASCTTNCLAPFVKVMDEEF
Sbjct  193  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYHHEASNIVSNASCTTNCLAPFVKVMDEEF  252

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  253  GIVKGTMTTTH  263



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   258 bits (660),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  131  LGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  190

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY HE SNIVSNASCTTNCLAPFVKVMDEEF
Sbjct  191  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYHHEASNIVSNASCTTNCLAPFVKVMDEEF  250

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  251  GIVKGTMTTTH  261



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   259 bits (661),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQ YSHEVS+I+SNASCTTNCLAPFVKVMDEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEQGYSHEVSDIISNASCTTNCLAPFVKVMDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEVSNIVSNASCTTNCLAPFVKVMDEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVSNIVSNASCTTNCLAPFVKVMDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG FKADVK+VDNETISVDGKP++VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGIFKADVKIVDNETISVDGKPVQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEV+NIVSNASCTTNCLAPFVKV+DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTTNCLAPFVKVLDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  158  LGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  217

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEVSNIVSNASCTTNCLAPFVKVMDEEF
Sbjct  218  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVSNIVSNASCTTNCLAPFVKVMDEEF  277

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  278  GIVKGTMTTTH  288



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  134  LGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  193

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEV+NIVSNASCTTNCLAPFVKVMDEEF
Sbjct  194  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTTNCLAPFVKVMDEEF  253

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  254  GIVKGTMTTTH  264



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKPIKVVSNRDPL+LPWA +GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNETISVDGKPIKVVSNRDPLQLPWAALGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY+HEVSNIVSNASCTTNCLAPFVKVMDEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYTHEVSNIVSNASCTTNCLAPFVKVMDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVKVVD ETISVDGKPI+VVS+RDPLKLPWAD+GIDIVIEGTGVFVDGPGAGKH
Sbjct  142  LGTFKADVKVVDTETISVDGKPIQVVSSRDPLKLPWADLGIDIVIEGTGVFVDGPGAGKH  201

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDY HEVSNIVSNASCTTNCLAPFVKV+DEEF
Sbjct  202  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYYHEVSNIVSNASCTTNCLAPFVKVLDEEF  261

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  262  GIVKGTMTTTH  272



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  134  LGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  193

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEV+NIVSNASCTTNCLAPFVKVMDEEF
Sbjct  194  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTTNCLAPFVKVMDEEF  253

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  254  GIVKGTMTTTH  264



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   257 bits (657),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKPIKVVSNRDPL+LPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  139  LGTFKADVKIVDNETISVDGKPIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKH  198

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY HEVSNI+SNASCTTNCLAPFVKVMDEEF
Sbjct  199  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNASCTTNCLAPFVKVMDEEF  258

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  259  GIVKGTMTTTH  269



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+V+NETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVNNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY HEVSNIVSNASCTTNCLAPFVKVMDEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIVSNASCTTNCLAPFVKVMDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKG+DIPTYVVGVNEQDY H+V+NI+SNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGSDIPTYVVGVNEQDYEHDVANIISNASCTTNCLAPFVKILDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   256 bits (655),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  138  LGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  197

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY HEVSNI+SNASCTTNCLAPFVKV+DEEF
Sbjct  198  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNASCTTNCLAPFVKVIDEEF  257

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  258  GIVKGTMTTTH  268



>gb|KDO85177.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85178.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=304

 Score =   251 bits (642),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEV+NIVSNASCTTNCLAPFVKVMDEE 
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEEL  256

Query  33   GIVKGTMTTTH  1
            GIVKG MTTTH
Sbjct  257  GIVKGAMTTTH  267



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score =   255 bits (651),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKP+KVVSNRDPLKLPW +MGIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNETISVDGKPVKVVSNRDPLKLPWTEMGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY H+V+NIVSNASCTTNCLAPFVKV+DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHDVANIVSNASCTTNCLAPFVKVLDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score =   256 bits (654),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWAD+GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWADLGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY HEV+NIVSNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVANIVSNASCTTNCLAPFVKIIDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG FKADVK+VDNETISVDGKP++VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGIFKADVKIVDNETISVDGKPVQVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEV+NIVSNASCTTNCLAPFVKV+DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTTNCLAPFVKVLDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  132  LGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  191

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYVVGVNEQDY+H+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  192  IQAGASKVIITAPAKGADIPTYVVGVNEQDYAHDVANIISNASCTTNCLAPFAKVLDEEF  251

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  252  GIVKGTMTTTH  262



>ref|XP_003603852.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=283

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+++NETI+VDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDY HEV++I+SNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNASCTTNCLAPFVKILDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  105  LGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  164

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYVVGVNE+DY HEV+NI+SNASCTTNCLAPFVKVMDEEF
Sbjct  165  IQAGATKVIITAPAKGADIPTYVVGVNEKDYDHEVANIISNASCTTNCLAPFVKVMDEEF  224

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  225  GIVKGTMTTTH  235



>gb|KDO85176.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=329

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEV+NIVSNASCTTNCLAPFVKVMDEE 
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEEL  256

Query  33   GIVKGTMTTTH  1
            GIVKG MTTTH
Sbjct  257  GIVKGAMTTTH  267



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYVVGVNE+DY HEV+NI+SNASCTTNCLAPFVKVMDEEF
Sbjct  196  IQAGATKVIITAPAKGADIPTYVVGVNEKDYDHEVANIISNASCTTNCLAPFVKVMDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKP+KVVSNRDPLKLPW +MGIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNETISVDGKPVKVVSNRDPLKLPWTEMGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY H+V+NIVSNASCTTNCLAPFVKV+DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHDVANIVSNASCTTNCLAPFVKVLDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKP+KVVSNRDPLKLPW +MGIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNETISVDGKPVKVVSNRDPLKLPWTEMGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY H+V+NIVSNASCTTNCLAPFVKV+DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHDVANIVSNASCTTNCLAPFVKVLDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPLKLPWAD+GIDIVIEGTGVFVDGPGAGKH
Sbjct  86   LGTFKADVKIVDNETISVDGKLIKVVSNRDPLKLPWADLGIDIVIEGTGVFVDGPGAGKH  145

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYVVGVNEQDYSH+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  146  IQAGASKVIITAPAKGADIPTYVVGVNEQDYSHDVANIISNASCTTNCLAPFAKVLDEEF  205

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  206  GIVKGTMTTTH  216



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKAD+K+VDNETISVDGKPIKVVSNRDPLKLPWA+MGIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADIKIVDNETISVDGKPIKVVSNRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY H V++IVSNASCTTNCLAPFVKV+DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYGHSVADIVSNASCTTNCLAPFVKVLDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKP+KVVS+RDPLKLPWA+MGIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY H+V+NIVSNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYGHDVANIVSNASCTTNCLAPFVKILDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   254 bits (649),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKP+KVVS+RDPLKLPWA+MGIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY H+V+NIVSNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYGHDVANIVSNASCTTNCLAPFVKILDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   254 bits (649),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  135  LGTFKADVKIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  194

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEV+NIVSNASCTTNCLAPF K++DEEF
Sbjct  195  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTTNCLAPFAKILDEEF  254

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  255  GIVKGTMTTTH  265



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  135  LGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  194

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHE++NI+SNASCTTNCLAPFVKVMDEE 
Sbjct  195  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEIANIISNASCTTNCLAPFVKVMDEEL  254

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  255  GIVKGTMTTTH  265



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  135  LGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  194

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHE++NI+SNASCTTNCLAPFVKVMDEE 
Sbjct  195  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEIANIISNASCTTNCLAPFVKVMDEEL  254

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  255  GIVKGTMTTTH  265



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  135  LGTFKADVKIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  194

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEV+NIVSNASCTTNCLAPF K++DEEF
Sbjct  195  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTTNCLAPFAKILDEEF  254

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  255  GIVKGTMTTTH  265



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   253 bits (647),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  105  LGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  164

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEV++I+SNASCTTNCLAPFVKVMDEE 
Sbjct  165  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVADIISNASCTTNCLAPFVKVMDEEL  224

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  225  GIVKGTMTTTH  235



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score =   254 bits (648),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 131/131 (100%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK++DNETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKILDNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY+H++SNI+SNASCTTNCLAPFVK++DEEF
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNERDYTHQISNIISNASCTTNCLAPFVKILDEEF  256

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  257  GIVKGTMTTTH  267



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   254 bits (648),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  135  LGTFKADVKIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  194

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYV+GVNEQDYSHEV+NIVSNASCTTNCLAPF K++DEEF
Sbjct  195  IQAGAKKVIITAPAKGADIPTYVIGVNEQDYSHEVANIVSNASCTTNCLAPFAKILDEEF  254

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  255  GIVKGTMTTTH  265



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   253 bits (647),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+V+NETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVNNETISVDGKLIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DYSHEV+NIVSNASCTTNCLAPFVKVMDEEF
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYSHEVANIVSNASCTTNCLAPFVKVMDEEF  256

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  257  GIVKGTMTTTH  267



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   253 bits (647),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKP+KVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVDNETISVDGKPVKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYV GVNE DYSHEV+NI+SNASCTTNCLAPFVKV+DE+F
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVYGVNETDYSHEVANIISNASCTTNCLAPFVKVLDEKF  256

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  257  GIVKGTMTTTH  267



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNET S+DGK IKVVSNRDPLKLPWAD+GIDIVIEGTGVFVDGPGAGKH
Sbjct  135  LGTFKADVKIVDNETFSIDGKSIKVVSNRDPLKLPWADLGIDIVIEGTGVFVDGPGAGKH  194

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DYSH+V+NI+SNASCTTNCLAPFVK+MDEEF
Sbjct  195  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYSHDVANIISNASCTTNCLAPFVKIMDEEF  254

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  255  GIVKGTMTTTH  265



>ref|XP_006435407.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48647.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=329

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEV+NIVSNASCTTNCLAPFVKVMDEE 
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEEL  256

Query  33   GIVKGTMTTTH  1
            GIVKG +TTTH
Sbjct  257  GIVKGAITTTH  267



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  132  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  191

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYVVGVNEQDYSH+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  192  IQAGASKVIITAPAKGADIPTYVVGVNEQDYSHDVANIISNASCTTNCLAPFAKVLDEEF  251

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  252  GIVKGTMTTTH  262



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VD++TISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  2    LGTFKADVKIVDDQTISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  61

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYV+GVNE DYSHEV+NI+SNASCTTNCLAPFVK++DEEF
Sbjct  62   IQAGAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNASCTTNCLAPFVKILDEEF  121

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  122  GIVKGTMTTTH  132



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DYSHEVSNIVSNASCTTNCLAPFVK++DEE 
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYSHEVSNIVSNASCTTNCLAPFVKILDEEL  256

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  257  GIVKGTMTTTH  267



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  132  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  191

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYVVGVNEQDYSH+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  192  IQAGASKVIITAPAKGADIPTYVVGVNEQDYSHDVANIISNASCTTNCLAPFAKVLDEEF  251

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  252  GIVKGTMTTTH  262



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DYSHEVSNIVSNASCTTNCLAPFVK++DEE 
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYSHEVSNIVSNASCTTNCLAPFVKILDEEL  256

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  257  GIVKGTMTTTH  267



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  134  LGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  193

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEV++I+SNASCTTNCLAPFVKVMDEE 
Sbjct  194  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVADIISNASCTTNCLAPFVKVMDEEL  253

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  254  GIVKGTMTTTH  264



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK++DNETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKILDNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY+H++SNI+SNASCTTNCLAPFVK++DEEF
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYTHQISNIISNASCTTNCLAPFVKILDEEF  256

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  257  GIVKGTMTTTH  267



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK++DNETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  138  LGTFKADVKILDNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  197

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY+H++SNI+SNASCTTNCLAPFVK++DEEF
Sbjct  198  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYTHQISNIISNASCTTNCLAPFVKILDEEF  257

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  258  GIVKGTMTTTH  268



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPLKLPWA +GIDIVIEGTGVFVDGPGAGKH
Sbjct  52   LGTFKADVKIVDNETISVDGKLIKVVSNRDPLKLPWAGLGIDIVIEGTGVFVDGPGAGKH  111

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYVVGVNEQDYSH+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  112  IQAGASKVIITAPAKGADIPTYVVGVNEQDYSHDVANIISNASCTTNCLAPFAKVLDEEF  171

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  172  GIVKGTMTTTH  182



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  134  LGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  193

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEV++I+SNASCTTNCLAPFVKVMDEE 
Sbjct  194  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVADIISNASCTTNCLAPFVKVMDEEL  253

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  254  GIVKGTMTTTH  264



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK++DNETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKILDNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY+H++SNI+SNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYTHQISNIISNASCTTNCLAPFVKILDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGKP+KVVS+RDPLKLPWA+MGIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPT+VVGVNE+DY H+V+NIVSNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTHVVGVNEKDYGHDVANIVSNASCTTNCLAPFVKILDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEV+NIVSNASCTTNCLAPFVKVMDEE 
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEEL  256

Query  33   GIVKGTMTTTH  1
            GIVKG MTTTH
Sbjct  257  GIVKGAMTTTH  267



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   251 bits (642),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VD+ETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  128  LGTFKADVKIVDDETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  187

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYV+GVNE DYSHEV+NI+SNASCTTNCLAPFVK++DEEF
Sbjct  188  IQAGAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNASCTTNCLAPFVKILDEEF  247

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  248  GIVKGTMTTTH  258



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  135  LGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  194

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY H+V+NIVSNASCTTNCLAPFVK++DEEF
Sbjct  195  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYYHDVANIVSNASCTTNCLAPFVKIIDEEF  254

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  255  GIVKGTMTTTH  265



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   251 bits (641),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDN TISVDGKP+ VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNGTISVDGKPVMVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYV+GVNE DY+HEV+NIVSNASCTTNCLAPFVKVMDEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVLGVNEGDYNHEVANIVSNASCTTNCLAPFVKVMDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score =   247 bits (630),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+++NETI+VDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  2    LGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  61

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDY HEV++I+SNASCTTNCLAPFVK++DEEF
Sbjct  62   IQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNASCTTNCLAPFVKILDEEF  121

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  122  GIVKGTMTTTH  132



>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|Q Chain Q, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|T Chain T, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=368

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK++DNET S+DGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  52   LGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  111

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKG+DIPTYVVGVNE+DY H+V+NI+SNASCTTNCLAPFVKV+DEE 
Sbjct  112  IQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEEL  171

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  172  GIVKGTMTTTH  182



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  98   LGTFKAAVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  157

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKG+DIPTYVVGVNE DYS EVSNIVSNASCTTNCLAPFVKVMDEEF
Sbjct  158  IQAGAKKVIITAPAKGSDIPTYVVGVNEGDYSDEVSNIVSNASCTTNCLAPFVKVMDEEF  217

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  218  GIVKGTMTTTH  228



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+++NETI+VDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDY HEV++I+SNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNASCTTNCLAPFVKILDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VD++TISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  128  LGTFKADVKIVDDQTISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  187

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYV+GVNE DYSHEV+NI+SNASCTTNCLAPFVK++DEEF
Sbjct  188  IQAGAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNASCTTNCLAPFVKILDEEF  247

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  248  GIVKGTMTTTH  258



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  132  LGTFKAEVKIVDNETISVDGKNIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  191

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYV+GVNEQDY HEV+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  192  IQAGASKVIITAPAKGADIPTYVMGVNEQDYGHEVANIISNASCTTNCLAPFAKVLDEEF  251

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  252  GIVKGTMTTTH  262



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDN TISVDGKPI VV++RDPLKLPW ++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNGTISVDGKPIMVVASRDPLKLPWTELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DYSHEVSNIVSNASCTTNCLAPFVKVMDEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VD+ TISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDDSTISVDGKHIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DYSH+V+NIVSNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYSHQVANIVSNASCTTNCLAPFVKIIDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK++DNET S+DGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  135  LGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  194

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKG+DIPTYVVGVNE+DY H+V+NI+SNASCTTNCLAPFVKV+DEE 
Sbjct  195  IQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEEL  254

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  255  GIVKGTMTTTH  265



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEV+NIVSNASCTTNCLAPFVKVMDEE 
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEEL  256

Query  33   GIVKGTMTTTH  1
            GIVKG MTTTH
Sbjct  257  GIVKGAMTTTH  267



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+++NETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  114  LGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  173

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKVIITAPAKGADIPTYV+GVNEQDY HEV++I+SNASCTTNCLAPF KV+DEEF
Sbjct  174  LQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEVADIISNASCTTNCLAPFAKVLDEEF  233

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  234  GIVKGTMTTTH  244



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK I+VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  128  LGTFKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  187

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKVIITAPAKGADIPTYVVGVNE DY HEV+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  188  LQAGAKKVIITAPAKGADIPTYVVGVNEGDYGHEVANIISNASCTTNCLAPFAKVLDEEF  247

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  248  GIVKGTMTTTH  258



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  132  LGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  191

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYVVGVNEQDY H+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  192  IQAGASKVIITAPAKGADIPTYVVGVNEQDYGHDVANIISNASCTTNCLAPFAKVLDEEF  251

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  252  GIVKGTMTTTH  262



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPW ++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKIVDNETISVDGKLIKVVSSRDPLKLPWTELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY+HE+SNI+SNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYTHEISNIISNASCTTNCLAPFVKILDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+++NETI+VDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDY HEV++I+SNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNASCTTNCLAPFVKILDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+++NETI+VDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDY HEV++I+SNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNASCTTNCLAPFVKILDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score =   247 bits (631),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  87   LGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  146

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYV+GVNEQDY H+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  147  IQAGASKVIITAPAKGADIPTYVMGVNEQDYGHDVANIISNASCTTNCLAPFAKVLDEEF  206

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  207  GIVKGTMTTTH  217



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   249 bits (635),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVS+RDPLKLPW ++GIDIVIEGTGVFVDGPGAGKH
Sbjct  135  LGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWGELGIDIVIEGTGVFVDGPGAGKH  194

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY H+V+NI+SNASCTTNCLAPFVK++DEEF
Sbjct  195  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYYHDVANIISNASCTTNCLAPFVKIIDEEF  254

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  255  GIVKGTMTTTH  265



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   249 bits (635),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVS+RDPLKLPW ++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWGELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY H+V+NI+SNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYYHDVANIISNASCTTNCLAPFVKIIDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   248 bits (634),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK I+VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  128  LGTFKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  187

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKVIITAPAKGADIPTYVVGVNE DY H+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  188  LQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHDVANIISNASCTTNCLAPFAKVLDEEF  247

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  248  GIVKGTMTTTH  258



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score =   248 bits (634),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  132  LGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  191

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYV+GVNEQDY H+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  192  IQAGASKVIITAPAKGADIPTYVMGVNEQDYGHDVANIISNASCTTNCLAPFAKVLDEEF  251

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  252  GIVKGTMTTTH  262



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+++NETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYV+GVNEQDY HEV++I+SNASCTTNCLAPF KV+DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEVADIISNASCTTNCLAPFAKVLDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADV+VVD++TISVDGK IKVVSNRDPL+LPW+D+GIDIVIEGTGVFVDGPGAGKH
Sbjct  124  LGTFKADVQVVDSQTISVDGKLIKVVSNRDPLQLPWSDLGIDIVIEGTGVFVDGPGAGKH  183

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSH+VS+I+SNASCTTNCLAPFVKV+DEEF
Sbjct  184  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHDVSDIISNASCTTNCLAPFVKVLDEEF  243

Query  33   GIVKGTMTTTH  1
            GI KGTMTTTH
Sbjct  244  GIEKGTMTTTH  254



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK I+VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  128  LGTFKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  187

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKVIITAPAKGADIPTYVVGVNE DY H+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  188  LQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHDVANIISNASCTTNCLAPFAKVLDEEF  247

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  248  GIVKGTMTTTH  258



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEV+NIVSNASCTTNCLAPFVKVMDEE 
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEEL  256

Query  33   GIVKGTMTTTH  1
            GIVKG +TTTH
Sbjct  257  GIVKGAITTTH  267



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK I+VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  128  LGTFKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  187

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKVIITAPAKGADIPTYVVGVNE DY H+V+NIVSNASCTTNCLAPF K++DEEF
Sbjct  188  LQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHDVANIVSNASCTTNCLAPFAKILDEEF  247

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  248  GIVKGTMTTTH  258



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+++NETI+VDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDY HEV++I+SNASCTTNCLAPFVK++DEEF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNASCTTNCLAPFVKILDEEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+++NETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  210  LGTFKADVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  269

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNEQDY H+V++I+SNASCTTNCLAPFVK++DEEF
Sbjct  270  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHDVADIISNASCTTNCLAPFVKILDEEF  329

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  330  GIVKGTMTTTH  340



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK++DNETI+VDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKADVKILDNETITVDGKSIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY+HE+SNI+SNASCTTNCLAPFVK++D EF
Sbjct  196  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYTHEISNIISNASCTTNCLAPFVKILDAEF  255

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  256  GIVKGTMTTTH  266



>gb|ACN40006.1| unknown [Picea sitchensis]
Length=460

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VKVVDN+TISVDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  144  LGTFKANVKVVDNKTISVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  203

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA+KVIITAPAKGADIPTYVVGVNE DYS EVSNIVSNASCTTNCLAPFVKV+DEEF
Sbjct  204  IQAGARKVIITAPAKGADIPTYVVGVNEGDYSDEVSNIVSNASCTTNCLAPFVKVLDEEF  263

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  264  GIVKGTMTTTH  274



>gb|ABK24645.1| unknown [Picea sitchensis]
Length=460

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VKVVDN+TISVDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  144  LGTFKANVKVVDNKTISVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  203

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA+KVIITAPAKGADIPTYVVGVNE DYS EVSNIVSNASCTTNCLAPFVKV+DEEF
Sbjct  204  IQAGARKVIITAPAKGADIPTYVVGVNEGDYSDEVSNIVSNASCTTNCLAPFVKVLDEEF  263

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  264  GIVKGTMTTTH  274



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK++DNETI+VDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKILDNETITVDGKSIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY+HE+SNI+SNASCTTNCLAPFVK++D EF
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYTHEISNIISNASCTTNCLAPFVKILDAEF  256

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  257  GIVKGTMTTTH  267



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VKVVD++TISVDGK I VVS+RDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH
Sbjct  115  LGTFKANVKVVDDKTISVDGKNITVVSSRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKG DIPTYVVGVNE DY HEV+NIVSNASCTTNCLAPFVKVMDEEF
Sbjct  175  IQAGAKKVIITAPAKGTDIPTYVVGVNEADYDHEVANIVSNASCTTNCLAPFVKVMDEEF  234

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  235  GIVKGTMTTTH  245



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VKVVD++TISVDGK I VVS+RDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH
Sbjct  115  LGTFKANVKVVDDKTISVDGKNIAVVSSRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKG DIPTYVVGVNE DY HEV+NIVSNASCTTNCLAPFVKVMDEEF
Sbjct  175  IQAGAKKVIITAPAKGTDIPTYVVGVNEADYDHEVANIVSNASCTTNCLAPFVKVMDEEF  234

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  235  GIVKGTMTTTH  245



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  87   LGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  146

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYV+GVNE+DY H+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  147  IQAGASKVIITAPAKGADIPTYVMGVNEKDYGHDVANIISNASCTTNCLAPFAKVLDEEF  206

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  207  GIVKGTMTTTH  217



>gb|ACN40526.1| unknown [Picea sitchensis]
Length=460

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VKVVDN+TISVDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  144  LGTFKANVKVVDNKTISVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  203

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA+KVIITAPAKGADIPTYVVGVNE DYS EVSNIVSNASCTTNCLAPFVKV+DEEF
Sbjct  204  IQAGARKVIITAPAKGADIPTYVVGVNEGDYSDEVSNIVSNASCTTNCLAPFVKVLDEEF  263

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  264  GIVKGTMTTTH  274



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  130  LGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  189

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYV+GVNE+DY H+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  190  IQAGASKVIITAPAKGADIPTYVMGVNEKDYGHDVANIISNASCTTNCLAPFAKVLDEEF  249

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  250  GIVKGTMTTTH  260



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score =   259 bits (661),  Expect = 4e-77, Method: Composition-based stats.
 Identities = 122/131 (93%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VD+ TISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  139  LGTFKADVKIVDDTTISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  198

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGA+IPTYVVGVNEQDY H+VSNIVSNASCTTNCLAPFVKV+DEEF
Sbjct  199  IQAGAKKVIITAPAKGAEIPTYVVGVNEQDYHHDVSNIVSNASCTTNCLAPFVKVLDEEF  258

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  259  GIVKGTMTTTH  269



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score =   246 bits (629),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  132  LGTFKAEVKIVDNETISVDGKIIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  191

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYV+GVNE+DY H+V+NI+SNASCTTNCLAPF KV+DEEF
Sbjct  192  IQAGASKVIITAPAKGADIPTYVMGVNEKDYGHDVANIISNASCTTNCLAPFAKVLDEEF  251

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  252  GIVKGTMTTTH  262



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VD+ TISVDGKPIKVVS+RDPLKLPWA+MGIDIVIEGTGVFVDGPGAGKH
Sbjct  128  LGTFKADVKIVDDTTISVDGKPIKVVSSRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKH  187

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY H V++I+SNASCTTNCLAPFVKV+DEEF
Sbjct  188  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHGVADIISNASCTTNCLAPFVKVLDEEF  247

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  248  GIVKGTMTTTH  258



>ref|XP_006383782.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61579.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=308

 Score =   241 bits (615),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 129/158 (82%), Gaps = 27/158 (17%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  136  LGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  195

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KVIITAPAKGADIPTYVVGVNE+DY HEV+NI+SNASCTTNCLAPFVKVMDEEF
Sbjct  196  IQAGATKVIITAPAKGADIPTYVVGVNEKDYDHEVANIISNASCTTNCLAPFVKVMDEEF  255

Query  33   ---------------------------GIVKGTMTTTH  1
                                       GIVKGTMTTTH
Sbjct  256  GMNSFIISVKYLDAYEGNWSNCVIILAGIVKGTMTTTH  293



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK+++NETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  132  LGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  191

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYV+GVNEQDY HEV++I+SNASCTTNCLAPF KV+DEE 
Sbjct  192  IQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEVADIISNASCTTNCLAPFAKVLDEES  251

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  252  GIVKGTMTTTH  262



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK I+VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  131  LGTFKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  190

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYV+GVNE+ Y H+V+NIVSNAS TTNCLAPFVKV+DEEF
Sbjct  191  IQAGAKKVIITAPAKGADIPTYVLGVNEEGYDHDVANIVSNASWTTNCLAPFVKVLDEEF  250

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  251  GIVKGTMTTTH  261



>emb|CAC80390.1| glyceraldehyde-3-phosphate dehydrogenase [Coleochaete scutata]
Length=317

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKA+VK +D++T+SV GKPI VVSNRDPLKLPWAD+GIDIVIEGTGVF+DGPGAGKH
Sbjct  46   LGTFKAEVKAIDDKTLSVGGKPITVVSNRDPLKLPWADLGIDIVIEGTGVFIDGPGAGKH  105

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVN  DY H+V+NI+SNASCTTNCLAPFVK+MD EF
Sbjct  106  IQAGAKKVIITAPAKGADIPTYVVGVNADDYDHDVANIISNASCTTNCLAPFVKIMDAEF  165

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  166  GIVKGTMTTTH  176



>gb|ABK00053.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=393

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG FKADVKV D+ T+ VDGKPI VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  113  LGIFKADVKVGDDTTLLVDGKPITVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  172

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTY++GVNE DYSHEV+NI+SNASCTTNCLAPFVKV+DE+F
Sbjct  173  IQAGAKKVIITAPAKGADIPTYIMGVNEGDYSHEVANIISNASCTTNCLAPFVKVLDEKF  232

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  233  GIVKGTMTTTH  243



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG FKADVKV D+ T+ VDGKPI VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  142  LGIFKADVKVGDDTTLLVDGKPITVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  201

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYV+GVNE DYSHEV+NI+SNASCTTNCLAPFVKV+DE+F
Sbjct  202  IQAGAKKVIITAPAKGADIPTYVMGVNEGDYSHEVANIISNASCTTNCLAPFVKVLDEKF  261

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  262  GIVKGTMTTTH  272



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VD+ TISVDGKPI VVS+RDPLKLPW ++GIDIVIEGTGVFVDGPGAGKH
Sbjct  133  LGTFKADVKIVDDTTISVDGKPITVVSSRDPLKLPWGELGIDIVIEGTGVFVDGPGAGKH  192

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE DY H V++I+SNASCTTNCLAPFVK++DEEF
Sbjct  193  IQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHSVADIISNASCTTNCLAPFVKILDEEF  252

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  253  GIVKGTMTTTH  263



>gb|KDO85181.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85182.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=269

 Score =   233 bits (594),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEV+NIVSNASCTTNCLAPFVKVMDEE 
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEEL  256

Query  33   G  31
            G
Sbjct  257  G  257



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK VD   ISVDGK I++VSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  162  LGTFNADVKTVDETHISVDGKVIQIVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  221

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKVIITAPAKG++IPTY VGVNE DY H+VSNI+SNASCTTNCLAPFVKV+DEEF
Sbjct  222  IQAGAKKVIITAPAKGSEIPTYAVGVNEGDYHHDVSNIISNASCTTNCLAPFVKVLDEEF  281

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  282  GIVKGTMTTTH  292



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF A+V ++D +TISVDGKPI +VSNRDP +LPWA++GID+VIEGTGVFVDGPGAGKH
Sbjct  139  LGTFNANVGIIDEKTISVDGKPITIVSNRDPAQLPWAELGIDLVIEGTGVFVDGPGAGKH  198

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAPAKGA+IPTYVVGVNE  Y H+ S I+SNASCTTNCLAPFVKV+DEEF
Sbjct  199  LQAGAKKVLITAPAKGAEIPTYVVGVNEDQYDHDASAIISNASCTTNCLAPFVKVLDEEF  258

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  259  GIVKGTMTTTH  269



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVKV+    ++V+GK I++VS+RDPL+LPWA MG+D+VIEGTGVF+DGPGAGKH
Sbjct  71   LGTFKADVKVISETALAVNGKTIEIVSSRDPLQLPWAKMGVDLVIEGTGVFIDGPGAGKH  130

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAPAKGA+IPTYVVGVNE+DY+H+VSNI+SNASCTTNCLAPF KV+DE F
Sbjct  131  IIAGAKKVLITAPAKGAEIPTYVVGVNEKDYTHDVSNIISNASCTTNCLAPFAKVLDENF  190

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  191  GIVKGTMTTTH  201



>gb|ABD37966.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Spirogyra 
sp. SAG 170.80]
Length=321

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VD++TISV GK I VVS+RDPL+LPWA++GIDIVIEGTGVF+D PGAGKH
Sbjct  50   LGTFKADVKIVDDKTISVGGKNILVVSSRDPLQLPWAELGIDIVIEGTGVFIDTPGAGKH  109

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            + AGAKKVIITAPAKG +IPTYV GVN  +YSHE +NI+SNASCTTNCLAPFVKV+DEEF
Sbjct  110  LTAGAKKVIITAPAKGNEIPTYVCGVNADEYSHEAANIISNASCTTNCLAPFVKVLDEEF  169

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  170  GIVKGTMTTTH  180



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   227 bits (578),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVKV+    ++V+GK I++VS+RDPL+LPWA MG+D+VIEGTGVF+DGPGAGKH
Sbjct  99   LGTFKADVKVISETALAVNGKTIEIVSSRDPLQLPWAKMGVDLVIEGTGVFIDGPGAGKH  158

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAPAKGA+IPTYVVGVNE+DY+H+VSNI+SNASCTTNCLAPF KV+DE F
Sbjct  159  IIAGAKKVLITAPAKGAEIPTYVVGVNEKDYTHDVSNIISNASCTTNCLAPFAKVLDENF  218

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  219  GIVKGTMTTTH  229



>ref|XP_001415434.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABG85192.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus 'lucimarinus']
 gb|ABO93726.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=406

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFK+DVKVVD+ TISVDG  IKVVS+RDPL LPW +MGIDIVIEGTGVF+DGPGAGKH
Sbjct  93   LGTFKSDVKVVDDATISVDGDIIKVVSDRDPLNLPWKEMGIDIVIEGTGVFLDGPGAGKH  152

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAPAKG+DIPTYVVGVN   Y +  +NIVSNASCTTNCLAPF KV+D++F
Sbjct  153  IQAGAKKVVITAPAKGSDIPTYVVGVNADQYDNS-ANIVSNASCTTNCLAPFAKVIDDKF  211

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  212  GIVKGTMTTTH  222



>ref|XP_002507103.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
 gb|ACO68361.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
Length=405

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKVVD+ TI+V+GKPIKVVS+RDPL LPW +MGIDIVIEGTGVF+DGPGAGKH
Sbjct  92   LGTFDADVKVVDDATITVNGKPIKVVSDRDPLNLPWKEMGIDIVIEGTGVFLDGPGAGKH  151

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAPAKG DIPTYVVGVN   Y    +NIVSNASCTTNCLAPF KV+DE+F
Sbjct  152  IQAGAKKVVITAPAKGNDIPTYVVGVNADQYDPS-ANIVSNASCTTNCLAPFAKVLDEKF  210

Query  33   GIVKGTMTTTH  1
            GI+KGTMTT H
Sbjct  211  GIIKGTMTTCH  221



>ref|XP_003056194.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
 gb|EEH59570.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
Length=406

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKVVD+ETISV+G  IKVVS+RDPL LPW +MGIDIVIEGTGVF+DGPGAGKH
Sbjct  92   LGTFDADVKVVDDETISVNGNIIKVVSDRDPLNLPWKEMGIDIVIEGTGVFLDGPGAGKH  151

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAPAKG DIPTYVVGVN   Y    +NIVSNASCTTNCLAPF KV+D++F
Sbjct  152  IQAGAKKVVITAPAKGNDIPTYVVGVNADTYDPS-ANIVSNASCTTNCLAPFAKVLDDKF  210

Query  33   GIVKGTMTTTH  1
            GIVKGTMTT H
Sbjct  211  GIVKGTMTTCH  221



>emb|CEF96577.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=407

 Score =   211 bits (538),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFK+DVKV+D+ TISVDG  IKVVS+RDPL LPW +MGIDIVIEGTGVF+DGPGAGKH
Sbjct  93   LGTFKSDVKVIDDSTISVDGDVIKVVSDRDPLNLPWKEMGIDIVIEGTGVFLDGPGAGKH  152

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAPAKG DIPTYVVGVN   +    +NIVSNASCTTNCLAPF KV+D++F
Sbjct  153  ITAGAKKVVITAPAKGNDIPTYVVGVNADQFDPS-ANIVSNASCTTNCLAPFAKVIDDKF  211

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  212  GIVKGTMTTTH  222



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   211 bits (536),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV  N+ ISVDGK IKVVS+R+PL LPW +MGID+VIEGTGVFVD  GAGKH
Sbjct  115  LGTFNADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGEMGIDLVIEGTGVFVDEAGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KGA IPTYVVGVNEQDY H    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  175  IQAGAKKVLITAPGKGA-IPTYVVGVNEQDYKHS-DAIISNASCTTNCLAPFVKVLDEKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   210 bits (534),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK+VD+  ISVDGK IK+VS+RDPL+LPW +M +D+VIEGTGVF+D  GAGKH
Sbjct  88   LGTFDADVKIVDDSHISVDGKVIKIVSSRDPLQLPWGEMDVDLVIEGTGVFIDKVGAGKH  147

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAPAK  DIPT+VVGVNE DY HE   I+SNASCTTNCLAPFVKV+ E+F
Sbjct  148  IQAGAKKVLITAPAKDKDIPTFVVGVNEADYKHEYP-IISNASCTTNCLAPFVKVLQEKF  206

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  207  GIVKGTMTTTH  217



>gb|ABG85191.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus tauri]
Length=439

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFK+DVKV+D+ TISVDG  IKVVS+RDPL LPW +MGIDIVIEGTGVF+DGPGAGKH
Sbjct  125  LGTFKSDVKVIDDSTISVDGDVIKVVSDRDPLNLPWKEMGIDIVIEGTGVFLDGPGAGKH  184

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAPAKG DIPTYVVGVN   +    +NIVSNASCTTNCLAPF KV+D++F
Sbjct  185  ITAGAKKVVITAPAKGNDIPTYVVGVNADQFDPS-ANIVSNASCTTNCLAPFAKVIDDKF  243

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  244  GIVKGTMTTTH  254



>ref|XP_003074208.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC) [Ostreococcus 
tauri]
Length=434

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFK+DVKV+D+ TISVDG  IKVVS+RDPL LPW +MGIDIVIEGTGVF+DGPGAGKH
Sbjct  120  LGTFKSDVKVIDDSTISVDGDVIKVVSDRDPLNLPWKEMGIDIVIEGTGVFLDGPGAGKH  179

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAPAKG DIPTYVVGVN   +    +NIVSNASCTTNCLAPF KV+D++F
Sbjct  180  ITAGAKKVVITAPAKGNDIPTYVVGVNADQFDPS-ANIVSNASCTTNCLAPFAKVIDDKF  238

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  239  GIVKGTMTTTH  249



>gb|ABD37955.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Scherffelia 
dubia]
Length=390

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADV++VD+  ISVDGK I VVS RDPLKLPW +MGIDIVIEGTGVF+D  GAGKH
Sbjct  105  LGTFGADVQIVDDSHISVDGKVITVVSARDPLKLPWKEMGIDIVIEGTGVFLDSEGAGKH  164

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAPAKG D+PTYV+GVN++DY+ +  +IVSNASCTTNCLAPFVKV+DE+F
Sbjct  165  ITAGAKKVVITAPAKGKDVPTYVIGVNDKDYNPKTDHIVSNASCTTNCLAPFVKVVDEKF  224

Query  33   GIVKGTMTTTH  1
            GIVKG MTTTH
Sbjct  225  GIVKGMMTTTH  235



>ref|XP_007515295.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO14174.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=405

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFK++VKV+D++TISVDG  I VV+ RDPLKLPW +MGIDIVIEGTGVF+DGPGAGKH
Sbjct  92   LGTFKSEVKVIDDKTISVDGDIINVVAERDPLKLPWKEMGIDIVIEGTGVFLDGPGAGKH  151

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAPAKG DIPTYVVGVN   +    +NIVSNASCTTNCLAPF KV+DE F
Sbjct  152  ITAGAKKVVITAPAKGNDIPTYVVGVNADQF-DPAANIVSNASCTTNCLAPFAKVLDESF  210

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  211  GIVKGTMTTTH  221



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV  N+ ISVDGK IKVVS+R+PL LPW +MGID+VIEGTGVFVD  GAGKH
Sbjct  121  LGTFNADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGEMGIDLVIEGTGVFVDEAGAGKH  180

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KGA IPTYVVGVNEQDY H    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  181  IQAGAKKVLITAPGKGA-IPTYVVGVNEQDYKHS-DAIISNASCTTNCLAPFVKVLDEKF  238

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  239  GIIKGTMTTTH  249



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK+VD+  ISVDGK IK+VS+RDPL+LPW +M ID+VIEGTGVF+D  GAGKH
Sbjct  88   LGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMNIDLVIEGTGVFIDKVGAGKH  147

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KV+ITAPAK  DIPT+VVGVNE DY HE   I+SNASCTTNCLAPFVKV++++F
Sbjct  148  IQAGASKVLITAPAKDKDIPTFVVGVNEGDYKHEYP-IISNASCTTNCLAPFVKVLEQKF  206

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  207  GIVKGTMTTTH  217



>ref|XP_005843104.1| hypothetical protein CHLNCDRAFT_49269 [Chlorella variabilis]
 gb|EFN51002.1| hypothetical protein CHLNCDRAFT_49269 [Chlorella variabilis]
Length=310

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            +GTF ADVK+V  ++ S++GK IKVVS+RDP KLPWADM +D+VIEGTGVF+D  GAGKH
Sbjct  67   MGTFNADVKIVSEDSFSINGKVIKVVSSRDPTKLPWADMKVDLVIEGTGVFIDEAGAGKH  126

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAPAKG+ IPTYVVGVN  DY H    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  127  IEAGAKKVLITAPAKGSGIPTYVVGVNADDYKHS-DTIISNASCTTNCLAPFVKVLDEKF  185

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  186  GIVKGTMTTTH  196



>gb|ABD37953.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorella 
sp. JP-2005]
Length=316

 Score =   206 bits (524),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            +GTF ADVK+VD+   SV+GK I+VVS+RDPL+LPW  + ID+VIEGTGVF+D  GA KH
Sbjct  31   MGTFDADVKIVDDTHFSVNGKVIQVVSSRDPLQLPWKALDIDLVIEGTGVFIDTKGASKH  90

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAPAKG+DIPTYVVGVNEQDY H    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  91   IEAGAKKVLITAPAKGSDIPTYVVGVNEQDYKHS-DAIISNASCTTNCLAPFVKVLDEKF  149

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  150  GIVKGTMTTTH  160



>sp|Q8VXQ9.1|G3PA_SCEVA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A; Short=GAPDHA, partial [Scenedesmus vacuolatus]
 emb|CAC81011.1| NADP-dependent glyceraldehyde-3-phosphate dehydrogenase (phosphorylating), 
partial [Scenedesmus vacuolatus]
Length=314

 Score =   206 bits (523),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK+VD+  ISV+GK I+VVS+RDP KLPW +M ID+VIEGTGVF+D PGA KH
Sbjct  46   LGKFDADVKIVDDGHISVNGKSIRVVSSRDPTKLPWGEMEIDLVIEGTGVFIDTPGASKH  105

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAPAKG+DIPTYVVGVN  DY H    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  106  IEAGAKKVLITAPAKGSDIPTYVVGVNAHDYKHS-DAIISNASCTTNCLAPFVKVLDEKF  164

Query  33   GIVKGTMTTTH  1
            GIVKGTMT TH
Sbjct  165  GIVKGTMTNTH  175



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   208 bits (529),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV  N+ ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKH
Sbjct  114  LGTFDADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKH  173

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KGA IPTYVVGVNE+DY H  S I+SNASCTTNCLAPFVKV+DE+F
Sbjct  174  IQAGAKKVLITAPGKGA-IPTYVVGVNEKDYKHSDS-IISNASCTTNCLAPFVKVLDEKF  231

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  232  GIIKGTMTTTH  242



>emb|CAC80394.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=283

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV  N+ ISVDGK IKVVS+R+PL LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  15   LGTFNADVKVDGNDGISVDGKIIKVVSDRNPLNLPWGELGIDLVIEGTGVFVDKEGAGKH  74

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KGA IPTYVVGVNE+ YSH    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  75   LQAGAKKVLITAPGKGA-IPTYVVGVNEEQYSHR-DEIISNASCTTNCLAPFVKVLDEKF  132

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  133  GIIKGTMTTTH  143



>gb|ABA01156.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
incerta]
Length=342

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK+VD+  ISVDGK IK+VS+RDPL+LPW +M ID+VIEGTGVF+D  GAGKH
Sbjct  75   LGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMDIDLVIEGTGVFIDKVGAGKH  134

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KV+ITAPAK  DIPT+VVGVN+ DY HE   I+SNASCTTNCLAPFVKV++++F
Sbjct  135  IQAGAHKVLITAPAKDKDIPTFVVGVNDADYKHEYP-IISNASCTTNCLAPFVKVLEQKF  193

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  194  GIVKGTMTTTH  204



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV  N+ ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKH
Sbjct  121  LGTFDADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKH  180

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KGA IPTYVVGVNE+DY H  S I+SNASCTTNCLAPFVKV+DE+F
Sbjct  181  IQAGAKKVLITAPGKGA-IPTYVVGVNEKDYKHSDS-IISNASCTTNCLAPFVKVLDEKF  238

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  239  GIIKGTMTTTH  249



>gb|ACX37507.1| chloroplast glyceraldehyde 3-phosphate dehydrogenase [Botryococcus 
braunii]
Length=411

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKVVD+ TI+V+GKPIK+VS+RDPL LPW D  ID+VIEGTGVFV   GAGKH
Sbjct  126  LGTFNADVKVVDDTTIAVNGKPIKIVSSRDPLALPWKDNNIDLVIEGTGVFVSSEGAGKH  185

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAPAKG+D+PTYVVGVN   Y H   NI+SNASCTTNCLAPFVKV+DE+ 
Sbjct  186  IAAGAKKVLITAPAKGSDVPTYVVGVNADQYKHS-DNIISNASCTTNCLAPFVKVLDEKL  244

Query  33   GIVKGTMTTTH  1
            GIVKGT+TTTH
Sbjct  245  GIVKGTVTTTH  255



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK+VD+  ISVDGK IK+VS+RDPL+LPW +M ID+VIEGTGVF+D  GAGKH
Sbjct  83   LGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMDIDLVIEGTGVFIDKVGAGKH  142

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGA KV+ITAPAK  DIPT+VVGVN+ DY HE   I+SNASCTTNCLAPFVKV++++F
Sbjct  143  IQAGAHKVLITAPAKDKDIPTFVVGVNDADYKHEYP-IISNASCTTNCLAPFVKVLEQKF  201

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  202  GIVKGTMTTTH  212



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV  N  ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKH
Sbjct  93   LGTFNADVKVEGNNAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKH  152

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KGA IPT+VVGVNEQDY H    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  153  IQAGAKKVLITAPGKGA-IPTFVVGVNEQDYKHS-DAIISNASCTTNCLAPFVKVLDEKF  210

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  211  GIIKGTMTTTH  221



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV  N  ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKH
Sbjct  121  LGTFNADVKVEGNNAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKH  180

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KGA IPT+VVGVNEQDY H    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  181  IQAGAKKVLITAPGKGA-IPTFVVGVNEQDYKHS-DAIISNASCTTNCLAPFVKVLDEKF  238

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  239  GIIKGTMTTTH  249



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV  N+ ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKH
Sbjct  91   LGTFDADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKH  150

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG  IPTYVVGVNEQDY H    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  151  IQAGAKKVLITAPGKGP-IPTYVVGVNEQDYKHS-DTIISNASCTTNCLAPFVKVLDEKF  208

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  209  GIIKGTMTTTH  219



>gb|ABD37954.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cyanophora 
paradoxa]
Length=412

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK VD+  ISV+GK IKVVS RDP  LPW ++G++IVIE TGVF+DGPGAGKH
Sbjct  127  LGRFDADVKYVDDGAISVNGKTIKVVSTRDPTTLPWKELGVEIVIESTGVFIDGPGAGKH  186

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAPAKG+DIPTYVVGVN +DY+    +IVSNASCTTNCLAPFVKV+DE+F
Sbjct  187  IAAGAKKVVITAPAKGSDIPTYVVGVNHKDYNPSTDHIVSNASCTTNCLAPFVKVLDEKF  246

Query  33   GIVKGTMTTTH  1
             I+KGTMTTTH
Sbjct  247  KIIKGTMTTTH  257



>gb|ADU04763.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=192

 Score =   199 bits (506),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK V ++TISVDGK IK+VS+RDPL+LPW +MGIDIVIEGTGVF+D  GAGKH
Sbjct  1    LGTFGADVKAVSDDTISVDGKLIKIVSSRDPLQLPWKEMGIDIVIEGTGVFIDEAGAGKH  60

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAP KG +IPTYVVGVN   Y      IVSNASCTTNCLAPF KV+D++F
Sbjct  61   ITAGAKKVLITAPGKGPNIPTYVVGVNADQY-KPTDTIVSNASCTTNCLAPFAKVLDDKF  119

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  120  GIIKGTMTTTH  130



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV D + ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKH
Sbjct  93   LGTFNADVKV-DGDGISVDGKTIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKH  151

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KGA IPTYV+GVNEQDY+H    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  152  LQAGAKKVLITAPGKGA-IPTYVIGVNEQDYTH-ADKIISNASCTTNCLAPFVKVLDEKF  209

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  210  GIIKGTMTTTH  220



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK V ++TISVDGK IK+VS+RDPL LPW +MGIDIVIEGTGVF+D  GAGKH
Sbjct  1    LGTFAADVKAVSDDTISVDGKLIKIVSSRDPLSLPWKEMGIDIVIEGTGVFIDEAGAGKH  60

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAP KG +IPTYVVGVN   Y      IVSNASCTTNCLAPF KV+DE+F
Sbjct  61   ITAGAKKVLITAPGKGPNIPTYVVGVNADQY-KSTDTIVSNASCTTNCLAPFAKVLDEKF  119

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  120  GIIKGTMTTTH  130



>gb|ABD37963.1| glyceraldehyde-3-phosphate dehydrogenase subunit A2 [Physcomitrella 
patens]
Length=323

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF A VKV  N+ ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKH
Sbjct  38   LGTFDAYVKVEGNDAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKH  97

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG  IPTYVVGVNEQDY H    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  98   IQAGAKKVLITAPGKGP-IPTYVVGVNEQDYKHS-DTIISNASCTTNCLAPFVKVLDEKF  155

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  156  GIIKGTMTTTH  166



>gb|ABK00056.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Mesostigma viride]
Length=310

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK V ++TISVDGK IK+VS+RDPL LPW +MGIDIVIEGTGVF+D  GAGKH
Sbjct  27   LGTFAADVKAVSDDTISVDGKLIKIVSSRDPLSLPWKEMGIDIVIEGTGVFIDEAGAGKH  86

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAP KG +IPTYVVGVN   Y      IVSNASCTTNCLAPF KV+DE+F
Sbjct  87   ITAGAKKVLITAPGKGPNIPTYVVGVNADQY-KSTDTIVSNASCTTNCLAPFAKVLDEKF  145

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  146  GIIKGTMTTTH  156



>emb|CBI21236.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   201 bits (511),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 116/131 (89%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+ADVK V ++ ISVDGK IK+VS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKH
Sbjct  120  LGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGKH  179

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN  +Y+H+ S I+SNASCTTNCLAPFVKV+D++F
Sbjct  180  IQAGAKKVLITAPGKG-DIPTYVVGVNADEYNHDES-IISNASCTTNCLAPFVKVLDQKF  237

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  238  GIIKGTMTTTH  248



>ref|XP_005644071.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19527.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=393

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF AD+KV+D+ T+SV+GK IK+VSNRDPL+LPW +MGID+VIEGTGVFV   GAGKH
Sbjct  109  LGTFNADIKVIDDSTVSVNGKQIKIVSNRDPLQLPWGEMGIDLVIEGTGVFVSSDGAGKH  168

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAPAKG DIPTYV+GVN+  +      I+SNASCTTNCLAPF KV+ E+F
Sbjct  169  IKAGAKKVLITAPAKGNDIPTYVIGVNDDTFDPSAP-IISNASCTTNCLAPFAKVLHEKF  227

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  228  GIVKGTMTTTH  238



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK   N+ ISVDGK IKVVS+R+PL LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  117  LGTFDADVKPEGNDAISVDGKVIKVVSDRNPLNLPWKDLGIDLVIEGTGVFVDREGAGKH  176

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVNE+ Y+H    I+SNASCTTNCLAPFVKV+D++F
Sbjct  177  IQAGAKKVLITAPGKG-DIPTYVVGVNEEGYTH-ADTIISNASCTTNCLAPFVKVLDQKF  234

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  235  GIIKGTMTTTH  245



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK   +  ISVDGK IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH
Sbjct  52   LGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKH  111

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVNE+ Y+H    I+SNASCTTNCLAPFVKV+D++F
Sbjct  112  LQAGAKKVLITAPGKG-DIPTYVVGVNEEGYTH-ADTIISNASCTTNCLAPFVKVLDQKF  169

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  170  GIIKGTMTTTH  180



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK   +  ISVDGK IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH
Sbjct  52   LGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKH  111

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVNE+ Y+H    I+SNASCTTNCLAPFVKV+D++F
Sbjct  112  LQAGAKKVLITAPGKG-DIPTYVVGVNEEGYTH-ADTIISNASCTTNCLAPFVKVLDQKF  169

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  170  GIIKGTMTTTH  180



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK   +  ISVDGK IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH
Sbjct  52   LGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKH  111

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVNE+ Y+H    I+SNASCTTNCLAPFVKV+D++F
Sbjct  112  LQAGAKKVLITAPGKG-DIPTYVVGVNEEGYTH-ADTIISNASCTTNCLAPFVKVLDQKF  169

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  170  GIIKGTMTTTH  180



>gb|ADB81492.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=315

 Score =   201 bits (510),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK V ++TISVDGK IK+VS+RDPL LPW +MGIDIVIEGTGVF+D  GAGKH
Sbjct  48   LGTFAADVKAVSDDTISVDGKLIKIVSSRDPLSLPWKEMGIDIVIEGTGVFIDEAGAGKH  107

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAP KG +IPTYVVGVN   Y      IVSNASCTTNCLAPF KV+DE+F
Sbjct  108  ITAGAKKVLITAPGKGPNIPTYVVGVNADQY-KSTDTIVSNASCTTNCLAPFAKVLDEKF  166

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  167  GIIKGTMTTTH  177



>gb|ABD37961.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Mesostigma 
viride]
Length=333

 Score =   201 bits (511),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK V ++TISVDGK IK+VS+RDPL LPW +MGIDIVIEGTGVF+D  GAGKH
Sbjct  48   LGTFAADVKAVSDDTISVDGKLIKIVSSRDPLSLPWKEMGIDIVIEGTGVFIDEAGAGKH  107

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAP KG +IPTYVVGVN   Y      IVSNASCTTNCLAPF KV+DE+F
Sbjct  108  ITAGAKKVLITAPGKGPNIPTYVVGVNADQYK-STDTIVSNASCTTNCLAPFAKVLDEKF  166

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  167  GIIKGTMTTTH  177



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   201 bits (511),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK   +  ISVDGK IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH
Sbjct  52   LGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKH  111

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVNE+ Y+H    I+SNASCTTNCLAPFVKV+D++F
Sbjct  112  LQAGAKKVLITAPGKG-DIPTYVVGVNEEGYTH-ADTIISNASCTTNCLAPFVKVLDQKF  169

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  170  GIIKGTMTTTH  180



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF A+VK V ++TISVDGK IK+VS+RDPL+LPW +MGIDIVIEGTGVF+D  GAGKH
Sbjct  1    LGTFAAEVKAVSDDTISVDGKLIKIVSSRDPLQLPWKEMGIDIVIEGTGVFIDEAGAGKH  60

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAP KG +IPTYVVGVN   Y      IVSNASCTTNCLAPF KV+D++F
Sbjct  61   ITAGAKKVLITAPGKGPNIPTYVVGVNADQY-KSTDTIVSNASCTTNCLAPFAKVLDDKF  119

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  120  GIIKGTMTTTH  130



>emb|CAC80391.2| glyceraldehyde-3-phosphate dehydrogenase [Klebsormidium flaccidum]
Length=315

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKVV ++ ISVDGK IKVVSNRDP KLPW +M ID+VIEGTGVFVD  GAGKH
Sbjct  50   LGTFDADVKVVGDDAISVDGKVIKVVSNRDPTKLPWGEMNIDLVIEGTGVFVDEAGAGKH  109

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            ++AGAKKV+ITAP KG +IPTYV+GVNE+ Y H    I+SNASCTTNCLAPFVKV+D++F
Sbjct  110  LEAGAKKVLITAPGKG-NIPTYVIGVNEEKYKHS-EKIISNASCTTNCLAPFVKVLDQKF  167

Query  33   GIVKGTMTTTH  1
            G+VKG MTTTH
Sbjct  168  GVVKGCMTTTH  178



>gb|ACA35006.1| glyceraldehyde-3-phosphate dehydrogenase [Dunaliella salina]
Length=376

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK VD +T+SV+GK I VVS+RDP +LPW  M ID+VIEGTGVF+D PGAGKH
Sbjct  90   LGKFSADVKAVDEKTLSVNGKNIAVVSSRDPTQLPWKAMNIDLVIEGTGVFIDTPGAGKH  149

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAPAKG+DIPT+VVGVN   Y H+   IVSNASCTTNCLAPFVKV+ E+F
Sbjct  150  IQAGAKKVLITAPAKGSDIPTFVVGVNCDGYKHDYP-IVSNASCTTNCLAPFVKVLHEKF  208

Query  33   GIVKGTMTTTH  1
            G+VKGTMTTTH
Sbjct  209  GVVKGTMTTTH  219



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK   +  ISVDGK IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH
Sbjct  117  LGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKH  176

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVNE+ Y+H    I+SNASCTTNCLAPFVKV+D++F
Sbjct  177  LQAGAKKVLITAPGKG-DIPTYVVGVNEEGYTH-ADTIISNASCTTNCLAPFVKVLDQKF  234

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  235  GIIKGTMTTTH  245



>ref|XP_005704189.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Galdieria sulphuraria]
 emb|CAC80066.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) [Galdieria sulphuraria]
 gb|EME27669.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Galdieria sulphuraria]
Length=414

 Score =   202 bits (514),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 94/131 (72%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+ DV+    + I+VDGK IKVVSNRDPL+LPW D+ ID+V+E TGVFVD  GAGKH
Sbjct  129  LGTFEKDVRA-GEDCITVDGKEIKVVSNRDPLQLPWKDLNIDLVVEATGVFVDSKGAGKH  187

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG D+ T+V+GVNE  Y H+V +IVSNASCTTNCLAPF+KV+ EEF
Sbjct  188  LQAGAKKVLITAPGKGEDVGTFVIGVNEHSYDHQVHHIVSNASCTTNCLAPFIKVLHEEF  247

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  248  GIVKGTMTTTH  258



>gb|ADB81491.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Klebsormidium 
flaccidum]
Length=314

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF AD+KVV ++ ISVDGK IK+VSNRDP KLPW +M ID+VIEGTGVFVD  GAGKH
Sbjct  48   LGTFDADIKVVGDDAISVDGKVIKIVSNRDPTKLPWGEMDIDLVIEGTGVFVDEAGAGKH  107

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG +IPTYVVGV+E+ Y H  + I+SNASCTTNCLAPFVKV+D++F
Sbjct  108  LQAGAKKVLITAPGKG-NIPTYVVGVSEEKYKHSEA-IISNASCTTNCLAPFVKVLDQKF  165

Query  33   GIVKGTMTTTH  1
            G++KGTMTTTH
Sbjct  166  GVIKGTMTTTH  176



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK   +  ISVDGK IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH
Sbjct  52   LGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKH  111

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVNE+ Y+H    I+SNASCTTNCLAPFVKV+D++F
Sbjct  112  LQAGAKKVLITAPGKG-DIPTYVVGVNEEGYTH-ADTIISNASCTTNCLAPFVKVLDQKF  169

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  170  GIIKGTMTTTH  180



>emb|CAC80392.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Spirogyra 
sp.]
Length=318

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK+ D+ +ISVDGK IKVVS+R+PL LPW +MGID+VIEGTGVF+DGPGAGKH
Sbjct  50   LGIFNADVKIADDNSISVDGKIIKVVSDRNPLNLPWGEMGIDLVIEGTGVFIDGPGAGKH  109

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAP KG  IPTYVVGVN   Y H    I+SNASCTTNCLAPFVK+++E+F
Sbjct  110  IEAGAKKVLITAPGKGP-IPTYVVGVNADKYVHS-EPIISNASCTTNCLAPFVKILEEKF  167

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  168  GIIKGTMTTTH  178



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 116/131 (89%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+ADVK V ++ ISVDGK IK+VS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKH
Sbjct  120  LGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGKH  179

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN  +Y+H+ S I+SNASCTTNCLAPFVKV+D++F
Sbjct  180  IQAGAKKVLITAPGKG-DIPTYVVGVNADEYNHDES-IISNASCTTNCLAPFVKVLDQKF  237

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  238  GIIKGTMTTTH  248



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 116/131 (89%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+ADVK V ++ ISVDGK IK+VS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKH
Sbjct  119  LGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN  +Y+H+ S I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IQAGAKKVLITAPGKG-DIPTYVVGVNADEYNHDES-IISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>emb|CAC80393.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=318

 Score =   199 bits (505),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV  N++ISVDGK IKVVS+R+PL LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  50   LGTFAADVKVDGNDSISVDGKTIKVVSDRNPLNLPWGELGIDLVIEGTGVFVDKEGAGKH  109

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            ++AGAKKV+ITAP KGA IPTYVVGVN  +Y+H    I+SNASCTTNCLAPFVKV+DE+F
Sbjct  110  LKAGAKKVLITAPGKGA-IPTYVVGVNADEYNHG-DEIISNASCTTNCLAPFVKVLDEKF  167

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  168  GIIKGTMTTTH  178



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   200 bits (509),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV  +  ISVDGK IKVVSNRDPLKLPW ++G+D+VIEGTGVFVD  GAGKH
Sbjct  118  LGTFDADVKVSGDSAISVDGKVIKVVSNRDPLKLPWGELGVDLVIEGTGVFVDQEGAGKH  177

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            ++AGAKKV+ITAP KGA IPTYVVGVN + YS     I+SNASCTTNCLAPFVKV+DE+F
Sbjct  178  LKAGAKKVLITAPGKGA-IPTYVVGVNAEQYS-PTEPIISNASCTTNCLAPFVKVLDEKF  235

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  236  GIIKGTMTTTH  246



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   200 bits (509),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVKV  +  ISVDGK IKVVSNRDPLKLPW ++G+D+VIEGTGVFVD  GAGKH
Sbjct  118  LGTFDADVKVSGDSAISVDGKVIKVVSNRDPLKLPWGELGVDLVIEGTGVFVDQEGAGKH  177

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            ++AGAKKV+ITAP KGA IPTYVVGVN + YS     I+SNASCTTNCLAPFVKV+DE+F
Sbjct  178  LKAGAKKVLITAPGKGA-IPTYVVGVNAEQYS-PTEPIISNASCTTNCLAPFVKVLDEKF  235

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  236  GIIKGTMTTTH  246



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+ADVK V ++ ISVDGK IK+VS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKH
Sbjct  120  LGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGKH  179

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN  +Y+H+   I+SNASCTTNCLAPFVKV+D++F
Sbjct  180  IQAGAKKVLITAPGKG-DIPTYVVGVNADEYNHD-EXIISNASCTTNCLAPFVKVLDQKF  237

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  238  GIIKGTMTTTH  248



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK V ++ ISVDGK IKVVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  119  LGTFDADVKPVGSDIISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVNE DYS +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IQAGAKKVLITAPGKG-DIPTYVVGVNEYDYSPD-EPIISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK V ++ ISVDGK IKVVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  119  LGTFDADVKPVGSDIISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVNE DYS +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IQAGAKKVLITAPGKG-DIPTYVVGVNEYDYSPD-EPIISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK V +  ISVDGK IKVVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  119  LGTFDADVKPVGSNVISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVNE DYS +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IQAGAKKVLITAPGKG-DIPTYVVGVNEYDYSPD-EPIISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>gb|ADB81484.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Bornetella 
sphaerica]
Length=277

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            +GTF+ DVK+VD+  ISVDGK I++VS RDPL+LPW +MG+D+VIEGTGVFV+  GAGKH
Sbjct  28   MGTFEGDVKIVDDSHISVDGKQIRIVSXRDPLQLPWGEMGVDLVIEGTGVFVNEEGAGKH  87

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            + AGAKKV+ITAP KG +IPT+V GVNE+ Y HE   I+SNASCTTNCLAPFVKV++++F
Sbjct  88   LTAGAKKVLITAPGKG-NIPTFVCGVNEELYKHEYP-IISNASCTTNCLAPFVKVLEQKF  145

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  146  GIVKGTMTTTH  156



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK V +  ISVDGK IKVVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  119  LGTFDADVKPVGSNVISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVNE DYS +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IQAGAKKVLITAPGKG-DIPTYVVGVNEYDYSPD-EPIISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK V +  ISVDGK IKVVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  119  LGTFDADVKPVGSNVISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVNE DYS +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IQAGAKKVLITAPGKG-DIPTYVVGVNEYDYSPD-EPIISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>gb|ADB81488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Codium sp. 
HEC 15711]
Length=291

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            +GTF ADV+VVD+  ISVDG+ I++VS RDP  LPWA++G+ IVIEGTGVFV+  GA KH
Sbjct  35   MGTFNADVQVVDDNHISVDGRKIQIVSTRDPTTLPWAELGVGIVIEGTGVFVNEEGASKH  94

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKVIITAP KG DIPT+VVGVNE  Y HE   IVSNASCTTNCLAPFVKV+++EF
Sbjct  95   LQAGAKKVIITAPGKG-DIPTFVVGVNEDGYKHEYP-IVSNASCTTNCLAPFVKVLEKEF  152

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  153  GIVKGTMTTTH  163



>gb|ABD37957.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cladophora 
rupestris]
Length=376

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+  V+ +D+ T++VDGK I++VSNRDP KLPWADMG+D+VIEGTGVFV   GAGKH
Sbjct  92   LGTFERTVEKIDDSTMAVDGKNIRIVSNRDPTKLPWADMGVDLVIEGTGVFVSEEGAGKH  151

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKVIITAP KG DIPT+V+GVN  DY HE   I+SNASCTTNCLAPFVKV+ E+F
Sbjct  152  LQAGAKKVIITAPGKG-DIPTFVMGVNSDDYKHEYP-IISNASCTTNCLAPFVKVIVEKF  209

Query  33   GIVKGTMTTTH  1
            G+VKGTMTTTH
Sbjct  210  GVVKGTMTTTH  220



>gb|ABD37960.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Coleochaete 
scutata]
Length=314

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF A+VK+V ++ ISVDG  IKVVS+R+PL +PW  MG+D+VIEGTGVFVD  GAGKH
Sbjct  48   LGTFGAEVKIVGDDAISVDGHVIKVVSDRNPLNMPWGKMGVDLVIEGTGVFVDSEGAGKH  107

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAP KG DIPTYVVGVN Q+Y H    I+SNASCTTNCLAPFV+++D +F
Sbjct  108  ITAGAKKVLITAPGKGKDIPTYVVGVNAQNYKH-TDTIISNASCTTNCLAPFVQILDAKF  166

Query  33   GIVKGTMTTTH  1
            G++KGTMTTTH
Sbjct  167  GLIKGTMTTTH  177



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F+ADVK   +E ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKH
Sbjct  119  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDMEIDLVIEGTGVFVDREGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAP KG DIPTYVVGVN   YSH+ S I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IEAGAKKVLITAPGKG-DIPTYVVGVNADAYSHDES-IISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   199 bits (505),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F+ADVK   +E ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKH
Sbjct  119  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDMEIDLVIEGTGVFVDREGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAP KG DIPTYVVGVN   YSH+ S I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IEAGAKKVLITAPGKG-DIPTYVVGVNADAYSHDES-IISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>gb|ADB81485.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Bryopsis sp. 
EE4]
Length=288

 Score =   195 bits (496),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            +GTF ADVKVVD+  ISV+G+ I++VS RDP  LPWA+M + I IEGTGVF++  GAGKH
Sbjct  27   MGTFDADVKVVDDSNISVNGRNIRIVSTRDPTTLPWAEMDVGIAIEGTGVFINEEGAGKH  86

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKVIITAP KG DIPT+VVGVNE+ Y HE   IVSNASCTTNCLAPFVKV++ EF
Sbjct  87   LQAGAKKVIITAPGKG-DIPTFVVGVNEEGYKHEYP-IVSNASCTTNCLAPFVKVLENEF  144

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  145  GIVKGTMTTTH  155



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score =   199 bits (505),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F+ADVK   +E ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKH
Sbjct  119  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDMEIDLVIEGTGVFVDREGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAP KG DIPTYVVGVN   YSH+ S I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IEAGAKKVLITAPGKG-DIPTYVVGVNADAYSHDES-IISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>gb|ABC00187.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
 gb|ABC00188.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
Length=376

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK VD++TISV+GK I VVS+RDP +LPW  M ID+VIEGTGVFVD PGAGKH
Sbjct  90   LGKFDADVKAVDDKTISVNGKNIAVVSSRDPTQLPWKAMDIDLVIEGTGVFVDTPGAGKH  149

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAPAKG DIPT+VVGVN   Y+H    I+SNASCTTNCLAPFVKV+ E+F
Sbjct  150  IQAGAKKVLITAPAKGNDIPTFVVGVNCDGYNHSYP-IISNASCTTNCLAPFVKVLHEKF  208

Query  33   GIVKGTMTTTH  1
             IVKGTMTTTH
Sbjct  209  RIVKGTMTTTH  219



>sp|P34919.1|G3PA_CHOCR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase; Flags: Precursor [Chondrus crispus]
 emb|CAA51516.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
precursor [Chondrus crispus]
Length=414

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADV   + +TISV+GK IK+VSNR+PL+LPW +M IDIV+E TGVFVD PGAGKH
Sbjct  129  LGTFDADVSAGE-DTISVNGKTIKIVSNRNPLQLPWKEMNIDIVVEATGVFVDAPGAGKH  187

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAP KG  I T+VVGVNE+DYSH+  +IVSNASCTTNC+APF+KV+D+EF
Sbjct  188  IEAGAKKVLITAPGKGDGIGTFVVGVNEKDYSHDKYDIVSNASCTTNCMAPFMKVLDDEF  247

Query  33   GIVKGTMTTTH  1
            G+V+G MTTTH
Sbjct  248  GVVRGMMTTTH  258



>ref|XP_005715477.1| glyceraldehyde-3-phosphate dehydrogenase [Chondrus crispus]
 emb|CAA51514.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Chondrus crispus]
 emb|CDF35658.1| glyceraldehyde-3-phosphate dehydrogenase [Chondrus crispus]
Length=414

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADV   + +TISV+GK IK+VSNR+PL+LPW +M IDIV+E TGVFVD PGAGKH
Sbjct  129  LGTFDADVSAGE-DTISVNGKTIKIVSNRNPLQLPWKEMNIDIVVEATGVFVDAPGAGKH  187

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAP KG  I T+VVGVNE+DYSH+  +IVSNASCTTNC+APF+KV+D+EF
Sbjct  188  IEAGAKKVLITAPGKGDGIGTFVVGVNEKDYSHDKYDIVSNASCTTNCMAPFMKVLDDEF  247

Query  33   GIVKGTMTTTH  1
            G+V+G MTTTH
Sbjct  248  GVVRGMMTTTH  258



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   196 bits (499),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V ++ ISVDGKPI+VVSNR+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  60   LGIFGADVKAVGDDVISVDGKPIQVVSNRNPANLPWGELGIDLVIEGTGVFVDREGAGKH  119

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  120  IQAGAKKVLITAPGKG-DIPTYVVGVNADQYSPD-DTIISNASCTTNCLAPFVKVLDQKF  177

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  178  GIIKGTMTTTH  188



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   198 bits (503),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F+ADVK V N+ ISVDGK IKVVS+R+P  LPW DMGID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFEADVKPVGNDGISVDGKVIKVVSDRNPSNLPWKDMGIDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN  DYS +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVVGVNADDYSPD-EPIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>gb|ADB81489.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Derbesia sp. 
2773-1]
Length=313

 Score =   195 bits (496),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            +GTF  +VK+ D++ I+VDGK I+VVSNRDP +LPW ++G+D+VIEGTGVFV   GAGKH
Sbjct  48   MGTFPHEVKIADDDHITVDGKEIRVVSNRDPTQLPWKELGVDLVIEGTGVFVSEEGAGKH  107

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            ++AGAKKV+ITAPAKG ++PT+VVGVNE+ Y HE   IVSNASCTTNCLAPFVKV+DE+F
Sbjct  108  LEAGAKKVVITAPAKG-NVPTFVVGVNEEGYKHEYP-IVSNASCTTNCLAPFVKVLDEKF  165

Query  33   GIVKGTMTTTH  1
            GI KGTMTTTH
Sbjct  166  GIAKGTMTTTH  176



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F A+VK V ++ ISVDGK IKVVS+R+PL LPW DMGID+VIEGTGVFVD  GAGKH
Sbjct  120  LGIFDAEVKPVGDDGISVDGKVIKVVSSRNPLNLPWKDMGIDLVIEGTGVFVDREGAGKH  179

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAP KG DIPTYVVGVN + YSH+   I+SNASCTTNCLAPFVKV+D++F
Sbjct  180  IEAGAKKVLITAPGKG-DIPTYVVGVNAELYSHD-DTIISNASCTTNCLAPFVKVLDQKF  237

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  238  GIIKGTMTTTH  248



>gb|ADB81487.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cladophora 
albida]
Length=273

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+  V+  D+ T++VDGK IK+VSNRDP KL W +M ID+VIEGTGVFVD  GAGKH
Sbjct  28   LGTFEKSVEKADDTTMAVDGKNIKIVSNRDPTKLLWKEMEIDLVIEGTGVFVDEAGAGKH  87

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            ++AGAKKV+ITAP KG DIPT+V+GVN+ DY HE   I+SNASCTTNCLAPFVKV+DE+F
Sbjct  88   LEAGAKKVLITAPGKG-DIPTFVMGVNDADYKHEYP-IISNASCTTNCLAPFVKVLDEKF  145

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  146  GIVKGTMTTTH  156



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V  + ISVDGK I+VVSNRDP+ LPW ++G+D+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPVGTDGISVDGKVIQVVSNRDPVNLPWGELGVDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN + YSH+   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHD-EPIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>gb|ADB81494.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Ulva sp. EE2]
Length=313

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 115/130 (88%), Gaps = 3/130 (2%)
 Frame = -2

Query  390  GTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHI  211
            GTF ADV++ D + I+VDGKPI+VVSNRDP +LPWA+MG+D+VIEGTGVFVD  GAGKH+
Sbjct  49   GTFDADVQIAD-DGITVDGKPIRVVSNRDPTQLPWAEMGVDLVIEGTGVFVDEAGAGKHL  107

Query  210  QAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEFG  31
            +AGAKKV+ITAP KG +IPT+V+GVN +DY HE   I+SN SCTTNC+APFVKV+D++FG
Sbjct  108  EAGAKKVVITAPGKG-NIPTFVMGVNAEDYKHEYP-IISNTSCTTNCMAPFVKVLDDKFG  165

Query  30   IVKGTMTTTH  1
            IVKGTMTTTH
Sbjct  166  IVKGTMTTTH  175



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 112/131 (85%), Gaps = 3/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK   +  ISV GK IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH
Sbjct  51   LGTFDADVKTAGDSAISV-GKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKH  109

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVNE+ Y+H    I+SNASCTTNCLAPFVKV+D++F
Sbjct  110  LQAGAKKVLITAPGKG-DIPTYVVGVNEEGYTH-ADTIISNASCTTNCLAPFVKVLDQKF  167

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  168  GIIKGTMTTTH  178



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   196 bits (499),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V  + ISVDGK I+VVSNRDP+ LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPVGTDGISVDGKIIQVVSNRDPVNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN + Y+H+   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVVGVNAELYNHD-EPIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            +GTF AD+K+    T SV+G+ I+VVS+RDPL LPW ++G+D+VIEGTGVFVD  GA KH
Sbjct  127  MGTFNADIKISGEGTFSVNGRDIRVVSSRDPLALPWGELGVDLVIEGTGVFVDRKGASKH  186

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKVIITAPAKG+D+PTYV+GVN   YS+   +I+SNASCTTNCLAPFVKV+++ F
Sbjct  187  LQAGAKKVIITAPAKGSDVPTYVMGVNADQYSNS-DDIISNASCTTNCLAPFVKVLNDRF  245

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  246  GIVKGTMTTTH  256



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score =   195 bits (496),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+ADVK+VD+  IS+DGK I++VS+RDPL+LPW  +G+D+VIEGTGVF+D PGA KH
Sbjct  95   LGTFEADVKIVDDTHISIDGKKIEIVSSRDPLQLPWKALGVDLVIEGTGVFIDTPGASKH  154

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGA KV+ITAPAKG DIPTYV+GVN   Y H    I+SNASCTTN LAPFVKV+DE+F
Sbjct  155  ITAGASKVLITAPAKGDDIPTYVLGVNADGYKHS-DKIISNASCTTNGLAPFVKVIDEKF  213

Query  33   GIVKGTMTTTH  1
            G+VKG MTTTH
Sbjct  214  GLVKGLMTTTH  224



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score =   195 bits (496),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+ADVK+VD+  IS+DGK I++VS+RDPL+LPW  +G+D+VIEGTGVF+D PGA KH
Sbjct  93   LGTFEADVKIVDDTHISIDGKKIEIVSSRDPLQLPWKALGVDLVIEGTGVFIDTPGASKH  152

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGA KV+ITAPAKG DIPTYV+GVN   Y H    I+SNASCTTN LAPFVKV+DE+F
Sbjct  153  ITAGASKVLITAPAKGDDIPTYVLGVNADGYKHS-DKIISNASCTTNGLAPFVKVIDEKF  211

Query  33   GIVKGTMTTTH  1
            G+VKG MTTTH
Sbjct  212  GLVKGLMTTTH  222



>ref|XP_001420043.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98336.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=341

 Score =   194 bits (493),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+ADVK++D+  IS+DGK I++VS+RDPL+LPW  +G+DIVIEGTGVF+D PGA KH
Sbjct  56   LGTFEADVKIIDDTHISIDGKSIEIVSSRDPLQLPWKALGVDIVIEGTGVFIDTPGASKH  115

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            + AGAKKV+ITAPAKG DIPTYV+GVN   Y +    IVSNASCTTN LAPFVKV+D+ F
Sbjct  116  LTAGAKKVVITAPAKGDDIPTYVLGVNADQYKN-TDKIVSNASCTTNGLAPFVKVLDDRF  174

Query  33   GIVKGTMTTTH  1
            GIVKG MTTTH
Sbjct  175  GIVKGLMTTTH  185



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score =   194 bits (492),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF  DVK V +  ISVDG+   +VS+R+PL LPW ++ ID+VIEGTGVFVD  GAGKH
Sbjct  28   LGTFAPDVKAVGDNKISVDGQEFMIVSSRNPLDLPWKELDIDLVIEGTGVFVDSAGAGKH  87

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAPAKG+DIPTYVVGVN+QDY    + I+SNASCTTNCLAPFVK++ ++F
Sbjct  88   IEAGAKKVLITAPAKGSDIPTYVVGVNDQDYDPS-APIISNASCTTNCLAPFVKILSDKF  146

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  147  GIVKGTMTTTH  157



>gb|ABG85190.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus 'lucimarinus']
Length=380

 Score =   195 bits (495),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+ADVK++D+  IS+DGK I++VS+RDPL+LPW  +G+DIVIEGTGVF+D PGA KH
Sbjct  95   LGTFEADVKIIDDTHISIDGKSIEIVSSRDPLQLPWKALGVDIVIEGTGVFIDTPGASKH  154

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            + AGAKKV+ITAPAKG DIPTYV+GVN   Y +    IVSNASCTTN LAPFVKV+D+ F
Sbjct  155  LTAGAKKVVITAPAKGDDIPTYVLGVNADQYKN-TDKIVSNASCTTNGLAPFVKVLDDRF  213

Query  33   GIVKGTMTTTH  1
            GIVKG MTTTH
Sbjct  214  GIVKGLMTTTH  224



>gb|AEW46689.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Ulva linza]
Length=352

 Score =   194 bits (493),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 114/131 (87%), Gaps = 3/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
             GTF ADV++ D + I+VDGKPI+VVSNRDP +LPW +MG+D+VIEGTGVFVD  GAGKH
Sbjct  87   FGTFDADVQIAD-DGITVDGKPIRVVSNRDPTQLPWGEMGVDLVIEGTGVFVDEAGAGKH  145

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            ++AGAKKV+ITAP KG DIPT+V+GVN  DY HE   IVSNASCTTNC+APFVKV++++F
Sbjct  146  LEAGAKKVVITAPGKG-DIPTFVMGVNGDDYKHEYP-IVSNASCTTNCMAPFVKVLNDKF  203

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  204  GIVKGTMTTTH  214



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+ADVK+VD+  +S+DGK I++VS+RDPL+LPW ++GIDIVIEGTGVF+D PGA KH
Sbjct  94   LGTFEADVKIVDDTHMSIDGKSIQIVSSRDPLQLPWKELGIDIVIEGTGVFIDTPGASKH  153

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            + AGAKKV+ITAPAKG DIPTYV+GVN   Y +    I+SNASCTTN LAPFVKV++++F
Sbjct  154  LTAGAKKVVITAPAKGDDIPTYVLGVNADQYKNS-DKIISNASCTTNGLAPFVKVLNDKF  212

Query  33   GIVKGTMTTTH  1
            G+VKG MTTTH
Sbjct  213  GLVKGLMTTTH  223



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  44   LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  103

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  104  IQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  161

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  162  GIIKGTMTTTH  172



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V N+ ISVDGK I+VVSNR+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  121  LGIFDADVKPVGNDAISVDGKVIQVVSNRNPSNLPWKELGIDLVIEGTGVFVDREGAGKH  180

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAP KG DIPTYVVGVN   Y+H+ + I+SNASCTTNCLAPFVKV+D++F
Sbjct  181  IEAGAKKVLITAPGKG-DIPTYVVGVNADAYTHDEA-IISNASCTTNCLAPFVKVLDQKF  238

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  239  GIIKGTMTTTH  249



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V ++ ISVDGK IK+VS+R+PL LPW +MG+D+VIEGTGVFVD  GAGKH
Sbjct  73   LGIFDADVKAVGDDAISVDGKIIKIVSDRNPLNLPWGEMGVDLVIEGTGVFVDKEGAGKH  132

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG  IPTYV+GVNE+ Y      I+SNASCTTNCLAPFVKV+DE+F
Sbjct  133  LQAGAKKVLITAPGKGP-IPTYVIGVNEELYDPS-EQIISNASCTTNCLAPFVKVLDEKF  190

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  191  GIIKGTMTTTH  201



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF  DVK V +  ISVDG+   +VS+R+PL LPW ++ ID+VIEGTGVFVD  GAGKH
Sbjct  50   LGTFAPDVKAVGDNKISVDGQEFMIVSSRNPLDLPWKELDIDLVIEGTGVFVDSAGAGKH  109

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAPAKG+DIPTYVVGVN+QDY    + I+SNASCTTNCLAPFVK++ ++F
Sbjct  110  IEAGAKKVLITAPAKGSDIPTYVVGVNDQDYDPS-APIISNASCTTNCLAPFVKILSDKF  168

Query  33   GIVKGTMTTTH  1
            GIVKGTMTTTH
Sbjct  169  GIVKGTMTTTH  179



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F+ADVK   ++ ISVDGK IKVVSNR+P  LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  118  LGIFEADVKPAGDDAISVDGKIIKVVSNRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  177

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   Y+ E   I+SNASCTTNCLAPFVKV+D++F
Sbjct  178  IQAGAKKVLITAPGKG-DIPTYVVGVNADSYNPE-EPIISNASCTTNCLAPFVKVLDQKF  235

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  236  GIIKGTMTTTH  246



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V +  ISVDGK IKVVS+R+P  LPW +MGID+VIEGTGVFVD  GAGKH
Sbjct  119  LGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGIDLVIEGTGVFVDRDGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            ++AGAKKV+ITAP KG DIPTYVVGVN + YSH    I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  LEAGAKKVLITAPGKG-DIPTYVVGVNAELYSHS-DTIISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF ADVK+VD+  IS+DGK I++VS+RDPL+LPW  +G+ +VIEGTGVF+D PGA KH
Sbjct  91   LGTFNADVKIVDDTHISIDGKSIEIVSSRDPLQLPWKKLGVQLVIEGTGVFIDTPGASKH  150

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            ++AGA+KV+ITAPAKG DIPTYV+GVN   Y+H    I+SNASCTTN LAPF KV+D++F
Sbjct  151  LEAGAEKVLITAPAKGDDIPTYVMGVNADQYTH-ADKIISNASCTTNGLAPFAKVLDDKF  209

Query  33   GIVKGTMTTTH  1
            GIVKG MTTTH
Sbjct  210  GIVKGLMTTTH  220



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSSLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V N+ ISVDGK IKVV++R+P  LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  111  LGIFDADVKPVGNDAISVDGKVIKVVTDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  170

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN  DY  +   I+SNASCTTNCLAPFVKV+DE+F
Sbjct  171  IQAGAKKVLITAPGKG-DIPTYVVGVNADDYKPD-ETIISNASCTTNCLAPFVKVLDEKF  228

Query  33   GIVKGTMTTTH  1
             I+KGTMTTTH
Sbjct  229  SIIKGTMTTTH  239



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V +  ISVDGK I+VVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  114  LGIFDADVKPVGDNAISVDGKVIQVVSDRNPSNLPWGDLGIDLVIEGTGVFVDRDGAGKH  173

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN  DYS +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  174  IQAGAKKVLITAPGKG-DIPTYVVGVNADDYSAD-EPIISNASCTTNCLAPFVKVLDQKF  231

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  232  GIIKGTMTTTH  242



>emb|CAC80373.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=312

 Score =   191 bits (485),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V  + ISVDGK IKVVS+R+P+ LPW D+G+D+VIEGTGVFVD  GAGKH
Sbjct  48   LGIFDADVKPVGTDGISVDGKVIKVVSDRNPINLPWKDLGVDLVIEGTGVFVDREGAGKH  107

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTTNCLAPFVKV+DE+F
Sbjct  108  IQAGAKKVLITAPGKG-DIPTYVVGVNADLYSPD-EPIISNASCTTNCLAPFVKVLDEKF  165

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  166  GIIKGTMTTTH  176



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  66   LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKH  125

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  126  LQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  183

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  184  GIIKGTMTTTH  194



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 3/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F+ADVK  D E ISVDGK IKVV+NR+P+ LPW +MGID+VIEGTGVFVD  GAGKH
Sbjct  116  LGIFEADVKPAD-EGISVDGKVIKVVTNRNPVNLPWGEMGIDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYV+GVN + Y+ +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVIGVNAETYNPD-ETIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  52   LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  111

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYV GVN + YSHE   IVSNASCTTNCLAPFVKV+D++F
Sbjct  112  IQAGAKKVLITAPGKG-DIPTYVCGVNAELYSHE-DTIVSNASCTTNCLAPFVKVLDQKF  169

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  170  GIIKGTMTTTH  180



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   192 bits (487),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  66   LGIFGADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKH  125

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  126  LQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  183

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  184  GIIKGTMTTTH  194



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V  + ISVDGK IKVVS+R+P+ LPW D+G+D+VIEGTGVFVD  GAGKH
Sbjct  125  LGIFDADVKPVGTDGISVDGKIIKVVSDRNPINLPWKDLGVDLVIEGTGVFVDREGAGKH  184

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   YS + S I+SNASCTTNCLAPFVKV+D++F
Sbjct  185  IQAGAKKVLITAPGKG-DIPTYVVGVNADLYSPDES-IISNASCTTNCLAPFVKVLDQKF  242

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  243  GIIKGTMTTTH  253



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   193 bits (490),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  LQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF+ADVK+VD+  +S+DGK I++VS+RDPL+LPW ++G+ IVIEGTGVF+D PGA KH
Sbjct  93   LGTFQADVKIVDDTHMSIDGKSIQIVSSRDPLQLPWKELGVQIVIEGTGVFIDTPGASKH  152

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            + AGA KVIITAPAKG DIPTYV+GVN  DY  +   I+SNASCTTN LAPF KV+D+ F
Sbjct  153  LTAGASKVIITAPAKGDDIPTYVMGVNADDY-KDSDKIISNASCTTNGLAPFAKVLDDSF  211

Query  33   GIVKGTMTTTH  1
            GI+KG MTTTH
Sbjct  212  GIIKGLMTTTH  222



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   193 bits (490),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   ++ ISVDGK IKVVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  120  LGIFDADVKPAGDDAISVDGKIIKVVSNRNPVNLPWKDLGIDLVIEGTGVFVDSDGAGKH  179

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   Y+ +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  180  IQAGAKKVLITAPGKG-DIPTYVVGVNADSYNPD-EPIISNASCTTNCLAPFVKVLDQKF  237

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  238  GIIKGTMTTTH  248



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   191 bits (486),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  66   LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  125

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYV GVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  126  IQAGAKKVLITAPGKG-DIPTYVCGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  183

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  184  GIIKGTMTTTH  194



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score =   192 bits (489),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   ++ ISVDGK IKVVS+R+P  LPW +MGID+VIEGTGVFVD  GAGKH
Sbjct  114  LGIFDADVKPSGDQAISVDGKIIKVVSDRNPSNLPWGEMGIDLVIEGTGVFVDRDGAGKH  173

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKV+ITAP KG DIPTYVVGVN   Y+H   NI+SNASCTTNCLAPFVKV+D++F
Sbjct  174  IEAGAKKVLITAPGKG-DIPTYVVGVNADLYNHS-ENIISNASCTTNCLAPFVKVIDQKF  231

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  232  GIIKGTMTTTH  242



>gb|KDO85183.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85184.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=275

 Score =   189 bits (480),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNA-SC  82
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEV+NIV +  SC
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRSVYSC  241



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   192 bits (489),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDAALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  LQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   192 bits (489),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK I++VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDAALSVDGKIIQIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYV GVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVCGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYV GVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVCGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYV GVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVCGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V +  ISVDGK IKVVSNR+P  LPW ++G+D+VIEGTGVFVD  GAGKH
Sbjct  32   LGIFDADVKPVGDNAISVDGKVIKVVSNRNPSNLPWGELGVDLVIEGTGVFVDREGAGKH  91

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   Y+ +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  92   IQAGAKKVLITAPGKG-DIPTYVVGVNADQYNPD-EPIISNASCTTNCLAPFVKVLDQKF  149

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  150  GIIKGTMTTTH  160



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYV GVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVCGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>ref|XP_010458726.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010458727.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=283

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVD K I++VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  66   LGIFDADVKPSGDAALSVDEKIIQIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  125

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  126  IQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  183

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  184  GIIKGTMTTTH  194



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK I++VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDAALSVDGKIIQIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN + YSHE   I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  IQAGAKKVLITAPGKG-DIPTYVVGVNAELYSHE-DTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F+ADVK V  + ISVDGK I+VVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  119  LGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   Y  +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IQAGAKKVLITAPGKG-DIPTYVVGVNADAYKPD-EPIISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F+ADVK V  + ISVDGK I+VVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  119  LGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   Y  +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IQAGAKKVLITAPGKG-DIPTYVVGVNADAYKPD-EPIISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F+ADVK   +  ISVDGK IKVVS+R+P+ LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  118  LGIFEADVKPAGDNAISVDGKIIKVVSDRNPVNLPWKDLGIDLVIEGTGVFVDREGAGKH  177

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   Y+ +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  178  IQAGAKKVLITAPGKG-DIPTYVVGVNADTYNPD-ETIISNASCTTNCLAPFVKVLDQKF  235

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  236  GIIKGTMTTTH  246



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F+ADVK   N  ISVDGK IKVV+NR+PL LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  161  LGIFEADVKPAGNAAISVDGKVIKVVTNRNPLDLPWKELGIDLVIEGTGVFVDREGAGKH  220

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN + Y+ +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  221  IQAGAKKVLITAPGKG-DIPTYVVGVNVETYNPD-EPIISNASCTTNCLAPFVKVLDQKF  278

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  279  GIIKGTMTTTH  289



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVKV   + ISVDGK I+VVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  114  LGIFDADVKVAGVDAISVDGKVIRVVSNRNPVNLPWKDLGIDLVIEGTGVFVDKEGAGKH  173

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   Y+     I+SNASCTTNCLAPFVKV+D++F
Sbjct  174  IQAGAKKVLITAPGKG-DIPTYVVGVNADAYNPS-EPIISNASCTTNCLAPFVKVLDQKF  231

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  232  GIIKGTMTTTH  242



>gb|KDO85179.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85180.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=248

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSN  91
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEV+NIV +
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRS  237



>gb|ABK00066.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=275

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 108/131 (82%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F  +VK+   + ISVDGK I++VSNR+PL LPW +MGID+VIEGTGVFVD  GAGKH
Sbjct  27   LGVFSGNVKIEAEDVISVDGKCIQIVSNRNPLNLPWGEMGIDLVIEGTGVFVDREGAGKH  86

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYV+GVN+ DY      I+SNASCTTNCLAPFVKV+D +F
Sbjct  87   LQAGAKKVLITAPGKG-DIPTYVMGVNDADYDPS-ETIISNASCTTNCLAPFVKVLDNKF  144

Query  33   GIVKGTMTTTH  1
             IVKGTMTTTH
Sbjct  145  TIVKGTMTTTH  155



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V  + ISVDGK IKVVS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  120  LGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWGELGIDLVIEGTGVFVDREGAGKH  179

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAP KG DIPTYVVGVN   YSH   +I+SNASCTTNCLAPFVKV+D++F
Sbjct  180  ITAGAKKVLITAPGKG-DIPTYVVGVNADGYSH-ADDIISNASCTTNCLAPFVKVLDQKF  237

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  238  GIIKGTMTTTH  248



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTF A VK V ++ ISVDGK IKVVS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  119  LGTFDAVVKPVGSDIISVDGKEIKVVSDRNPANLPWKELGIDLVIEGTGVFVDREGAGKH  178

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I AGAKKV+ITAP KG DIPTYVVGVNE DYS +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  179  IVAGAKKVLITAPGKG-DIPTYVVGVNEYDYSGD-EPIISNASCTTNCLAPFVKVLDQKF  236

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  237  GIIKGTMTTTH  247



>gb|ABD37958.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Chara vulgaris]
Length=318

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 108/131 (82%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F  +VK+   + ISVDGK I++VSNR+PL LPW +MGID+VIEGTGVFVD  GAGKH
Sbjct  50   LGVFSGNVKIEAEDVISVDGKSIQIVSNRNPLNLPWGEMGIDLVIEGTGVFVDREGAGKH  109

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVN+ DY      I+SNASCTTNCLAPFVKV+D +F
Sbjct  110  LQAGAKKVLITAPGKG-DIPTYVVGVNDADYDPS-ETIISNASCTTNCLAPFVKVLDNKF  167

Query  33   GIVKGTMTTTH  1
             IVKGTMTTTH
Sbjct  168  TIVKGTMTTTH  178



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V  + ISVDGK IKVVSNR+P  LPW ++G+D+VIEGTGVFVD  GAGKH
Sbjct  121  LGIFDADVKPVGEDAISVDGKVIKVVSNRNPANLPWKELGVDLVIEGTGVFVDREGAGKH  180

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTTNCLAPFVKV+D++F
Sbjct  181  IQAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTTNCLAPFVKVLDQKF  238

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  239  GIIKGTMTTTH  249



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK      ISVDGK I+VVSNR+P  LPW ++GIDIVIEGTGVFVD  GAGKH
Sbjct  53   LGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKH  112

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKVIITAP KG DIPTYVVGVN   YSH+   I+SNASCTTNCLAPFVKV+D++F
Sbjct  113  IEAGAKKVIITAPGKG-DIPTYVVGVNADAYSHD-EPIISNASCTTNCLAPFVKVLDQKF  170

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  171  GIIKGTMTTTH  181



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK      ISVDGK I+VVSNR+P  LPW ++GIDIVIEGTGVFVD  GAGKH
Sbjct  116  LGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKH  175

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            I+AGAKKVIITAP KG DIPTYVVGVN   YSH+   I+SNASCTTNCLAPFVKV+D++F
Sbjct  176  IEAGAKKVIITAPGKG-DIPTYVVGVNADAYSHD-EPIISNASCTTNCLAPFVKVLDQKF  233

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  234  GIIKGTMTTTH  244



>gb|EMS61784.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Triticum 
urartu]
Length=365

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V +  ISVDGK IKVVS+R+P  LPW +MGID+VIEGTGVFVD  GAGKH
Sbjct  108  LGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGIDLVIEGTGVFVDRAGAGKH  167

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            ++AGAKKV+ITAP KG DIPTYV GVN   Y+H    I+SNASCTTNCLAPFVKV+D++F
Sbjct  168  LEAGAKKVLITAPGKG-DIPTYVCGVNADLYTH-ADTIISNASCTTNCLAPFVKVLDQKF  225

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  226  GIIKGTMTTTH  236



>gb|KDO85175.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=309

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  137  LGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKH  196

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNAS  85
            IQAGAKKVIITAPAKGADIPTYVVGVNE+DY HEV+NIV +  
Sbjct  197  IQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVRDCQ  239



>emb|CAC80372.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=314

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F+ADVK V  + ISVDGK I+VVSNR+P  LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  48   LGIFEADVKPVGTDGISVDGKVIQVVSNRNPSNLPWGDLGIDLVIEGTGVFVDREGAGKH  107

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   Y+ +   I+SNASCTTNCLAPFVK++D++F
Sbjct  108  IQAGAKKVLITAPGKG-DIPTYVVGVNADLYNPD-EPIISNASCTTNCLAPFVKILDQKF  165

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  166  GIIKGTMTTTH  176



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK   +  +SVDGK IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKH  174

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            +QAGAKKV+ITAP KG DIPTYVVGVN + YSH    I+SNASCTTNCLAPFVKV+D++F
Sbjct  175  LQAGAKKVLITAPGKG-DIPTYVVGVNAELYSH-ADTIISNASCTTNCLAPFVKVLDQKF  232

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  233  GIIKGTMTTTH  243



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   191 bits (485),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  393  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  214
            LG F ADVK V  + ISVDGK I+VVS+R+P+ LPW D+GID+VIEGTGVFVD  GAGKH
Sbjct  117  LGIFDADVKPVGTDGISVDGKVIQVVSDRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKH  176

Query  213  IQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVSNIVSNASCTTNCLAPFVKVMDEEF  34
            IQAGAKKV+ITAP KG DIPTYVVGVN   Y+ + S I+SNASCTTNCLAPFVKV+D++F
Sbjct  177  IQAGAKKVLITAPGKG-DIPTYVVGVNADLYNPDES-IISNASCTTNCLAPFVKVLDQKF  234

Query  33   GIVKGTMTTTH  1
            GI+KGTMTTTH
Sbjct  235  GIIKGTMTTTH  245



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514367491556