BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9384_g1_i1 len=476 path=[905:0-475]

Length=476
                                                                      Score     E

gb|KDP45718.1|  hypothetical protein JCGZ_17325                         114   6e-27   
ref|XP_002518279.1|  hypothetical protein RCOM_0815310                  104   1e-23   Ricinus communis
emb|CDP04054.1|  unnamed protein product                                102   7e-23   
ref|XP_002276629.1|  PREDICTED: transcription repressor OFP4            102   8e-23   Vitis vinifera
ref|XP_011021025.1|  PREDICTED: transcription repressor OFP4-like       102   8e-23   
ref|XP_002319964.2|  hypothetical protein POPTR_0013s15120g             102   9e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009801448.1|  PREDICTED: transcription repressor OFP3-like       101   1e-22   
ref|XP_004294737.1|  PREDICTED: uncharacterized protein LOC101298496    100   5e-22   
ref|XP_009589294.1|  PREDICTED: transcription repressor OFP3-like     98.2    1e-21   
ref|XP_007142050.1|  hypothetical protein PHAVU_008G248300g           98.6    2e-21   
gb|KFK27365.1|  hypothetical protein AALP_AA8G373400                  97.8    3e-21   
ref|XP_009602083.1|  PREDICTED: transcription repressor OFP2-like     97.4    3e-21   
ref|XP_002326076.1|  ovate family protein                             97.4    4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_003518343.1|  PREDICTED: uncharacterized protein LOC100780926  97.4    4e-21   
ref|XP_008354530.1|  PREDICTED: uncharacterized protein LOC103418164  96.7    9e-21   
ref|XP_010108488.1|  hypothetical protein L484_010681                 95.5    2e-20   
ref|XP_002270134.1|  PREDICTED: transcription repressor OFP1          95.9    2e-20   Vitis vinifera
ref|XP_006350877.1|  PREDICTED: uncharacterized protein DDB_G0271...  95.5    2e-20   
ref|XP_011041802.1|  PREDICTED: transcription repressor OFP4          95.5    2e-20   
ref|XP_003551614.1|  PREDICTED: uncharacterized protein LOC100794572  95.1    3e-20   
ref|XP_007146867.1|  hypothetical protein PHAVU_006G077000g           95.1    3e-20   
ref|XP_009120344.1|  PREDICTED: transcription repressor OFP3-like     94.7    3e-20   
ref|XP_008384677.1|  PREDICTED: uncharacterized protein LOC103447277  94.7    4e-20   
ref|XP_007208152.1|  hypothetical protein PRUPE_ppa022134mg           95.1    5e-20   
ref|XP_009407003.1|  PREDICTED: transcription repressor OFP3-like     94.4    5e-20   
ref|XP_007017064.1|  Ovate family protein 4, putative                 94.4    5e-20   
ref|XP_011080730.1|  PREDICTED: transcription repressor OFP1          94.0    6e-20   
gb|KHN04235.1|  hypothetical protein glysoja_040999                   94.4    6e-20   
ref|XP_009589890.1|  PREDICTED: transcription repressor OFP1          93.6    8e-20   
ref|XP_003552922.1|  PREDICTED: uncharacterized protein LOC100798120  94.0    9e-20   
gb|AFK36960.1|  unknown                                               93.6    9e-20   
gb|KHN48405.1|  hypothetical protein glysoja_042270                   93.2    1e-19   
ref|XP_010253122.1|  PREDICTED: transcription repressor OFP1          93.6    1e-19   
emb|CDY32990.1|  BnaA10g11960D                                        92.4    2e-19   
ref|XP_002866259.1|  ATOFP3/OFP3                                      92.0    2e-19   
ref|XP_009358432.1|  PREDICTED: transcription repressor OFP2-like     92.4    3e-19   
ref|XP_010543161.1|  PREDICTED: transcription repressor OFP1          91.3    4e-19   
emb|CDY43860.1|  BnaC09g33830D                                        91.3    4e-19   
ref|XP_004492547.1|  PREDICTED: uncharacterized protein LOC101493488  91.7    4e-19   
emb|CDY02063.1|  BnaC04g14380D                                        91.3    5e-19   
ref|XP_004242487.1|  PREDICTED: transcription repressor OFP2-like     91.3    5e-19   
ref|XP_010683528.1|  PREDICTED: transcription repressor OFP1          91.3    6e-19   
ref|XP_008245084.1|  PREDICTED: uncharacterized protein LOC103343188  92.0    6e-19   
emb|CDY10735.1|  BnaA05g12010D                                        90.9    7e-19   
ref|XP_009374363.1|  PREDICTED: transcription repressor OFP4-like     91.3    7e-19   
gb|KFK26818.1|  hypothetical protein AALP_AA8G297500                  90.5    8e-19   
ref|XP_007140109.1|  hypothetical protein PHAVU_008G084900g           90.9    9e-19   
gb|KEH23269.1|  ovate transcriptional repressor                       90.1    1e-18   
ref|XP_003544334.1|  PREDICTED: uncharacterized protein LOC100797854  90.5    1e-18   
gb|KHN01889.1|  hypothetical protein glysoja_044815                   90.5    1e-18   
ref|XP_003623592.1|  hypothetical protein MTR_7g072880                89.7    2e-18   
ref|XP_003616018.1|  Plant-specific domain TIGR01568 family protein   90.1    2e-18   
gb|AFK33619.1|  unknown                                               90.5    2e-18   
ref|XP_004305088.1|  PREDICTED: uncharacterized protein LOC101300552  90.5    2e-18   
gb|KEH23266.1|  ovate transcriptional repressor                       89.7    2e-18   
ref|XP_004249045.1|  PREDICTED: transcription repressor OFP1          89.4    2e-18   
emb|CBI18053.3|  unnamed protein product                              89.4    2e-18   
ref|XP_004506433.1|  PREDICTED: putative uncharacterized protein ...  90.1    3e-18   
gb|KDP22779.1|  hypothetical protein JCGZ_00366                       89.7    3e-18   
ref|XP_009589714.1|  PREDICTED: transcription repressor OFP1-like     89.4    3e-18   
ref|XP_009144305.1|  PREDICTED: transcription repressor OFP2-like     89.0    3e-18   
ref|XP_008798620.1|  PREDICTED: transcription repressor OFP4          89.4    3e-18   
ref|XP_006410100.1|  hypothetical protein EUTSA_v10017964mg           88.6    5e-18   
ref|XP_011095118.1|  PREDICTED: transcription repressor OFP1          89.4    5e-18   
ref|XP_006432000.1|  hypothetical protein CICLE_v10003798mg           88.6    5e-18   
ref|XP_011008759.1|  PREDICTED: transcription repressor OFP2-like     89.4    5e-18   
ref|XP_004490708.1|  PREDICTED: uncharacterized protein LOC101489571  88.6    5e-18   
emb|CDY04827.1|  BnaAnng00090D                                        87.8    6e-18   
ref|XP_006294613.1|  hypothetical protein CARUB_v10023651mg           88.2    6e-18   
ref|XP_006587927.1|  PREDICTED: uncharacterized protein LOC100817790  88.6    6e-18   
ref|XP_010252093.1|  PREDICTED: transcription repressor OFP1-like     89.0    6e-18   
ref|XP_009760912.1|  PREDICTED: transcription repressor OFP3          87.8    7e-18   
ref|XP_002323063.2|  ovate family protein                             89.0    7e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009124091.1|  PREDICTED: transcription repressor OFP1          87.8    7e-18   
gb|AFK43560.1|  unknown                                               88.2    8e-18   
gb|ACJ86070.1|  unknown                                               86.7    8e-18   Medicago truncatula
ref|XP_009126889.1|  PREDICTED: transcription repressor OFP3          87.4    9e-18   
ref|XP_011019018.1|  PREDICTED: transcription repressor OFP1-like     88.6    9e-18   
gb|EYU45676.1|  hypothetical protein MIMGU_mgv1a021422mg              87.8    1e-17   
ref|XP_010046752.1|  PREDICTED: transcription repressor OFP1-like     87.4    1e-17   
emb|CDY62219.1|  BnaCnng39640D                                        87.4    1e-17   
ref|XP_010414270.1|  PREDICTED: transcription repressor OFP2-like     87.0    1e-17   
gb|KDO37952.1|  hypothetical protein CISIN_1g039447mg                 87.0    1e-17   
ref|XP_010475442.1|  PREDICTED: transcription repressor OFP4-like     87.0    1e-17   
emb|CDY67505.1|  BnaCnng55350D                                        87.0    1e-17   
ref|XP_010522004.1|  PREDICTED: transcription repressor OFP2-like...  87.4    1e-17   
ref|XP_010469857.1|  PREDICTED: transcription repressor OFP2-like     87.0    2e-17   
ref|XP_009402214.1|  PREDICTED: transcription repressor OFP1-like     87.8    2e-17   
ref|XP_002309180.1|  ovate family protein                             87.8    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002892365.1|  hypothetical protein ARALYDRAFT_470713           86.3    2e-17   
ref|XP_009780345.1|  PREDICTED: transcription repressor OFP1-like     86.7    3e-17   
ref|XP_006279335.1|  hypothetical protein CARUB_v10012721mg           85.5    3e-17   
gb|AFK39924.1|  unknown                                               86.7    3e-17   
ref|XP_010541469.1|  PREDICTED: transcription repressor OFP3          85.9    3e-17   
ref|XP_007033562.1|  AF4/FMR2 family member 1                         87.8    4e-17   
gb|AGV22117.1|  ovate family protein 1                                85.9    4e-17   
ref|XP_010510366.1|  PREDICTED: transcription repressor OFP2-like     85.9    4e-17   
ref|XP_006429553.1|  hypothetical protein CICLE_v10011867mg           86.7    5e-17   
gb|KDO49665.1|  hypothetical protein CISIN_1g015381mg                 86.3    6e-17   
ref|XP_010501348.1|  PREDICTED: transcription repressor OFP4-like     85.1    6e-17   
gb|KFK24678.1|  hypothetical protein AALP_AA8G010900                  85.1    7e-17   
ref|XP_010483413.1|  PREDICTED: transcription repressor OFP3-like     85.1    7e-17   
ref|XP_009132729.1|  PREDICTED: transcription repressor OFP2-like     84.7    9e-17   
ref|XP_002534303.1|  hypothetical protein RCOM_0116230                85.5    2e-16   Ricinus communis
ref|XP_009118470.1|  PREDICTED: transcription repressor OFP4          84.0    2e-16   
ref|XP_006843708.1|  hypothetical protein AMTR_s00007p00212750        84.3    2e-16   
gb|EYU42002.1|  hypothetical protein MIMGU_mgv1a024247mg              84.7    2e-16   
ref|XP_008792265.1|  PREDICTED: transcription repressor OFP2-like     84.7    2e-16   
ref|XP_006398574.1|  hypothetical protein EUTSA_v10016086mg           83.6    2e-16   
ref|XP_008782640.1|  PREDICTED: transcription repressor OFP2-like     84.0    3e-16   
ref|XP_010922720.1|  PREDICTED: transcription repressor OFP1-like     84.3    3e-16   
ref|XP_007134688.1|  hypothetical protein PHAVU_010G067800g           84.0    3e-16   
ref|XP_006281461.1|  hypothetical protein CARUB_v10027544mg           83.2    3e-16   
ref|XP_006417868.1|  hypothetical protein EUTSA_v10009577mg           83.2    3e-16   
ref|NP_172174.1|  ovate family protein 4                              83.2    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008388333.1|  PREDICTED: uncharacterized protein LOC103450737  84.0    3e-16   
ref|XP_010457847.1|  PREDICTED: transcription repressor OFP4-like     83.2    4e-16   
ref|XP_006401092.1|  hypothetical protein EUTSA_v10014213mg           82.8    4e-16   
ref|XP_009346927.1|  PREDICTED: transcription repressor OFP2-like     83.6    4e-16   
ref|XP_009371999.1|  PREDICTED: transcription repressor OFP2          83.6    5e-16   
ref|XP_008355779.1|  PREDICTED: uncharacterized protein LOC103419462  82.4    5e-16   
ref|XP_010453556.1|  PREDICTED: transcription repressor OFP3-like     82.4    6e-16   
ref|XP_003516429.1|  PREDICTED: uncharacterized protein LOC100785362  83.2    6e-16   
ref|XP_003522091.1|  PREDICTED: putative uncharacterized protein ...  83.2    7e-16   
ref|XP_010553202.1|  PREDICTED: transcription repressor OFP1-like     80.9    1e-15   
emb|CDY09945.1|  BnaC08g45060D                                        81.3    1e-15   
emb|CDY06241.1|  BnaA09g49620D                                        81.3    1e-15   
ref|XP_006306181.1|  hypothetical protein CARUB_v10011767mg           81.3    2e-15   
ref|XP_009764897.1|  PREDICTED: transcription repressor OFP5          82.4    2e-15   
ref|XP_007205267.1|  hypothetical protein PRUPE_ppa006439mg           82.0    2e-15   
ref|XP_009785142.1|  PREDICTED: transcription repressor OFP2-like     81.3    2e-15   
ref|XP_010443554.1|  PREDICTED: transcription repressor OFP3-like     80.9    2e-15   
ref|XP_009627121.1|  PREDICTED: transcription repressor OFP5          81.6    4e-15   
ref|XP_010091076.1|  hypothetical protein L484_021958                 80.9    4e-15   
gb|KCW47510.1|  hypothetical protein EUGRSUZ_K01276                   80.5    5e-15   
ref|XP_004150976.1|  PREDICTED: uncharacterized protein LOC101204894  79.7    5e-15   
ref|XP_010456346.1|  PREDICTED: transcription repressor OFP1-like     78.6    6e-15   
ref|XP_010921121.1|  PREDICTED: transcription repressor OFP2-like     80.5    6e-15   
gb|KGN54443.1|  hypothetical protein Csa_4G332100                     79.7    6e-15   
emb|CDX84837.1|  BnaA03g13930D                                        79.0    7e-15   
ref|XP_008463251.1|  PREDICTED: uncharacterized protein LOC103501454  79.3    8e-15   
ref|XP_010931348.1|  PREDICTED: transcription repressor OFP3          80.1    8e-15   
ref|XP_010035991.1|  PREDICTED: transcription repressor OFP3          80.5    1e-14   
ref|NP_180599.1|  ovate family protein 2                              78.6    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009384772.1|  PREDICTED: transcription repressor OFP2-like     79.0    2e-14   
ref|XP_009392064.1|  PREDICTED: transcription repressor OFP1-like     78.2    2e-14   
ref|XP_010043070.1|  PREDICTED: transcription repressor OFP1-like     78.6    2e-14   
ref|XP_010451932.1|  PREDICTED: transcription repressor OFP1-like     77.4    2e-14   
ref|XP_009386725.1|  PREDICTED: transcription repressor OFP1-like     78.6    2e-14   
ref|XP_004173780.1|  PREDICTED: uncharacterized protein LOC101230017  74.7    3e-14   
ref|XP_008808317.1|  PREDICTED: transcription repressor OFP2-like     78.6    3e-14   
ref|XP_010490501.1|  PREDICTED: transcription repressor OFP1-like     77.0    3e-14   
ref|XP_010558403.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  77.0    4e-14   
ref|XP_002862819.1|  hypothetical protein ARALYDRAFT_497281           77.4    4e-14   
ref|XP_002879263.1|  hypothetical protein ARALYDRAFT_481952           77.4    4e-14   
ref|XP_004961753.1|  PREDICTED: uncharacterized protein LOC101777258  77.8    5e-14   
ref|XP_010937994.1|  PREDICTED: transcription repressor OFP3-like     76.6    1e-13   
ref|XP_010424000.1|  PREDICTED: transcription repressor OFP1-like     75.1    1e-13   
ref|XP_010099393.1|  hypothetical protein L484_007756                 75.1    2e-13   
ref|NP_200644.1|  ovate family protein 3                              75.5    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872991.1|  hypothetical protein ARALYDRAFT_486884           75.1    2e-13   
ref|XP_010685971.1|  PREDICTED: transcription repressor OFP1-like     75.1    2e-13   
emb|CDX97830.1|  BnaC04g41090D                                        75.1    3e-13   
ref|NP_195804.1|  ovate family protein 1                              74.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004172085.1|  PREDICTED: uncharacterized protein LOC101229726  74.3    6e-13   
ref|XP_004137682.1|  PREDICTED: uncharacterized protein LOC101203459  74.3    6e-13   
ref|XP_004309635.1|  PREDICTED: uncharacterized protein LOC101311721  73.2    6e-13   
gb|KGN58701.1|  hypothetical protein Csa_3G730160                     74.3    7e-13   
ref|XP_011010911.1|  PREDICTED: transcription repressor OFP5-like     75.1    8e-13   
ref|XP_002305721.2|  ovate family protein                             75.1    8e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011033512.1|  PREDICTED: transcription repressor OFP5-like     75.1    9e-13   
ref|XP_008371508.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  74.7    9e-13   
ref|XP_010088012.1|  hypothetical protein L484_004602                 74.3    9e-13   
emb|CDY29674.1|  BnaA04g17530D                                        73.6    9e-13   
ref|XP_009141063.1|  PREDICTED: transcription repressor OFP2-like     73.6    1e-12   
ref|XP_002522269.1|  conserved hypothetical protein                   74.3    1e-12   Ricinus communis
ref|XP_004163359.1|  PREDICTED: uncharacterized protein LOC101232237  74.3    1e-12   
emb|CDP06399.1|  unnamed protein product                              74.3    2e-12   
ref|XP_004486277.1|  PREDICTED: protein Shroom4-like                  73.6    2e-12   
emb|CBI30728.3|  unnamed protein product                              71.6    2e-12   
gb|KGN49331.1|  hypothetical protein Csa_6G520290                     73.9    2e-12   
ref|XP_008439714.1|  PREDICTED: uncharacterized protein LOC103484429  73.9    2e-12   
ref|XP_006449556.1|  hypothetical protein CICLE_v10017829mg           72.8    2e-12   
ref|XP_009419680.1|  PREDICTED: transcription repressor OFP4-like     72.0    2e-12   
ref|XP_006358138.1|  PREDICTED: caldesmon-like                        73.9    2e-12   
ref|XP_007213877.1|  hypothetical protein PRUPE_ppa006822mg           73.2    2e-12   
gb|KDO77935.1|  hypothetical protein CISIN_1g040838mg                 73.6    3e-12   
ref|XP_008442333.1|  PREDICTED: uncharacterized protein LOC103486236  73.2    3e-12   
ref|XP_010242153.1|  PREDICTED: transcription repressor OFP3-like     73.6    3e-12   
ref|NP_001136474.1|  uncharacterized protein LOC100216587             72.4    4e-12   Zea mays [maize]
ref|XP_010317346.1|  PREDICTED: transcription repressor OFP5          72.4    4e-12   
ref|XP_009352720.1|  PREDICTED: transcription repressor OFP5-like     72.8    4e-12   
gb|KCW76063.1|  hypothetical protein EUGRSUZ_D00431                   72.0    5e-12   
ref|XP_010052159.1|  PREDICTED: transcription repressor OFP5          72.4    5e-12   
ref|XP_011085317.1|  PREDICTED: uncharacterized protein LOC105167340  72.4    6e-12   
ref|XP_009414262.1|  PREDICTED: transcription repressor OFP1-like     70.5    9e-12   
ref|XP_002265116.1|  PREDICTED: transcription repressor OFP5          72.0    9e-12   Vitis vinifera
ref|XP_008792401.1|  PREDICTED: transcription repressor OFP5-like     71.2    1e-11   
ref|XP_008383592.1|  PREDICTED: uncharacterized protein LOC103446287  71.6    1e-11   
ref|XP_010248390.1|  PREDICTED: transcription repressor OFP5-like     71.2    1e-11   
ref|XP_009389676.1|  PREDICTED: transcription repressor OFP1-like     69.7    2e-11   
ref|XP_003593824.1|  hypothetical protein MTR_2g018030                70.5    2e-11   
ref|XP_007025296.1|  Ovate family protein 5, putative                 70.5    3e-11   
ref|XP_002458691.1|  hypothetical protein SORBIDRAFT_03g038320        67.8    3e-11   Sorghum bicolor [broomcorn]
ref|XP_009416721.1|  PREDICTED: uncharacterized protein LOC103997277  69.3    3e-11   
ref|XP_010665684.1|  PREDICTED: transcription repressor OFP5          69.7    4e-11   
ref|XP_004970397.1|  PREDICTED: uncharacterized protein LOC101773811  69.3    5e-11   
gb|KDP21145.1|  hypothetical protein JCGZ_21616                       69.7    5e-11   
ref|XP_008225255.1|  PREDICTED: uncharacterized protein LOC103324921  69.7    5e-11   
gb|EMS50273.1|  hypothetical protein TRIUR3_18530                     67.8    5e-11   
ref|XP_003567233.1|  PREDICTED: transcription repressor OFP2-like     68.9    6e-11   
ref|XP_002439957.1|  hypothetical protein SORBIDRAFT_09g023390        68.6    9e-11   Sorghum bicolor [broomcorn]
emb|CDM84783.1|  unnamed protein product                              68.6    1e-10   
ref|XP_008657114.1|  PREDICTED: uncharacterized protein LOC103636549  68.6    1e-10   
ref|XP_009369931.1|  PREDICTED: transcription repressor OFP8          66.2    1e-10   
ref|XP_010917398.1|  PREDICTED: transcription repressor OFP5-like     67.8    2e-10   
ref|XP_009406773.1|  PREDICTED: transcription repressor OFP1-like     67.4    2e-10   
ref|XP_006644925.1|  PREDICTED: uncharacterized protein LOC102709788  67.8    2e-10   
ref|XP_010925176.1|  PREDICTED: transcription repressor OFP5-like     67.4    2e-10   
ref|NP_001044660.2|  Os01g0823500                                     67.8    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76320.1|  hypothetical protein OsI_04254                        67.4    2e-10   Oryza sativa Indica Group [Indian rice]
gb|EPS73962.1|  hypothetical protein M569_00800                       63.9    3e-10   
gb|EPS67743.1|  hypothetical protein M569_07034                       63.2    3e-10   
ref|XP_008674880.1|  PREDICTED: uncharacterized protein LOC103651061  67.0    3e-10   
emb|CDY02814.1|  BnaC02g10750D                                        62.4    4e-10   
ref|XP_007147996.1|  hypothetical protein PHAVU_006G171800g           67.0    4e-10   
emb|CDY32706.1|  BnaA02g07680D                                        62.0    5e-10   
gb|AFW81607.1|  plant-specific domain TIGR01568 family protein        65.1    5e-10   
ref|XP_008777736.1|  PREDICTED: transcription repressor OFP5-like     66.2    5e-10   
ref|NP_001151830.1|  plant-specific domain TIGR01568 family protein   64.7    7e-10   Zea mays [maize]
ref|XP_006598318.1|  PREDICTED: eukaryotic translation initiation...  65.9    7e-10   
emb|CBH32507.1|  conserved hypothetical protein                       65.5    7e-10   
gb|EAY98423.1|  hypothetical protein OsI_20338                        66.2    7e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_006655410.1|  PREDICTED: uncharacterized protein LOC102722774  65.5    8e-10   
gb|EPS69579.1|  hypothetical protein M569_05187                       62.8    8e-10   
ref|XP_004962442.1|  PREDICTED: uncharacterized protein LOC101755245  63.9    1e-09   
ref|NP_001055838.1|  Os05g0477200                                     65.9    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003629846.1|  hypothetical protein MTR_8g087530                65.5    1e-09   
ref|XP_009351714.1|  PREDICTED: transcription repressor OFP5-like     65.1    2e-09   
ref|XP_004504419.1|  PREDICTED: uncharacterized protein LOC101510071  64.7    2e-09   
ref|XP_008361544.1|  PREDICTED: uncharacterized protein LOC103425237  62.8    2e-09   
ref|XP_011101456.1|  PREDICTED: transcription repressor OFP5          63.9    2e-09   
emb|CDY01560.1|  BnaC07g35500D                                        64.7    2e-09   
ref|XP_009136961.1|  PREDICTED: transcription repressor OFP5-like...  63.9    3e-09   
gb|EMS64314.1|  hypothetical protein TRIUR3_29052                     62.8    3e-09   
ref|XP_004238599.1|  PREDICTED: transcription repressor OFP7-like     63.2    3e-09   
gb|KHN48028.1|  hypothetical protein glysoja_015498                   64.3    3e-09   
ref|XP_007159490.1|  hypothetical protein PHAVU_002G241900g           64.3    4e-09   
gb|KHN47391.1|  hypothetical protein glysoja_020259                   64.3    4e-09   
ref|XP_009374782.1|  PREDICTED: transcription repressor OFP4-like     61.6    5e-09   
ref|XP_007017502.1|  Ovate family protein 8, putative                 63.5    5e-09   
ref|XP_006594532.1|  PREDICTED: reticulocyte-binding protein 2 ho...  63.9    5e-09   
gb|EAY75824.1|  hypothetical protein OsI_03738                        62.8    8e-09   Oryza sativa Indica Group [Indian rice]
dbj|BAB56051.1|  hypothetical protein                                 62.8    8e-09   Oryza sativa Japonica Group [Japonica rice]
gb|KHN06430.1|  hypothetical protein glysoja_010774                   63.2    9e-09   
dbj|BAJ99686.1|  predicted protein                                    62.8    1e-08   
ref|XP_009136960.1|  PREDICTED: transcription repressor OFP5-like...  62.4    1e-08   
ref|XP_009136962.1|  PREDICTED: transcription repressor OFP5-like...  62.0    1e-08   
ref|XP_002439563.1|  hypothetical protein SORBIDRAFT_09g012740        60.8    1e-08   Sorghum bicolor [broomcorn]
ref|XP_006342213.1|  PREDICTED: uncharacterized protein LOC102595171  61.2    2e-08   
ref|XP_003567117.1|  PREDICTED: transcription repressor OFP1-like     61.6    2e-08   
gb|EYU43304.1|  hypothetical protein MIMGU_mgv1a026081mg              61.2    2e-08   
ref|XP_010916741.1|  PREDICTED: transcription repressor OFP7-like     62.0    2e-08   
ref|XP_008790074.1|  PREDICTED: transcription repressor OFP3-like     62.0    2e-08   
gb|EPS63037.1|  hypothetical protein M569_11751                       57.8    2e-08   
ref|XP_007136583.1|  hypothetical protein PHAVU_009G057100g           60.5    3e-08   
gb|KEH36147.1|  ovate transcriptional repressor                       60.5    3e-08   
ref|XP_004969952.1|  PREDICTED: uncharacterized protein LOC101772718  60.8    3e-08   
emb|CDX99420.1|  BnaC01g11320D                                        60.8    4e-08   
ref|XP_009419860.1|  PREDICTED: transcription repressor OFP1-like     60.1    4e-08   
ref|XP_008649880.1|  PREDICTED: serine/arginine repetitive matrix...  60.5    4e-08   
gb|KFK28564.1|  hypothetical protein AALP_AA7G012700                  60.8    4e-08   
ref|XP_006434964.1|  hypothetical protein CICLE_v10003347mg           60.5    4e-08   
ref|XP_002870022.1|  ATOFP5/OFP5                                      60.8    4e-08   
ref|XP_003539314.1|  PREDICTED: uncharacterized protein LOC100784032  60.8    4e-08   
emb|CAB52868.1|  putative protein                                     60.5    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193618.2|  ovate family protein 5                              60.5    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530387.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  60.8    5e-08   
gb|KDO84517.1|  hypothetical protein CISIN_1g043733mg                 60.1    5e-08   
ref|XP_001757467.1|  predicted protein                                61.2    5e-08   
gb|EMT23715.1|  hypothetical protein F775_22444                       58.5    6e-08   
gb|EMS50156.1|  hypothetical protein TRIUR3_26453                     59.3    7e-08   
ref|XP_009612203.1|  PREDICTED: transcription repressor OFP3-like     58.2    7e-08   
gb|AEW07785.1|  hypothetical protein 0_11531_01                       57.8    9e-08   
ref|XP_006283967.1|  hypothetical protein CARUB_v10005090mg           59.7    1e-07   
ref|XP_009759557.1|  PREDICTED: transcription repressor OFP7-like     59.3    1e-07   
gb|AFG67771.1|  hypothetical protein 0_11531_01                       57.4    1e-07   
ref|NP_001169320.1|  hypothetical protein                             59.7    1e-07   
ref|XP_008245527.1|  PREDICTED: uncharacterized protein LOC103343660  57.8    1e-07   
gb|EAY98704.1|  hypothetical protein OsI_20636                        59.3    1e-07   
ref|XP_007207871.1|  hypothetical protein PRUPE_ppa022029mg           57.4    1e-07   
gb|KDP38487.1|  hypothetical protein JCGZ_04412                       59.3    1e-07   
ref|XP_004987200.1|  PREDICTED: uncharacterized protein LOC101769088  58.2    1e-07   
gb|AEW07786.1|  hypothetical protein 0_11531_01                       57.0    1e-07   
ref|XP_006414047.1|  hypothetical protein EUTSA_v10027385mg           59.3    1e-07   
gb|EEC82686.1|  hypothetical protein OsI_27342                        58.9    1e-07   
ref|XP_006658964.1|  PREDICTED: uncharacterized protein LOC102708169  58.5    1e-07   
gb|EYU28123.1|  hypothetical protein MIMGU_mgv1a025991mg              58.5    2e-07   
ref|XP_002465308.1|  hypothetical protein SORBIDRAFT_01g036070        58.5    2e-07   
ref|NP_001060638.1|  Os07g0679200                                     58.9    2e-07   
tpg|DAA64123.1|  TPA: plant-specific domain TIGR01568 family protein  57.8    2e-07   
ref|NP_001150899.1|  plant-specific domain TIGR01568 family protein   57.8    2e-07   
ref|XP_010106010.1|  hypothetical protein L484_021187                 58.2    2e-07   
ref|XP_002510365.1|  conserved hypothetical protein                   58.9    2e-07   
ref|XP_002312831.1|  hypothetical protein POPTR_0009s16330g           56.6    3e-07   
ref|XP_001763963.1|  predicted protein                                58.9    3e-07   
ref|XP_002523863.1|  hypothetical protein RCOM_1282480                56.2    3e-07   
ref|XP_004984455.1|  PREDICTED: uncharacterized protein LOC101755276  57.8    3e-07   
ref|XP_009132274.1|  PREDICTED: transcription repressor OFP5          58.2    3e-07   
emb|CDX78899.1|  BnaA01g09660D                                        58.2    3e-07   
ref|XP_002441383.1|  hypothetical protein SORBIDRAFT_09g025650        58.2    3e-07   
gb|AEI98622.1|  putative ovate protein                                58.2    4e-07   
ref|NP_001055201.1|  Os05g0324600                                     57.4    4e-07   
emb|CDP02824.1|  unnamed protein product                              58.2    4e-07   
gb|EEC78987.1|  hypothetical protein OsI_19476                        57.4    4e-07   
gb|KCW68256.1|  hypothetical protein EUGRSUZ_F01903                   55.1    4e-07   
ref|XP_010439804.1|  PREDICTED: transcription repressor OFP5          57.8    4e-07   
ref|NP_179440.1|  ovate family protein 7                              57.8    4e-07   
emb|CDY36485.1|  BnaC03g48440D                                        57.8    4e-07   
ref|XP_010467669.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  57.8    4e-07   
emb|CBI28072.3|  unnamed protein product                              58.5    4e-07   
ref|XP_010449457.1|  PREDICTED: transcription repressor OFP5-like     57.8    4e-07   
tpg|DAA41760.1|  TPA: hypothetical protein ZEAMMB73_229064            56.6    4e-07   
ref|XP_003574010.1|  PREDICTED: transcription repressor OFP1-like     57.0    5e-07   
ref|XP_002521609.1|  conserved hypothetical protein                   57.8    5e-07   
ref|XP_010656326.1|  PREDICTED: transcription repressor OFP8          57.4    5e-07   
ref|XP_009150728.1|  PREDICTED: transcription repressor OFP7-like     57.4    5e-07   
ref|XP_010434489.1|  PREDICTED: transcription repressor OFP5-like     57.8    5e-07   
ref|XP_009631046.1|  PREDICTED: transcription repressor OFP7-like     57.8    5e-07   
ref|XP_004963653.1|  PREDICTED: uncharacterized protein LOC101761208  57.4    5e-07   
ref|XP_002970418.1|  hypothetical protein SELMODRAFT_69626            53.9    6e-07   
ref|XP_002456360.1|  hypothetical protein SORBIDRAFT_03g034650        57.4    6e-07   
ref|XP_011099599.1|  PREDICTED: transcription repressor OFP7          57.4    6e-07   
ref|XP_006579035.1|  PREDICTED: uncharacterized protein LOC102662518  56.6    6e-07   
ref|XP_002884139.1|  ATOFP7/OFP7                                      57.0    6e-07   
ref|XP_010414369.1|  PREDICTED: transcription repressor OFP7          57.4    6e-07   
ref|XP_010489554.1|  PREDICTED: transcription repressor OFP7-like     57.0    6e-07   
ref|XP_006298137.1|  hypothetical protein CARUB_v10014184mg           57.0    6e-07   
ref|XP_009102240.1|  PREDICTED: transcription repressor OFP7          57.0    7e-07   
emb|CDY72229.1|  BnaCnng76610D                                        57.0    7e-07   
ref|XP_001753012.1|  predicted protein                                57.8    7e-07   
ref|XP_004301901.1|  PREDICTED: uncharacterized protein LOC101292030  57.0    7e-07   
ref|XP_009791327.1|  PREDICTED: transcription repressor OFP7-like     57.0    7e-07   
ref|XP_006582470.1|  PREDICTED: uncharacterized protein LOC102666713  56.2    8e-07   
ref|XP_011097217.1|  PREDICTED: transcription repressor OFP7-like     57.0    8e-07   
ref|XP_009760416.1|  PREDICTED: transcription repressor OFP7-like     57.0    8e-07   
ref|XP_006451146.1|  hypothetical protein CICLE_v10008914mg           56.6    9e-07   
ref|XP_006381702.1|  hypothetical protein POPTR_0006s16140g           56.6    9e-07   
gb|EMS45019.1|  hypothetical protein TRIUR3_27070                     53.1    9e-07   
ref|XP_011006761.1|  PREDICTED: transcription repressor OFP7-like     56.6    9e-07   
ref|XP_006386926.1|  hypothetical protein POPTR_0002s26330g           56.6    9e-07   
gb|KHN22262.1|  hypothetical protein glysoja_022018                   56.2    9e-07   
gb|EAY76319.1|  hypothetical protein OsI_04253                        52.8    1e-06   
gb|KDP33671.1|  hypothetical protein JCGZ_07242                       56.6    1e-06   
ref|NP_001151878.1|  plant-specific domain TIGR01568 family protein   56.2    1e-06   
ref|XP_004501129.1|  PREDICTED: uncharacterized protein LOC101512953  55.8    1e-06   
ref|XP_004497705.1|  PREDICTED: uncharacterized protein LOC101495227  54.3    1e-06   
emb|CDY59540.1|  BnaCnng35180D                                        56.2    1e-06   
ref|XP_003572003.1|  PREDICTED: transcription repressor OFP7-like     55.5    1e-06   
ref|XP_002310801.1|  ovate family protein                             56.2    1e-06   
ref|XP_009356680.1|  PREDICTED: transcription repressor OFP7-like     56.2    1e-06   
ref|XP_009371567.1|  PREDICTED: transcription repressor OFP7-like     56.2    1e-06   
ref|NP_001146879.1|  plant-specific domain TIGR01568 family protein   55.5    2e-06   
ref|XP_011006744.1|  PREDICTED: transcription repressor OFP6-like     54.3    2e-06   
gb|KEH15511.1|  ovate transcriptional repressor                       54.3    2e-06   
ref|XP_009120676.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  54.3    2e-06   
ref|XP_010244298.1|  PREDICTED: transcription repressor OFP7-like     56.2    2e-06   
ref|XP_008338597.1|  PREDICTED: uncharacterized protein LOC103401660  55.8    2e-06   
ref|XP_011025749.1|  PREDICTED: transcription repressor OFP7          56.2    2e-06   
tpg|DAA45246.1|  TPA: plant-specific domain TIGR01568 family protein  55.8    2e-06   
ref|XP_001752154.1|  predicted protein                                56.6    2e-06   
gb|KDO79506.1|  hypothetical protein CISIN_1g037866mg                 55.8    2e-06   
ref|XP_009141556.1|  PREDICTED: transcription repressor OFP6          54.3    2e-06   
ref|XP_008463402.1|  PREDICTED: uncharacterized protein LOC103501571  55.5    2e-06   
ref|XP_006467142.1|  PREDICTED: uncharacterized protein LOC102622107  55.8    2e-06   
ref|XP_006425708.1|  hypothetical protein CICLE_v10025709mg           56.2    2e-06   
ref|XP_002461215.1|  hypothetical protein SORBIDRAFT_02g042950        55.8    2e-06   
ref|XP_003561662.1|  PREDICTED: transcription repressor OFP1-like     55.5    2e-06   
ref|XP_010254459.1|  PREDICTED: uncharacterized protein LOC104595426  56.6    2e-06   
ref|XP_011043465.1|  PREDICTED: transcription repressor OFP8          55.5    2e-06   
gb|EMT02993.1|  hypothetical protein F775_22600                       55.1    2e-06   
ref|XP_006475688.1|  PREDICTED: uncharacterized protein LOC102610065  55.5    2e-06   
ref|XP_008444697.1|  PREDICTED: uncharacterized protein LOC103487956  55.5    2e-06   
ref|XP_002324990.1|  hypothetical protein POPTR_0018s08740g           55.5    2e-06   
ref|XP_008241648.1|  PREDICTED: uncharacterized protein LOC103340060  55.5    2e-06   
ref|XP_004169248.1|  PREDICTED: uncharacterized protein LOC101225569  54.7    3e-06   
ref|XP_007046985.1|  Ovate family protein 7, putative                 55.5    3e-06   
ref|XP_004149156.1|  PREDICTED: uncharacterized protein LOC101212095  55.1    3e-06   
ref|XP_002978499.1|  hypothetical protein SELMODRAFT_418142           55.8    3e-06   
ref|XP_007202838.1|  hypothetical protein PRUPE_ppa014570mg           55.1    3e-06   
ref|XP_010254896.1|  PREDICTED: transcription repressor OFP7-like     55.5    3e-06   
emb|CDP06863.1|  unnamed protein product                              53.1    3e-06   
gb|KGN62588.1|  hypothetical protein Csa_2G361530                     54.7    3e-06   
gb|EPS66245.1|  hypothetical protein M569_08533                       53.5    3e-06   
ref|XP_006383227.1|  hypothetical protein POPTR_0005s12670g           55.1    3e-06   
ref|XP_010233191.1|  PREDICTED: transcription repressor OFP1-like     55.5    3e-06   
ref|XP_008361253.1|  PREDICTED: pinin-like                            54.7    4e-06   
ref|XP_008337388.1|  PREDICTED: pinin-like                            54.7    4e-06   
emb|CDY09258.1|  BnaC03g62880D                                        54.7    4e-06   
ref|XP_002518035.1|  conserved hypothetical protein                   55.1    4e-06   
ref|XP_010651852.1|  PREDICTED: transcription repressor OFP6          53.1    4e-06   
ref|XP_010999973.1|  PREDICTED: transcription repressor OFP7-like     55.1    4e-06   
ref|XP_011013075.1|  PREDICTED: transcription repressor OFP8-like     54.7    4e-06   
gb|ABW05088.1|  ovate-like protein                                    54.7    4e-06   
ref|XP_010064629.1|  PREDICTED: transcription repressor OFP7-like     54.7    5e-06   
ref|XP_009374072.1|  PREDICTED: transcription repressor OFP8-like     54.3    5e-06   
ref|XP_002314697.1|  ovate family protein                             53.5    5e-06   
ref|XP_009405752.1|  PREDICTED: transcription repressor OFP7-like     54.3    5e-06   
gb|ABU45215.1|  unknown                                               54.3    6e-06   
ref|XP_002979425.1|  hypothetical protein SELMODRAFT_419120           54.3    6e-06   
ref|XP_009614200.1|  PREDICTED: transcription repressor OFP7-like     54.7    6e-06   
dbj|BAJ88951.1|  predicted protein                                    53.9    6e-06   
ref|XP_010548340.1|  PREDICTED: transcription repressor OFP7          53.9    7e-06   
ref|XP_010249737.1|  PREDICTED: transcription repressor OFP8-like     53.9    7e-06   
ref|XP_004150057.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.5    7e-06   
ref|XP_004293215.1|  PREDICTED: uncharacterized protein LOC101308843  53.9    7e-06   
ref|XP_008453732.1|  PREDICTED: beta-adducin                          53.9    7e-06   
ref|XP_002983211.1|  hypothetical protein SELMODRAFT_117843           50.8    7e-06   
ref|NP_001279994.1|  uncharacterized protein LOC100263246             53.9    8e-06   
gb|KDP36490.1|  hypothetical protein JCGZ_09498                       53.9    8e-06   
ref|XP_011021522.1|  PREDICTED: transcription repressor OFP12-like    53.5    8e-06   
gb|KHN08721.1|  hypothetical protein glysoja_037043                   52.0    8e-06   
emb|CAN68317.1|  hypothetical protein VITISV_032189                   53.9    8e-06   
gb|ADZ96939.1|  ovate-like protein                                    53.9    8e-06   
gb|ABU45184.1|  unknown                                               53.9    8e-06   
emb|CBI19679.3|  unnamed protein product                              53.9    8e-06   
ref|XP_011026580.1|  PREDICTED: transcription repressor OFP12         52.8    9e-06   
gb|KCW90485.1|  hypothetical protein EUGRSUZ_A02608                   52.4    9e-06   
ref|XP_002281515.2|  PREDICTED: transcription repressor OFP7-like     53.9    1e-05   
gb|AHL68404.1|  ovate                                                 53.9    1e-05   
ref|XP_002467594.1|  hypothetical protein SORBIDRAFT_01g030720        53.5    1e-05   
ref|NP_001234221.1|  ovate protein                                    53.5    1e-05   
ref|XP_002312533.1|  ovate family protein                             52.4    1e-05   
emb|CBI17543.3|  unnamed protein product                              53.1    1e-05   
gb|KHN21180.1|  hypothetical protein glysoja_006659                   52.4    1e-05   
ref|XP_006592351.1|  PREDICTED: hybrid signal transduction protei...  52.0    1e-05   
ref|XP_002514304.1|  conserved hypothetical protein                   53.1    1e-05   
ref|XP_007015720.1|  Ovate family protein 6, putative                 52.0    1e-05   
ref|XP_011090315.1|  PREDICTED: transcription repressor OFP6-like     52.0    1e-05   
ref|XP_010059275.1|  PREDICTED: transcription repressor OFP6          52.4    1e-05   
ref|XP_001783542.1|  predicted protein                                53.9    1e-05   
ref|XP_004983834.1|  PREDICTED: uncharacterized protein AFUA_6G14...  53.1    1e-05   
gb|EMS56102.1|  hypothetical protein TRIUR3_32720                     49.7    1e-05   
ref|XP_010095277.1|  hypothetical protein L484_014618                 53.1    1e-05   
ref|XP_009364515.1|  PREDICTED: transcription repressor OFP7-like     53.1    1e-05   
ref|XP_010253397.1|  PREDICTED: transcription repressor OFP8-like     52.4    1e-05   
ref|XP_006577093.1|  PREDICTED: uncharacterized protein LOC100804319  52.0    1e-05   
ref|XP_008377417.1|  PREDICTED: uncharacterized protein LOC103440502  53.1    1e-05   
ref|XP_006366994.1|  PREDICTED: uncharacterized protein LOC102580284  52.0    1e-05   
gb|EPS73133.1|  hypothetical protein M569_01624                       51.2    2e-05   
ref|XP_010031549.1|  PREDICTED: transcription repressor OFP6-like     52.0    2e-05   
gb|KDP40181.1|  hypothetical protein JCGZ_02179                       52.8    2e-05   
ref|XP_008657870.1|  PREDICTED: mucin-5B-like                         52.8    2e-05   
ref|NP_001146915.1|  plant-specific domain TIGR01568 family protein   52.8    2e-05   
ref|XP_010099584.1|  hypothetical protein L484_002190                 52.8    2e-05   
ref|XP_011077921.1|  PREDICTED: transcription repressor OFP6-like     51.2    2e-05   
gb|EYU22326.1|  hypothetical protein MIMGU_mgv1a025822mg              52.8    2e-05   
ref|XP_010910796.1|  PREDICTED: transcription repressor OFP6-like     51.2    2e-05   
gb|KHN33168.1|  hypothetical protein glysoja_039484                   51.6    2e-05   
ref|XP_011089210.1|  PREDICTED: transcription repressor OFP6          51.6    2e-05   
ref|XP_011043235.1|  PREDICTED: transcription repressor OFP6-like     51.6    2e-05   
ref|XP_008345568.1|  PREDICTED: uncharacterized protein LOC103408497  52.8    2e-05   
ref|XP_009770588.1|  PREDICTED: transcription repressor OFP8-like     52.4    2e-05   
ref|XP_007227310.1|  hypothetical protein PRUPE_ppa016655mg           52.8    2e-05   
ref|XP_004506212.1|  PREDICTED: uncharacterized protein LOC101503098  51.2    2e-05   
ref|XP_008242646.1|  PREDICTED: pinin                                 52.4    2e-05   
ref|XP_006591603.1|  PREDICTED: putative uncharacterized protein ...  51.6    2e-05   
ref|XP_003535805.1|  PREDICTED: uncharacterized protein LOC100786450  51.2    2e-05   
gb|KHN19912.1|  hypothetical protein glysoja_032392                   51.6    2e-05   
emb|CDX92372.1|  BnaA10g14110D                                        49.7    2e-05   
ref|XP_008386472.1|  PREDICTED: uncharacterized protein LOC103448978  52.4    2e-05   
ref|XP_006584451.1|  PREDICTED: uncharacterized protein LOC102663136  50.8    2e-05   
ref|XP_006856082.1|  hypothetical protein AMTR_s00059p00120360        52.8    2e-05   
tpg|DAA46045.1|  TPA: hypothetical protein ZEAMMB73_146213            52.8    2e-05   
ref|XP_007203031.1|  hypothetical protein PRUPE_ppa022590mg           52.4    2e-05   
ref|XP_009588172.1|  PREDICTED: transcription repressor OFP8-like     52.4    2e-05   
ref|XP_010046719.1|  PREDICTED: transcription repressor OFP6-like     51.6    2e-05   
ref|XP_002894628.1|  hypothetical protein ARALYDRAFT_892779           49.3    2e-05   
ref|XP_002517130.1|  conserved hypothetical protein                   51.6    3e-05   
ref|XP_004228564.1|  PREDICTED: transcription repressor OFP6          50.8    3e-05   
ref|XP_010102030.1|  hypothetical protein L484_016321                 51.2    3e-05   
gb|EYU23017.1|  hypothetical protein MIMGU_mgv1a012175mg              52.0    3e-05   
gb|EMS64269.1|  hypothetical protein TRIUR3_33001                     50.8    3e-05   
ref|XP_009365596.1|  PREDICTED: transcription repressor OFP7-like     52.4    3e-05   
ref|XP_004503437.1|  PREDICTED: probable serine/threonine-protein...  52.0    3e-05   
ref|XP_007145810.1|  hypothetical protein PHAVU_007G269800g           51.6    3e-05   
ref|XP_010029818.1|  PREDICTED: transcription repressor OFP7          52.4    3e-05   
ref|XP_010688199.1|  PREDICTED: transcription repressor OFP8-like     52.0    3e-05   
ref|XP_008220895.1|  PREDICTED: uncharacterized protein LOC103320934  52.0    3e-05   
gb|KHN02184.1|  hypothetical protein glysoja_002208                   50.8    3e-05   
ref|XP_009793465.1|  PREDICTED: transcription repressor OFP4-like     52.0    3e-05   
ref|XP_009371464.1|  PREDICTED: transcription repressor OFP8-like     52.0    4e-05   
ref|XP_010536003.1|  PREDICTED: transcription repressor OFP8          51.6    4e-05   
ref|XP_003519129.2|  PREDICTED: uncharacterized protein LOC100818531  50.4    4e-05   
ref|XP_009602773.1|  PREDICTED: transcription repressor OFP7-like     50.4    4e-05   
ref|XP_009617923.1|  PREDICTED: transcription repressor OFP4-like     51.6    4e-05   
ref|XP_006384785.1|  hypothetical protein POPTR_0004s21080g           50.4    4e-05   
ref|XP_008792405.1|  PREDICTED: transcription repressor OFP8-like     51.6    4e-05   
gb|KDO58263.1|  hypothetical protein CISIN_1g043741mg                 48.9    4e-05   
ref|XP_006348492.1|  PREDICTED: uncharacterized protein LOC102586159  50.4    4e-05   



>gb|KDP45718.1| hypothetical protein JCGZ_17325 [Jatropha curcas]
Length=367

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDF  256
            R    S   G+RLR NS    PRIA RKI+ S+ ++         G A+VK+SVDPQKDF
Sbjct  258  RSSTSSNSVGIRLRTNS----PRIASRKIQASARKSLSRNKTFLEGCAVVKSSVDPQKDF  313

Query  257  KesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            K+SM+EMI EN ++ S+DLE+LLACYLSLN +EYHHLIIKAFEQIWF++ HL
Sbjct  314  KDSMVEMIIENNIRTSKDLEDLLACYLSLNSKEYHHLIIKAFEQIWFDMAHL  365



>ref|XP_002518279.1| hypothetical protein RCOM_0815310 [Ricinus communis]
 gb|EEF44039.1| hypothetical protein RCOM_0815310 [Ricinus communis]
Length=406

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 81/117 (69%), Gaps = 9/117 (8%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPR---AEKMELPESGGVAMVKASVDPQ  247
            R    S   G+RLR NS    PRIA RKI+ S  R   +    L ES   A+VK+S DPQ
Sbjct  296  RSSTSSNSVGIRLRTNS----PRIASRKIQASCARKSMSRNKTLSES--FAVVKSSTDPQ  349

Query  248  KDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            KDFK+SM+EMI EN ++ SRDLE+LLACYLSLN +EYH LI+KAFEQIWF++  + L
Sbjct  350  KDFKDSMVEMIIENNIRASRDLEDLLACYLSLNSKEYHDLIVKAFEQIWFDMTDVRL  406



>emb|CDP04054.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 82/118 (69%), Gaps = 16/118 (14%)
 Frame = +2

Query  89   VSKVTGVRLRGNSSSSSPRIAVRKIR----------RSSPRAEKMELPESGGVAMVKASV  238
            VS  TG++LR NS    P++A +KI+          R S   +K    ES   A+VKAS+
Sbjct  293  VSHSTGIKLRANS----PKLASKKIQGQGRKSLSGNRRSKTLQKKGFSES--FAIVKASI  346

Query  239  DPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            DP+KDF+ESMMEMI EN ++ S+DLEELLACYLSLN +EYH LIIKAFEQIWF +P L
Sbjct  347  DPEKDFRESMMEMIVENNIRASKDLEELLACYLSLNSDEYHELIIKAFEQIWFNMPDL  404



>ref|XP_002276629.1| PREDICTED: transcription repressor OFP4 [Vitis vinifera]
Length=387

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 15/120 (13%)
 Frame = +2

Query  86   PVSKVTGVRLRGNSSSSSPRIAVRKIR---------RSSPRAEKMELPESGGVAMVKASV  238
            P +   GV+LR NS    PR+A RKI+         R+S +A+   L ES   A+VKAS 
Sbjct  274  PTANAAGVKLRTNS----PRLASRKIQAYARKSVYSRTSSKAQSRSLSES--CAVVKASF  327

Query  239  DPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            DP++DF++SM+EMI EN ++ S+DLEELLACYLSLN +EYH LI+KAFEQIWF+   L +
Sbjct  328  DPERDFRDSMLEMIVENNIRASKDLEELLACYLSLNSDEYHDLIVKAFEQIWFDTSDLRM  387



>ref|XP_011021025.1| PREDICTED: transcription repressor OFP4-like [Populus euphratica]
Length=385

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 10/118 (8%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKI----RRSSPRAEKMELPESGGVAMVKASVDP  244
            RK  V+   G++LR N+    PRIA RKI    R+S   +    L ES   A+VK SVDP
Sbjct  274  RKSSVNSAKGIKLRANT----PRIASRKIQGCARKSVSLSRNKTLSES--FAVVKFSVDP  327

Query  245  QKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            Q+DFK+SMMEMI E  ++ S+DLE+LLACYLSLN +EYH++I+KAFEQIWF++  L L
Sbjct  328  QRDFKDSMMEMIVEKNIRGSKDLEDLLACYLSLNSKEYHYIIVKAFEQIWFDMTDLHL  385



>ref|XP_002319964.2| hypothetical protein POPTR_0013s15120g [Populus trichocarpa]
 gb|EEE95887.2| hypothetical protein POPTR_0013s15120g [Populus trichocarpa]
Length=432

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 84/118 (71%), Gaps = 10/118 (8%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKI----RRSSPRAEKMELPESGGVAMVKASVDP  244
            RK  V+   G++LR N+    PRIA RKI    R+S   +    L ES   A+VK SVDP
Sbjct  321  RKSSVNSAKGIKLRANT----PRIASRKIQGCSRKSVSLSRNKTLSES--FAVVKFSVDP  374

Query  245  QKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            Q+DFK+SM+EMI EN ++ S+DLE+LLACYLSLN +EYH++I+KAFEQIWF++  L L
Sbjct  375  QRDFKDSMVEMIVENNIRGSKDLEDLLACYLSLNSKEYHYIIVKAFEQIWFDMTDLHL  432



>ref|XP_009801448.1| PREDICTED: transcription repressor OFP3-like [Nicotiana sylvestris]
Length=302

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 86/132 (65%), Gaps = 6/132 (5%)
 Frame = +2

Query  32   LPELIGLEESVDFRPRKPP--VSKVTGVRLRGNSSS-SSPRIAVRKIRRSSPRAEKMELP  202
            LP ++  + SV  +  K     S  +GV+LR NS+  ++ +I+V   R S P+ E     
Sbjct  174  LPPILTKQVSVKIQKEKETKYFSNSSGVKLRTNSTKIANKKISVSLKRHSKPKKESFS--  231

Query  203  ESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAF  382
             +G  A+VK S DP+KDF+ESM+EMI EN +K S++LE LLACYLSLN  EYH LIIKAF
Sbjct  232  -AGSFAIVKTSTDPEKDFRESMIEMIVENNIKASKNLENLLACYLSLNSNEYHDLIIKAF  290

Query  383  EQIWFELPHLDL  418
            ++IWF  P L L
Sbjct  291  QEIWFNFPDLHL  302



>ref|XP_004294737.1| PREDICTED: uncharacterized protein LOC101298496 [Fragaria vesca 
subsp. vesca]
Length=386

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 83/111 (75%), Gaps = 11/111 (10%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPES-GGV----AMVKASVDPQKDFKes  265
            TG+RLRGNS    PR+A +K+++  P   K  + ++ GG+    A+VK+S+DPQ+DFK+S
Sbjct  282  TGIRLRGNS----PRLASKKLQQ--PFGSKKSVSKNRGGISDSFAVVKSSLDPQRDFKDS  335

Query  266  mmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            M EMI EN +K S+DLE+LLACYLSLN  EYH LI+KAFEQIWF++  + +
Sbjct  336  MREMIMENNIKESKDLEDLLACYLSLNSREYHDLIVKAFEQIWFDMARIKI  386



>ref|XP_009589294.1| PREDICTED: transcription repressor OFP3-like [Nicotiana tomentosiformis]
Length=306

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +2

Query  89   VSKVTGVRLRGNSSS-SSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKes  265
             S   GV+LR NS+  +S +I+V   +RS P+ E      +   A+VK S DP+KDF+ES
Sbjct  199  FSNSFGVKLRTNSTKRASKKISVSLKKRSKPKKESFS---AESFAIVKTSTDPEKDFRES  255

Query  266  mmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            M+EM+ EN +K S+DLE LLACYLSLN +EYH LIIKAF++IWF  P L L
Sbjct  256  MIEMVVENNIKASKDLENLLACYLSLNSDEYHGLIIKAFQEIWFNFPDLHL  306



>ref|XP_007142050.1| hypothetical protein PHAVU_008G248300g [Phaseolus vulgaris]
 gb|ESW14044.1| hypothetical protein PHAVU_008G248300g [Phaseolus vulgaris]
Length=379

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 15/120 (13%)
 Frame = +2

Query  80   KPPVSKVTGVRLRGNSSSSSPRIAVRKI----RRS----SPRAEK-MELPESGGVAMVKA  232
            + P +  +G+RLR NS    P++A RKI    RRS    + RA +    P+  G A+VK+
Sbjct  264  RKPFTNSSGIRLRINS----PKLASRKIQACARRSVSSTASRASRGTSFPD--GFAVVKS  317

Query  233  SVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            S DPQ DF+ESM+EMI EN ++ S+DLE+LLACYLSLN  EYH LI+KAFEQIWF+L  L
Sbjct  318  SFDPQSDFRESMVEMIVENNIRASKDLEDLLACYLSLNSSEYHDLIVKAFEQIWFDLAQL  377



>gb|KFK27365.1| hypothetical protein AALP_AA8G373400 [Arabis alpina]
Length=332

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 7/113 (6%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIR-RSSPRAEKMELPESGGVAMVKASVDPQKD  253
            +KP     +G+R+R NS    P+IA +K + R+S   +K  +PES   A+V  SVDP++D
Sbjct  225  KKPKAGSSSGIRIRANS----PKIARKKTKGRTSTEPKKKGVPES--FAIVLTSVDPERD  278

Query  254  FKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            F+ESM+EMI EN+MK  +DLE+LLACYLSLN  EYH +IIKAFE+ WF L HL
Sbjct  279  FRESMVEMIVENKMKEQKDLEDLLACYLSLNSSEYHDIIIKAFEKTWFHLTHL  331



>ref|XP_009602083.1| PREDICTED: transcription repressor OFP2-like [Nicotiana tomentosiformis]
Length=304

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  206  SGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFE  385
            SG  A+VKAS DPQKDF+ESMMEMI EN +K S+DLE LLACYLSLN +EYHHLII AFE
Sbjct  234  SGSFAIVKASFDPQKDFRESMMEMILENNIKASKDLEHLLACYLSLNSDEYHHLIINAFE  293

Query  386  QIWFELPHLDL  418
            QIWF   HL L
Sbjct  294  QIWFNFSHLHL  304



>ref|XP_002326076.1| ovate family protein [Populus trichocarpa]
 gb|EEF00458.1| ovate family protein [Populus trichocarpa]
Length=386

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 80/119 (67%), Gaps = 10/119 (8%)
 Frame = +2

Query  74   PRKPPVSKVTGVRLRGNSSSSSPRIAVRKI----RRSSPRAEKMELPESGGVAMVKASVD  241
            P +   +  TG++LR N+    PRIA RKI    R+    +    L ES  V M  +SVD
Sbjct  274  PTRKSSANSTGIKLRANT----PRIASRKIQTCARKGVSFSRNKTLSESFAVVM--SSVD  327

Query  242  PQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            PQ+DFK+SM+EMI EN ++ S+DLEELLACYLSLN ++YH  IIKAFEQIWF++  L L
Sbjct  328  PQRDFKDSMVEMIVENNIQDSKDLEELLACYLSLNSKKYHDFIIKAFEQIWFDMTDLHL  386



>ref|XP_003518343.1| PREDICTED: uncharacterized protein LOC100780926 [Glycine max]
 gb|KHN40984.1| hypothetical protein glysoja_013326 [Glycine soja]
Length=383

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 85/135 (63%), Gaps = 16/135 (12%)
 Frame = +2

Query  44   IGLEESVDFRPRKP-----PVSKVTGVRLRGNSSSSSPRIAVRKI----RRSSPRAEKME  196
            I  EES+  + R+      P +   G+RLR NS    P++A RK+    RRS        
Sbjct  251  INKEESIRTQRRRKSNHRKPFANSAGIRLRVNS----PKLASRKVQACARRSVSSTASKG  306

Query  197  LPESG---GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHL  367
               +G   G A+VK+S DPQ DF+ESM+EMI EN ++ S+DLE+LLACYLSLN  EYH L
Sbjct  307  SRSTGFPDGFAVVKSSFDPQSDFRESMVEMIVENNIRASKDLEDLLACYLSLNSSEYHDL  366

Query  368  IIKAFEQIWFELPHL  412
            I+KAFEQIWF+L  L
Sbjct  367  IVKAFEQIWFDLAQL  381



>ref|XP_008354530.1| PREDICTED: uncharacterized protein LOC103418164 [Malus domestica]
Length=383

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 77/118 (65%), Gaps = 18/118 (15%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPE------------SGGVAMVKASVDP  244
            TG+R RGNS    PR+  R  +++ PR  K                 S   A+VK SVDP
Sbjct  272  TGIRJRGNS----PRL--RSKKKTQPRGRKSVSSSPSSCLKSKNRLLSESFAVVKTSVDP  325

Query  245  QKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            Q+DF+ESMMEMI EN ++ ++DLE+LLACYLSLN  EYH LI+KAFEQIWF++ H+ +
Sbjct  326  QRDFRESMMEMIVENNIRAAKDLEDLLACYLSLNSNEYHDLIVKAFEQIWFDMAHIKM  383



>ref|XP_010108488.1| hypothetical protein L484_010681 [Morus notabilis]
 gb|EXC19550.1| hypothetical protein L484_010681 [Morus notabilis]
Length=364

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 77/103 (75%), Gaps = 10/103 (10%)
 Frame = +2

Query  107  VRLRGNSSSSSPRIAVRKI----RRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmme  274
            +RLR NS    PR+A +KI    R+S     K  L ES   A+VK+SVDPQ+DF++SM+E
Sbjct  263  IRLRTNS----PRLASKKIQAYARKSVSSRNKQYLSES--FAVVKSSVDPQRDFRDSMVE  316

Query  275  mieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            MI EN ++ S+DLEELLACYLSLN +EYH +I+KAFEQIWF++
Sbjct  317  MIVENNIRASKDLEELLACYLSLNSKEYHDVIVKAFEQIWFDM  359



>ref|XP_002270134.1| PREDICTED: transcription repressor OFP1 [Vitis vinifera]
Length=396

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 88/131 (67%), Gaps = 15/131 (11%)
 Frame = +2

Query  53   EESVDFRPRKP-PVSKVTG----VRLRGNSSSSSPRIAVRKIR------RSSPRAEKMEL  199
            EES+  + +KP PV + +G    VRLR NS    PRIA RKI+       SS  +     
Sbjct  268  EESIGMKKQKPSPVRRFSGNSPGVRLRNNS----PRIASRKIQSHGRKSVSSTSSSSSRR  323

Query  200  PESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKA  379
              S   A+VK+S DPQ+DF++SMMEMI EN ++ S+DLEELLACYLSLN +EYH +IIK 
Sbjct  324  SLSDSFAIVKSSFDPQRDFRDSMMEMIVENNIRASKDLEELLACYLSLNSDEYHDIIIKV  383

Query  380  FEQIWFELPHL  412
            F+QIWF++P +
Sbjct  384  FKQIWFDIPDV  394



>ref|XP_006350877.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Solanum 
tuberosum]
Length=351

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = +2

Query  92   SKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGV--AMVKASVDPQKDFKes  265
            S  +GV+LR NS+  + +       +   +A+K     S G   A+VKAS+DP+KDF+ES
Sbjct  241  SSSSGVKLRTNSTKVASKRNSVSSSKRRSKAKKESCSTSTGTSFAIVKASIDPEKDFRES  300

Query  266  mmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            M+EM+ EN ++ S+DLE LLACYLSLN  EYH LIIKAFEQIWF L  L L
Sbjct  301  MIEMVVENNIRASKDLENLLACYLSLNSNEYHDLIIKAFEQIWFNLSDLHL  351



>ref|XP_011041802.1| PREDICTED: transcription repressor OFP4 [Populus euphratica]
Length=386

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 80/122 (66%), Gaps = 14/122 (11%)
 Frame = +2

Query  77   RKPPVSKV----TGVRLRGNSSSSSPRIAVRKI----RRSSPRAEKMELPESGGVAMVKA  232
            + PP  K     TG++LR N+    PRIA RKI    R+    +    L ES  V M  +
Sbjct  271  KNPPTRKSSANSTGIKLRANT----PRIASRKIQACARKGVSFSRNKTLSESFAVVM--S  324

Query  233  SVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            SVDPQ+DFK+SM+EMI EN ++ S+DLE+LLACYLSLN  +YH  I+KAFEQIWF++  L
Sbjct  325  SVDPQRDFKDSMVEMIVENNIQDSKDLEDLLACYLSLNSRKYHDFIVKAFEQIWFDMTDL  384

Query  413  DL  418
             L
Sbjct  385  HL  386



>ref|XP_003551614.1| PREDICTED: uncharacterized protein LOC100794572 [Glycine max]
 gb|KHN40617.1| hypothetical protein glysoja_001115 [Glycine soja]
Length=377

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 10/104 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKI----RRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmm  271
            GVRLR NS    PRIA R+I    RRS   A +  L  S   A+VK+S++PQ+DF+ESM+
Sbjct  276  GVRLRMNS----PRIASRRIQAHGRRSVSSAPRRSL--SDSFAVVKSSLNPQRDFRESMV  329

Query  272  emieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EMI +N ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  330  EMIVQNNIRTSKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDL  373



>ref|XP_007146867.1| hypothetical protein PHAVU_006G077000g [Phaseolus vulgaris]
 gb|ESW18861.1| hypothetical protein PHAVU_006G077000g [Phaseolus vulgaris]
Length=383

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 94/136 (69%), Gaps = 19/136 (14%)
 Frame = +2

Query  53   EESVDFRPRKP-PVSKV-----TGVRLRGNSSSSSPRIAVRKI----RRS-SPRAEKMEL  199
            E S   R RK  PVS++     TG+RLR NS    P++A +K+    RRS S +A K  +
Sbjct  253  ESSRTKRERKTSPVSRISSANSTGIRLRVNS----PKLASKKVQAYARRSVSSKAGKASV  308

Query  200  PESG---GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLI  370
             ++G   G A+VK+S+DPQ+DF+ESM+EMI EN ++ S+DLE LLACYLSLN  EYH LI
Sbjct  309  -DTGFPEGFAVVKSSLDPQRDFRESMVEMIVENNIRASKDLENLLACYLSLNSREYHDLI  367

Query  371  IKAFEQIWFELPHLDL  418
            +KAFEQIW+++  L +
Sbjct  368  VKAFEQIWYDMALLGM  383



>ref|XP_009120344.1| PREDICTED: transcription repressor OFP3-like [Brassica rapa]
Length=342

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 7/111 (6%)
 Frame = +2

Query  80   KPPVSKVTGVRLRGNSSSSSPRIAVRKIR-RSSPRAEKMELPESGGVAMVKASVDPQKDF  256
            K P +  TG+R+R +S    PRIA +K + R+SP+  K E  ES   A+V  SVDP++DF
Sbjct  236  KKPKAGSTGIRIRAHS----PRIARKKTKGRTSPQPMKKETAES--FAIVLTSVDPERDF  289

Query  257  KesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPH  409
            +ESM+EMI EN+MK  +DLE+LLACYLSLN  EYH  IIKAFE+ WF L H
Sbjct  290  RESMVEMIVENKMKEQKDLEDLLACYLSLNSSEYHDTIIKAFEKTWFHLTH  340



>ref|XP_008384677.1| PREDICTED: uncharacterized protein LOC103447277 [Malus domestica]
Length=380

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 83/118 (70%), Gaps = 18/118 (15%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVRKI-----RRSSP-------RAEKMELPESGGVAMVKASVDP  244
            TG+RLRGNS    PR+  +K      R+S P       +++   L ES   A+VK+SVDP
Sbjct  269  TGIRLRGNS----PRLGXKKKXQPCGRKSVPSSPSSCLKSKNRHLSES--FAVVKSSVDP  322

Query  245  QKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            Q+DF++SMMEMI EN ++ ++DLE+LLACYLSLN +EYH LI+KAFEQIWF++  + +
Sbjct  323  QRDFRDSMMEMIVENNIRAAKDLEDLLACYLSLNSKEYHELIVKAFEQIWFDMAXIKM  380



>ref|XP_007208152.1| hypothetical protein PRUPE_ppa022134mg [Prunus persica]
 gb|EMJ09351.1| hypothetical protein PRUPE_ppa022134mg [Prunus persica]
Length=416

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 81/127 (64%), Gaps = 20/127 (16%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPE-------------SGGV  217
            RK   +  TG+RLRGNS    PR+   K +++ P A K                  S   
Sbjct  297  RKSSANSTTGIRLRGNS----PRL---KSKKNQPYARKSVSSPSPSSCLKSKNRRLSESF  349

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+SVDPQKDF++SM+EMI EN ++ S+DLE+LLACYLSLN  EYH LI+KAFEQIWF
Sbjct  350  AVVKSSVDPQKDFRDSMVEMIVENNIRESKDLEDLLACYLSLNSNEYHDLIVKAFEQIWF  409

Query  398  ELPHLDL  418
            ++  + +
Sbjct  410  DMADIKM  416



>ref|XP_009407003.1| PREDICTED: transcription repressor OFP3-like [Musa acuminata 
subsp. malaccensis]
Length=344

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 78/113 (69%), Gaps = 13/113 (12%)
 Frame = +2

Query  107  VRLRGNSSSSSPRIAVRKIR---------RSSPRAEKMELPESGGVAMVKASVDPQKDFK  259
            +R RGNS    PR+A +K+R          ++P A +     SG  A+VK+S DPQ+DF+
Sbjct  236  LRTRGNS----PRLACKKLRPRCNRRSGTSTAPAAMQKGKGLSGSFAVVKSSSDPQRDFR  291

Query  260  esmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            +SM+EMI EN ++ S+DLEELLACYLSLN +EYH +I+  F+QIWFEL  L+L
Sbjct  292  DSMVEMIVENNIRASKDLEELLACYLSLNSDEYHGVIVAVFQQIWFELTSLNL  344



>ref|XP_007017064.1| Ovate family protein 4, putative [Theobroma cacao]
 gb|EOY34683.1| Ovate family protein 4, putative [Theobroma cacao]
Length=388

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 79/112 (71%), Gaps = 11/112 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR-------RSSPRAEKMELPESGGVAMVKASVDPQKDFKe  262
            G+RLR NS    PRIA +KI+        SS   +      +G +A+VK+S+DPQ+DF++
Sbjct  281  GIRLRANS----PRIASKKIQAYARKSVSSSTYLKSRNRSIAGSLAVVKSSLDPQRDFRD  336

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            SM+EMI EN ++ S+DLE+LLACYLSLN  +YH LII+AFEQIW ++ +L L
Sbjct  337  SMVEMIVENNIRASKDLEDLLACYLSLNSNQYHDLIIEAFEQIWLDMTNLRL  388



>ref|XP_011080730.1| PREDICTED: transcription repressor OFP1 [Sesamum indicum]
Length=335

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 8/106 (8%)
 Frame = +2

Query  89   VSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesm  268
            VS+  GV++RG       +I  R   R S ++EK  L  S   A+VKAS DP++DF++SM
Sbjct  234  VSRSGGVKIRGK------KIETRG--RRSVKSEKKGLFYSDSFAIVKASFDPERDFRDSM  285

Query  269  memieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELP  406
            MEMI EN ++ S+DLEELLACYLSLN  +YH LIIKAFEQIWF +P
Sbjct  286  MEMILENNIRASKDLEELLACYLSLNSNQYHGLIIKAFEQIWFNMP  331



>gb|KHN04235.1| hypothetical protein glysoja_040999 [Glycine soja]
Length=385

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 90/130 (69%), Gaps = 19/130 (15%)
 Frame = +2

Query  71   RPRKP-PVSKV-----TGVRLRGNSSSSSPRIAVRKI----RRS-SPRAEKMELPESG--  211
            R RK  PV+++     TG++LR NS    P++A +K+    RRS S  A K  +  SG  
Sbjct  261  RERKTSPVARISSANSTGIKLRVNS----PKLASKKVQAYARRSVSSNACKASM-NSGFP  315

Query  212  -GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQ  388
             G A+VK+S+DPQ+DF+ESM+EMI EN ++ S+DLE LLACYLSLN  EYH LI+KAFEQ
Sbjct  316  KGFAVVKSSLDPQRDFRESMVEMIVENNIRASKDLENLLACYLSLNSREYHDLIVKAFEQ  375

Query  389  IWFELPHLDL  418
            IW+++  L +
Sbjct  376  IWYDMAQLRM  385



>ref|XP_009589890.1| PREDICTED: transcription repressor OFP1 [Nicotiana tomentosiformis]
Length=357

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 6/105 (6%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemie  283
            GV+LR    + SPRI  RK   SS    +  + ES   A+VK+S DPQ+DFKESM+EMI 
Sbjct  258  GVKLR----TKSPRIVSRKSVSSSTNMLRTSVGES--FAVVKSSKDPQRDFKESMVEMIV  311

Query  284  enemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            EN ++ SRDLEELLACYLSLN ++YH LIIK F+QIWF++  + L
Sbjct  312  ENNIRTSRDLEELLACYLSLNSDQYHDLIIKVFKQIWFDITDVQL  356



>ref|XP_003552922.1| PREDICTED: uncharacterized protein LOC100798120 [Glycine max]
Length=385

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 19/130 (15%)
 Frame = +2

Query  71   RPRKP-PVSKVT-----GVRLRGNSSSSSPRIAVRKI----RRS-SPRAEKMELPESG--  211
            R RK  PV++V+     G++LR NS    P++A +K+    RRS S RA K  +  SG  
Sbjct  261  RERKTSPVARVSSANSPGIKLRVNS----PKLASKKVQAYARRSVSSRACKASM-NSGFP  315

Query  212  -GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQ  388
             G A+VK+S+DPQ+DF+ESM+EMI EN +  S+DLE LLACYLSLN  EYH LI+KAFEQ
Sbjct  316  EGFAVVKSSLDPQRDFRESMVEMIVENNIHASKDLENLLACYLSLNSREYHDLIVKAFEQ  375

Query  389  IWFELPHLDL  418
            IW+++  L +
Sbjct  376  IWYDMAQLRM  385



>gb|AFK36960.1| unknown [Lotus japonicus]
Length=348

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 84/130 (65%), Gaps = 11/130 (8%)
 Frame = +2

Query  44   IGLEESVDFRPRKPPVSKVTGVRLRGNSSSSSPRIAVRKI----RRSSPRAEKMELPESG  211
            I  EE+   + R+      +G+RLR NS    P++  RK+    RRS       +   +G
Sbjct  221  ICKEETSRTQRRRKKNYNSSGIRLRVNS----PKLGSRKVQGCVRRSVSSGASKDSRNAG  276

Query  212  ---GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAF  382
               G A+VK+S DPQ DF++SM+EMI EN+++ S+DLE+LLACYLSLN  EYH LI+KAF
Sbjct  277  FPDGFAVVKSSFDPQSDFRDSMVEMIVENKIRESKDLEDLLACYLSLNSSEYHELIVKAF  336

Query  383  EQIWFELPHL  412
            EQIW+++  L
Sbjct  337  EQIWYDMAQL  346



>gb|KHN48405.1| hypothetical protein glysoja_042270 [Glycine soja]
Length=385

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 90/130 (69%), Gaps = 19/130 (15%)
 Frame = +2

Query  71   RPRKP-PVSKVT-----GVRLRGNSSSSSPRIAVRKI----RRS-SPRAEKMELPESG--  211
            R RK  PV++++     G++LR NS    P++A +K+    RRS S RA K  +  SG  
Sbjct  261  RERKTSPVARISSANSPGIKLRVNS----PKLASKKVQAYARRSVSSRACKASM-NSGFP  315

Query  212  -GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQ  388
             G A+VK+S+DPQ+DF+ESM+EMI EN +  S+DLE LLACYLSLN  EYH LI+KAFEQ
Sbjct  316  EGFAVVKSSLDPQRDFRESMVEMIVENNIHASKDLENLLACYLSLNSREYHDLIVKAFEQ  375

Query  389  IWFELPHLDL  418
            IW+++  L +
Sbjct  376  IWYDMAQLRM  385



>ref|XP_010253122.1| PREDICTED: transcription repressor OFP1 [Nelumbo nucifera]
Length=414

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 80/121 (66%), Gaps = 13/121 (11%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIR-------RSSPRAEKMELPESGGVAMVKAS  235
            R+ PVS   G +LR NS    PRIA RKI+        S+P +       S   A+VK+S
Sbjct  300  RQLPVS--PGFKLRANS----PRIASRKIQAYARKSVSSTPSSRPRRKSLSESFAVVKSS  353

Query  236  VDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLD  415
             DPQ+DF++SM+EM+ EN ++ S+DLEELLACYLSLN +EYH LI+K FEQIWF L  + 
Sbjct  354  FDPQRDFRDSMVEMVVENNIRASKDLEELLACYLSLNSDEYHDLIVKVFEQIWFGLTDIR  413

Query  416  L  418
            L
Sbjct  414  L  414



>emb|CDY32990.1| BnaA10g11960D [Brassica napus]
Length=286

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 7/109 (6%)
 Frame = +2

Query  80   KPPVSKVTGVRLRGNSSSSSPRIAVRKIR-RSSPRAEKMELPESGGVAMVKASVDPQKDF  256
            K P +  TG+R+R +S    PRIA +K + R+SP+  K E  ES   A+V  SVDP++DF
Sbjct  180  KKPKAGSTGIRIRAHS----PRIARKKTKGRTSPQPMKKETAES--FAIVLTSVDPERDF  233

Query  257  KesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            +ESM+EMI EN+MK  +DLE+LLACYLSLN  EYH  IIKAFE+ WF L
Sbjct  234  RESMVEMIVENKMKEQKDLEDLLACYLSLNSSEYHDTIIKAFEKTWFHL  282



>ref|XP_002866259.1| ATOFP3/OFP3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42518.1| ATOFP3/OFP3 [Arabidopsis lyrata subsp. lyrata]
Length=296

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 81/111 (73%), Gaps = 6/111 (5%)
 Frame = +2

Query  80   KPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFK  259
            K P ++ TG+++R NS    P+IA +K + ++P ++K    +S   A+V +SVDP+KDF+
Sbjct  191  KKPNARSTGIKIRSNS----PKIARKKTKGNTPVSKKKGTVKS--FAIVLSSVDPEKDFR  244

Query  260  esmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            ESM+EMI EN+M+  +DLE+LLACYLSLN  EYH +IIKAFE+ W  L HL
Sbjct  245  ESMVEMIMENKMREQKDLEDLLACYLSLNSSEYHDVIIKAFEKTWLHLTHL  295



>ref|XP_009358432.1| PREDICTED: transcription repressor OFP2-like [Pyrus x bretschneideri]
Length=383

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 18/118 (15%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVRKIRRSSPR------------AEKMELPESGGVAMVKASVDP  244
            TG+RLRGNS    PR+  +K  +   R            ++     ES   A+VK SVDP
Sbjct  272  TGIRLRGNS----PRLGSKKKIQPCGRKRVSSSPSSCLKSKNRRFSES--FAVVKTSVDP  325

Query  245  QKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            Q+DF+ESMMEMI EN ++ ++DLE+LLACYLSLN  EYH LI+KAFEQIWF++ H+ +
Sbjct  326  QRDFRESMMEMIVENNIRAAKDLEDLLACYLSLNSNEYHDLIVKAFEQIWFDMAHIKM  383



>ref|XP_010543161.1| PREDICTED: transcription repressor OFP1 [Tarenaya hassleriana]
Length=284

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 18/104 (17%)
 Frame = +2

Query  92   SKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmm  271
            + V GVR+R     SSPR++VR+ RRS+              A+VKASVDP +DFK+SM+
Sbjct  195  TAVAGVRVRL----SSPRVSVREWRRST--------------AVVKASVDPVRDFKDSMV  236

Query  272  emieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EMI EN +  S+DLEELLACYLSLN +EYHH+II  F+QIW +L
Sbjct  237  EMIMENNITTSKDLEELLACYLSLNSDEYHHIIIAVFKQIWLDL  280



>emb|CDY43860.1| BnaC09g33830D [Brassica napus]
Length=290

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 78/110 (71%), Gaps = 8/110 (7%)
 Frame = +2

Query  80   KPPVSKVTGVRLRGNSSSSSPRIAVRKIR-RSSPR-AEKMELPESGGVAMVKASVDPQKD  253
            K P +  TG+R+R NS    PRIA +K + R+SP+   K E  ES   A+V  SVDP+KD
Sbjct  183  KKPKAGSTGIRIRANS----PRIARKKTKGRTSPQPMMKKETAES--FAIVLTSVDPEKD  236

Query  254  FKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            F+ESM+EMI EN+MK  +DLE+LLACYLSLN  EYH  IIKAFE+ WF L
Sbjct  237  FRESMVEMIVENKMKEQKDLEDLLACYLSLNSSEYHDTIIKAFEKTWFHL  286



>ref|XP_004492547.1| PREDICTED: uncharacterized protein LOC101493488 [Cicer arietinum]
Length=370

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 74/104 (71%), Gaps = 8/104 (8%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKI----RRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmm  271
            GV+LR NS    PRI+ RKI    R+S           S   A+VK+S++PQ+DF+ESM+
Sbjct  267  GVKLRINS----PRISSRKIQGHGRKSVSNDSSNRRSLSDSFAIVKSSMNPQRDFRESMV  322

Query  272  emieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EMI +N ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  323  EMIVQNNIRTSKDLEDLLACYLSLNSDEYHELIIKVFKQIWFDL  366



>emb|CDY02063.1| BnaC04g14380D [Brassica napus]
Length=311

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 79/102 (77%), Gaps = 6/102 (6%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVRKIRRSSPRAE-KMELPESGGVAMVKASVDPQKDFKesmmem  277
            +G+ LR     +SPRI +   RRS+ R+E K  + ES   A++K+SVDP+KDF+ESM+EM
Sbjct  211  SGINLR---RVNSPRIQLSGTRRSTSRSENKQAVLES--FAVMKSSVDPKKDFRESMVEM  265

Query  278  ieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            IE+N ++ S+DLE+LLACYLSLNP+EYH LII+ FEQIW +L
Sbjct  266  IEDNNIRASKDLEDLLACYLSLNPKEYHDLIIQVFEQIWRQL  307



>ref|XP_004242487.1| PREDICTED: transcription repressor OFP2-like [Solanum lycopersicum]
Length=351

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = +2

Query  92   SKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGV--AMVKASVDPQKDFKes  265
            S  +GV+LR NS+  + +       +   + +K     S G   A+VKAS+DP+KDF+ES
Sbjct  241  SSSSGVKLRTNSTKVANKRNSVSSSKRRSKTKKESCSASRGTSFAIVKASIDPEKDFRES  300

Query  266  mmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            M+EM+ EN ++ S++LE LLACYLSLN  EYH LIIKAFEQIWF+L  L L
Sbjct  301  MVEMVVENNIRASKELENLLACYLSLNSNEYHDLIIKAFEQIWFDLSDLHL  351



>ref|XP_010683528.1| PREDICTED: transcription repressor OFP1 [Beta vulgaris subsp. 
vulgaris]
Length=315

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 82/124 (66%), Gaps = 12/124 (10%)
 Frame = +2

Query  53   EESVDFRPRKPPVSKVTGVRLRGNSSSSSPRI-AVRKIRRSSPRAEKMELPE----SGGV  217
            E+ +   PRK P     GVRL+ NS    PRI  +++ +      + M L +    S   
Sbjct  197  EQRISSTPRKNPEK---GVRLKINS----PRIMGIKQAQNGISGRKSMSLKKRRSISESF  249

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+S DPQ+DFKESM+EMI +N ++ S+DLE+LLACYLSLN +EYH +IIK F+QIWF
Sbjct  250  AVVKSSFDPQRDFKESMVEMIVQNNLRTSKDLEDLLACYLSLNSDEYHDVIIKVFKQIWF  309

Query  398  ELPH  409
            +L H
Sbjct  310  DLRH  313



>ref|XP_008245084.1| PREDICTED: uncharacterized protein LOC103343188 [Prunus mume]
Length=442

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 75/110 (68%), Gaps = 11/110 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSS-------PRAEKMELPESGGVAMVKASVDPQKDFKe  262
            GVRLR NS    PRIA RKI +++         +       S   A+VK+S DPQ+DF+E
Sbjct  334  GVRLRMNS----PRIANRKINQANLSRRSVSSNSSSKRRSLSESFAIVKSSFDPQRDFRE  389

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            SM+EMI EN +K S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L  L
Sbjct  390  SMVEMIMENNIKASKDLEDLLACYLSLNSDEYHELIIKVFKQIWFDLTDL  439



>emb|CDY10735.1| BnaA05g12010D [Brassica napus]
Length=309

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 78/101 (77%), Gaps = 6/101 (6%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAE-KMELPESGGVAMVKASVDPQKDFKesmmemi  280
            G+ LR     +SPRI +   RRS+ R+E K  + ES   A++K+SVDP+KDF+ESM+EMI
Sbjct  210  GINLRR---VNSPRIQLSGTRRSTSRSENKQAVLES--FAVMKSSVDPKKDFRESMVEMI  264

Query  281  eenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EEN ++ S+DLE+LLACYLSLNP+EYH LII+ FEQIW +L
Sbjct  265  EENNIRASKDLEDLLACYLSLNPKEYHDLIIQVFEQIWRQL  305



>ref|XP_009374363.1| PREDICTED: transcription repressor OFP4-like [Pyrus x bretschneideri]
Length=385

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 81/123 (66%), Gaps = 23/123 (19%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVRKI-----RRSSP------------RAEKMELPESGGVAMVK  229
            TG+RLRGNS    PR+  +K      R+S              +++   L ES   A+VK
Sbjct  269  TGIRLRGNS----PRLGSKKKTQPCGRKSXXXXSVPSSPSSCLKSKNRHLSES--FAVVK  322

Query  230  ASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPH  409
            +SVDPQ+DF+ SMMEMI EN ++ ++DLEELLACYLSLN +EYH LI+KAFEQIWF++  
Sbjct  323  SSVDPQRDFRHSMMEMIVENNIRAAKDLEELLACYLSLNSKEYHELIVKAFEQIWFDMAR  382

Query  410  LDL  418
            + +
Sbjct  383  IKM  385



>gb|KFK26818.1| hypothetical protein AALP_AA8G297500 [Arabis alpina]
Length=292

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +2

Query  134  SSPRIAVRKIRRSSPRAE-KMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRD  310
            +SPRI +   RRS+ R E K  + ES   A+VK SVDP+KDFKESM+EMIEEN ++ S+D
Sbjct  200  NSPRIQLSGSRRSTSRTESKQAVLES--FAVVKRSVDPKKDFKESMVEMIEENNIRASKD  257

Query  311  LEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            LE+LLACYLSLNP+EYH LII+ FEQIW +L
Sbjct  258  LEDLLACYLSLNPKEYHDLIIQVFEQIWRQL  288



>ref|XP_007140109.1| hypothetical protein PHAVU_008G084900g [Phaseolus vulgaris]
 gb|ESW12103.1| hypothetical protein PHAVU_008G084900g [Phaseolus vulgaris]
Length=375

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 10/115 (9%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKI----RRSSPRAEKMELPES--GGVAMVKASV  238
            R+  VS   GV+LR NS    PRIA RK     RR++  A       S     A+VK+S+
Sbjct  262  RRFSVSSSPGVKLRMNS----PRIATRKAQAHGRRNASSAAGSGSQRSLLDSFAIVKSSL  317

Query  239  DPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            +PQ+DF+ESM+EMI +N ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  318  NPQRDFRESMVEMIVQNNIRTSKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDL  372



>gb|KEH23269.1| ovate transcriptional repressor [Medicago truncatula]
Length=287

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 11/107 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGG-------VAMVKASVDPQKDFKe  262
            GV+LR NS    PRI+ RKI+    ++    +  +G         A+VK+S++PQ DF+E
Sbjct  181  GVKLRINS----PRISSRKIQTHGRKSTSSTIISAGNRRSLSDSFAIVKSSLNPQGDFRE  236

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            SM+EMI +N ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  237  SMVEMIVQNNIRTSKDLEDLLACYLSLNSDEYHELIIKVFKQIWFDL  283



>ref|XP_003544334.1| PREDICTED: uncharacterized protein LOC100797854 [Glycine max]
Length=374

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 79/119 (66%), Gaps = 14/119 (12%)
 Frame = +2

Query  80   KPPVSKVTGVRLRGNSSSSSPRIAVRKI----RRSSPRAEKMELPES----GGVAMVKAS  235
            + P +   G+RLR +S    P++A RKI    R  SP + K   P S     G A+VK+S
Sbjct  260  RKPFANSAGIRLRVHS----PKLASRKIQACARSVSPISSKA--PRSTGFLDGFAVVKSS  313

Query  236  VDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
             DPQ DF+ESM+EMI EN ++ S+DLE+LLACYLSLN  EY  LI+KAFEQIWF++  L
Sbjct  314  FDPQSDFRESMLEMIVENNIRASKDLEDLLACYLSLNSSEYRDLIVKAFEQIWFDMTQL  372



>gb|KHN01889.1| hypothetical protein glysoja_044815 [Glycine soja]
Length=374

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 79/119 (66%), Gaps = 14/119 (12%)
 Frame = +2

Query  80   KPPVSKVTGVRLRGNSSSSSPRIAVRKI----RRSSPRAEKMELPES----GGVAMVKAS  235
            + P +   G+RLR +S    P++A RKI    R  SP + K   P S     G A+VK+S
Sbjct  260  RKPFANSAGIRLRVHS----PKLASRKIQACARSVSPISRKA--PRSTGFLDGFAVVKSS  313

Query  236  VDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
             DPQ DF+ESM+EMI EN ++ S+DLE+LLACYLSLN  EY  LI+KAFEQIWF++  L
Sbjct  314  FDPQSDFRESMLEMIVENNIRASKDLEDLLACYLSLNSSEYRDLIVKAFEQIWFDMTQL  372



>ref|XP_003623592.1| hypothetical protein MTR_7g072880, partial [Medicago truncatula]
Length=323

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 11/107 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGG-------VAMVKASVDPQKDFKe  262
            GV+LR NS    PRI+ RKI+    ++    +  +G         A+VK+S++PQ DF+E
Sbjct  217  GVKLRINS----PRISSRKIQTHGRKSTSSTIISAGNRRSLSDSFAIVKSSLNPQGDFRE  272

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            SM+EMI +N ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  273  SMVEMIVQNNIRTSKDLEDLLACYLSLNSDEYHELIIKVFKQIWFDL  319



>ref|XP_003616018.1| Plant-specific domain TIGR01568 family protein [Medicago truncatula]
 gb|AES98976.1| ovate transcriptional repressor [Medicago truncatula]
Length=349

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 82/120 (68%), Gaps = 10/120 (8%)
 Frame = +2

Query  71   RPRKPPVSKVT-----GVRLRGNSSSSSPRIAVRKIRRSSPRA-EKMELPESGGVAMVKA  232
            R RK  +++ T     G++LR NS    P+I  +KI+  + ++  K +     G A+VK+
Sbjct  232  RRRKSQIARKTSPNSQGIKLRVNS----PKIVSKKIQACARKSISKNDAGFVDGFAVVKS  287

Query  233  SVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            S+DP  DFKESM+EMI EN ++ S+DLE+LLACYLSLN  EYH +I+KAFEQIW+++  L
Sbjct  288  SIDPISDFKESMVEMIVENNIRESKDLEDLLACYLSLNSSEYHDVIVKAFEQIWYDMAQL  347



>gb|AFK33619.1| unknown [Lotus japonicus]
Length=400

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 74/105 (70%), Gaps = 11/105 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR-----RSSPRAEKMELPESGGVAMVKASVDPQKDFKesm  268
            GV+LR NS    PRIA  K+      RSS    +     SG  A+VK+S +PQKDF+ESM
Sbjct  300  GVKLRVNS----PRIASLKVHNYSHGRSSTTGSRRSF--SGSCAVVKSSFNPQKDFRESM  353

Query  269  memieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            +EMI +N ++ S+DLE+LLACYLSLN ++YH LII+ F+QIWF+L
Sbjct  354  VEMIVQNNIRASKDLEDLLACYLSLNSDQYHELIIRVFKQIWFDL  398



>ref|XP_004305088.1| PREDICTED: uncharacterized protein LOC101300552 [Fragaria vesca 
subsp. vesca]
Length=394

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 73/110 (66%), Gaps = 11/110 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSS-------PRAEKMELPESGGVAMVKASVDPQKDFKe  262
            GV+LR NS    PRIA RKI ++          +       S   A+VK+S DPQ+DF+E
Sbjct  286  GVKLRTNS----PRIANRKINQAQVGRRSLSSNSSSKRRSLSESFAIVKSSFDPQRDFRE  341

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            SM+EMI EN +K S+DLE+LLACYLSLN  EYH LIIK F+QIWF+L  +
Sbjct  342  SMIEMIMENNIKASKDLEDLLACYLSLNANEYHELIIKVFKQIWFDLTDI  391



>gb|KEH23266.1| ovate transcriptional repressor [Medicago truncatula]
Length=349

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 11/107 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGG-------VAMVKASVDPQKDFKe  262
            GV+LR NS    PRI+ RKI+    ++    +  +G         A+VK+S++PQ DF+E
Sbjct  243  GVKLRINS----PRISSRKIQTHGRKSTSSTIISAGNRRSLSDSFAIVKSSLNPQGDFRE  298

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            SM+EMI +N ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  299  SMVEMIVQNNIRTSKDLEDLLACYLSLNSDEYHELIIKVFKQIWFDL  345



>ref|XP_004249045.1| PREDICTED: transcription repressor OFP1 [Solanum lycopersicum]
Length=321

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  98   VTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmem  277
              GV+LR NS    PRI           + K     +   A+VK+S +PQKDF+ESM+EM
Sbjct  218  TNGVKLRTNS----PRITTTTTNSRKSVSSKRTSVTTDSFAVVKSSRNPQKDFRESMVEM  273

Query  278  ieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            I EN +  S+DLEELLACYLSLN +EYH +IIK F+QIWFE+  + L
Sbjct  274  IIENNITTSKDLEELLACYLSLNSDEYHDIIIKVFKQIWFEITEIRL  320



>emb|CBI18053.3| unnamed protein product [Vitis vinifera]
Length=300

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 76/112 (68%), Gaps = 10/112 (9%)
 Frame = +2

Query  95   KVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGG------VAMVKASVDPQKDF  256
            KV  +RLR NS    PRIA RKI+    ++       S         A+VK+S DPQ+DF
Sbjct  166  KVRRMRLRNNS----PRIASRKIQSHGRKSVSSTSSSSSRRSLSDSFAIVKSSFDPQRDF  221

Query  257  KesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            ++SMMEMI EN ++ S+DLEELLACYLSLN +EYH +IIK F+QIWF++P +
Sbjct  222  RDSMMEMIVENNIRASKDLEELLACYLSLNSDEYHDIIIKVFKQIWFDIPDV  273



>ref|XP_004506433.1| PREDICTED: putative uncharacterized protein DDB_G0277255-like 
[Cicer arietinum]
Length=404

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 11/110 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKI---RRSSPRAEKMELPE----SGGVAMVKASVDPQKDFKe  262
            GV+LR NS    PRIA RK+   RR S  + +         SG +A+VK+S +P KDF+E
Sbjct  298  GVKLRVNS----PRIATRKVQFHRRKSVSSTETSGAYRRSLSGSLAIVKSSFNPHKDFRE  353

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            SM+EMI EN ++ S+DLE+LLACYL LN +EYH +IIK F+QIWF+L  +
Sbjct  354  SMVEMIVENNIRASKDLEDLLACYLCLNSDEYHDIIIKVFKQIWFDLTEI  403



>gb|KDP22779.1| hypothetical protein JCGZ_00366 [Jatropha curcas]
Length=389

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 76/106 (72%), Gaps = 12/106 (11%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR------RSSPRAEKMELPESGGVAMVKASVDPQKDFKes  265
            G++LR NS    PRIA ++I+       SS  A +  L  S  +A+VK+S DPQ+DF+ES
Sbjct  284  GLKLRVNS----PRIANKRIQAHRKSVSSSLTASRRSL--SDSLAIVKSSFDPQRDFRES  337

Query  266  mmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            M+EMI EN ++ S+DLE+LLACYLSLN  EYH LIIK F+QIWF+L
Sbjct  338  MVEMIVENNIRASKDLEDLLACYLSLNSNEYHDLIIKVFKQIWFDL  383



>ref|XP_009589714.1| PREDICTED: transcription repressor OFP1-like [Nicotiana tomentosiformis]
Length=336

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDF  256
            R+  VS  TGV+LR NS   +    ++ + R S  + +     S   A+VK+S +PQKDF
Sbjct  222  RRVSVSSTTGVKLRTNSPKITNSKKIQAVSRRSVSSRRRSSSVSESFAVVKSSKNPQKDF  281

Query  257  KesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            +ESM+EMI EN ++ S+DLEELLACYLSLN +EYH LIIK F+QIWF++  + L
Sbjct  282  RESMVEMIVENNIRTSKDLEELLACYLSLNSDEYHDLIIKVFKQIWFDITDIRL  335



>ref|XP_009144305.1| PREDICTED: transcription repressor OFP2-like [Brassica rapa]
Length=316

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 76/99 (77%), Gaps = 6/99 (6%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVRKIRRSSPRAE-KMELPESGGVAMVKASVDPQKDFKesmmem  277
             G+ LR     +SPRI +   RRS+ R+E K  + ES   A++K+SVDP+KDF+ESM+EM
Sbjct  209  AGINLR---RVNSPRIQLSGTRRSTSRSENKQAVLES--FAVMKSSVDPKKDFRESMVEM  263

Query  278  ieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIW  394
            IEEN ++ S+DLE+LLACYLSLNP+EYH LII+ FEQIW
Sbjct  264  IEENNIRASKDLEDLLACYLSLNPKEYHDLIIQVFEQIW  302



>ref|XP_008798620.1| PREDICTED: transcription repressor OFP4 [Phoenix dactylifera]
Length=374

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = +2

Query  107  VRLRGNSSS-SSPRIAVRKIRRSSPRAEKMELPESG---GVAMVKASVDPQKDFKesmme  274
            +R+R N+      R+ V++ R+S   A   ++ + G   G A++K+S DPQ+DF++SM+E
Sbjct  267  IRMRANTPRLVGKRVQVQRSRKSGGLAMTEKMQKKGLQQGFAIIKSSSDPQRDFRDSMVE  326

Query  275  mieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            MI EN +  S+DLEELLACYLSLN  EYH LI+K FEQIWF+L ++ L
Sbjct  327  MIVENNIWASKDLEELLACYLSLNSNEYHDLIVKVFEQIWFDLTNIRL  374



>ref|XP_006410100.1| hypothetical protein EUTSA_v10017964mg [Eutrema salsugineum]
 gb|ESQ51553.1| hypothetical protein EUTSA_v10017964mg [Eutrema salsugineum]
Length=320

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 3/91 (3%)
 Frame = +2

Query  134  SSPRIAVRKIRRSSPRAE-KMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRD  310
            +SPRI +   RRS+ R+E K  + ES   A++K+SVDP+KDF+ESM+EMIEEN ++ S+D
Sbjct  228  NSPRIQLSGTRRSTSRSESKQVVLES--FAVMKSSVDPKKDFRESMVEMIEENNIRASKD  285

Query  311  LEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            LE+LLACYL+LNP+EYH LII+ FEQIW +L
Sbjct  286  LEDLLACYLTLNPKEYHDLIIQVFEQIWRQL  316



>ref|XP_011095118.1| PREDICTED: transcription repressor OFP1 [Sesamum indicum]
Length=411

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 11/114 (10%)
 Frame = +2

Query  110  RLRGNSSS-------SSPRIAVRKIRRSSPRAEKMELPE----SGGVAMVKASVDPQKDF  256
            RL GNSSS       +SPRIA R+I+     +           S   A+VK+S DPQ+DF
Sbjct  297  RLSGNSSSAGVKLRMNSPRIANRRIQGRKSASSNSSWGSRRSVSESFAVVKSSKDPQRDF  356

Query  257  KesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            +ESMMEMI EN ++ S+DLEELLACYLSLN +EYH LII  F+QIWF+  H+ L
Sbjct  357  RESMMEMIVENNIRASKDLEELLACYLSLNSDEYHDLIINVFKQIWFDFVHVRL  410



>ref|XP_006432000.1| hypothetical protein CICLE_v10003798mg [Citrus clementina]
 ref|XP_006494378.1| PREDICTED: uncharacterized protein LOC102615891 [Citrus sinensis]
 gb|ESR45240.1| hypothetical protein CICLE_v10003798mg [Citrus clementina]
Length=336

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 11/121 (9%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIR-------RSSPRAEKMELPESGGVAMVKAS  235
            RK   S   G+R+R NS    PRIA +K++        S+ R++      S    +VK+S
Sbjct  220  RKSSPSHSIGIRMRANS----PRIASKKLQAHARKSISSNTRSKSSNKSISESFVVVKSS  275

Query  236  VDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLD  415
             DPQ+DF+ESM+EMI EN ++ S+DLE+LLACY SLN  EYH +I+KAFEQ+W ++ +L 
Sbjct  276  FDPQRDFRESMVEMIVENNLRGSQDLEDLLACYFSLNSNEYHEVIVKAFEQVWLDITNLC  335

Query  416  L  418
            L
Sbjct  336  L  336



>ref|XP_011008759.1| PREDICTED: transcription repressor OFP2-like [Populus euphratica]
Length=419

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 14/115 (12%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR----------RSSPRAEKMELPESGGVAMVKASVDPQKD  253
            GVRLR NS    PRI+ RKI+           ++    +     S  +A+VK+S DPQKD
Sbjct  308  GVRLRVNS----PRISNRKIQAYNNGRKSVSSTTSSLSRSRRSLSDSLAVVKSSFDPQKD  363

Query  254  FKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            F+ESMMEMI EN +K S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L  + L
Sbjct  364  FRESMMEMIVENNIKASKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDLSDIKL  418



>ref|XP_004490708.1| PREDICTED: uncharacterized protein LOC101489571 [Cicer arietinum]
Length=366

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 75/113 (66%), Gaps = 14/113 (12%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPES----------GGVAMVKASVDPQKD  253
            G+RLR NS    P+I  RKI+  + ++       S           G A+VK+S+DPQ D
Sbjct  256  GIRLRVNS----PKIGNRKIQACARKSVSSSSKGSKDSRNDARFLDGFAVVKSSIDPQSD  311

Query  254  FKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            FKESM+EMI EN ++ S+DLE+LLACYLSLN  EYH LI+KAFEQIW+++  L
Sbjct  312  FKESMVEMIVENNIRESKDLEDLLACYLSLNSSEYHDLIVKAFEQIWYDMAQL  364



>emb|CDY04827.1| BnaAnng00090D [Brassica napus]
Length=257

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 81/130 (62%), Gaps = 21/130 (16%)
 Frame = +2

Query  83   PPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGV---------------  217
            P ++K T   +R  + S+SP  A  ++R  SPR    +   SGG                
Sbjct  131  PIITKPTTT-VRKTAVSTSP--AGVRLRLRSPRISTRKTASSGGAQITGTSATASSRRSR  187

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VKASVDP++DFKESM EMI EN+++ S+DLEELLACYL LN +EYHH+II  F+QIW 
Sbjct  188  AVVKASVDPRRDFKESMEEMIAENKIRESKDLEELLACYLCLNSDEYHHIIINVFKQIWL  247

Query  398  EL---PHLDL  418
            +L   PHL L
Sbjct  248  DLNLSPHLSL  257



>ref|XP_006294613.1| hypothetical protein CARUB_v10023651mg [Capsella rubella]
 gb|EOA27511.1| hypothetical protein CARUB_v10023651mg [Capsella rubella]
Length=320

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +2

Query  134  SSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDL  313
            +SPRI +   RRS+ R  +         A++K SVDP+KDFKESM+EMIEEN ++ S+DL
Sbjct  228  NSPRIQLSGTRRSTSRRPESRQDVLESFAVMKRSVDPKKDFKESMIEMIEENNIRASKDL  287

Query  314  EELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            E+LLACYLSLNP+EYH LII  FEQIW +L
Sbjct  288  EDLLACYLSLNPKEYHDLIIHVFEQIWLQL  317



>ref|XP_006587927.1| PREDICTED: uncharacterized protein LOC100817790 [Glycine max]
Length=386

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 75/107 (70%), Gaps = 11/107 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPE-------SGGVAMVKASVDPQKDFKe  262
            GVRLR NS    PRIA R+++ +  R+              S   A+VK+S++PQ+DF+E
Sbjct  280  GVRLRMNS----PRIASRRVQANGRRSVSSAAAAAAARRSLSDSFAVVKSSLNPQRDFRE  335

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            SM+EMI +N ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  336  SMVEMIVQNNIRTSKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDL  382



>ref|XP_010252093.1| PREDICTED: transcription repressor OFP1-like [Nelumbo nucifera]
Length=415

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 11/112 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR---RSSPRAEKMELPESGGV----AMVKASVDPQKDFKe  262
            G++LR NS    PRIA RKI+   R S  +     P   G+    A+VK+S DPQ+DF++
Sbjct  308  GLKLRTNS----PRIASRKIQAYGRKSVSSTSTSRPRRKGLSESFAVVKSSFDPQRDFRD  363

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            SM+EMI EN ++ S+D+E+LLACYLSLN  EYH LI+K F+QIW +L  + L
Sbjct  364  SMVEMIVENNIRASKDMEDLLACYLSLNSNEYHDLIVKVFKQIWIDLTDIPL  415



>ref|XP_009760912.1| PREDICTED: transcription repressor OFP3 [Nicotiana sylvestris]
Length=277

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = +2

Query  209  GGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQ  388
            G +A+V AS DPQKDFKESMMEMI EN +K S+DLE LLACYLSLN +EYHHLII AFEQ
Sbjct  211  GSLAIVMASFDPQKDFKESMMEMIVENNIKASKDLEHLLACYLSLNSDEYHHLIINAFEQ  270

Query  389  IWFELPHL  412
            IW +L HL
Sbjct  271  IWSDL-HL  277



>ref|XP_002323063.2| ovate family protein [Populus trichocarpa]
 gb|EEF04824.2| ovate family protein [Populus trichocarpa]
Length=418

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 14/115 (12%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR----------RSSPRAEKMELPESGGVAMVKASVDPQKD  253
            GVRLR NS    PRI+ RKI+           ++    +     S  +A+VK+S DPQKD
Sbjct  307  GVRLRVNS----PRISNRKIQAYNNGRKSVSSTTSSLSRSRRSLSDSLAVVKSSFDPQKD  362

Query  254  FKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            F+ESMMEMI EN +K S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L  + L
Sbjct  363  FRESMMEMIVENNIKASKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDLSDIKL  417



>ref|XP_009124091.1| PREDICTED: transcription repressor OFP1 [Brassica rapa]
Length=263

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 81/130 (62%), Gaps = 21/130 (16%)
 Frame = +2

Query  83   PPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGV---------------  217
            P ++K T   +R  + S+SP  A  ++R  SPR    +   SGG                
Sbjct  137  PIITKPTTT-VRKTAVSTSP--AGVRLRLRSPRISTRKTASSGGARIAGTSATASSRRSR  193

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VKASVDP++DFKESM EMI EN+++ S+DLEELLACYL LN +EYHH+II  F+QIW 
Sbjct  194  AVVKASVDPRRDFKESMEEMITENKIRESKDLEELLACYLCLNSDEYHHIIINVFKQIWL  253

Query  398  EL---PHLDL  418
            +L   PHL L
Sbjct  254  DLNLSPHLSL  263



>gb|AFK43560.1| unknown [Medicago truncatula]
Length=349

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 11/107 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGG-------VAMVKASVDPQKDFKe  262
            GV+LR NS    PRI+ RKI+    ++    +  +G         A+VK+S++PQ DF+E
Sbjct  243  GVKLRINS----PRISSRKIQTHGRKSTSSTIISAGNRRSLSDSFAIVKSSLNPQGDFRE  298

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            SM+EMI +N ++ S+DLE+LLACYLSL+ +EYH LIIK F+QIWF+L
Sbjct  299  SMVEMIVQNNIRTSKDLEDLLACYLSLDSDEYHELIIKVFKQIWFDL  345



>gb|ACJ86070.1| unknown [Medicago truncatula]
Length=206

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 8/104 (8%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIA----VRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmm  271
            GV+LR      SPRI     VRK   S+  +       SG +A+VK+S +PQKDF+ESM+
Sbjct  103  GVKLR----IKSPRIVQFHHVRKSVSSTVTSSGYRRSFSGSLAIVKSSFNPQKDFRESMV  158

Query  272  emieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EMI EN ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  159  EMIVENNIRASKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDL  202



>ref|XP_009126889.1| PREDICTED: transcription repressor OFP3, partial [Brassica rapa]
Length=248

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 5/111 (5%)
 Frame = +2

Query  80   KPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFK  259
            K P +  +G+R+R NS    P+ A RK +  +    K +   S   A+V  SVDP++DF+
Sbjct  142  KKPKAGSSGIRIRANS----PKKARRKTKARTSYTSKRK-GNSESFAIVLTSVDPERDFR  196

Query  260  esmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            ESM+EMI EN+MK   DLE+LLACYLSLN  EYH +IIKAFE+ WF L H+
Sbjct  197  ESMVEMIVENKMKEQTDLEDLLACYLSLNSSEYHDIIIKAFEKTWFHLTHV  247



>ref|XP_011019018.1| PREDICTED: transcription repressor OFP1-like [Populus euphratica]
Length=409

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 78/115 (68%), Gaps = 14/115 (12%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR----------RSSPRAEKMELPESGGVAMVKASVDPQKD  253
            GVRLR NS    PRI+ +KI+           ++  + +     S  +A+VK+S DPQKD
Sbjct  298  GVRLRVNS----PRISNKKIQAYNNGRKSVSSTTSSSSRSRRSLSDSMAVVKSSFDPQKD  353

Query  254  FKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            F+ESM+EMI EN +K S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L  + L
Sbjct  354  FRESMVEMIVENNIKASKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDLTDIKL  408



>gb|EYU45676.1| hypothetical protein MIMGU_mgv1a021422mg [Erythranthe guttata]
Length=345

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 78/130 (60%), Gaps = 25/130 (19%)
 Frame = +2

Query  89   VSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPE--------------------S  208
            VS+ +GV++R N     PR+A    RR  P + K+                        S
Sbjct  220  VSRASGVKIRANG----PRVASNGSRRK-PTSVKLSGDRDYDYDYEDEEKKKKKGLSFYS  274

Query  209  GGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQ  388
               A+VKAS DP+KDF+ESMMEMI EN ++ S++LE LLACYLSLN  +YH LI+KAFEQ
Sbjct  275  ESFAIVKASFDPEKDFRESMMEMIVENNIRASKELEHLLACYLSLNSNQYHDLIVKAFEQ  334

Query  389  IWFELPHLDL  418
            IWF +P L++
Sbjct  335  IWFNMPQLEI  344



>ref|XP_010046752.1| PREDICTED: transcription repressor OFP1-like [Eucalyptus grandis]
 gb|KCW87575.1| hypothetical protein EUGRSUZ_B04023 [Eucalyptus grandis]
Length=309

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 78/118 (66%), Gaps = 12/118 (10%)
 Frame = +2

Query  71   RPRKPPVSKVTGVRLRGNSSSSSPRIAV--RKIRRSSPRAEKMELPESGGVAMVKASVDP  244
            R RKP      G+++RGNS    PRI V   + R+S    +      +   A+VK+SVDP
Sbjct  202  RMRKP------GIKVRGNS----PRIQVVPAQARKSISSVKFSNKNLADSFAVVKSSVDP  251

Query  245  QKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            Q+DF ESM+EMI EN++  S+DLE+LLACYLSLNP  YH  I+KAFEQIWF + +L L
Sbjct  252  QRDFWESMVEMIVENDISASKDLEDLLACYLSLNPPYYHPHIVKAFEQIWFHMSNLSL  309



>emb|CDY62219.1| BnaCnng39640D [Brassica napus]
Length=309

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 76/102 (75%), Gaps = 6/102 (6%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVRKIRRSSPRAE-KMELPESGGVAMVKASVDPQKDFKesmmem  277
            +G+ LR     +SPRI +   RRS+ R+E K  + ES   A+VK SVDP+KDF+ESM+EM
Sbjct  209  SGINLR---RVTSPRIQLSGTRRSTSRSESKQVVLES--FAVVKRSVDPKKDFRESMVEM  263

Query  278  ieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            IEEN ++ S+DLE+LLACYLSLNP+EYH LII  FEQIW + 
Sbjct  264  IEENNIRDSKDLEDLLACYLSLNPKEYHDLIIHVFEQIWRQF  305



>ref|XP_010414270.1| PREDICTED: transcription repressor OFP2-like [Camelina sativa]
Length=321

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +2

Query  134  SSPRIAVRKIRRS-SPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRD  310
            +SPRI +  +RRS S R+E          A++K SVDP+KDF++SM+EMIEEN ++ S+D
Sbjct  227  NSPRIQLSGMRRSTSKRSESSRQDVLESYAVMKRSVDPKKDFRDSMIEMIEENNIRASKD  286

Query  311  LEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            LE+LLACYLSLNP+EYH LII  FEQIW +L
Sbjct  287  LEDLLACYLSLNPKEYHDLIIHVFEQIWLQL  317



>gb|KDO37952.1| hypothetical protein CISIN_1g039447mg [Citrus sinensis]
Length=307

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 80/122 (66%), Gaps = 12/122 (10%)
 Frame = +2

Query  74   PRKPPVSKVTGVRLRGNSSSSSPRIAVRKIR-------RSSPRAEKMELPESGGVAMVKA  232
            P+  P   + G+R+R NS    PRIA +K++        S+ R++      S    +VK+
Sbjct  191  PKSSPSHSI-GIRMRANS----PRIASKKLQAHARKSISSNTRSKSSNKSISESFVVVKS  245

Query  233  SVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            S DPQ+DF+ESM+EMI EN ++ S+DLE+LLACY SLN  EYH +I+KAFEQ+W ++ +L
Sbjct  246  SFDPQRDFRESMVEMIVENNLRGSQDLEDLLACYFSLNSNEYHEVIVKAFEQVWLDITNL  305

Query  413  DL  418
             L
Sbjct  306  CL  307



>ref|XP_010475442.1| PREDICTED: transcription repressor OFP4-like [Camelina sativa]
Length=317

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 10/103 (10%)
 Frame = +2

Query  119  GNSSSSSPRIAVR--------KIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmme  274
            G SS  SPRI +R          RRS+ R +  ++ +S   A++K+S+DP+KDF+ESM+E
Sbjct  209  GRSSVKSPRIKLRVSSPRLQFSPRRSTSRLQNTQVCDS--FAVIKSSLDPKKDFRESMVE  266

Query  275  mieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            MI EN ++ S+DLE+LLACYL+LNP+EYH LIIK F QIW E+
Sbjct  267  MITENNIRASKDLEDLLACYLTLNPKEYHDLIIKVFVQIWLEV  309



>emb|CDY67505.1| BnaCnng55350D [Brassica napus]
Length=301

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 76/109 (70%), Gaps = 14/109 (13%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVR--------KIRRSSPRAEKMELPESGGVAMVKASVDPQKDF  256
            TG R    SSS+SPRI ++          RRS  R++  ++ ES   A++K+S+DP+KDF
Sbjct  191  TGRR----SSSNSPRIKIKVSSPRVQVSARRSKSRSQNKQVLES--FALIKSSLDPKKDF  244

Query  257  KesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            +ESM+EMIEEN ++ S+DL ELLACYLSLNP EYH LI+K F Q+W E 
Sbjct  245  RESMVEMIEENNIRASQDLRELLACYLSLNPREYHDLILKVFVQVWLEF  293



>ref|XP_010522004.1| PREDICTED: transcription repressor OFP2-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522005.1| PREDICTED: transcription repressor OFP2-like isoform X2 [Tarenaya 
hassleriana]
Length=357

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 74/105 (70%), Gaps = 7/105 (7%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemie  283
            GV+LR NS    PRI V   RRS  ++    + +S   A++K SVDP+KDF+ESM+EM+ 
Sbjct  259  GVKLRVNS----PRIQV-SARRSMSQSHSKRVLDS--FAVIKCSVDPEKDFRESMLEMMM  311

Query  284  enemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            EN +  S+DLE+LLACYLSLN +EYH +IIK FEQIWFE   L L
Sbjct  312  ENNITTSKDLEDLLACYLSLNRKEYHDVIIKVFEQIWFETTELRL  356



>ref|XP_010469857.1| PREDICTED: transcription repressor OFP2-like [Camelina sativa]
Length=321

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +2

Query  134  SSPRIAVRKIRRS-SPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRD  310
            +SPRI +  +RRS S R+E          A++K SVDP+KDF++SM+EMIEEN ++ S+D
Sbjct  227  NSPRIQLSGMRRSTSKRSESSRQDVLESYAVMKRSVDPKKDFRDSMIEMIEENNIRASKD  286

Query  311  LEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            LE+LLACYLSLNP+EYH LII  FEQIW +L
Sbjct  287  LEDLLACYLSLNPKEYHDLIIHVFEQIWLQL  317



>ref|XP_009402214.1| PREDICTED: transcription repressor OFP1-like [Musa acuminata 
subsp. malaccensis]
Length=393

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 86/137 (63%), Gaps = 23/137 (17%)
 Frame = +2

Query  44   IGLEESVDFRPRKPPVSK----VTGVRLRGNSSSSSPRIAVRKIRRSSPR----------  181
            IG   S+     K PV K    +  +R+R NS    PR+A +K++    R          
Sbjct  257  IGHNVSLGKAQNKVPVKKSSPGLHRLRMRANS----PRLASKKVQAHRSRRCTVSTTTSA  312

Query  182  ---AEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPE  352
                ++M L ES   A+VK+S DPQ+DF++SM+EMI EN ++ S+DLEELLACYLSLN +
Sbjct  313  TATKQRMGLSES--FAVVKSSSDPQRDFRDSMLEMIVENNIRASKDLEELLACYLSLNSD  370

Query  353  EYHHLIIKAFEQIWFEL  403
            EYH +I+KAF+QIWF+L
Sbjct  371  EYHDVIVKAFQQIWFDL  387



>ref|XP_002309180.1| ovate family protein [Populus trichocarpa]
 gb|EEE92703.1| ovate family protein [Populus trichocarpa]
Length=405

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 78/115 (68%), Gaps = 14/115 (12%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR----------RSSPRAEKMELPESGGVAMVKASVDPQKD  253
            GVRLR NS    PRI+ +KI+           ++  + +     S  +A+VK+S DPQKD
Sbjct  294  GVRLRVNS----PRISNKKIQAYNNGRKSVSSTTSSSSRSRRSLSDSLAVVKSSFDPQKD  349

Query  254  FKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            F+ESM+EMI EN +K S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L  + L
Sbjct  350  FRESMVEMIVENNIKASKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDLTDIKL  404



>ref|XP_002892365.1| hypothetical protein ARALYDRAFT_470713 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68624.1| hypothetical protein ARALYDRAFT_470713 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 79/107 (74%), Gaps = 7/107 (7%)
 Frame = +2

Query  95   KVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmme  274
            K T ++LR     SSPRI V   RRS  R++  ++ +S   A++K+S+DP+KDF+ESM+E
Sbjct  204  KSTRIKLRV----SSPRIQVSP-RRSKSRSQNKQVLDS--FAVIKSSLDPKKDFRESMVE  256

Query  275  mieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLD  415
            MI E+ ++ S+D+E+LLACYL+LN +EYH+LIIK F Q+W E+ + D
Sbjct  257  MIAESNIRTSKDMEDLLACYLTLNAKEYHNLIIKVFVQVWLEVINYD  303



>ref|XP_009780345.1| PREDICTED: transcription repressor OFP1-like [Nicotiana sylvestris]
Length=343

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 9/119 (8%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIA-VRKIR----RSSPRAEKMELPESGGVAMVKASVD  241
            R+  VS  TGV+LR NS    P+I   +KI+    +S     +     S   A+VK+S +
Sbjct  228  RRVSVSSTTGVKLRTNS----PKITNSKKIQGVSRKSVSSRRRSSSSVSESFAVVKSSKN  283

Query  242  PQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            PQKDF+ESM+EMI EN ++ S+DLEELLACYLSLN +EYH LIIK F+QIWF++  + L
Sbjct  284  PQKDFRESMVEMIMENNIRTSKDLEELLACYLSLNSDEYHDLIIKVFKQIWFDITDIRL  342



>ref|XP_006279335.1| hypothetical protein CARUB_v10012721mg [Capsella rubella]
 gb|EOA12233.1| hypothetical protein CARUB_v10012721mg [Capsella rubella]
Length=229

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 79/133 (59%), Gaps = 33/133 (25%)
 Frame = +2

Query  59   SVDFRP---------RKPPVSKVTGVRLRGNSSSSSPRIAVRK---IRRSSPRAEKMELP  202
            S D RP         RKP VS   GVR R  S    PRI+ RK   +RRS          
Sbjct  105  STDLRPIITKPATPARKPAVSSPAGVRRRLRS----PRISTRKSVSVRRSG---------  151

Query  203  ESGGV------AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHH  364
              GG       A+VKASVDP++DFKESM EMI EN+++ S+DLEELLACYL LN +EYH 
Sbjct  152  --GGTSARRSRAVVKASVDPRRDFKESMEEMIAENKIRESKDLEELLACYLCLNSDEYHS  209

Query  365  LIIKAFEQIWFEL  403
            +II  F+QIW +L
Sbjct  210  VIINVFKQIWLDL  222



>gb|AFK39924.1| unknown [Medicago truncatula]
 gb|KEH29206.1| ovate transcriptional repressor [Medicago truncatula]
Length=382

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 8/104 (8%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIA----VRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmm  271
            GV+LR      SPRI     VRK   S+  +       SG +A+VK+S +PQKDF+ESM+
Sbjct  279  GVKLRI----KSPRIVQFHHVRKSVSSTVTSSGYRRSFSGSLAIVKSSFNPQKDFRESMV  334

Query  272  emieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EMI EN ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  335  EMIVENNIRASKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDL  378



>ref|XP_010541469.1| PREDICTED: transcription repressor OFP3 [Tarenaya hassleriana]
Length=267

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 16/143 (11%)
 Frame = +2

Query  26   STLPELIGLEESVDFRPRKPPVSK-------VTGVRLRGNSSSSSPRIAVRKIRR-SSPR  181
            S +P   G E  ++ R RK P S          G++LR NS    P+I+ +K  R S+  
Sbjct  129  SRVPVGFGKEAPLEARTRKKPTSGSRKSNAGALGIKLRVNS----PKISRKKSSRVSASN  184

Query  182  AEKMELPESGGVA----MVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNP  349
             +K    E+ G+A    MV  SVDP++DF++SM+EMI EN ++  +DLE+LLACYLSLN 
Sbjct  185  EQKGPEKENKGIAESFAMVLTSVDPERDFRQSMVEMIVENNIREQKDLEDLLACYLSLNS  244

Query  350  EEYHHLIIKAFEQIWFELPHLDL  418
             EYHH+II AFE+ W  L +  L
Sbjct  245  SEYHHVIINAFEKTWLHLSNSSL  267



>ref|XP_007033562.1| AF4/FMR2 family member 1 [Theobroma cacao]
 gb|EOY04488.1| AF4/FMR2 family member 1 [Theobroma cacao]
Length=551

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 85/133 (64%), Gaps = 10/133 (8%)
 Frame = +2

Query  38   ELIGLEESVDFRPRKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGG-  214
            E I ++E  ++ P +       GVRLR NS    P+IA R+I+  + ++       S   
Sbjct  422  ERITVKEQKNYSPVRKFSVNSPGVRLRINS----PKIASRRIQGHARKSVSSSSSSSSRR  477

Query  215  -----VAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKA  379
                  A+VK+S DPQ+DF++SM+EMI EN ++ S+DLE+LLACYLSLN +EYH +IIK 
Sbjct  478  SLSDSFAVVKSSFDPQRDFRDSMVEMIMENNIRASKDLEDLLACYLSLNADEYHDVIIKV  537

Query  380  FEQIWFELPHLDL  418
            F+QIWF+L  + L
Sbjct  538  FKQIWFDLSDVRL  550



>gb|AGV22117.1| ovate family protein 1 [Betula luminifera]
Length=326

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 71/103 (69%), Gaps = 7/103 (7%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR---RSSPRAEKMELPESGGVAMVKASVDPQKDFKesmme  274
            GVRLR NS    PR+  RK++   R S  +       S   A+VK+S DPQ+DF ESM+E
Sbjct  222  GVRLRINS----PRVGSRKVQGQSRRSVSSSTSRRSISDSFAVVKSSFDPQRDFTESMVE  277

Query  275  mieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            MI EN +K S+DLE+LLACYLSLN +EYH LIIK F+QIWF L
Sbjct  278  MIVENNIKASKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFNL  320



>ref|XP_010510366.1| PREDICTED: transcription repressor OFP2-like [Camelina sativa]
Length=322

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +2

Query  134  SSPRIAVRKIRRS-SPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRD  310
            +SPRI +  +R+S S R+E          A++K SVDP+KDF+ESM+EMIEEN ++ S+D
Sbjct  228  NSPRIQLSGMRKSTSKRSESSRQDVLESYAVMKRSVDPKKDFRESMIEMIEENNIRASKD  287

Query  311  LEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            LE+LLACYLSLNP+EYH LII  FEQIW +L
Sbjct  288  LEDLLACYLSLNPKEYHDLIIHVFEQIWLQL  318



>ref|XP_006429553.1| hypothetical protein CICLE_v10011867mg [Citrus clementina]
 ref|XP_006481171.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
 gb|ESR42793.1| hypothetical protein CICLE_v10011867mg [Citrus clementina]
Length=409

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 10/113 (9%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR--------RSSPRAEKMELPESGGVAMVKASVDPQKDFK  259
            GVRLR     +SPRIA RKI+         S+  +       S   A+VK+S DPQ+DF+
Sbjct  297  GVRLRM--KMNSPRIANRKIQAHGRRSTSSSNSSSSSRRSNLSDSFAIVKSSFDPQRDFR  354

Query  260  esmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            ESM+EMI EN ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L  + L
Sbjct  355  ESMVEMIVENNIRASKDLEDLLACYLSLNSDEYHELIIKVFKQIWFDLTDVKL  407



>gb|KDO49665.1| hypothetical protein CISIN_1g015381mg [Citrus sinensis]
Length=408

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 10/113 (9%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR--------RSSPRAEKMELPESGGVAMVKASVDPQKDFK  259
            GVRLR     +SPRIA RKI+         S+  +       S   A+VK+S DPQ+DF+
Sbjct  296  GVRLRM--KMNSPRIANRKIQAHGRRSTSSSNSSSSSRRSNLSDSFAIVKSSFDPQRDFR  353

Query  260  esmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            ESM+EMI EN ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L  + L
Sbjct  354  ESMVEMIVENNIRASKDLEDLLACYLSLNSDEYHELIIKVFKQIWFDLTDVKL  406



>ref|XP_010501348.1| PREDICTED: transcription repressor OFP4-like [Camelina sativa]
Length=319

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 10/103 (10%)
 Frame = +2

Query  119  GNSSSSSPRIAVR--------KIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmme  274
            G SS  SPRI +R          RRS  R +  ++ +S   A++K+S+DP+KDF+ESM+E
Sbjct  208  GRSSVKSPRIKLRVSSPRLQFSPRRSQSRLQNKQVCDS--FAVIKSSLDPKKDFRESMVE  265

Query  275  mieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            MI EN ++ S+DL++LLACYL+LNP+EYH LIIK F QIW E+
Sbjct  266  MITENNIRASKDLDDLLACYLTLNPKEYHDLIIKVFVQIWLEV  308



>gb|KFK24678.1| hypothetical protein AALP_AA8G010900 [Arabis alpina]
Length=297

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 78/127 (61%), Gaps = 15/127 (12%)
 Frame = +2

Query  56   ESVDFRPR-KPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGV-----  217
            + +D RP      +K T VR    ++ SSP   VR IR  SPR    +   + G      
Sbjct  170  QELDLRPIITKKANKATTVR---KTAVSSPAGGVR-IRLRSPRISTRKSVSNSGARGNGS  225

Query  218  -----AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAF  382
                 A+VKAS+DP++DFKESM EMI EN ++ S+DLEELLACYL LN +EYHH+II  F
Sbjct  226  SRRSRAVVKASLDPKRDFKESMEEMIVENNIRASKDLEELLACYLCLNSDEYHHIIINVF  285

Query  383  EQIWFEL  403
            +QIW +L
Sbjct  286  KQIWLDL  292



>ref|XP_010483413.1| PREDICTED: transcription repressor OFP3-like [Camelina sativa]
Length=320

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 77/114 (68%), Gaps = 6/114 (5%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAE--KMELPESGGVAMVKASVDPQK  250
            +KP       +++R NS    P+IA +K +  +  AE  K E   +   A+V +SVDP+K
Sbjct  210  KKPNARSSPRIKIRANS----PKIARKKTKEGTSPAEWKKKETGVAKSFAIVLSSVDPEK  265

Query  251  DFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            DF+ESM+EMI EN+M+  +DLE+LLACYLSLN  EYH +IIKAFE+ W +L HL
Sbjct  266  DFRESMVEMIVENKMREQKDLEDLLACYLSLNSSEYHDVIIKAFEKTWLQLTHL  319



>ref|XP_009132729.1| PREDICTED: transcription repressor OFP2-like [Brassica rapa]
Length=308

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 6/99 (6%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVRKIRRSSPRAE-KMELPESGGVAMVKASVDPQKDFKesmmem  277
            +G+ LR     +SPRI +   R S+ R++ K  + ES   A+VK SVDP+KDF+ESM+EM
Sbjct  208  SGINLR---RVTSPRIQLSGTRTSTSRSKSKQVVLES--FAVVKRSVDPKKDFRESMVEM  262

Query  278  ieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIW  394
            I+EN ++ S+DLE+LLACYLSLNP+EYH LII  FEQIW
Sbjct  263  IDENNIRASKDLEDLLACYLSLNPKEYHDLIIHVFEQIW  301



>ref|XP_002534303.1| hypothetical protein RCOM_0116230 [Ricinus communis]
 gb|EEF28078.1| hypothetical protein RCOM_0116230 [Ricinus communis]
Length=434

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 76/107 (71%), Gaps = 11/107 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAV-RKIR------RSSPRAEKMELPESGGVAMVKASVDPQKDFKe  262
            G+RLR NS    PRIAV R+++       SS  +       S  +A+VK+S DPQKDF+E
Sbjct  326  GLRLRVNS----PRIAVSRRVQAGRKSVSSSNSSSSSRRSLSDSLAIVKSSCDPQKDFRE  381

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            SM+EMI EN ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  382  SMLEMIVENNIRASKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDL  428



>ref|XP_009118470.1| PREDICTED: transcription repressor OFP4 [Brassica rapa]
Length=301

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +2

Query  134  SSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDL  313
            +SPR+ V   RRS  R++  ++ ES   A++K+S+DP+KDF+ESM+EMIEEN ++ S+DL
Sbjct  207  NSPRVQV-PARRSKSRSQNKQVLES--FAVIKSSLDPKKDFRESMVEMIEENNIRASQDL  263

Query  314  EELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
             ELLACYLSLNP+EYH LI+K F Q+W E+
Sbjct  264  RELLACYLSLNPKEYHDLILKVFVQVWLEV  293



>ref|XP_006843708.1| hypothetical protein AMTR_s00007p00212750 [Amborella trichopoda]
 gb|ERN05383.1| hypothetical protein AMTR_s00007p00212750 [Amborella trichopoda]
Length=351

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 73/110 (66%), Gaps = 8/110 (7%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGV----AMVKASVDPQKDFKesm  268
            TG++LR NS    PRI   + R      +K       GV    A+VKAS DPQ+DFKESM
Sbjct  246  TGLKLRSNS----PRILGSRGRIQRRPGQKRNPSGLSGVSESLAVVKASRDPQRDFKESM  301

Query  269  memieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            +EMI EN+++ S +LEELLACYLSLN +EYH +I+K FEQ+WFE   + L
Sbjct  302  VEMILENDLRASAELEELLACYLSLNSDEYHDVIVKVFEQVWFEFTDIRL  351



>gb|EYU42002.1| hypothetical protein MIMGU_mgv1a024247mg [Erythranthe guttata]
Length=394

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 72/108 (67%), Gaps = 12/108 (11%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIR--------RSSPRAEKMELPESGGVAMVKASVDPQKDFK  259
            GV+LR NS    PRIA R+I+         SS  + +     +   A+VK S DP++DF+
Sbjct  291  GVKLRTNS----PRIANRRIQGRKTLASPNSSSGSRRSVTAAAETFAVVKTSKDPRRDFR  346

Query  260  esmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            ESM+EMI EN ++ S+DLEELLACYLSLN +EYH +II  F+QIWF+ 
Sbjct  347  ESMVEMIVENNLRASKDLEELLACYLSLNSDEYHDVIINVFKQIWFDF  394



>ref|XP_008792265.1| PREDICTED: transcription repressor OFP2-like [Phoenix dactylifera]
Length=388

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 73/101 (72%), Gaps = 8/101 (8%)
 Frame = +2

Query  134  SSPRI------AVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenem  295
            SSPR+      A R    ++ R ++  L ES   A++K+S DPQ+DF++SM+EMI EN +
Sbjct  290  SSPRLVGDRVQAQRSRLATTARMQRKALRES--FAVIKSSSDPQRDFRDSMVEMIVENNI  347

Query  296  KCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            + S+DLEELLACYLSLN +EYH +I+KAFEQIWF L ++ L
Sbjct  348  RASKDLEELLACYLSLNSDEYHEVIVKAFEQIWFHLTNIRL  388



>ref|XP_006398574.1| hypothetical protein EUTSA_v10016086mg [Eutrema salsugineum]
 gb|ESQ40027.1| hypothetical protein EUTSA_v10016086mg [Eutrema salsugineum]
Length=285

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 77/123 (63%), Gaps = 9/123 (7%)
 Frame = +2

Query  62   VDFRPR-KPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAM-----  223
            +D RP    P +K T VR     S +  RI +R  R S+ ++       SG VA+     
Sbjct  156  LDLRPIITKPANKPTTVRKTAAGSPAGVRIRLRSPRISTRKSASSSARRSGTVAVSSRRS  215

Query  224  ---VKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIW  394
               VKASVDP++DFKESM EMI EN ++ S+DLEELLACYL LN +EYH++II  F+Q+W
Sbjct  216  RAVVKASVDPRRDFKESMEEMIAENNIRASKDLEELLACYLCLNSDEYHNIIINVFKQLW  275

Query  395  FEL  403
             +L
Sbjct  276  LDL  278



>ref|XP_008782640.1| PREDICTED: transcription repressor OFP2-like [Phoenix dactylifera]
Length=362

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 75/105 (71%), Gaps = 11/105 (10%)
 Frame = +2

Query  131  SSSPRIAVRKIRRSSPRAEKMELPESG---------GVAMVKASVDPQKDFKesmmemie  283
            +SSPR+  +K++  + R++KM   E+          G  +VK+S+DP++DF+ESM+EMI 
Sbjct  260  ASSPRVGTKKLQ--AHRSQKMAGLEAAMQQRKGRMEGFVVVKSSLDPRRDFRESMVEMIV  317

Query  284  enemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            EN ++ S+DLEELLACYLSLN +EYH +II  FEQIWF+L  + L
Sbjct  318  ENNLRASKDLEELLACYLSLNSKEYHEVIIHVFEQIWFDLADIIL  362



>ref|XP_010922720.1| PREDICTED: transcription repressor OFP1-like [Elaeis guineensis]
Length=389

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 74/108 (69%), Gaps = 4/108 (4%)
 Frame = +2

Query  107  VRLRGNSSS-SSPRIAVRKIRRSSPRAEKMELPESG---GVAMVKASVDPQKDFKesmme  274
            +R+R NS    S ++ V++ R+S   A    + + G     A++K+S DPQ+DF++SMME
Sbjct  282  LRMRANSPKLVSKKVQVQRGRKSGGLAMTATMQKKGLQQSFAIIKSSSDPQRDFRDSMME  341

Query  275  mieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            MI EN +   +DLEELLACYLSLN  EYH LI+K FEQIWF+L ++ L
Sbjct  342  MIVENNIWSPKDLEELLACYLSLNSNEYHDLIVKVFEQIWFDLTNIRL  389



>ref|XP_007134688.1| hypothetical protein PHAVU_010G067800g [Phaseolus vulgaris]
 gb|ESW06682.1| hypothetical protein PHAVU_010G067800g [Phaseolus vulgaris]
Length=373

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 10/104 (10%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAE----KMELPESGGVAMVKASVDPQKDFKesmm  271
            GVRLR +S    P+IA  K R+S         +  L ES   A+VK+S DPQKDF+ESM+
Sbjct  272  GVRLRVHS----PKIAGWKGRKSVSSTASSGSRRSLSES--FAVVKSSFDPQKDFRESMV  325

Query  272  emieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EMI EN ++ S+DLE+LLACYLSLN ++YH LIIK F+QIWF+L
Sbjct  326  EMIVENNIRASKDLEDLLACYLSLNSDQYHDLIIKVFKQIWFDL  369



>ref|XP_006281461.1| hypothetical protein CARUB_v10027544mg [Capsella rubella]
 gb|EOA14359.1| hypothetical protein CARUB_v10027544mg [Capsella rubella]
Length=273

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 73/112 (65%), Gaps = 18/112 (16%)
 Frame = +2

Query  80   KPPVSKVT-GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESG---GVAMVKASVDPQ  247
            K P  K+  G+R+R NS    P+I  +K R           P+ G     A+V +SVDP+
Sbjct  172  KEPQKKLNAGIRIRANS----PKIVRKKTR----------TPKKGIAKSFAIVVSSVDPE  217

Query  248  KDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            KDF++SM+EMI EN+M+  RDLE+LLACYLSLN  EYH +IIKAFE+ WF L
Sbjct  218  KDFRDSMVEMILENKMREERDLEDLLACYLSLNSNEYHDVIIKAFEKTWFHL  269



>ref|XP_006417868.1| hypothetical protein EUTSA_v10009577mg [Eutrema salsugineum]
 gb|ESQ36221.1| hypothetical protein EUTSA_v10009577mg [Eutrema salsugineum]
Length=313

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 76/101 (75%), Gaps = 10/101 (10%)
 Frame = +2

Query  125  SSSSSPRIAVR----KI----RRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemi  280
            SS++SPRI +R    KI    RRS  R +  ++ +S   A++K+SVDP KDF+ESM+EMI
Sbjct  208  SSANSPRIKLRVTSPKIHVSARRSKSRLQSKQVLDS--FAVIKSSVDPNKDFRESMVEMI  265

Query  281  eenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EEN+++ S+D+E+LLACYLSLNP+EYH LI K F Q+W E+
Sbjct  266  EENDIRDSQDMEDLLACYLSLNPKEYHDLIFKVFVQVWLEV  306



>ref|NP_172174.1| ovate family protein 4 [Arabidopsis thaliana]
 sp|F4HNU8.1|OFP4_ARATH RecName: Full=Transcription repressor OFP4; AltName: Full=Ovate 
family protein 4; Short=AtOFP4 [Arabidopsis thaliana]
 gb|AEE28053.1| ovate family protein 4 [Arabidopsis thaliana]
Length=315

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 73/101 (72%), Gaps = 10/101 (10%)
 Frame = +2

Query  125  SSSSSPRIAVR----KI----RRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemi  280
            SS+ SPRI +R    +I    RRS  R++  ++ +S   A++K+S+DP KDF+ESM+EMI
Sbjct  209  SSAKSPRIKLRARSPRIQVSPRRSKSRSQNKQILDS--FAVIKSSIDPSKDFRESMVEMI  266

Query  281  eenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
             EN ++ S D+E+LL CYL+LNP+EYH LIIK F Q+W E+
Sbjct  267  AENNIRTSNDMEDLLVCYLTLNPKEYHDLIIKVFVQVWLEV  307



>ref|XP_008388333.1| PREDICTED: uncharacterized protein LOC103450737 [Malus domestica]
 ref|XP_008366802.1| PREDICTED: uncharacterized protein LOC103430444 [Malus domestica]
Length=385

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 12/107 (11%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRS-------SPRAEKMELPESGGVAMVKASVDPQKDFKe  262
            G RLR      SPRI+ RKI ++       S  +       S   A+VK S DPQ+DF+E
Sbjct  278  GFRLRN-----SPRISNRKINQACLSRRSVSSNSSSKRRSISDSFAIVKTSFDPQRDFRE  332

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            SM+EMI EN +K S+DLE+LLACYLSLN +EYH +IIK F+QIWF+L
Sbjct  333  SMVEMIMENNIKASKDLEDLLACYLSLNSDEYHEMIIKVFKQIWFDL  379



>ref|XP_010457847.1| PREDICTED: transcription repressor OFP4-like [Camelina sativa]
Length=315

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 10/101 (10%)
 Frame = +2

Query  125  SSSSSPRIAVR--------KIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemi  280
            SS  SPRI +R          RRS+ R +  ++ +S   A++K+S+DP+KDF+ESM+EMI
Sbjct  209  SSVKSPRIKLRVSSPRLQFSPRRSTSRWQNKQVCDS--FAVIKSSLDPKKDFRESMVEMI  266

Query  281  eenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
             EN ++ S+DLE LLACYL+LNP+EYH LIIK F QIW E+
Sbjct  267  TENNIRASKDLENLLACYLTLNPKEYHDLIIKVFVQIWVEV  307



>ref|XP_006401092.1| hypothetical protein EUTSA_v10014213mg [Eutrema salsugineum]
 gb|ESQ42545.1| hypothetical protein EUTSA_v10014213mg [Eutrema salsugineum]
Length=303

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 8/111 (7%)
 Frame = +2

Query  80   KPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFK  259
            K P +  +G+R+R NS    P+I  +K +  + +    ++  +   A+V  SVDP++DF+
Sbjct  200  KKPKAGSSGIRIRTNS----PKIVRKKTKGRTIK----DMGAAESFAIVLTSVDPERDFR  251

Query  260  esmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            ESM+EMI EN+MK  +DLE LLACYLSLN  EYH +II+AFE+ WF L HL
Sbjct  252  ESMVEMIVENKMKEQKDLEGLLACYLSLNSCEYHDIIIRAFEKTWFHLTHL  302



>ref|XP_009346927.1| PREDICTED: transcription repressor OFP2-like [Pyrus x bretschneideri]
Length=384

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 79/124 (64%), Gaps = 23/124 (19%)
 Frame = +2

Query  89   VSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESG-------------------  211
            ++K  G RL  +++++SP I +R    +SPR    ++ ++G                   
Sbjct  259  ITKSDGRRLPSSNAATSPGIRLR----NSPRISNRKINQAGLSRRSVSSNSSSKRRSISD  314

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A+VK+S DPQ+DF+ESM+EMI EN +K S+DLE+LLACYLSLN +EYH +IIK F+QI
Sbjct  315  SFAIVKSSFDPQRDFRESMVEMIMENNIKASKDLEDLLACYLSLNSDEYHEMIIKVFKQI  374

Query  392  WFEL  403
            W +L
Sbjct  375  WIDL  378



>ref|XP_009371999.1| PREDICTED: transcription repressor OFP2 [Pyrus x bretschneideri]
Length=378

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 12/107 (11%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRS-------SPRAEKMELPESGGVAMVKASVDPQKDFKe  262
            G RLR     +SPRI+ RKI ++       S  +       S   A+VK+S DPQ+DF+E
Sbjct  271  GFRLR-----NSPRISNRKINQACLSRRSVSSNSSSKRRSISDSFAIVKSSFDPQRDFRE  325

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            SM+EMI EN +K S+D+E+LLACYLSLN +EYH +IIK F+QIWF+L
Sbjct  326  SMVEMIMENNIKASKDMEDLLACYLSLNSDEYHEMIIKVFKQIWFDL  372



>ref|XP_008355779.1| PREDICTED: uncharacterized protein LOC103419462 [Malus domestica]
Length=267

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 12/110 (11%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSS-------PRAEKMELPESGGVAMVKASVDPQKDFKe  262
            GVRLR      SPRI+ RKI ++          +       S   A+VK+S DPQ+DF+E
Sbjct  160  GVRLRN-----SPRISNRKINQAGLSRRSVSSNSSSKRRSISDSFAIVKSSFDPQRDFRE  214

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            SM+EMI EN +K S+DLE+LLACYLSLN +EYH +II  F+QIW +L  +
Sbjct  215  SMVEMILENNIKASKDLEDLLACYLSLNSDEYHEMIIXVFKQIWIDLTDI  264



>ref|XP_010453556.1| PREDICTED: transcription repressor OFP3-like [Camelina sativa]
Length=318

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 80/123 (65%), Gaps = 11/123 (9%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVR----KIRRSSPRA-------EKMELPESGGVAM  223
            ++PP       +L+  ++ SSPRI +R    KI R + +        +K E   +   A+
Sbjct  195  KEPPFQLSKQQKLKKPNARSSPRIKIRVNSPKIARKNTKEGTSPTEWKKKEKGIAKSFAI  254

Query  224  VKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            V +SVDP+KDF+ESM+EMI EN+M+  +DLE+LLACYLSLN  EYH +IIKAFE+ W +L
Sbjct  255  VLSSVDPEKDFRESMVEMIVENKMREQKDLEDLLACYLSLNSSEYHDIIIKAFEKTWLQL  314

Query  404  PHL  412
             HL
Sbjct  315  THL  317



>ref|XP_003516429.1| PREDICTED: uncharacterized protein LOC100785362 [Glycine max]
 gb|KHN14261.1| hypothetical protein glysoja_042980 [Glycine soja]
Length=385

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 70/102 (69%), Gaps = 6/102 (6%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPES--GGVAMVKASVDPQKDFKesmmem  277
            G RLR +S    PRIA R+ R+S           S     A+VK+S +PQKDF ESMMEM
Sbjct  284  GGRLRIHS----PRIAGRRGRKSVSSTASSGSRRSLSDSFAVVKSSFNPQKDFMESMMEM  339

Query  278  ieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            I EN ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  340  IVENNIRASKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDL  381



>ref|XP_003522091.1| PREDICTED: putative uncharacterized protein DDB_G0277255-like 
[Glycine max]
 gb|KHN43740.1| hypothetical protein glysoja_039579 [Glycine soja]
Length=387

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 13/107 (12%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRK-------IRRSSPRAEKMELPESGGVAMVKASVDPQKDFKe  262
            GVRLR +S    PRIA R+          ++    +  L ES   A+VK+S DPQKDF E
Sbjct  283  GVRLRIHS----PRIAGRRGRKSVSSSSTTTSSGSRRSLSES--FAVVKSSFDPQKDFME  336

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            SM+EMI EN ++ S+DLE+LLACYLSLN +EYH LIIK F+QIWF+L
Sbjct  337  SMVEMIVENNIRASKDLEDLLACYLSLNSDEYHDLIIKVFKQIWFDL  383



>ref|XP_010553202.1| PREDICTED: transcription repressor OFP1-like [Tarenaya hassleriana]
Length=226

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 70/113 (62%), Gaps = 13/113 (12%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVA----MVKASVDP  244
            RKP V+  +GVRLR NS         R+   +    + +  P S G +    +VK S+DP
Sbjct  117  RKPNVTTSSGVRLRPNS---------RRRVFTGKGVKTVRPPASAGFSDSFVVVKTSMDP  167

Query  245  QKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
              DFK SMMEMI EN ++  +DLEELLACYLSLN +EYH +II+ F+QIW E 
Sbjct  168  YGDFKASMMEMIVENRIRAKKDLEELLACYLSLNSDEYHDIIIRVFKQIWLEF  220



>emb|CDY09945.1| BnaC08g45060D [Brassica napus]
Length=301

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +2

Query  134  SSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDL  313
            SSPR+ V   RRS  R++  ++ +S   A++K+S+DP+KDF+ESM+EMIEEN ++ S+DL
Sbjct  207  SSPRVQV-SARRSKSRSQSKQVLDS--FAVMKSSLDPKKDFRESMVEMIEENNIRASQDL  263

Query  314  EELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
             ELLACYLSLNP+E+H LI+K F Q+W E+
Sbjct  264  RELLACYLSLNPKEHHDLILKVFVQVWLEV  293



>emb|CDY06241.1| BnaA09g49620D [Brassica napus]
Length=301

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +2

Query  134  SSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDL  313
            SSPR+ V   RRS  R++  ++ +S   A++K+S+DP+KDF+ESM+EMIEEN ++ S+DL
Sbjct  207  SSPRVQV-SARRSKSRSQSKQVLDS--FAVMKSSLDPKKDFRESMVEMIEENNIRASQDL  263

Query  314  EELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
             ELLACYLSLNP+E+H LI+K F Q+W E+
Sbjct  264  RELLACYLSLNPKEHHDLILKVFVQVWLEV  293



>ref|XP_006306181.1| hypothetical protein CARUB_v10011767mg [Capsella rubella]
 gb|EOA39079.1| hypothetical protein CARUB_v10011767mg [Capsella rubella]
Length=317

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 68/90 (76%), Gaps = 3/90 (3%)
 Frame = +2

Query  134  SSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDL  313
            SSPR+     RRS  R +  ++ +S   A++K+S+DP KDF+ESM+EMI EN+++ S DL
Sbjct  223  SSPRLQFSP-RRSKSRLQNKKVVDS--FAVIKSSLDPMKDFRESMVEMISENKIRASNDL  279

Query  314  EELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            E+LLACYL+LNP+EYH LIIK F QIW E+
Sbjct  280  EDLLACYLTLNPKEYHDLIIKVFVQIWLEV  309



>ref|XP_009764897.1| PREDICTED: transcription repressor OFP5 [Nicotiana sylvestris]
Length=429

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 82/140 (59%), Gaps = 17/140 (12%)
 Frame = +2

Query  50   LEESVDFRPRKPPV-----SKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPE---  205
            + E  D++ RK         +  GV+LR  S  ++ +I  R       +  KM++ +   
Sbjct  274  MSEKSDYQQRKSVYINQKRRRKHGVKLRAYSPRTTAKIECRIKALEDMKKAKMKMRQETK  333

Query  206  --SGG-------VAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEY  358
              SGG        A+VK+S DP +DF+ESM+EMI +  +K S +LEELLACYL+LN +EY
Sbjct  334  ERSGGDRTVFDSYAVVKSSFDPFRDFRESMIEMITQRGIKNSEELEELLACYLTLNCDEY  393

Query  359  HHLIIKAFEQIWFELPHLDL  418
            H LIIK F Q+WFEL  +++
Sbjct  394  HDLIIKVFRQVWFELNQVNI  413



>ref|XP_007205267.1| hypothetical protein PRUPE_ppa006439mg [Prunus persica]
 gb|EMJ06466.1| hypothetical protein PRUPE_ppa006439mg [Prunus persica]
Length=412

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+S DPQ+DF+ESM+EMI EN +K S+DLE+LLACYLSLN +EYH LIIK F+QIWF
Sbjct  345  AIVKSSFDPQRDFRESMVEMIMENNIKASKDLEDLLACYLSLNSDEYHELIIKVFKQIWF  404

Query  398  ELPHL  412
            +L  L
Sbjct  405  DLTDL  409



>ref|XP_009785142.1| PREDICTED: transcription repressor OFP2-like [Nicotiana sylvestris]
Length=347

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 9/105 (9%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemie  283
            GV+LR    + SPRI  RK   SS +    E       A+VK+S DPQ+DFKESM+EMI 
Sbjct  251  GVKLR----TKSPRIVSRKSVSSSKKTSVGE-----SFAVVKSSKDPQRDFKESMVEMIV  301

Query  284  enemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            EN ++ S+DLE+LLACYLSLN ++YH LIIK F+QIWF++  + L
Sbjct  302  ENNIRTSKDLEQLLACYLSLNSDQYHDLIIKVFKQIWFDITDVQL  346



>ref|XP_010443554.1| PREDICTED: transcription repressor OFP3-like [Camelina sativa]
Length=318

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 82/123 (67%), Gaps = 11/123 (9%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVR----KIRR------SSP-RAEKMELPESGGVAM  223
            ++PP       +L+  ++ SSPRI +R    KI R      +SP + +K E   +   A+
Sbjct  195  KEPPFQLRKQQKLKKPNARSSPRIKIRANYPKIARKKTKEGTSPAKWKKKEKGIAKSFAI  254

Query  224  VKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            V +SVDP+KDF+ESM+EMI EN+M+  +DLE+LLACYLSLN  EYH +IIKAFE+ W +L
Sbjct  255  VLSSVDPEKDFRESMVEMIVENKMREQKDLEDLLACYLSLNSSEYHVVIIKAFEKTWLQL  314

Query  404  PHL  412
             HL
Sbjct  315  THL  317



>ref|XP_009627121.1| PREDICTED: transcription repressor OFP5 [Nicotiana tomentosiformis]
Length=425

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 74/115 (64%), Gaps = 10/115 (9%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMEL---PESGG-------VAMVKASVDPQKD  253
            GV++R  S  ++ +I  R       +  KM++    +SGG        A+VK+S DP +D
Sbjct  295  GVKIRAYSPRTTAKIECRIKALEDMKKAKMKMRQETKSGGDRTVFDSYAVVKSSFDPFRD  354

Query  254  FKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            F+ESM+EMI +  +K S +LEELLACYL+LN +EYH LIIK F Q+WFEL  +++
Sbjct  355  FRESMLEMITQRGIKNSEELEELLACYLTLNCDEYHDLIIKVFRQVWFELNQVNI  409



>ref|XP_010091076.1| hypothetical protein L484_021958 [Morus notabilis]
 gb|EXB42366.1| hypothetical protein L484_021958 [Morus notabilis]
Length=379

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 17/120 (14%)
 Frame = +2

Query  83   PPVSKVT----GVRLRGNSSSSSPRIAVRKIRRSS---------PRAEKMELPESGGVAM  223
            PPV K++    G+RLR NS    PRI   K   SS           + +     S   A+
Sbjct  258  PPVRKLSSNAPGIRLRMNS----PRIISSKRVVSSHGRRSLSSFSSSSEKRRSLSESFAI  313

Query  224  VKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            VK+S DPQ+DF+ESM+EMI EN ++ S+DLE+LLACYLSLN +EYH LII  F+QIWF+L
Sbjct  314  VKSSFDPQRDFRESMVEMIVENNIRASKDLEDLLACYLSLNSDEYHDLIINVFKQIWFDL  373



>gb|KCW47510.1| hypothetical protein EUGRSUZ_K01276 [Eucalyptus grandis]
Length=366

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  206  SGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFE  385
            S   A++KASVDPQ+DF++SMMEMI EN+++ S+DLEELLA YLSLN +EYH LIIK F+
Sbjct  295  SDSFAVMKASVDPQRDFRDSMMEMIVENDIRASKDLEELLASYLSLNSDEYHDLIIKVFK  354

Query  386  QIWFEL  403
            QIWF+L
Sbjct  355  QIWFDL  360



>ref|XP_004150976.1| PREDICTED: uncharacterized protein LOC101204894 [Cucumis sativus]
Length=324

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 71/100 (71%), Gaps = 6/100 (6%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemie  283
            GVRLR +S    P+I  RK+     ++       S  +A++K+S DPQKDF+ESM+EMI 
Sbjct  223  GVRLRIHS----PKIGYRKM--GGRKSVSSRRSLSESLAIMKSSYDPQKDFRESMVEMIV  276

Query  284  enemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EN ++ S++LE+LLACYL LN +EYH LIIK F+QIWF+L
Sbjct  277  ENNIRSSKELEDLLACYLCLNADEYHDLIIKVFKQIWFDL  316



>ref|XP_010456346.1| PREDICTED: transcription repressor OFP1-like [Camelina sativa]
Length=176

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 69/110 (63%), Gaps = 0/110 (0%)
 Frame = +2

Query  74   PRKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKD  253
            PRK  VS   GVRLR  S   S R +V     +               A+VKASVDP++D
Sbjct  63   PRKTAVSSPAGVRLRLRSPRVSTRKSVSVSSSARRSGSGSGSSARRSRAVVKASVDPRRD  122

Query  254  FKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            FKESM EMI EN+++ S+DLEELLACYL LN +EYH +II  F+QIW +L
Sbjct  123  FKESMEEMIAENKIRASKDLEELLACYLCLNSDEYHPIIINVFKQIWLDL  172



>ref|XP_010921121.1| PREDICTED: transcription repressor OFP2-like [Elaeis guineensis]
Length=367

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 72/103 (70%), Gaps = 7/103 (7%)
 Frame = +2

Query  131  SSSPRIAVRKI---RRSSPRAEKMELPESGG----VAMVKASVDPQKDFKesmmemieen  289
            +SSPR+  +K+   R       K  + +  G    + +VK+S+DP+ DF+ESM+EMI EN
Sbjct  265  ASSPRLGNKKLQAHRSQKTVGLKAAMQQRKGLMESIVVVKSSLDPRWDFRESMVEMIIEN  324

Query  290  emKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
             ++ S+DLEELLACYLSLN +EYH +II+ FEQIWF+LP + L
Sbjct  325  NLRTSKDLEELLACYLSLNSKEYHDVIIEVFEQIWFDLPDIIL  367



>gb|KGN54443.1| hypothetical protein Csa_4G332100 [Cucumis sativus]
Length=335

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 71/100 (71%), Gaps = 6/100 (6%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemie  283
            GVRLR +S    P+I  RK+     ++       S  +A++K+S DPQKDF+ESM+EMI 
Sbjct  234  GVRLRIHS----PKIGYRKM--GGRKSVSSRRSLSESLAIMKSSYDPQKDFRESMVEMIV  287

Query  284  enemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EN ++ S++LE+LLACYL LN +EYH LIIK F+QIWF+L
Sbjct  288  ENNIRSSKELEDLLACYLCLNADEYHDLIIKVFKQIWFDL  327



>emb|CDX84837.1| BnaA03g13930D [Brassica napus]
Length=240

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = +2

Query  164  RRSSPRAE-KMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLS  340
            R+S+ R+E K  + ES   A+VK SVDP+KDF+ESM+EMIEEN ++ S+DLE+LLACYLS
Sbjct  158  RKSTSRSESKQVVLES--FAVVKRSVDPKKDFRESMVEMIEENNIRASKDLEDLLACYLS  215

Query  341  LNPEEYHHLIIKAFEQIW  394
            LNP+EYH LII  FEQIW
Sbjct  216  LNPKEYHDLIIHVFEQIW  233



>ref|XP_008463251.1| PREDICTED: uncharacterized protein LOC103501454 [Cucumis melo]
Length=331

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 71/100 (71%), Gaps = 6/100 (6%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemie  283
            GVRLR +S    P+I  RK+     ++       S  +A++K+S DPQKDF+ESM+EMI 
Sbjct  230  GVRLRIHS----PKIGYRKM--GGRKSVSSRRSLSESLAIMKSSYDPQKDFRESMVEMIV  283

Query  284  enemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EN ++ S++LE+LLACYL LN +EYH LIIK F+QIWF+L
Sbjct  284  ENNIRGSKELEDLLACYLCLNADEYHDLIIKVFKQIWFDL  323



>ref|XP_010931348.1| PREDICTED: transcription repressor OFP3 [Elaeis guineensis]
Length=388

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 70/100 (70%), Gaps = 5/100 (5%)
 Frame = +2

Query  134  SSPRIAVRKIRRSSPRAEKMELPESG-----GVAMVKASVDPQKDFKesmmemieenemK  298
            SSPR+   ++++     +  +L  +        A++ +S DPQ+DF+ESM+EMI EN ++
Sbjct  289  SSPRLVSNRVQQVQRNRKSSDLAMTAKGLRESFAIIISSSDPQRDFRESMVEMIVENNIR  348

Query  299  CSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
             S+DLEELLACYLSLN +EYH +I+K FEQIWF+L ++ L
Sbjct  349  ASKDLEELLACYLSLNSKEYHGVIVKVFEQIWFDLTNIRL  388



>ref|XP_010035991.1| PREDICTED: transcription repressor OFP3 [Eucalyptus grandis]
Length=422

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  206  SGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFE  385
            S   A++KASVDPQ+DF++SMMEMI EN+++ S+DLEELLA YLSLN +EYH LIIK F+
Sbjct  351  SDSFAVMKASVDPQRDFRDSMMEMIVENDIRASKDLEELLASYLSLNSDEYHDLIIKVFK  410

Query  386  QIWFEL  403
            QIWF+L
Sbjct  411  QIWFDL  416



>ref|NP_180599.1| ovate family protein 2 [Arabidopsis thaliana]
 sp|O04351.1|OFP2_ARATH RecName: Full=Transcription repressor OFP2; AltName: Full=Ovate 
family protein 2; Short=AtOFP2 [Arabidopsis thaliana]
 gb|AAB63094.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14819.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08382.1| ovate family protein 2 [Arabidopsis thaliana]
Length=320

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A++K SVDP+KDF+ESM+EMIEEN ++ S+DLE+LLACYL+LNP+EYH LII  FEQI
Sbjct  253  SFAVMKRSVDPKKDFRESMIEMIEENNIRASKDLEDLLACYLTLNPKEYHDLIIHVFEQI  312

Query  392  WFEL  403
            W +L
Sbjct  313  WLQL  316



>ref|XP_009384772.1| PREDICTED: transcription repressor OFP2-like [Musa acuminata 
subsp. malaccensis]
Length=371

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  206  SGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFE  385
            S   A+VK+S +P +DFK+SM+EMI EN ++ S+DLEELLACYLSLN  EYH +I+K FE
Sbjct  301  SESFAVVKSSSNPHRDFKDSMLEMIVENNIRASKDLEELLACYLSLNSREYHDVIVKVFE  360

Query  386  QIWFELPHLDL  418
            QIWF+L ++ L
Sbjct  361  QIWFDLTNIKL  371



>ref|XP_009392064.1| PREDICTED: transcription repressor OFP1-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 73/109 (67%), Gaps = 8/109 (7%)
 Frame = +2

Query  89   VSKVTGVRLRGNSSSSSPRIAVRKIRRS-SPR---AEKMELPESGGVAMVKASVDPQKDF  256
            VS + G+++R      SPR+  RK++    P+    ++   P S  + M+K+S +P +DF
Sbjct  208  VSGIHGIKVR----QVSPRVGSRKVQACRKPKVATTQQKRRPVSQSLVMIKSSSNPSRDF  263

Query  257  KesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
             ESM+EMI EN ++ ++DLEELLACYLSLN +EYH +IIK FE IWF L
Sbjct  264  TESMVEMIVENNIREAKDLEELLACYLSLNSKEYHEVIIKVFEHIWFVL  312



>ref|XP_010043070.1| PREDICTED: transcription repressor OFP1-like [Eucalyptus grandis]
 gb|KCW88324.1| hypothetical protein EUGRSUZ_A00713 [Eucalyptus grandis]
Length=358

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 70/109 (64%), Gaps = 9/109 (8%)
 Frame = +2

Query  92   SKVTGVRLRGNSSSSSPRIAVR-----KIRRSSPRAEKMELPESGGVAMVKASVDPQKDF  256
            S+  GV+L+    + SPR+  +       R+SSP             A+VK+S DP +DF
Sbjct  242  SRSPGVKLK----TKSPRLLAKIKLEGHARKSSPAVSLNPTRIGNSFAVVKSSSDPARDF  297

Query  257  KesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            +ESM+EMI EN +K S+DLEELL CYLSLN +EYH +I+  F+QIWF+L
Sbjct  298  RESMVEMIVENNIKASKDLEELLTCYLSLNSDEYHQVIVDVFKQIWFDL  346



>ref|XP_010451932.1| PREDICTED: transcription repressor OFP1-like [Camelina sativa]
Length=262

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 68/110 (62%), Gaps = 0/110 (0%)
 Frame = +2

Query  74   PRKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKD  253
            PRK  VS   GVRLR  S   S R +V     +               A+VKASVDP++D
Sbjct  149  PRKTAVSSPAGVRLRLRSPRVSTRKSVSVSSSARRSGSGSGSSARRSRAVVKASVDPRRD  208

Query  254  FKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            FKESM EMI EN+++ S+DLEELLACYL LN  EYH +II  F+QIW +L
Sbjct  209  FKESMEEMIAENKIRASKDLEELLACYLCLNSNEYHPVIINVFKQIWLDL  258



>ref|XP_009386725.1| PREDICTED: transcription repressor OFP1-like [Musa acuminata 
subsp. malaccensis]
Length=361

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 69/104 (66%), Gaps = 8/104 (8%)
 Frame = +2

Query  131  SSSPRIAVRKIR-----RSSPRAEKMELPESG---GVAMVKASVDPQKDFKesmmemiee  286
            ++SPR+A +K++     R         L   G     A+VK+S DP +DF++SM+EMI E
Sbjct  239  ANSPRLARKKVQAQLGQRCGGTEAAAALERKGFLESFAVVKSSSDPGRDFRDSMVEMIVE  298

Query  287  nemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            N ++ S+DLEELLACYL LN  EYH +I+KAFEQIWF+L  + L
Sbjct  299  NNIRASKDLEELLACYLLLNSNEYHDVIVKAFEQIWFDLAEVKL  342



>ref|XP_004173780.1| PREDICTED: uncharacterized protein LOC101230017 [Cucumis sativus]
Length=87

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A++K+S DPQKDF+ESM+EMI EN ++ S++LE+LLACYL LN +EYH LIIK F+QIWF
Sbjct  18   AIMKSSYDPQKDFRESMVEMIVENNIRSSKELEDLLACYLCLNADEYHDLIIKVFKQIWF  77

Query  398  EL  403
            +L
Sbjct  78   DL  79



>ref|XP_008808317.1| PREDICTED: transcription repressor OFP2-like [Phoenix dactylifera]
Length=368

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  236  VDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLD  415
            +DP++DF+ESM+EMI EN ++ S+DLEELLACYLSLN +EYH +II+ FEQIWF+LPH+ 
Sbjct  308  LDPRRDFRESMVEMIVENNLRASKDLEELLACYLSLNSKEYHDVIIEVFEQIWFDLPHIR  367

Query  416  L  418
            L
Sbjct  368  L  368



>ref|XP_010490501.1| PREDICTED: transcription repressor OFP1-like [Camelina sativa]
Length=258

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 72/109 (66%), Gaps = 4/109 (4%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDF  256
            RK  VS   GVRLR  S    PR++ RK    S  A +         A+VKASVDP+KDF
Sbjct  150  RKTAVSSPAGVRLRLRS----PRVSTRKSVSVSSSARRSGSSARRSRAVVKASVDPRKDF  205

Query  257  KesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            KESM EMIEEN+++ S+DLEELLACYL LN  EYH +II  F+QIW +L
Sbjct  206  KESMEEMIEENKIRASKDLEELLACYLCLNSNEYHPVIINVFKQIWLDL  254



>ref|XP_010558403.1| PREDICTED: LOW QUALITY PROTEIN: transcription repressor OFP1-like 
[Tarenaya hassleriana]
Length=270

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 66/100 (66%), Gaps = 17/100 (17%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemie  283
            GVRLR     SSPR++V     +S              A+VKASV+P++DFKESM+EMI 
Sbjct  185  GVRLR----LSSPRVSVSXAGITS-------------TAVVKASVNPRRDFKESMVEMIA  227

Query  284  enemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EN ++ S DLEELLACYL LN +EYH +II  F+QIW +L
Sbjct  228  ENNIRASEDLEELLACYLCLNSDEYHQVIISVFKQIWIDL  267



>ref|XP_002862819.1| hypothetical protein ARALYDRAFT_497281 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39077.1| hypothetical protein ARALYDRAFT_497281 [Arabidopsis lyrata subsp. 
lyrata]
Length=319

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A++K S+DP+KDF+ESM+EMIEEN ++ S+DLE+LLACYLSLNP+EYH LII  FEQI
Sbjct  255  SFAVMKRSLDPKKDFRESMIEMIEENNIRASKDLEDLLACYLSLNPKEYHDLIIHVFEQI  314

Query  392  WFEL  403
            W +L
Sbjct  315  WLQL  318



>ref|XP_002879263.1| hypothetical protein ARALYDRAFT_481952 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55522.1| hypothetical protein ARALYDRAFT_481952 [Arabidopsis lyrata subsp. 
lyrata]
Length=319

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A++K S+DP+KDF+ESM+EMIEEN ++ S+DLE+LLACYLSLNP+EYH LII  FEQI
Sbjct  255  SFAVMKRSLDPKKDFRESMIEMIEENNIRASKDLEDLLACYLSLNPKEYHDLIIHVFEQI  314

Query  392  WFEL  403
            W +L
Sbjct  315  WLQL  318



>ref|XP_004961753.1| PREDICTED: uncharacterized protein LOC101777258 [Setaria italica]
Length=363

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 73/119 (61%), Gaps = 13/119 (11%)
 Frame = +2

Query  74   PRKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRS-------SPRAEKMELPE--SGGVAMV  226
            PR+P VS    +R R NS    PR+A  + R+S       SPR      P   +   A+V
Sbjct  243  PRRPSVSAGRRLRTRVNS----PRLASARSRKSKPTTPAASPRKTTTPAPPPLAESFAVV  298

Query  227  KASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            KAS DP++DF+ESM EMI E  ++ + DLE+LLACYL+LN  E+H LI++ FEQIW  L
Sbjct  299  KASADPRRDFRESMEEMIAEKGIRDAADLEDLLACYLALNAAEHHDLIVEVFEQIWASL  357



>ref|XP_010937994.1| PREDICTED: transcription repressor OFP3-like [Elaeis guineensis]
Length=360

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  221  MVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFE  400
            +VK+S+DP++DF+ESM+EMI EN ++ S+DLEELLACYLSLN +E+H +II+ FEQIWFE
Sbjct  295  VVKSSLDPRRDFRESMVEMIIENNLRASKDLEELLACYLSLNSKEHHDIIIQVFEQIWFE  354

Query  401  LPHLDL  418
            L  + L
Sbjct  355  LSDIRL  360



>ref|XP_010424000.1| PREDICTED: transcription repressor OFP1-like [Camelina sativa]
Length=262

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDF  256
            RK  VS   GVRLR  S   S R +V     +               A+VKASVDP++DF
Sbjct  150  RKTAVSSPAGVRLRLRSPRVSTRKSVSVSSSARRSGSGSGSSARRSRAVVKASVDPRRDF  209

Query  257  KesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            KESM EMI EN+++ S+DLEELLACYL LN  EYH +II  F+QIW +L
Sbjct  210  KESMEEMIAENKIRASKDLEELLACYLCLNSNEYHPVIINVFKQIWLDL  258



>ref|XP_010099393.1| hypothetical protein L484_007756 [Morus notabilis]
 gb|EXB78238.1| hypothetical protein L484_007756 [Morus notabilis]
Length=274

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+S DPQKDFK+SM+EMI E +M    +LEELLACYL+LN +EYH +IIK F Q+WF
Sbjct  196  AVVKSSFDPQKDFKDSMVEMIVEKKMSKPEELEELLACYLTLNSDEYHDMIIKVFRQVWF  255

Query  398  EL  403
            EL
Sbjct  256  EL  257



>ref|NP_200644.1| ovate family protein 3 [Arabidopsis thaliana]
 sp|Q9LVL4.1|OFP3_ARATH RecName: Full=Transcription repressor OFP3; AltName: Full=Ovate 
family protein 3; Short=AtOFP3 [Arabidopsis thaliana]
 dbj|BAA96927.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAY78869.1| ovate family protein [Arabidopsis thaliana]
 gb|AED97042.1| ovate family protein 3 [Arabidopsis thaliana]
Length=296

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 4/113 (4%)
 Frame = +2

Query  77   RKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGV----AMVKASVDP  244
            ++PP   +T  +L+   + SS      KI R   +    ++ +  GV    A+V +SVDP
Sbjct  176  KEPPFEMMTQQKLKKPKAHSSGIKIPTKIVRKKKKERTSQVSKKKGVVKSFAIVLSSVDP  235

Query  245  QKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            +KDF+ESM+EMI EN+M+  +DLE+LLACYLSLN  EYH +IIKAFE  W  L
Sbjct  236  EKDFRESMVEMIMENKMREQKDLEDLLACYLSLNSSEYHDVIIKAFENTWLHL  288



>ref|XP_002872991.1| hypothetical protein ARALYDRAFT_486884 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49250.1| hypothetical protein ARALYDRAFT_486884 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  221  MVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFE  400
            +VKASVDP++DFKESM EMI EN+++ ++DLEELLACYL LN +EYH +II  F+QIW +
Sbjct  202  VVKASVDPKRDFKESMEEMIAENKIRATKDLEELLACYLCLNSDEYHAIIINVFKQIWLD  261

Query  401  L  403
            L
Sbjct  262  L  262



>ref|XP_010685971.1| PREDICTED: transcription repressor OFP1-like [Beta vulgaris subsp. 
vulgaris]
Length=323

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  215  VAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIW  394
             A++K+S+DPQ+DFK+SMMEMI+EN ++  +DLE+LLACYLSLN +EYH LI+ AFEQIW
Sbjct  260  FAIIKSSIDPQRDFKDSMMEMIQENNIRGFKDLEQLLACYLSLNCKEYHPLIVDAFEQIW  319

Query  395  FEL  403
             +L
Sbjct  320  LDL  322



>emb|CDX97830.1| BnaC04g41090D [Brassica napus]
Length=317

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A++K SVDP+KDF+ESM+EMIEEN ++ S+DLE+LLACYLSLN +EYH LII+ FEQIW 
Sbjct  252  AVMKRSVDPKKDFRESMVEMIEENNIRASKDLEDLLACYLSLNAKEYHDLIIQVFEQIWR  311

Query  398  EL  403
            +L
Sbjct  312  QL  313



>ref|NP_195804.1| ovate family protein 1 [Arabidopsis thaliana]
 sp|Q9LZW2.1|OFP1_ARATH RecName: Full=Transcription repressor OFP1; AltName: Full=Ovate 
family protein 1; Short=AtOFP1 [Arabidopsis thaliana]
 emb|CAB82754.1| putative protein [Arabidopsis thaliana]
 gb|AED90399.1| ovate family protein 1 [Arabidopsis thaliana]
Length=270

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  221  MVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFE  400
            +VKASVDP++DFKESM EMI EN+++ ++DLEELLACYL LN +EYH +II  F+QIW +
Sbjct  202  VVKASVDPKRDFKESMEEMIAENKIRATKDLEELLACYLCLNSDEYHAIIINVFKQIWLD  261

Query  401  L  403
            L
Sbjct  262  L  262



>ref|XP_004172085.1| PREDICTED: uncharacterized protein LOC101229726 [Cucumis sativus]
Length=325

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 66/91 (73%), Gaps = 6/91 (7%)
 Frame = +2

Query  131  SSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRD  310
            SSS R +    RRS  R+       +  +A+VK++ DPQ+DF+ESM+EMI EN++  S +
Sbjct  233  SSSKRFSHVSRRRSGKRSL------NDSLAIVKSTKDPQRDFRESMVEMIVENKISGSNE  286

Query  311  LEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            LE+LLACYLSLN +EYH +I+K F+QIWF++
Sbjct  287  LEDLLACYLSLNTDEYHDIIVKVFKQIWFDM  317



>ref|XP_004137682.1| PREDICTED: uncharacterized protein LOC101203459 [Cucumis sativus]
Length=325

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 66/91 (73%), Gaps = 6/91 (7%)
 Frame = +2

Query  131  SSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRD  310
            SSS R +    RRS  R+       +  +A+VK++ DPQ+DF+ESM+EMI EN++  S +
Sbjct  233  SSSKRFSHVSRRRSGKRSL------NDSLAIVKSTKDPQRDFRESMVEMIVENKISGSNE  286

Query  311  LEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            LE+LLACYLSLN +EYH +I+K F+QIWF++
Sbjct  287  LEDLLACYLSLNTDEYHDIIVKVFKQIWFDM  317



>ref|XP_004309635.1| PREDICTED: uncharacterized protein LOC101311721 [Fragaria vesca 
subsp. vesca]
Length=212

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DPQ+DF++SM+EMI E ++    DLEELLACYL+LN +EYH LIIK F Q+WF
Sbjct  134  AVVKCSFDPQQDFRDSMVEMIVEKKLTRPDDLEELLACYLTLNSDEYHDLIIKVFRQVWF  193

Query  398  ELPH  409
            +L  
Sbjct  194  DLNQ  197



>gb|KGN58701.1| hypothetical protein Csa_3G730160 [Cucumis sativus]
Length=343

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 66/91 (73%), Gaps = 6/91 (7%)
 Frame = +2

Query  131  SSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRD  310
            SSS R +    RRS  R+       +  +A+VK++ DPQ+DF+ESM+EMI EN++  S +
Sbjct  251  SSSKRFSHVSRRRSGKRSL------NDSLAIVKSTKDPQRDFRESMVEMIVENKISGSNE  304

Query  311  LEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            LE+LLACYLSLN +EYH +I+K F+QIWF++
Sbjct  305  LEDLLACYLSLNTDEYHDIIVKVFKQIWFDM  335



>ref|XP_011010911.1| PREDICTED: transcription repressor OFP5-like [Populus euphratica]
Length=439

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A+VK S DPQKDF++SM+EMIEE  +  S +LEELLACYL+LN +EYH LI+K F Q+
Sbjct  359  NFAVVKTSFDPQKDFRDSMIEMIEEKRISRSEELEELLACYLTLNADEYHDLIVKVFRQV  418

Query  392  WFEL  403
            WF+L
Sbjct  419  WFDL  422



>ref|XP_002305721.2| ovate family protein [Populus trichocarpa]
 gb|EEE86232.2| ovate family protein [Populus trichocarpa]
Length=431

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A+VK S DPQKDF++SM+EMIEE  +  S +LEELLACYL+LN +EYH LI+K F Q+
Sbjct  351  NFAVVKTSFDPQKDFRDSMIEMIEEKRISRSEELEELLACYLTLNADEYHDLIVKVFRQV  410

Query  392  WFEL  403
            WF+L
Sbjct  411  WFDL  414



>ref|XP_011033512.1| PREDICTED: transcription repressor OFP5-like [Populus euphratica]
Length=439

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A+VK S DPQKDF++SM+EMIEE  +  S +LEELLACYL+LN +EYH LI+K F Q+
Sbjct  359  NFAVVKTSFDPQKDFRDSMIEMIEEKRISRSEELEELLACYLTLNADEYHDLIVKVFRQV  418

Query  392  WFEL  403
            WF+L
Sbjct  419  WFDL  422



>ref|XP_008371508.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CWC27 homolog 
[Malus domestica]
 ref|XP_008364214.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CWC27 homolog 
[Malus domestica]
Length=401

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DPQKDF++SM+EM+ E ++    DLEELLACYL+LN +EYH LIIK F Q+WF
Sbjct  326  AVVKCSFDPQKDFRDSMVEMVVEKKITQPEDLEELLACYLTLNSDEYHDLIIKVFRQVWF  385

Query  398  EL  403
            +L
Sbjct  386  DL  387



>ref|XP_010088012.1| hypothetical protein L484_004602 [Morus notabilis]
 gb|EXB31128.1| hypothetical protein L484_004602 [Morus notabilis]
Length=382

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+S DPQKDFK+SM+EMI E +M    +LEELLACYL+LN +EYH +IIK F Q+WF
Sbjct  304  AVVKSSFDPQKDFKDSMVEMIVEKKMSKPEELEELLACYLTLNSDEYHDMIIKVFRQVWF  363

Query  398  EL  403
            EL
Sbjct  364  EL  365



>emb|CDY29674.1| BnaA04g17530D [Brassica napus]
Length=324

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A++K SVDP+KDF+ESM+EMIEEN ++ S+DLE+LLACYLSLN +EYH  II+ FEQI
Sbjct  251  SYAVMKRSVDPKKDFRESMVEMIEENNIRASKDLEDLLACYLSLNAKEYHDFIIQVFEQI  310

Query  392  WFEL  403
            W +L
Sbjct  311  WRQL  314



>ref|XP_009141063.1| PREDICTED: transcription repressor OFP2-like [Brassica rapa]
Length=324

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A++K SVDP+KDF+ESM+EMIEEN+++ S+DLE+LLACYLSLN +EYH  II+ FEQI
Sbjct  251  SYAVMKRSVDPKKDFRESMVEMIEENKIRASKDLEDLLACYLSLNAKEYHDFIIQVFEQI  310

Query  392  WFEL  403
            W +L
Sbjct  311  WRQL  314



>ref|XP_002522269.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40127.1| conserved hypothetical protein [Ricinus communis]
Length=417

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DPQKDF++SM+EMI+E  +  S +LEELLACYL+LN +EYH LII+ F Q+WF
Sbjct  348  AVVKCSYDPQKDFRDSMVEMIKEQNISRSEELEELLACYLTLNSDEYHDLIIRVFRQVWF  407

Query  398  ELPH  409
            +L  
Sbjct  408  DLNQ  411



>ref|XP_004163359.1| PREDICTED: uncharacterized protein LOC101232237 [Cucumis sativus]
Length=441

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+S DPQ+DF++SM+EMI E  +  + +LEELLACYL+LN ++YH LIIK F Q+WF
Sbjct  360  AVVKSSFDPQQDFRDSMVEMIMERRISKAEELEELLACYLTLNSDQYHDLIIKVFRQVWF  419

Query  398  ELPHLDL*V*LKSPFIFNLHLV  463
            +L    L   L   F  N  LV
Sbjct  420  DLNQAALESELHKQFPCNEQLV  441



>emb|CDP06399.1| unnamed protein product [Coffea canephora]
Length=459

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+S DPQ DF+ESMMEMI EN +  S+DLE+LLACYLSLN ++YH LII+ F+QIWF
Sbjct  391  AVVKSSKDPQSDFRESMMEMIVENNICASKDLEDLLACYLSLNSDQYHDLIIRVFKQIWF  450

Query  398  ELPHL  412
            ++  L
Sbjct  451  DIVDL  455



>ref|XP_004486277.1| PREDICTED: protein Shroom4-like [Cicer arietinum]
Length=369

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 72/106 (68%), Gaps = 6/106 (6%)
 Frame = +2

Query  89   VSKVTGVRLRG-NSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKes  265
            VSK+   R++      +  ++ ++K+ R     E++  PE    A++K S++P++DF++S
Sbjct  252  VSKIEICRIKALEEMRNKAKLKMKKLER-----EEIGKPELDSFAVIKCSLNPKQDFRDS  306

Query  266  mmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            M+EMIEE  +K   ++EELLACYL+LN +EYH LIIK F Q+WFE+
Sbjct  307  MIEMIEEKGIKKPEEMEELLACYLTLNADEYHDLIIKVFRQVWFEM  352



>emb|CBI30728.3| unnamed protein product [Vitis vinifera]
Length=195

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A+VK+S+DPQKDF++SM+EMI E  +    +LEELLACYL+LN +EYH LIIK F Q+
Sbjct  116  SFAVVKSSLDPQKDFRDSMIEMIMEKGISQPEELEELLACYLTLNSDEYHDLIIKVFRQV  175

Query  392  WFEL  403
            WF L
Sbjct  176  WFGL  179



>gb|KGN49331.1| hypothetical protein Csa_6G520290 [Cucumis sativus]
Length=468

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+S DPQ+DF++SM+EMI E  +  + +LEELLACYL+LN ++YH LIIK F Q+WF
Sbjct  387  AVVKSSFDPQQDFRDSMVEMIMERRISKAEELEELLACYLTLNSDQYHDLIIKVFRQVWF  446

Query  398  ELPHLDL*V*LKSPFIFNLHLV  463
            +L    L   L   F  N  LV
Sbjct  447  DLNQAALESELHKQFPCNEQLV  468



>ref|XP_008439714.1| PREDICTED: uncharacterized protein LOC103484429 [Cucumis melo]
Length=468

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+S DPQ+DF++SM+EMI E  +  + +LEELLACYL+LN ++YH LIIK F Q+WF
Sbjct  387  AVVKSSFDPQQDFRDSMVEMIMERRISKAEELEELLACYLTLNSDQYHDLIIKVFRQVWF  446

Query  398  ELPHLDL*V*LKSPFIFNLHLV  463
            +L    L   L   F  N  LV
Sbjct  447  DLNQAALESELHKQFPCNEQLV  468



>ref|XP_006449556.1| hypothetical protein CICLE_v10017829mg [Citrus clementina]
 gb|ESR62796.1| hypothetical protein CICLE_v10017829mg [Citrus clementina]
Length=334

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DPQKDF++SM+EMI E      ++LEELLACYL+LN +EYH LIIK F Q+WF
Sbjct  257  AVVKCSFDPQKDFRDSMIEMILEKRFSQPQELEELLACYLTLNSDEYHDLIIKVFRQVWF  316

Query  398  ELPH  409
            +L  
Sbjct  317  DLNQ  320



>ref|XP_009419680.1| PREDICTED: transcription repressor OFP4-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 64/92 (70%), Gaps = 6/92 (7%)
 Frame = +2

Query  137  SPRIA---VRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSR  307
            +PR+A     + R+SS +  K  L   G + +VK+S DPQ+DF+ESM+EMI  N ++  +
Sbjct  182  TPRLAGLQAYRNRKSSVQQSKALL---GSLVVVKSSSDPQRDFRESMVEMIIGNNIRSPK  238

Query  308  DLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            ++EELLACYLSLN  +YH LI+K F+QIW E 
Sbjct  239  EMEELLACYLSLNSWKYHSLIVKEFQQIWLEF  270



>ref|XP_006358138.1| PREDICTED: caldesmon-like [Solanum tuberosum]
Length=491

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 70/119 (59%), Gaps = 4/119 (3%)
 Frame = +2

Query  62   VDFRPRKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVD  241
            +  R   P  +K+   R++        R+  R   + S R ++         A++K+S D
Sbjct  284  IKVRAYSPRTAKME-CRIKALEDMKKARMKTRHETKESFRGDRTVFD---SYAIMKSSFD  339

Query  242  PQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            P  DF++SM+EMI +  +K S +LEELLACYL+LN +EYH +IIK F Q+WFEL  +++
Sbjct  340  PFSDFRDSMIEMITQRGIKSSEELEELLACYLTLNCDEYHDIIIKVFRQVWFELNQVNI  398



>ref|XP_007213877.1| hypothetical protein PRUPE_ppa006822mg [Prunus persica]
 gb|EMJ15076.1| hypothetical protein PRUPE_ppa006822mg [Prunus persica]
Length=394

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DPQ+DF++SM+EMI E ++    DLEELLACYL+LN +EYH LI+K F Q+WF
Sbjct  316  AVVKCSFDPQQDFRDSMVEMIVEKKITQPEDLEELLACYLTLNSDEYHDLIVKVFRQVWF  375

Query  398  ELPH  409
            +L  
Sbjct  376  DLNQ  379



>gb|KDO77935.1| hypothetical protein CISIN_1g040838mg [Citrus sinensis]
Length=430

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DPQKDF++SM+EMI E      ++LEELLACYL+LN +EYH LIIK F Q+WF
Sbjct  353  AVVKCSFDPQKDFRDSMIEMILEKRFSQPQELEELLACYLTLNSDEYHDLIIKVFRQVWF  412

Query  398  ELPH  409
            +L  
Sbjct  413  DLNQ  416



>ref|XP_008442333.1| PREDICTED: uncharacterized protein LOC103486236 [Cucumis melo]
Length=380

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +2

Query  134  SSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDL  313
            +SPR++  K      R +  +   +  +A+VK++ DPQ+DF+ESMMEMI EN++  S +L
Sbjct  283  NSPRVSSSKRFGHVGRRKSGKRSLNDSLAIVKSTEDPQRDFRESMMEMIVENKISGSSEL  342

Query  314  EELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            E+LLACYLSLN +EYH +I+K F+QIWF++
Sbjct  343  EDLLACYLSLNTDEYHDIIVKVFKQIWFDM  372



>ref|XP_010242153.1| PREDICTED: transcription repressor OFP3-like [Nelumbo nucifera]
Length=484

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 9/114 (8%)
 Frame = +2

Query  74   PRKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESG--GVAMVKASVDPQ  247
            PR P  SKV   ++R     +   +   K+R  + + E+     +G    A+ K S DPQ
Sbjct  373  PRTP--SKVEACKIR-----ALEEMKKTKLREKTKKKERGVEGRTGLENFAVAKCSFDPQ  425

Query  248  KDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPH  409
            KDF+ESMMEMI EN+M+   +LE LLACYLSLN +EYH LIIK F Q+WFEL  
Sbjct  426  KDFRESMMEMIVENQMRRPEELENLLACYLSLNSDEYHDLIIKVFRQVWFELKQ  479



>ref|NP_001136474.1| uncharacterized protein LOC100216587 [Zea mays]
 gb|ACF82004.1| unknown [Zea mays]
 gb|AFW78377.1| hypothetical protein ZEAMMB73_391666 [Zea mays]
 gb|AIB05284.1| OFP transcription factor, partial [Zea mays]
Length=366

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 78/127 (61%), Gaps = 14/127 (11%)
 Frame = +2

Query  53   EESVDFRPRKPPVSKVTGVRLRGNSSSSSPRIAVRKIRR--------SSPRAEKMELPE-  205
            E+     PR+  VS   G RLR  +  SSPR+A  + R+        +SPR  +   P  
Sbjct  229  EQGSKGHPRRSSVS--VGRRLR--TRVSSPRLASARSRKNSKPTSAGASPRKTRPAPPPP  284

Query  206  -SGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAF  382
             +   A+VK+S DP++DF+ESM EMI E  ++ + DLE+LLACYL+LN +E+H LI++ F
Sbjct  285  LAESFAVVKSSADPRRDFRESMEEMIAEKGIRGAADLEDLLACYLALNADEHHDLIVEVF  344

Query  383  EQIWFEL  403
            E+IW  L
Sbjct  345  EEIWASL  351



>ref|XP_010317346.1| PREDICTED: transcription repressor OFP5 [Solanum lycopersicum]
Length=377

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A++K+S DP  DF++SM+EMI +  +K S +LEELLACYL+LN +EYH +IIK F Q+WF
Sbjct  299  AIMKSSFDPFSDFRDSMIEMITQRGIKSSEELEELLACYLTLNCDEYHDIIIKVFRQVWF  358

Query  398  ELPHLDL  418
            EL  +++
Sbjct  359  ELNQINI  365



>ref|XP_009352720.1| PREDICTED: transcription repressor OFP5-like [Pyrus x bretschneideri]
Length=397

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DPQKDF++SM+EMI E ++    DLEELLACYL+LN +EYH LIIK F Q+WF
Sbjct  319  AVVKCSFDPQKDFRDSMVEMIVEKKITQPEDLEELLACYLTLNSDEYHDLIIKVFRQVWF  378

Query  398  EL  403
             +
Sbjct  379  GM  380



>gb|KCW76063.1| hypothetical protein EUGRSUZ_D00431, partial [Eucalyptus grandis]
Length=344

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S  PQ+DF+ESMMEMI E  ++ + D+EELLACYL+LN +E+H LIIK F Q+WF
Sbjct  276  AVVKCSYHPQRDFRESMMEMIVERRIRRTEDMEELLACYLTLNSDEHHELIIKVFRQVWF  335

Query  398  EL  403
            EL
Sbjct  336  EL  337



>ref|XP_010052159.1| PREDICTED: transcription repressor OFP5 [Eucalyptus grandis]
Length=384

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S  PQ+DF+ESMMEMI E  ++ + D+EELLACYL+LN +E+H LIIK F Q+WF
Sbjct  316  AVVKCSYHPQRDFRESMMEMIVERRIRRTEDMEELLACYLTLNSDEHHELIIKVFRQVWF  375

Query  398  EL  403
            EL
Sbjct  376  EL  377



>ref|XP_011085317.1| PREDICTED: uncharacterized protein LOC105167340 [Sesamum indicum]
Length=412

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 4/79 (5%)
 Frame = +2

Query  179  RAEKMELPES----GGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLN  346
            R E++E+ E        A+VK+S DPQ+DF++SM+EMI    +    DLEELLACYL+LN
Sbjct  324  RKEQLEVVEGKTMFDSFAVVKSSNDPQQDFRDSMVEMIRAKGIDRPEDLEELLACYLTLN  383

Query  347  PEEYHHLIIKAFEQIWFEL  403
             +EYH LIIK F Q+W EL
Sbjct  384  HDEYHDLIIKVFRQVWIEL  402



>ref|XP_009414262.1| PREDICTED: transcription repressor OFP1-like [Musa acuminata 
subsp. malaccensis]
Length=278

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (61%), Gaps = 11/112 (10%)
 Frame = +2

Query  89   VSKVTGVRLRGNSSSSSPRIAVRKI---RRSSPRAEKMELPE----SGGVAMVKASVDPQ  247
            VS V G+++R NS    PR+  RK    R  +  A +  +      S    ++K+S  P 
Sbjct  166  VSGVHGIKVRQNS----PRVGSRKAQAGRNHNAAASEATMRRRALLSENFVVIKSSSSPM  221

Query  248  KDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            +DF ESMMEMI EN ++  +DLEELLACYL LN +EYH +IIK FE IWF L
Sbjct  222  RDFMESMMEMIVENNIREPKDLEELLACYLFLNSKEYHEVIIKVFEHIWFAL  273



>ref|XP_002265116.1| PREDICTED: transcription repressor OFP5 [Vitis vinifera]
Length=444

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+S+DPQKDF++SM+EMI E  +    +LEELLACYL+LN +EYH LIIK F Q+WF
Sbjct  367  AVVKSSLDPQKDFRDSMIEMIMEKGISQPEELEELLACYLTLNSDEYHDLIIKVFRQVWF  426

Query  398  EL  403
             L
Sbjct  427  GL  428



>ref|XP_008792401.1| PREDICTED: transcription repressor OFP5-like [Phoenix dactylifera]
Length=370

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = +2

Query  131  SSSPRIAVRKIRRSSPRAEKMELPESG--GVAMVKASVDPQKDFKesmmemieenemKCS  304
            S++ R+ V +I+ ++ R       ++G  G A+VK S DPQKDF+ESM+EMI E  +   
Sbjct  266  SAASRVEVGRIKAATARRRVEAEEKTGLEGFAVVKCSCDPQKDFRESMVEMIWEKGIGRP  325

Query  305  RDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
             +LE LLACYLSLN +E+H +I+K F Q+WF+L
Sbjct  326  EELESLLACYLSLNSDEHHDVIVKVFRQVWFDL  358



>ref|XP_008383592.1| PREDICTED: uncharacterized protein LOC103446287 [Malus domestica]
Length=396

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S +PQKDF++SM+EMI E ++    DLEELLACYL+LN  EYH LIIK F Q+WF
Sbjct  318  AVVKCSFEPQKDFRDSMVEMIVEKKITQPEDLEELLACYLTLNSNEYHDLIIKVFRQVWF  377

Query  398  EL  403
            ++
Sbjct  378  DM  379



>ref|XP_010248390.1| PREDICTED: transcription repressor OFP5-like [Nelumbo nucifera]
Length=457

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A+ K S+DPQKDF+ESM+EMI +N M+   +LE LLACYLSLN +EYH LI+K F Q+
Sbjct  380  SFAVAKCSLDPQKDFRESMVEMIVQNHMRQPEELENLLACYLSLNSDEYHDLIVKVFRQV  439

Query  392  WFELPHL  412
            WF++   
Sbjct  440  WFDMSQF  446



>ref|XP_009389676.1| PREDICTED: transcription repressor OFP1-like [Musa acuminata 
subsp. malaccensis]
Length=276

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 64/94 (68%), Gaps = 7/94 (7%)
 Frame = +2

Query  158  KIRRSSPRAE---KMELPESGGVA----MVKASVDPQKDFKesmmemieenemKCSRDLE  316
            +I ++SPR E   KM + +   V+    ++K+S +P++DF +SM+EMI EN +   +DLE
Sbjct  183  RIGQNSPRVESRRKMAMRQRRAVSESLVIIKSSSNPRRDFTKSMVEMIVENNLHELKDLE  242

Query  317  ELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            ELLACYLSLN +EYH  IIK FE +WF L  L +
Sbjct  243  ELLACYLSLNSKEYHEDIIKVFEHVWFALTDLRM  276



>ref|XP_003593824.1| hypothetical protein MTR_2g018030 [Medicago truncatula]
 gb|AES64075.1| ovate transcriptional repressor [Medicago truncatula]
Length=357

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  200  PESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKA  379
            PE    A++K S +P++DF++SM+EMIEE ++  + ++EELLACYL+LN +EYH LIIK 
Sbjct  274  PELDSFAVIKCSSNPKQDFRDSMIEMIEEKQISKAEEMEELLACYLTLNADEYHDLIIKV  333

Query  380  FEQIWFELPHLDL*V  424
            F Q+WF++    L V
Sbjct  334  FRQVWFDISQYGLGV  348



>ref|XP_007025296.1| Ovate family protein 5, putative [Theobroma cacao]
 gb|EOY27918.1| Ovate family protein 5, putative [Theobroma cacao]
Length=438

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              AMVK S DP+KDF++SM+EMI E  +    +LEELLACYL+LN + YH LIIK F+Q+
Sbjct  358  NFAMVKCSFDPEKDFRDSMVEMIMEKRISQPEELEELLACYLTLNSDAYHDLIIKVFQQV  417

Query  392  WFELPH  409
            W +L  
Sbjct  418  WLDLDQ  423



>ref|XP_002458691.1| hypothetical protein SORBIDRAFT_03g038320 [Sorghum bicolor]
 gb|EES03811.1| hypothetical protein SORBIDRAFT_03g038320 [Sorghum bicolor]
Length=165

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+S DP++DF+ESM EMI EN ++ + DLE+LLACYLSLN  EYH LI++ FE IW 
Sbjct  99   AVVKSSRDPRRDFRESMEEMITENGIRTAADLEDLLACYLSLNAAEYHDLIVEVFEHIWV  158

Query  398  EL  403
             L
Sbjct  159  TL  160



>ref|XP_009416721.1| PREDICTED: uncharacterized protein LOC103997277 [Musa acuminata 
subsp. malaccensis]
Length=322

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 8/121 (7%)
 Frame = +2

Query  65   DFRPRKPPVSKVTGVRLRGNSSSSSPRIA------VRKIRRSSPRAEKMELPESG--GVA  220
            D R   P  S    +R R      SPR A      V ++R +S R  + E+   G    A
Sbjct  189  DARDGLPRRSFTGKIRHRAKVRVRSPRTAAVRAEEVERMRAASRRKREEEVARRGLERFA  248

Query  221  MVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFE  400
            +VK S DPQ DF+ESM+EMI E  +    ++E LLACYL+LN +E+H +I+K F Q+WFE
Sbjct  249  VVKCSSDPQTDFRESMVEMICEKGLGRPEEMESLLACYLALNSDEHHDVIVKVFRQVWFE  308

Query  401  L  403
            L
Sbjct  309  L  309



>ref|XP_010665684.1| PREDICTED: transcription repressor OFP5 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  209  GGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQ  388
            G  A+VK++ +PQ+DF++SM EMI E  ++   +LEELLACYL+LN +EYH LIIKAF Q
Sbjct  318  GSFAVVKSTRNPQQDFRDSMFEMIMEKRIRKPEELEELLACYLTLNADEYHGLIIKAFRQ  377

Query  389  IWFEL  403
            +W EL
Sbjct  378  VWREL  382



>ref|XP_004970397.1| PREDICTED: uncharacterized protein LOC101773811 [Setaria italica]
Length=364

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 72/123 (59%), Gaps = 14/123 (11%)
 Frame = +2

Query  56   ESVDFRPRKPPVSKVTGVRLRGNSSSSSPRIAVRK-------IRRSSPRAEKMELPESGG  214
            E    +PR+  VS    ++ R N+    PRIA  K         RS  R +   L ES  
Sbjct  244  EQSKLKPRRS-VSSARRLKTRANT----PRIASSKKCKPPAATPRSPARTKPPPLAES--  296

Query  215  VAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIW  394
             A+VK S DP++DF+ESM EMI EN ++ + DLE+LLACYL+LN  EYH LI++ FE IW
Sbjct  297  FAVVKTSRDPRRDFRESMEEMIAENGIRTAADLEDLLACYLALNAAEYHDLIVEVFEHIW  356

Query  395  FEL  403
              L
Sbjct  357  VTL  359



>gb|KDP21145.1| hypothetical protein JCGZ_21616 [Jatropha curcas]
Length=409

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S +PQKDF++SM+EMI+E  +    +LEELLACYL+LN +EYH LII+ F Q+WF
Sbjct  335  AVVKCSYNPQKDFRDSMIEMIKEQRISRPEELEELLACYLTLNSDEYHDLIIRVFRQVWF  394

Query  398  ELPH  409
            +L  
Sbjct  395  DLNQ  398



>ref|XP_008225255.1| PREDICTED: uncharacterized protein LOC103324921 [Prunus mume]
Length=415

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DP +DF++SM+EMI E ++    DLEELLACYL+LN +EYH LI+K F Q+WF
Sbjct  337  AVVKCSFDPPQDFRDSMVEMIVEKKITQPEDLEELLACYLTLNSDEYHDLIVKVFRQVWF  396

Query  398  EL  403
            +L
Sbjct  397  DL  398



>gb|EMS50273.1| hypothetical protein TRIUR3_18530 [Triticum urartu]
Length=229

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  200  PESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKA  379
            P +   A+VK S DP++DF+ESM EMI EN ++ + DLE+LLACYLSLN  EYH LI+  
Sbjct  157  PLAESFAVVKTSRDPRRDFRESMEEMIAENGIRTAADLEDLLACYLSLNAAEYHDLIVDV  216

Query  380  FEQIWFELPHLDL  418
            FE IW  L  + +
Sbjct  217  FEHIWAGLADISM  229



>ref|XP_003567233.1| PREDICTED: transcription repressor OFP2-like [Brachypodium distachyon]
Length=357

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 72/126 (57%), Gaps = 7/126 (6%)
 Frame = +2

Query  53   EESVDFRPRKPPVSKVTGVRLRGN----SSSSSPRIAVRKIRRSSPRAEKMELPESGGVA  220
            ++ VD +PR+   S    ++ R N    S  SS R        + P+A+    P +   A
Sbjct  235  DKHVDIKPRRSVSSSARRLKTRANTPRVSKKSSSRPPAPATTNTKPQAQP---PLAESFA  291

Query  221  MVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFE  400
            +VK S DP++DF+ESM EMI EN +  + DLE+LLACYLSLN  EYH LI+  FE IW  
Sbjct  292  VVKTSRDPRRDFRESMEEMIAENGICTAADLEDLLACYLSLNAAEYHDLIVDVFEHIWAS  351

Query  401  LPHLDL  418
            L  + L
Sbjct  352  LADIKL  357



>ref|XP_002439957.1| hypothetical protein SORBIDRAFT_09g023390 [Sorghum bicolor]
 gb|EES18387.1| hypothetical protein SORBIDRAFT_09g023390 [Sorghum bicolor]
Length=377

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 74/126 (59%), Gaps = 20/126 (16%)
 Frame = +2

Query  74   PRKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRS------------SPRAEKME----LPE  205
            PR+P VS   G RLR  +  +SPR+A    R S            SPR +        P 
Sbjct  249  PRRPSVS--VGRRLR--TRVNSPRLASTTTRSSRKSISKPTTPGASPRRKTTTPAPPAPL  304

Query  206  SGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFE  385
            +   A+VK+S +P++DF+ESM EMI E  ++ + DLE+LLACYL+LN  E+H LI++ FE
Sbjct  305  AESFAVVKSSANPRRDFRESMEEMIAEKGIRDAADLEDLLACYLALNAAEHHDLIVEVFE  364

Query  386  QIWFEL  403
            +IW  L
Sbjct  365  EIWSSL  370



>emb|CDM84783.1| unnamed protein product [Triticum aestivum]
Length=362

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 74/125 (59%), Gaps = 8/125 (6%)
 Frame = +2

Query  53   EESVDFRPRKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRS---SPRAEKMELPESGGVAM  223
            E+S   +PR+   S    ++ RGN+    PR+A  K  +    SP  EK   P +   A+
Sbjct  243  EQSKAAKPRRSVSSSARRLKTRGNT----PRVASCKKSKPPAPSPAREKTP-PLAESFAV  297

Query  224  VKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            VK S DP++DF+ESM EMI EN +  + DLE+LLACYLSLN  EYH LI+  FE IW  L
Sbjct  298  VKTSRDPRRDFRESMEEMIAENGICTAADLEDLLACYLSLNAAEYHDLIVDVFEHIWAGL  357

Query  404  PHLDL  418
              + +
Sbjct  358  ADISM  362



>ref|XP_008657114.1| PREDICTED: uncharacterized protein LOC103636549 [Zea mays]
 gb|AFW84734.1| hypothetical protein ZEAMMB73_342616 [Zea mays]
 gb|AIB05555.1| OFP transcription factor, partial [Zea mays]
Length=361

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +2

Query  200  PESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKA  379
            P +   A+VK+S DP++DF+ESM EMI EN ++ + DLE+LLACYLSLN  EYH LI++ 
Sbjct  289  PLAKSFAVVKSSRDPRRDFRESMEEMIAENGIRAAADLEDLLACYLSLNAAEYHDLIVEV  348

Query  380  FEQIWFEL  403
            FE IW  L
Sbjct  349  FEHIWVTL  356



>ref|XP_009369931.1| PREDICTED: transcription repressor OFP8 [Pyrus x bretschneideri]
Length=187

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 7/105 (7%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPE----SGGVAMVKASVDPQKDFKesm  268
            T V    +SS S P      +  ++P+  K+  P     SG +A+VK S DP +DF++SM
Sbjct  76   TTVSFNNSSSQSKP---FDSVESTNPKNTKISSPNTTKTSGSIAVVKESNDPYQDFRQSM  132

Query  269  memieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            ++MI E ++    DL+ELL C+L LN   +H +II+AF QIW +L
Sbjct  133  LQMIVEKQIYWKEDLQELLRCFLELNSPSHHDVIIRAFTQIWNDL  177



>ref|XP_010917398.1| PREDICTED: transcription repressor OFP5-like [Elaeis guineensis]
Length=366

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +2

Query  179  RAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEY  358
            RAE  E       A+VK S DPQKDF+ESM+EMI E  +    +LE LLACYLSLN +E+
Sbjct  280  RAEAEEKKGLESFAVVKCSCDPQKDFRESMVEMIWEKRIGRPEELESLLACYLSLNSDEH  339

Query  359  HHLIIKAFEQIWFEL  403
            H +I+K F Q+WF+L
Sbjct  340  HDVIVKVFRQVWFDL  354



>ref|XP_009406773.1| PREDICTED: transcription repressor OFP1-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 4/93 (4%)
 Frame = +2

Query  137  SPRIAVRK--IRRSSPRAEKMELPESG--GVAMVKASVDPQKDFKesmmemieenemKCS  304
            SPR A  K  + R    A + E    G    A+VK S DPQ+DF+ESM+EMI +  +   
Sbjct  213  SPRAAAAKAEVERIKAAARRAEGKRKGLERFAVVKCSRDPQRDFRESMVEMIRQKGIGRP  272

Query  305  RDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
             ++E LLACYLSLN +E+H +I+K F Q+WFEL
Sbjct  273  EEMESLLACYLSLNSDEHHDVIVKVFRQVWFEL  305



>ref|XP_006644925.1| PREDICTED: uncharacterized protein LOC102709788 [Oryza brachyantha]
Length=369

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 72/118 (61%), Gaps = 7/118 (6%)
 Frame = +2

Query  80   KPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRA-----EKMELPESGGVAMVKASVDP  244
            KP  S  +  RL+  + +++PRI  +K +  +  A        + P +   A+VK+S DP
Sbjct  254  KPRRSASSARRLK--TRANTPRIVAKKSKPPAAAARSPAPTTTKPPLAESFAVVKSSRDP  311

Query  245  QKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHLDL  418
            ++DF+ESM EMI EN ++ + DLE+LLACYLSLN  EYH LI+  FE IW  L  + +
Sbjct  312  RRDFRESMEEMIAENGIRTAADLEDLLACYLSLNAAEYHDLIVDVFEHIWANLADIKM  369



>ref|XP_010925176.1| PREDICTED: transcription repressor OFP5-like [Elaeis guineensis]
Length=353

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DPQKDF+ESM+EMI E  +    +LE LLACYLSLN +E+H +I+K F Q+WF
Sbjct  280  AVVKCSCDPQKDFRESMVEMIWEKGIGRPEELESLLACYLSLNSDEHHDVIVKVFRQVWF  339

Query  398  EL  403
            +L
Sbjct  340  DL  341



>ref|NP_001044660.2| Os01g0823500 [Oryza sativa Japonica Group]
 dbj|BAD87078.1| ovate family protein-like [Oryza sativa Japonica Group]
 gb|EAZ13984.1| hypothetical protein OsJ_03909 [Oryza sativa Japonica Group]
 dbj|BAG89044.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06574.2| Os01g0823500 [Oryza sativa Japonica Group]
Length=379

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  200  PESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKA  379
            P +   A+VK+S DP++DF+ESM EMI EN ++ + DLE+LLACYLSLN  EYH LI+  
Sbjct  307  PLAESFAVVKSSRDPRRDFRESMEEMIAENGIRTAADLEDLLACYLSLNAAEYHDLIVDV  366

Query  380  FEQIWFELPHLDL  418
            FE IW  L  + +
Sbjct  367  FEHIWANLADIKM  379



>gb|EAY76320.1| hypothetical protein OsI_04254 [Oryza sativa Indica Group]
Length=379

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  200  PESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKA  379
            P +   A+VK+S DP++DF+ESM EMI EN ++ + DLE+LLACYLSLN  EYH LI+  
Sbjct  307  PLAESFAVVKSSRDPRRDFRESMEEMIAENGIRTAADLEDLLACYLSLNAAEYHDLIVDV  366

Query  380  FEQIWFELPHLDL  418
            FE IW  L  + +
Sbjct  367  FEHIWANLADIKM  379



>gb|EPS73962.1| hypothetical protein M569_00800, partial [Genlisea aurea]
Length=91

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 62/100 (62%), Gaps = 9/100 (9%)
 Frame = +2

Query  104  GVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemie  283
            GV+LR      SPRI  R    ++ R        +    +VK+S DP++DF++SM+EMI 
Sbjct  1    GVKLR------SPRIGTRM---AASRKNACRRGVAQSFPVVKSSRDPRRDFRDSMVEMIL  51

Query  284  enemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EN +  S++ EELLA YL+LN +EYH LII  F+QIW + 
Sbjct  52   ENNLSESKEFEELLASYLALNSDEYHELIITVFKQIWIDF  91



>gb|EPS67743.1| hypothetical protein M569_07034, partial [Genlisea aurea]
Length=66

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
            G AMVK+S DP+KDF +SM++MI E +++   ++E LLACYL+LN +EYH +II  F ++
Sbjct  2    GFAMVKSSFDPEKDFWDSMVDMIRERKIQHHDEMERLLACYLTLNGDEYHDMIIDVFRRV  61

Query  392  WFEL  403
            W ++
Sbjct  62   WLQM  65



>ref|XP_008674880.1| PREDICTED: uncharacterized protein LOC103651061 [Zea mays]
 tpg|DAA57052.1| TPA: hypothetical protein ZEAMMB73_810218 [Zea mays]
 gb|AIB05634.1| OFP transcription factor, partial [Zea mays]
Length=368

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +2

Query  56   ESVDFRPRKPPVSKVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKAS  235
            E    RPR+  VS    ++ R N+   +  +  +    ++P  +   L ES   A+VK+S
Sbjct  251  EQGKLRPRRS-VSSARRLKTRANTPRLASSMKCKSPTTATPPTKPPPLAES--FAVVKSS  307

Query  236  VDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
             DP++DF+ESM EMI EN ++ + DLE+LLACYL+LN  EYH LI++ FE IW  L
Sbjct  308  RDPRRDFRESMEEMIVENGIRTATDLEDLLACYLALNAAEYHDLIVEVFEHIWVTL  363



>emb|CDY02814.1| BnaC02g10750D [Brassica napus]
Length=50

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  308  DLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            DLE+LLACYLSLN  EYH +IIKAFE+ WF L HL
Sbjct  15   DLEDLLACYLSLNSSEYHDIIIKAFEKTWFHLSHL  49



>ref|XP_007147996.1| hypothetical protein PHAVU_006G171800g [Phaseolus vulgaris]
 gb|ESW19990.1| hypothetical protein PHAVU_006G171800g [Phaseolus vulgaris]
Length=405

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  194  ELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLII  373
            E+P     A++K+S+DP++DF++SM+EMI EN++    ++E+LLACYL+LN +EYH LII
Sbjct  320  EIPGLESFAVIKSSIDPKQDFRDSMIEMIIENQIIDPEEMEDLLACYLTLNADEYHDLII  379

Query  374  KAFEQIWFEL  403
            K F ++WF++
Sbjct  380  KVFRKVWFDM  389



>emb|CDY32706.1| BnaA02g07680D [Brassica napus]
Length=50

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  308  DLEELLACYLSLNPEEYHHLIIKAFEQIWFELPHL  412
            DLE+LLACYLSLN  EYH +IIKAFE+ WF L HL
Sbjct  15   DLEDLLACYLSLNSSEYHDIIIKAFEKTWFHLTHL  49



>gb|AFW81607.1| plant-specific domain TIGR01568 family protein [Zea mays]
 gb|AIB05264.1| OFP transcription factor, partial [Zea mays]
Length=259

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VKAS DP +DFKESM++MI EN+M    DL+ELL CYLSLN  EYH +I++ F +IW 
Sbjct  190  AVVKASADPLRDFKESMVQMIVENDMSAPEDLQELLECYLSLNSMEYHGVIVEVFREIWL  249

Query  398  ELPH  409
            ++ H
Sbjct  250  QIVH  253



>ref|XP_008777736.1| PREDICTED: transcription repressor OFP5-like [Phoenix dactylifera]
Length=372

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  215  VAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIW  394
             A+VK S DPQKDF+ESM+EMI E  +    +LE LLACYLSLN +E+H +I+K F Q+W
Sbjct  298  FAVVKCSRDPQKDFRESMVEMIWEKGIGRPEELESLLACYLSLNSDEHHDVIVKVFRQVW  357

Query  395  FEL  403
            F+L
Sbjct  358  FDL  360



>ref|NP_001151830.1| plant-specific domain TIGR01568 family protein [Zea mays]
 gb|ACG44494.1| plant-specific domain TIGR01568 family protein [Zea mays]
Length=259

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A+VKAS DP +DFKESM++MI EN+M    DL+ELL CYLSLN  EYH +I++ F +I
Sbjct  188  SFAVVKASADPLRDFKESMVQMIVENDMSAPEDLQELLECYLSLNSMEYHGVIVEVFREI  247

Query  392  WFELPH  409
            W ++ H
Sbjct  248  WLQIVH  253



>ref|XP_006598318.1| PREDICTED: eukaryotic translation initiation factor 5B-like [Glycine 
max]
Length=340

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            AM+K+S+DP++DF +SM EMI EN +    ++E+LLACYL+LN +EYH LIIK F Q+W 
Sbjct  262  AMIKSSLDPKQDFSDSMTEMITENRISRPEEMEDLLACYLTLNADEYHDLIIKVFRQVWS  321

Query  398  EL  403
            ++
Sbjct  322  DM  323



>emb|CBH32507.1| conserved hypothetical protein [Triticum aestivum]
 emb|CDM84176.1| unnamed protein product [Triticum aestivum]
Length=291

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = +2

Query  134  SSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDL  313
            ++P   +  +R  SPR   + +      A+V+ + DPQ++F+ SM+EMI    +    +L
Sbjct  188  TTPGARLAAVRVRSPRCTVVAVSGLERFAVVRRTSDPQREFRNSMVEMITSKRIGRPEEL  247

Query  314  EELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            E LLACYL+LN EE+H  I+K F Q+WFEL
Sbjct  248  ETLLACYLALNAEEHHDCIVKVFRQVWFEL  277



>gb|EAY98423.1| hypothetical protein OsI_20338 [Oryza sativa Indica Group]
 dbj|BAH01174.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64092.1| hypothetical protein OsJ_18923 [Oryza sativa Japonica Group]
Length=384

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DP++DF ESM EMI EN ++ + DLE+LLACYLSLN  EYH LI++ FEQ+W 
Sbjct  315  AVVKTSSDPRRDFLESMEEMIAENGIRDAGDLEDLLACYLSLNSGEYHDLIVEVFEQVWT  374

Query  398  EL  403
             L
Sbjct  375  GL  376



>ref|XP_006655410.1| PREDICTED: uncharacterized protein LOC102722774, partial [Oryza 
brachyantha]
Length=312

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 63/100 (63%), Gaps = 11/100 (11%)
 Frame = +2

Query  131  SSSPRIAVRKIRRSSPRAEKMELPE---------SGGVAMVKASVDPQKDFKesmmemie  283
            ++SPR+A    R+  P A    LP+         +   A+VK+S DP++DF ESM EMI 
Sbjct  207  TNSPRLAA--CRKCKPTARPSTLPQQQQQPPPPLADSFAVVKSSSDPRRDFLESMEEMIA  264

Query  284  enemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            EN +  + DLE+LLACYLSLN  EYH LI++ FEQ+W  L
Sbjct  265  ENGICGAGDLEDLLACYLSLNSAEYHDLIVEVFEQVWAGL  304



>gb|EPS69579.1| hypothetical protein M569_05187 [Genlisea aurea]
Length=108

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 55/92 (60%), Gaps = 1/92 (1%)
 Frame = +2

Query  128  SSSSPRIAVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmemieenemKCSR  307
            SSS  R  +  + R    +E          AMV +S DP +DF++SM+EMI E  +    
Sbjct  16   SSSWGRNGINPVWRQCGDSETTTTV-FDSFAMVVSSFDPMRDFRDSMVEMIRERGITRCV  74

Query  308  DLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            DLE LLACYL+LN +EYHH+I  AF ++W ++
Sbjct  75   DLERLLACYLTLNGDEYHHIIFAAFREVWCDM  106



>ref|XP_004962442.1| PREDICTED: uncharacterized protein LOC101755245 [Setaria italica]
Length=247

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VKAS DP +DF+ESM+EMI EN+++   D+EELL CYLSLN  EYH +I++ F  IW 
Sbjct  179  AVVKASTDPPRDFRESMVEMIAENKVQTPEDMEELLECYLSLNSREYHGVIMEVFRGIWL  238

Query  398  EL  403
            E+
Sbjct  239  EI  240



>ref|NP_001055838.1| Os05g0477200 [Oryza sativa Japonica Group]
 gb|AAT01359.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17752.1| Os05g0477200 [Oryza sativa Japonica Group]
Length=472

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DP++DF ESM EMI EN ++ + DLE+LLACYLSLN  EYH LI++ FEQ+W 
Sbjct  403  AVVKTSSDPRRDFLESMEEMIAENGIRDAGDLEDLLACYLSLNSGEYHDLIVEVFEQVWT  462

Query  398  EL  403
             L
Sbjct  463  GL  464



>ref|XP_003629846.1| hypothetical protein MTR_8g087530 [Medicago truncatula]
 gb|AET04322.1| ovate transcriptional repressor [Medicago truncatula]
Length=339

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  212  GVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQI  391
              A+VK S+DPQ+DF++SM+EMI+E  +    ++EELLACYLSLN  E+H +IIKAF Q+
Sbjct  259  SFAVVKCSLDPQQDFRDSMIEMIKEKHISQPEEMEELLACYLSLNSNEFHDIIIKAFRQV  318

Query  392  WF  397
            W 
Sbjct  319  WL  320



>ref|XP_009351714.1| PREDICTED: transcription repressor OFP5-like [Pyrus x bretschneideri]
Length=400

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S DPQKDF++SM+EM+ E ++    DLEELLA YL+LN ++Y  LIIK F Q+WF
Sbjct  325  AVVKCSFDPQKDFRDSMVEMVVEKKITQPEDLEELLASYLTLNSDKYRDLIIKVFRQVWF  384

Query  398  EL  403
            +L
Sbjct  385  DL  386



>ref|XP_004504419.1| PREDICTED: uncharacterized protein LOC101510071 [Cicer arietinum]
Length=351

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK S+DPQ+DF +SM+EMI+E ++  + ++EELLACYL+LN  EYH LIIKAF ++W 
Sbjct  282  AVVKCSLDPQQDFIDSMIEMIKEKQISQAEEMEELLACYLTLNSNEYHDLIIKAFRKVWL  341



>ref|XP_008361544.1| PREDICTED: uncharacterized protein LOC103425237, partial [Malus 
domestica]
Length=188

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 63/107 (59%), Gaps = 4/107 (4%)
 Frame = +2

Query  95   KVTGVRLRGNSSSSSPRIAVRKIRRSSPRAEKMELPE----SGGVAMVKASVDPQKDFKe  262
            + T   +  N++SS           ++P+  K+  P     SG +A+VK S DP +DF++
Sbjct  72   QCTSTTVSFNNNSSLQSKPFDSAESTNPKNTKISSPNTTKTSGSIAVVKESNDPYQDFRQ  131

Query  263  smmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            SM++MI E ++    DL+ELL C+L LN   +H +I++AF QIW +L
Sbjct  132  SMLQMIVEKQIYWKEDLQELLRCFLELNSPSHHDVIVRAFTQIWNDL  178



>ref|XP_011101456.1| PREDICTED: transcription repressor OFP5 [Sesamum indicum]
Length=290

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  218  AMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWF  397
            A+VK+S +PQ+DF++SM++MI    ++   +L+ELLACYL+LN + +H LIIK F+++WF
Sbjct  224  AVVKSSFNPQQDFRDSMVQMIRAKRIRQPEELQELLACYLTLNHDGHHELIIKVFQEVWF  283

Query  398  EL  403
            + 
Sbjct  284  DF  285



>emb|CDY01560.1| BnaC07g35500D [Brassica napus]
Length=356

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRI-AVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmem  277
            + VR+    SS   R+ A+  ++++  RA++ E+ E+   A+VK S DPQKDF++SM+EM
Sbjct  221  SKVRVFSPRSSEKCRVKAIEDLKKAKQRAKEQEM-ENESFAVVKCSSDPQKDFRDSMIEM  279

Query  278  ieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            I EN +    +L+ELL CYL LN +EYH +II  F+Q+  +L
Sbjct  280  IMENGINRPEELKELLVCYLRLNSDEYHDMIINVFQQVHNDL  321



>ref|XP_009136961.1| PREDICTED: transcription repressor OFP5-like isoform X2 [Brassica 
rapa]
Length=323

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = +2

Query  101  TGVRLRGNSSSSSPRI-AVRKIRRSSPRAEKMELPESGGVAMVKASVDPQKDFKesmmem  277
            + VR+    SS   R+ A+  ++++  RA++ E+ E+   A+VK S DPQKDF++SM+EM
Sbjct  219  SKVRVFSPRSSEKCRVKAIEDLKKAKLRAKEQEM-ENESFAVVKCSSDPQKDFRDSMIEM  277

Query  278  ieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
            I EN +    +L+ELL CYL LN +EYH +II  F+Q+  +L
Sbjct  278  IMENGINRPEELKELLVCYLRLNTDEYHDMIINVFQQVHNDL  319



>gb|EMS64314.1| hypothetical protein TRIUR3_29052 [Triticum urartu]
Length=238

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  221  MVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFE  400
            +VK S DP++DF+ESM EMI    ++ + DLE+LLACYLSLN   +H LII  FEQIW  
Sbjct  173  VVKMSEDPRQDFRESMEEMISAKRIQDAEDLEDLLACYLSLNDAAHHDLIIDVFEQIWVS  232

Query  401  L  403
            L
Sbjct  233  L  233



>ref|XP_004238599.1| PREDICTED: transcription repressor OFP7-like [Solanum lycopersicum]
Length=266

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 69/112 (62%), Gaps = 11/112 (10%)
 Frame = +2

Query  89   VSKVTGVRLRGNSSSSSPRIAVRKIRR---SSPRAEKMELPESGGV----AMVKASVDPQ  247
            +  ++G+R + N++++     VR++RR   +S +   M     G V    A+VK SVDP 
Sbjct  143  IDPLSGIRRKKNNNNT----KVRRLRRYLSNSLKDSMMPCMADGKVNESFAIVKRSVDPY  198

Query  248  KDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIWFEL  403
             DFK SM EMI E EM  + DLE+LL C+LSLN   +H +I++AF +IW EL
Sbjct  199  DDFKNSMKEMIMEKEMFEAEDLEQLLLCFLSLNSRHHHAIIVEAFTEIWEEL  250



>gb|KHN48028.1| hypothetical protein glysoja_015498 [Glycine soja]
Length=413

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  215  VAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIW  394
             A+VK S+DPQKDF++SM+EMI E ++    ++E+LLACYL+LN  EYH LII+ F+Q+W
Sbjct  334  FAVVKCSLDPQKDFRDSMIEMITEKQISEPEEMEDLLACYLTLNSSEYHDLIIQVFKQVW  393

Query  395  F  397
             
Sbjct  394  L  394



>ref|XP_007159490.1| hypothetical protein PHAVU_002G241900g [Phaseolus vulgaris]
 gb|ESW31484.1| hypothetical protein PHAVU_002G241900g [Phaseolus vulgaris]
Length=399

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  215  VAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLIIKAFEQIW  394
             A+VK S+DPQKDF++SM+EMI E ++    ++++LLACYL+LN  EYH LII+ F+Q+W
Sbjct  330  FAVVKCSLDPQKDFRDSMIEMITEKQISQPEEMQDLLACYLTLNSNEYHDLIIQVFKQVW  389

Query  395  F  397
             
Sbjct  390  L  390



>gb|KHN47391.1| hypothetical protein glysoja_020259 [Glycine soja]
Length=414

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  194  ELPESGGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYLSLNPEEYHHLII  373
            E P     A++K+S+DP++DF++SM+EMI EN++    ++E+LLACYL+LN +EYH LII
Sbjct  328  ETPGLESFAVIKSSLDPKQDFRDSMIEMIIENQISKPEEMEDLLACYLTLNADEYHDLII  387

Query  374  KAFEQIWFEL  403
            K F Q+W ++
Sbjct  388  KVFRQVWSDM  397



>ref|XP_009374782.1| PREDICTED: transcription repressor OFP4-like [Pyrus x bretschneideri]
 ref|XP_009347154.1| PREDICTED: transcription repressor OFP4-like [Pyrus x bretschneideri]
Length=191

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = +2

Query  170  SSPRAEKMELPES----GGVAMVKASVDPQKDFKesmmemieenemKCSRDLEELLACYL  337
            ++P+  K+  P +      +A+VK S DP KDF++SM++MI E ++    DL+ELL+C+L
Sbjct  100  TNPKNTKISSPNTMKVHDSIAVVKESNDPYKDFRQSMLQMIVEQQIYSKDDLQELLSCFL  159

Query  338  SLNPEEYHHLIIKAFEQIWFEL  403
             LN   +H +II+AF QIW +L
Sbjct  160  ELNSASHHDVIIRAFTQIWNDL  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508381126058