BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c93760_g1_i1 len=231 path=[209:0-230]

Length=231
                                                                      Score     E

ref|XP_009612652.1|  PREDICTED: crocetin glucosyltransferase, chl...  79.7    2e-15   
ref|XP_009622554.1|  PREDICTED: crocetin glucosyltransferase, chl...  76.6    3e-14   
ref|XP_009787090.1|  PREDICTED: crocetin glucosyltransferase, chl...  76.3    3e-14   
dbj|BAG80545.1|  UDP-glucose:glucosyltransferase                      74.7    1e-13   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_004229323.2|  PREDICTED: crocetin glucosyltransferase, chl...  72.4    7e-13   
ref|XP_004247895.1|  PREDICTED: crocetin glucosyltransferase, chl...  72.4    8e-13   
ref|XP_006342284.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  71.6    1e-12   
ref|XP_009765809.1|  PREDICTED: crocetin glucosyltransferase, chl...  71.2    2e-12   
ref|XP_009612650.1|  PREDICTED: crocetin glucosyltransferase, chl...  71.2    2e-12   
dbj|BAA19155.1|  glucosyl transferase                                 70.9    2e-12   Nicotiana tabacum [American tobacco]
ref|XP_007221319.1|  hypothetical protein PRUPE_ppa021645mg           68.9    1e-11   
emb|CDP15120.1|  unnamed protein product                              68.2    2e-11   
dbj|BAG80537.1|  putative glycosyltransferase                         67.8    3e-11   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_004252977.1|  PREDICTED: crocetin glucosyltransferase, chl...  67.8    3e-11   
ref|XP_008222736.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  66.2    1e-10   
ref|XP_004242781.1|  PREDICTED: crocetin glucosyltransferase, chl...  66.2    1e-10   
ref|XP_008380456.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  65.9    1e-10   
ref|XP_006349902.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  65.5    2e-10   
emb|CDP15119.1|  unnamed protein product                              65.5    2e-10   
ref|XP_008222735.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  65.5    2e-10   
dbj|BAB88935.1|  glucosyltransferase                                  65.5    2e-10   Nicotiana tabacum [American tobacco]
ref|XP_009778637.1|  PREDICTED: crocetin glucosyltransferase, chl...  65.5    2e-10   
ref|XP_009601422.1|  PREDICTED: crocetin glucosyltransferase, chl...  65.5    2e-10   
ref|XP_007163802.1|  hypothetical protein PHAVU_001G265400g           65.5    2e-10   
ref|XP_009790237.1|  PREDICTED: crocetin glucosyltransferase, chl...  65.1    3e-10   
ref|XP_009590508.1|  PREDICTED: crocetin glucosyltransferase, chl...  64.7    3e-10   
ref|XP_010023603.1|  PREDICTED: crocetin glucosyltransferase, chl...  64.7    3e-10   
ref|XP_007221281.1|  hypothetical protein PRUPE_ppa005161mg           64.7    4e-10   
ref|XP_004247896.2|  PREDICTED: crocetin glucosyltransferase, chl...  64.3    5e-10   
ref|XP_009373577.1|  PREDICTED: crocetin glucosyltransferase, chl...  64.3    5e-10   
ref|XP_008380454.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  64.3    6e-10   
ref|XP_009373578.1|  PREDICTED: crocetin glucosyltransferase, chl...  63.9    7e-10   
ref|XP_010527436.1|  PREDICTED: UDP-glycosyltransferase 75C1 isof...  63.9    7e-10   
emb|CBI39411.3|  unnamed protein product                              62.4    9e-10   
ref|XP_004504379.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     63.5    9e-10   
ref|XP_010023602.1|  PREDICTED: crocetin glucosyltransferase, chl...  63.5    1e-09   
gb|KDP32590.1|  hypothetical protein JCGZ_13140                       63.2    1e-09   
ref|XP_010673328.1|  PREDICTED: crocetin glucosyltransferase, chl...  63.2    1e-09   
ref|XP_006307449.1|  hypothetical protein CARUB_v10009073mg           63.2    1e-09   
gb|KHN12357.1|  UDP-glycosyltransferase 75D1                          62.8    1e-09   
dbj|BAF49301.1|  putative glycosyltransferase                         62.8    2e-09   Clitoria ternatea
ref|XP_003531212.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  62.8    2e-09   
gb|AAY27090.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase         62.8    2e-09   Pyrus communis
ref|XP_011024782.1|  PREDICTED: crocetin glucosyltransferase, chl...  62.4    2e-09   
ref|XP_002301753.1|  INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE ...  62.4    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010650398.1|  PREDICTED: crocetin glucosyltransferase, chl...  62.4    2e-09   
ref|XP_002263975.1|  PREDICTED: crocetin glucosyltransferase, chl...  62.4    2e-09   Vitis vinifera
ref|XP_010485047.1|  PREDICTED: UDP-glycosyltransferase 75B1 isof...  62.4    2e-09   
gb|AAX16493.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase         62.4    2e-09   Malus domestica [apple tree]
ref|XP_003552552.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  62.4    2e-09   
gb|KFK42892.1|  hypothetical protein AALP_AA1G052200                  62.4    3e-09   
ref|XP_010522273.1|  PREDICTED: UDP-glycosyltransferase 75B2-like     62.4    3e-09   
gb|EYU32718.1|  hypothetical protein MIMGU_mgv1a005538mg              62.0    3e-09   
ref|XP_002263700.1|  PREDICTED: crocetin glucosyltransferase, chl...  62.0    3e-09   Vitis vinifera
ref|XP_004298223.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     62.0    3e-09   
ref|XP_006368000.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  62.0    3e-09   
ref|XP_006358760.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  62.0    4e-09   
ref|XP_008380455.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  62.0    4e-09   
ref|XP_007034187.1|  Indole-3-acetate beta-D-glucosyltransferase,...  62.0    4e-09   
ref|XP_010450109.1|  PREDICTED: UDP-glycosyltransferase 75C1          61.6    4e-09   
emb|CDY12370.1|  BnaC08g08350D                                        61.6    4e-09   
ref|XP_004247894.1|  PREDICTED: crocetin glucosyltransferase, chl...  61.6    4e-09   
ref|XP_009108098.1|  PREDICTED: UDP-glycosyltransferase 75C1          61.6    5e-09   
ref|XP_003629627.1|  Indole-3-acetate beta-glucosyltransferase        61.6    5e-09   
emb|CDY27124.1|  BnaA08g07620D                                        61.6    5e-09   
gb|AAK54465.1|  cold-induced glucosyl transferase                     61.6    5e-09   Solanum sogarandinum
dbj|BAG80544.1|  UDP-glucose:glucosyltransferase                      61.6    5e-09   Lycium barbarum [Duke of Argyll's teatree]
dbj|BAF49300.1|  putative glycosyltransferase                         61.6    5e-09   Clitoria ternatea
dbj|BAF75879.1|  glucosyltransferase                                  61.2    6e-09   Dianthus caryophyllus [carnation]
ref|XP_010435193.1|  PREDICTED: UDP-glycosyltransferase 75C1-like     61.2    6e-09   
ref|XP_008355875.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     59.7    7e-09   
ref|XP_009337747.1|  PREDICTED: crocetin glucosyltransferase, chl...  61.2    7e-09   
gb|AAL69494.1|  putative glucosyltransferase                          60.8    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003629628.1|  UDP-glucose flavonoid 7-O-glucosyltransferase    60.8    7e-09   
dbj|BAE98677.1|  glucosyltransferase like protein                     60.8    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193146.1|  anthocyanin 5-O-glucosyltransferase                 60.8    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003601707.1|  UDP-glucuronosyltransferase 1-6                  60.8    8e-09   
ref|XP_004298222.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     60.8    9e-09   
ref|XP_010099953.1|  UDP-glycosyltransferase 75D1                     60.8    1e-08   
ref|XP_007034186.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase    60.5    1e-08   
ref|XP_004297014.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     60.5    1e-08   
gb|EYU31588.1|  hypothetical protein MIMGU_mgv1a005398mg              60.5    1e-08   
ref|XP_010450127.1|  PREDICTED: UDP-glycosyltransferase 75C1-like     60.5    1e-08   
gb|EYU31585.1|  hypothetical protein MIMGU_mgv1a007491mg              60.1    1e-08   
ref|XP_002892298.1|  UDP-glucosyl transferase 75B1                    60.5    1e-08   
ref|XP_003601706.1|  UDP-glucose glucosyltransferase                  60.5    1e-08   
ref|XP_010246531.1|  PREDICTED: crocetin glucosyltransferase, chl...  60.1    1e-08   
ref|XP_008348418.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  60.1    1e-08   
ref|XP_010243149.1|  PREDICTED: crocetin glucosyltransferase, chl...  60.1    2e-08   
ref|XP_008359982.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     57.8    2e-08   
emb|CAN77410.1|  hypothetical protein VITISV_038710                   58.9    2e-08   Vitis vinifera
ref|XP_002868314.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  59.7    2e-08   
sp|Q9ZR25.1|5GT_VERHY  RecName: Full=Anthocyanidin 3-O-glucoside ...  59.3    2e-08   Glandularia x hybrida [garden verbena]
emb|CDY22902.1|  BnaA01g18400D                                        59.3    2e-08   
ref|XP_010040347.1|  PREDICTED: crocetin glucosyltransferase, chl...  59.3    3e-08   
ref|XP_010025793.1|  PREDICTED: crocetin glucosyltransferase, chl...  59.3    3e-08   
ref|XP_011020320.1|  PREDICTED: crocetin glucosyltransferase, chl...  59.3    3e-08   
ref|XP_011069457.1|  PREDICTED: crocetin glucosyltransferase, chl...  58.9    3e-08   
emb|CDY65144.1|  BnaC01g41850D                                        59.3    3e-08   
ref|XP_009146925.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     59.3    3e-08   
ref|XP_009381252.1|  PREDICTED: crocetin glucosyltransferase, chl...  59.3    3e-08   
ref|XP_010100065.1|  UDP-glycosyltransferase 75D1                     58.9    3e-08   
gb|KCW57186.1|  hypothetical protein EUGRSUZ_H00001                   58.9    3e-08   
gb|AAL24226.1|  AT4g15550/dl3815c                                     58.9    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32582.1|  hypothetical protein JCGZ_13132                       58.9    3e-08   
ref|XP_009373576.1|  PREDICTED: crocetin glucosyltransferase, chl...  59.3    3e-08   
ref|NP_567471.1|  UDP-glucose:indole-3-acetate beta-D-glucosyltra...  58.9    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282890.1|  hypothetical protein CARUB_v10007134mg           58.9    4e-08   
gb|AAB58497.1|  UDP-glucose:indole-3-acetate beta-D-glucosyltrans...  58.9    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418014.1|  hypothetical protein EUTSA_v10007593mg           58.9    4e-08   
ref|XP_008380634.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  58.9    4e-08   
ref|XP_010485054.1|  PREDICTED: UDP-glycosyltransferase 75B1 isof...  58.9    4e-08   
ref|XP_003601705.1|  O-glucosyltransferase                            58.9    4e-08   
ref|XP_004297003.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     58.9    4e-08   
ref|XP_010475249.1|  PREDICTED: UDP-glycosyltransferase 75B1-like     58.5    5e-08   
ref|XP_003560622.2|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  58.5    5e-08   
dbj|BAF96596.1|  UDP-glucose:anthocysnin 5-O-glucosyltransferase      58.2    5e-08   Rosa hybrid cultivar
ref|XP_002321086.2|  INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE ...  58.5    5e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010457643.1|  PREDICTED: UDP-glycosyltransferase 75B1-like     58.5    6e-08   
ref|XP_002262883.1|  PREDICTED: crocetin glucosyltransferase, chl...  58.5    6e-08   Vitis vinifera
emb|CAN67608.1|  hypothetical protein VITISV_036779                   58.5    6e-08   Vitis vinifera
ref|XP_006414807.1|  hypothetical protein EUTSA_v10025167mg           58.2    6e-08   
gb|ABL85474.1|  glycosyltransferase UGT75L4                           58.2    6e-08   Maclura pomifera
emb|CBI39391.3|  unnamed protein product                              58.2    6e-08   
ref|XP_002868197.1|  indole-3-acetate beta-D-glucosyltransferase      58.2    6e-08   
ref|XP_010069411.1|  PREDICTED: crocetin glucosyltransferase, chl...  58.2    7e-08   
gb|EYU31586.1|  hypothetical protein MIMGU_mgv1a005918mg              58.2    7e-08   
ref|XP_002516389.1|  UDP-glucosyltransferase, putative                58.2    7e-08   Ricinus communis
ref|XP_002267526.1|  PREDICTED: crocetin glucosyltransferase, chl...  58.2    7e-08   Vitis vinifera
ref|XP_002263422.1|  PREDICTED: crocetin glucosyltransferase, chl...  58.2    8e-08   Vitis vinifera
emb|CAN62624.1|  hypothetical protein VITISV_001657                   58.2    8e-08   Vitis vinifera
ref|XP_002301754.1|  hypothetical protein POPTR_0002s23770g           58.2    8e-08   Populus trichocarpa [western balsam poplar]
gb|ADG45874.1|  UDP-glucosyltransferase                               57.8    9e-08   
ref|XP_002263301.1|  PREDICTED: crocetin glucosyltransferase, chl...  57.8    9e-08   Vitis vinifera
gb|EYU31587.1|  hypothetical protein MIMGU_mgv1a018203mg              57.8    9e-08   
ref|XP_002266800.1|  PREDICTED: crocetin glucosyltransferase, chl...  56.6    1e-07   Vitis vinifera
ref|XP_003524181.2|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  57.8    1e-07   
ref|XP_010039940.1|  PREDICTED: crocetin glucosyltransferase, chl...  57.4    1e-07   
ref|XP_008793438.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  57.4    1e-07   
dbj|BAD90935.1|  monoterpene glucosyltransferase                      57.4    1e-07   Eucalyptus perriniana
ref|XP_003532736.2|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  57.4    1e-07   
ref|XP_003524180.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  57.0    2e-07   
ref|XP_008793436.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  57.0    2e-07   
ref|XP_010039961.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     55.1    2e-07   
gb|KCW57754.1|  hypothetical protein EUGRSUZ_H00503                   57.0    2e-07   
gb|KCW45598.1|  hypothetical protein EUGRSUZ_L006311                  55.1    2e-07   
gb|AFJ52965.1|  UDP-glycosyltransferase 1                             57.0    2e-07   
emb|CDX68805.1|  BnaC01g06480D                                        57.0    2e-07   
emb|CDY09070.1|  BnaC08g10240D                                        57.0    2e-07   
ref|XP_010246963.1|  PREDICTED: crocetin glucosyltransferase, chl...  57.0    2e-07   
ref|XP_010440288.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     57.0    2e-07   
ref|XP_010068983.1|  PREDICTED: crocetin glucosyltransferase, chl...  57.0    2e-07   
emb|CDY22742.1|  BnaA08g05720D                                        56.6    2e-07   
ref|XP_009107848.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     56.6    2e-07   
gb|KFK36297.1|  hypothetical protein AALP_AA4G104100                  56.6    2e-07   
ref|XP_010549173.1|  PREDICTED: UDP-glycosyltransferase 75D1          56.6    3e-07   
gb|ABQ02258.1|  O-glucosyltransferase 3                               56.6    3e-07   Vitis labrusca [Concord grape]
emb|CAN76093.1|  hypothetical protein VITISV_027116                   56.6    3e-07   Vitis vinifera
ref|XP_010230853.1|  PREDICTED: crocetin glucosyltransferase, chl...  56.6    3e-07   
ref|XP_004502258.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     56.6    3e-07   
emb|CDP15115.1|  unnamed protein product                              56.2    3e-07   
gb|KFK39474.1|  hypothetical protein AALP_AA3G248900                  56.2    3e-07   
ref|NP_563742.1|  UDP-glucosyltransferase 75B1                        56.2    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434517.1|  PREDICTED: UDP-glycosyltransferase 75D1          56.2    3e-07   
ref|XP_010434952.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     56.2    3e-07   
ref|XP_004965983.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  56.2    4e-07   
ref|XP_006414486.1|  hypothetical protein EUTSA_v10027441mg           56.2    4e-07   
ref|XP_009403481.1|  PREDICTED: crocetin glucosyltransferase, chl...  55.8    4e-07   
ref|XP_007099701.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase    55.8    4e-07   
ref|XP_010246537.1|  PREDICTED: crocetin glucosyltransferase, chl...  55.8    4e-07   
emb|CDY09069.1|  BnaC08g10230D                                        55.8    5e-07   
emb|CDY09068.1|  BnaC08g10220D                                        55.8    5e-07   
ref|XP_003629629.1|  UDP-glucose glucosyltransferase                  55.1    5e-07   
ref|XP_009107846.1|  PREDICTED: UDP-glycosyltransferase 75D1-like...  55.8    5e-07   
ref|XP_010915038.1|  PREDICTED: crocetin glucosyltransferase, chl...  55.8    5e-07   
dbj|BAM28983.1|  UDP-glucose crocetin glucosyltransferase             55.8    5e-07   
sp|F8WKW0.1|UGT1_GARJA  RecName: Full=Crocetin glucosyltransferas...  55.8    5e-07   
ref|XP_009107847.1|  PREDICTED: UDP-glycosyltransferase 75D1-like...  55.8    5e-07   
emb|CDY22741.1|  BnaA08g05710D                                        55.5    6e-07   
ref|XP_006282963.1|  hypothetical protein CARUB_v10007692mg           55.5    6e-07   
ref|XP_002437220.1|  hypothetical protein SORBIDRAFT_10g023060        55.5    6e-07   Sorghum bicolor [broomcorn]
ref|XP_011101592.1|  PREDICTED: crocetin glucosyltransferase, chl...  55.5    6e-07   
gb|AET04105.2|  UDP-glucose:glucosyltransferase, putative             53.1    6e-07   
ref|XP_010434494.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     55.5    7e-07   
emb|CDY10124.1|  BnaC05g03670D                                        55.5    7e-07   
ref|XP_010246964.1|  PREDICTED: crocetin glucosyltransferase, chl...  55.1    7e-07   
emb|CBI39410.3|  unnamed protein product                              55.1    7e-07   
ref|XP_002266967.1|  PREDICTED: crocetin glucosyltransferase, chl...  55.1    8e-07   Vitis vinifera
ref|XP_002308970.1|  putative glucosyltransferase family protein      55.1    8e-07   Populus trichocarpa [western balsam poplar]
emb|CDP15112.1|  unnamed protein product                              55.1    9e-07   
gb|AFJ52964.1|  UDP-glycosyltransferase 1                             55.1    9e-07   
ref|XP_002266628.2|  PREDICTED: crocetin glucosyltransferase, chl...  55.1    1e-06   Vitis vinifera
gb|KGN45711.1|  hypothetical protein Csa_6G007450                     54.7    1e-06   
dbj|BAD90934.1|  monoterpene glucosyltransferase                      54.7    1e-06   Eucalyptus perriniana
ref|XP_003560621.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  54.7    1e-06   
emb|CDY21979.1|  BnaC09g00850D                                        54.7    1e-06   
sp|B2NID7.1|5GT_GENTR  RecName: Full=Anthocyanidin 3-O-glucoside ...  54.7    1e-06   Gentiana triflora
ref|XP_010434953.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     54.7    1e-06   
ref|XP_002438628.1|  hypothetical protein SORBIDRAFT_10g023120        54.7    1e-06   Sorghum bicolor [broomcorn]
ref|XP_004965984.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     54.7    1e-06   
emb|CDY09754.1|  BnaC07g33070D                                        54.7    1e-06   
ref|XP_002892295.1|  UDP-glucosyl transferase 75B2                    54.3    2e-06   
ref|XP_002267330.2|  PREDICTED: crocetin glucosyltransferase, chl...  54.3    2e-06   Vitis vinifera
ref|XP_007221288.1|  hypothetical protein PRUPE_ppa016890mg           54.3    2e-06   
gb|EYU27003.1|  hypothetical protein MIMGU_mgv1a024986mg              53.9    2e-06   
ref|XP_010925318.1|  PREDICTED: crocetin glucosyltransferase, chl...  53.9    2e-06   
ref|XP_010039944.1|  PREDICTED: crocetin glucosyltransferase, chl...  53.9    2e-06   
gb|AFJ52962.1|  UDP-glycosyltransferase 1                             53.9    2e-06   
emb|CBI36304.3|  unnamed protein product                              53.5    2e-06   
ref|XP_008458151.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  53.5    3e-06   
ref|XP_003571494.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  53.5    3e-06   
emb|CDX90584.1|  BnaA03g41970D                                        53.5    3e-06   
dbj|BAJ96117.1|  predicted protein                                    53.5    3e-06   
ref|XP_011033298.1|  PREDICTED: crocetin glucosyltransferase, chl...  53.5    3e-06   
ref|XP_006285715.1|  hypothetical protein CARUB_v10007186mg           53.1    4e-06   
ref|XP_009119145.1|  PREDICTED: UDP-glycosyltransferase 75B1          53.1    4e-06   
ref|XP_006305828.1|  hypothetical protein CARUB_v10010859mg           52.8    4e-06   
dbj|BAK06770.1|  predicted protein                                    53.1    5e-06   
gb|AHL68667.1|  UDP-glucose: anthocyanin 5-O-glucosyltransferase      52.8    5e-06   
dbj|BAP90370.1|  UDP-glycose: glycosyltransferase UGT75R1             52.8    5e-06   
ref|XP_002438625.1|  hypothetical protein SORBIDRAFT_10g023050        52.4    8e-06   Sorghum bicolor [broomcorn]
ref|XP_003565426.1|  PREDICTED: crocetin glucosyltransferase, chl...  52.4    8e-06   
ref|NP_001142122.1|  uncharacterized protein LOC100274286             52.4    8e-06   Zea mays [maize]
ref|NP_001057976.1|  Os06g0593200                                     52.0    9e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CDY47274.1|  BnaA10g03720D                                        52.0    9e-06   
ref|XP_006373112.1|  hypothetical protein POPTR_0017s08830g           50.1    1e-05   
ref|XP_002322699.1|  hypothetical protein POPTR_0016s05290g           52.0    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_003632054.2|  PREDICTED: crocetin glucosyltransferase, chl...  51.6    1e-05   
ref|XP_002438626.1|  hypothetical protein SORBIDRAFT_10g023070        51.2    2e-05   Sorghum bicolor [broomcorn]
ref|XP_008439390.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     48.9    2e-05   
ref|XP_002266919.1|  PREDICTED: crocetin glucosyltransferase, chl...  50.8    3e-05   Vitis vinifera
emb|CAN62622.1|  hypothetical protein VITISV_001655                   50.8    3e-05   Vitis vinifera
ref|XP_002263498.1|  PREDICTED: crocetin glucosyltransferase, chl...  50.8    3e-05   Vitis vinifera
ref|XP_003565425.1|  PREDICTED: crocetin glucosyltransferase, chl...  50.8    3e-05   
ref|XP_010039945.1|  PREDICTED: crocetin glucosyltransferase, chl...  50.4    3e-05   
emb|CBI39398.3|  unnamed protein product                              50.4    3e-05   
dbj|BAC54093.1|  anthocyanin 5-glucosyltransferase                    50.4    3e-05   Torenia hybrid cultivar
emb|CBI39388.3|  unnamed protein product                              50.4    4e-05   
gb|ACM66950.1|  flavonoid glucosyltransferase                         50.4    4e-05   Crocus sativus [saffron crocus]
ref|XP_006657100.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     50.1    4e-05   
dbj|BAA89009.1|  anthocyanin 5-O-glucosyltransferase                  50.1    4e-05   Petunia x hybrida [garden petunia]
dbj|BAF03079.1|  UDP-glucose:flavonol 5-O-glucosyltransferase hom...  49.7    4e-05   Solanum melongena [aubergine]
ref|XP_008793440.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  50.1    5e-05   
gb|AFI71902.1|  flavonol 5-O-glucosyltransferase                      50.1    5e-05   
ref|XP_010650395.1|  PREDICTED: crocetin glucosyltransferase, chl...  50.1    5e-05   
emb|CAN75179.1|  hypothetical protein VITISV_018406                   50.1    5e-05   Vitis vinifera
ref|XP_010485039.1|  PREDICTED: UDP-glycosyltransferase 75B2-like     49.7    6e-05   
ref|NP_172044.1|  UDP-glucosyl transferase 75B2                       49.7    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010039943.1|  PREDICTED: crocetin glucosyltransferase, chl...  49.7    6e-05   
ref|XP_004147672.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     49.3    6e-05   
ref|XP_006349903.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  49.3    8e-05   
ref|XP_004252978.1|  PREDICTED: crocetin glucosyltransferase, chl...  49.3    8e-05   
gb|EAY72781.1|  hypothetical protein OsI_00644                        49.3    9e-05   Oryza sativa Indica Group [Indian rice]
gb|AFJ52963.1|  UDP-glycosyltransferase 1                             48.9    1e-04   
ref|XP_006415092.1|  hypothetical protein EUTSA_v10007589mg           48.9    1e-04   
dbj|BAD67837.1|  putative glucosyltransferase                         48.9    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ10778.1|  hypothetical protein OsJ_00613                        48.9    1e-04   Oryza sativa Japonica Group [Japonica rice]
sp|Q9ZR27.1|5GT1_PERFR  RecName: Full=Anthocyanidin 3-O-glucoside...  48.9    1e-04   Perilla frutescens var. crispa
ref|NP_001042201.2|  Os01g0179600                                     48.9    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010925530.1|  PREDICTED: crocetin glucosyltransferase, chl...  48.1    1e-04   
ref|XP_006414506.1|  hypothetical protein EUTSA_v10025072mg           48.5    2e-04   
ref|XP_011081386.1|  PREDICTED: crocetin glucosyltransferase, chl...  48.1    2e-04   
ref|XP_009105515.1|  PREDICTED: UDP-glycosyltransferase 75B2          48.1    2e-04   
emb|CDY71964.1|  BnaAnng39390D                                        48.1    2e-04   
emb|CDY46180.1|  BnaA01g23020D                                        47.8    2e-04   
ref|XP_010915126.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...  47.8    3e-04   
ref|XP_009403483.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  47.4    4e-04   
dbj|BAJ90555.1|  predicted protein                                    47.4    4e-04   
ref|XP_008793435.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  47.4    4e-04   
gb|EAY84926.1|  hypothetical protein OsI_06294                        47.4    4e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010103920.1|  UDP-glycosyltransferase 75D1                     47.4    4e-04   
ref|NP_001046237.2|  Os02g0203300                                     47.4    4e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CDP15111.1|  unnamed protein product                              47.4    4e-04   
dbj|BAD15509.1|  putative anthocyanin 5-O-glucosyltransferase         47.4    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004137099.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  47.4    4e-04   
gb|KCW57187.1|  hypothetical protein EUGRSUZ_H000022                  45.1    5e-04   
ref|XP_008458142.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  47.0    5e-04   
ref|XP_009381851.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...  46.6    6e-04   
ref|XP_010917296.1|  PREDICTED: crocetin glucosyltransferase, chl...  46.6    6e-04   
gb|ACD03260.1|  UDP-glycosyltransferase UGT75E2                       46.6    6e-04   
ref|XP_008458144.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  46.6    7e-04   
ref|XP_008659736.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  46.6    7e-04   
ref|NP_001057977.1|  Os06g0593800                                     46.2    8e-04   



>ref|XP_009612652.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=481

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  8    VNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQP  187
            ++ F++S+ +  S  +  L+  +  EG+PFTR+I+ T MAW G+VA+   +  TL WIQP
Sbjct  79   LHSFYSSLISHGSEFVTRLVTFRTAEGRPFTRIIYTTLMAWVGLVAKNINVPSTLFWIQP  138

Query  188  AAVFDIYYHYFTDY  229
            A VFDIYY+ FTDY
Sbjct  139  ATVFDIYYYCFTDY  152



>ref|XP_009622554.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=467

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  14   DFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAA  193
            +F+AS     S  ++++   + +EG+PF+R+I+   ++W G+VARR     TLLWIQPA 
Sbjct  85   EFYASFIALGSEFVSEIFTDRAKEGRPFSRIIYTAVLSWVGIVARRLNAPATLLWIQPAT  144

Query  194  VFDIYYHYFTDY  229
            + DIYY+YFT Y
Sbjct  145  LLDIYYYYFTSY  156



>ref|XP_009787090.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=466

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  14   DFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAA  193
            +F+AS     S  ++++ A + +EG+PF+R+I+ T ++W G+VA+R     TLLWIQPA 
Sbjct  85   EFYASFIALGSEFVSEIFADRAKEGRPFSRIIYTTVLSWVGIVAKRLNAPATLLWIQPAT  144

Query  194  VFDIYYHYFTDY  229
            + D+YY+YFT Y
Sbjct  145  LLDLYYYYFTSY  156



>dbj|BAG80545.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=467

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  11   NDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPA  190
            + F++S+ +  S  +  +I ++  EG PFTR+I+ T MAW GVVA+   +  T  WIQPA
Sbjct  80   DSFYSSLMSHGSEFVTQIIKSRVAEGHPFTRIIYTTIMAWVGVVAKSINVPSTFFWIQPA  139

Query  191  AVFDIYYHYFTDY  229
             V DIYY+ FTDY
Sbjct  140  TVLDIYYYCFTDY  152



>ref|XP_004229323.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=467

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 52/78 (67%), Gaps = 3/78 (4%)
 Frame = +2

Query  5    SVNDF---WASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLL  175
            SV+DF   ++SVK+  S  + +LI +  + G PF+ VI+   M W G+VA++  +  TL 
Sbjct  77   SVDDFHMFYSSVKSHGSKFIFNLIQSNAKNGTPFSHVIYTIIMEWVGLVAKKINIPSTLF  136

Query  176  WIQPAAVFDIYYHYFTDY  229
            WIQPA VFD+YY+ FTDY
Sbjct  137  WIQPATVFDVYYYRFTDY  154



>ref|XP_004247895.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=468

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +2

Query  17   FWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAV  196
            F++S+ +  S  +  +I ++  EG+PF RVI+ T MAW G+VA+   +  T  WIQPA V
Sbjct  82   FYSSLVSHGSEFMTQIIESRAVEGRPFKRVIYTTLMAWVGIVAKGINVPSTFFWIQPATV  141

Query  197  FDIYYHYFTDY  229
             DIYY+ FTDY
Sbjct  142  MDIYYYCFTDY  152



>ref|XP_006342284.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=467

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 53/78 (68%), Gaps = 3/78 (4%)
 Frame = +2

Query  5    SVNDFW---ASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLL  175
            SV+DF+   +SVK++ S  + +LI +  + G PF+ VI+   M W G+VA++  +  TL 
Sbjct  77   SVDDFYLFYSSVKSRGSKFIFNLIQSNAKNGTPFSHVIYTIIMEWVGLVAKKINVPSTLF  136

Query  176  WIQPAAVFDIYYHYFTDY  229
            WIQPA VFD+YY+ FT+Y
Sbjct  137  WIQPATVFDVYYYRFTNY  154



>ref|XP_009765809.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X1 [Nicotiana sylvestris]
Length=485

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +2

Query  17   FWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAV  196
            F +++K+  S  +A+LI +K + G PFTRVI+   M WAG VA++  +  TL WIQPA V
Sbjct  100  FNSAIKSHGSEFIANLIKSKAKNGYPFTRVIYTILMDWAGSVAKKLHIPSTLFWIQPATV  159

Query  197  FDIYYHYFTDY  229
            FDIYY+ FT++
Sbjct  160  FDIYYYRFTNF  170



>ref|XP_009612650.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X1 [Nicotiana tomentosiformis]
Length=467

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  23   ASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFD  202
            +++KT  S  +A+LI +  + G PFTRVI+   M WAG VA++F +  TL WIQPA VFD
Sbjct  84   SAIKTHGSEFIANLIKSNAENGCPFTRVIYTILMDWAGSVAKKFNIPSTLFWIQPATVFD  143

Query  203  IYYHYFTDY  229
            IYY+ FT++
Sbjct  144  IYYYRFTNF  152



>dbj|BAA19155.1| glucosyl transferase [Nicotiana tabacum]
Length=467

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +2

Query  17   FWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAV  196
            F +++K+  S  +A+LI +K + G PFTRVI+   M WAG VA++  +  TL WIQPA V
Sbjct  82   FNSAIKSHGSEFIANLIKSKAKNGYPFTRVIYTILMDWAGSVAKKLHIPSTLFWIQPATV  141

Query  197  FDIYYHYFTDY  229
            FDIYY+ FT++
Sbjct  142  FDIYYYRFTNF  152



>ref|XP_007221319.1| hypothetical protein PRUPE_ppa021645mg [Prunus persica]
 gb|EMJ22518.1| hypothetical protein PRUPE_ppa021645mg [Prunus persica]
Length=474

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EG+P+T +I+   + WA VVAR   L   L+WIQPA VFDIYY+YF+ Y
Sbjct  99   KEGRPYTCLIYTILLPWAAVVARELHLPSVLVWIQPATVFDIYYYYFSGY  148



>emb|CDP15120.1| unnamed protein product [Coffea canephora]
Length=466

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  8    VNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQP  187
            V ++  S+ T+ S  L +LI A++ EG+P T V++A  M W G VAR+ Q+  TLLWIQP
Sbjct  76   VQEYMTSLVTRGSQTLKELIMAQSNEGRPITHVVYAILMPWVGQVARQLQIPSTLLWIQP  135

Query  188  AAVFDIYYHYF  220
            AA+F +YY +F
Sbjct  136  AALFQLYYCFF  146



>dbj|BAG80537.1| putative glycosyltransferase [Lycium barbarum]
Length=471

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ G PF+ VI+   M WAG VA++  +  TL W QPA VFDIYY+ FTDY
Sbjct  103  SKNGPPFSHVIYTPLMDWAGSVAKKINIPSTLFWTQPATVFDIYYYRFTDY  153



>ref|XP_004252977.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=463

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  8    VNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQP  187
            +++F AS++T  +  + +L+  + ++G PF R+I+ T  AW G++A++  +  T LWIQP
Sbjct  79   IHEFNASLRTHGTEFVTNLVEDRAKQGCPFKRIIYTTLTAWIGLLAKKINVPSTFLWIQP  138

Query  188  AAVFDIYYHYFTDY  229
            A+V +IYY++F  Y
Sbjct  139  ASVLNIYYYFFNGY  152



>ref|XP_008222736.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Prunus mume]
Length=474

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EG+P+T +I+   + WA V AR   L   L+WIQPA VFDIYY+YF  Y
Sbjct  99   KEGRPYTCLIYTILLPWAAVAARELHLPSVLVWIQPATVFDIYYYYFRGY  148



>ref|XP_004242781.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=466

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  95   FTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            FTR+I+ T MAW G VA+   +  TL WIQP  + DIYY+YFTDY
Sbjct  110  FTRIIYTTLMAWVGSVAKIINVPSTLFWIQPVTILDIYYYYFTDY  154



>ref|XP_008380456.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            +++ +W+ ++ + + A+ DL+ +   EG P+T +++   + WA  VA    L   LLWIQ
Sbjct  74   NIDHYWSELRRRGAQAITDLVVSSANEGHPYTCLVYTILLPWAADVAHELHLPNVLLWIQ  133

Query  185  PAAVFDIYYHYFTDY  229
            PA VFDIYY+YF  Y
Sbjct  134  PATVFDIYYYYFNGY  148



>ref|XP_006349902.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=459

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            S  +F AS++T  +  + +L+  + ++G PF R+I+ T  AW G++A+   +  T LWIQ
Sbjct  78   SFREFNASLRTHGTEFVTNLVEDRAKQGCPFKRIIYTTLTAWIGLLAKSINVPSTFLWIQ  137

Query  185  PAAVFDIYYHYFTDY  229
            PA+V +IYY++F  Y
Sbjct  138  PASVLNIYYYFFNGY  152



>emb|CDP15119.1| unnamed protein product [Coffea canephora]
Length=466

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  17   FWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAV  196
            +  S  T+ S  L +LI A++ EG P T V++   M+W G VAR+ Q+  TLLWIQPAAV
Sbjct  79   YMTSAATRGSQTLKELIMAQSNEGHPITHVVYTILMSWVGQVARQLQIPSTLLWIQPAAV  138

Query  197  FDIYYHYF  220
            F +YY +F
Sbjct  139  FQLYYCFF  146



>ref|XP_008222735.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Prunus mume]
Length=473

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EG+P+T +I+   + WA VVA    L   L+WIQPA VFDIYY+YF  Y
Sbjct  99   KEGRPYTCLIYTILLPWAAVVASELHLPSVLMWIQPATVFDIYYYYFGGY  148



>dbj|BAB88935.1| glucosyltransferase [Nicotiana tabacum]
Length=470

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  17   FWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAV  196
            + + +K++ S  L D+I   + EG+P T ++++  + WA  VAR F +   LLWIQPA V
Sbjct  81   YMSEIKSRGSKTLKDIILKSSDEGRPVTSLVYSLLLPWAAKVAREFHIPCALLWIQPATV  140

Query  197  FDIYYHYFTDY  229
             DIYY+YF  Y
Sbjct  141  LDIYYYYFNGY  151



>ref|XP_009778637.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
 ref|XP_009778638.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=463

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +2

Query  11   NDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPA  190
            ++F  S +T+ S  + +L+  + +EG PF R+++ T   W G++A+   +  T LWIQPA
Sbjct  80   HEFNNSFRTQGSEFVINLVKTRAKEGNPFKRIVYTTLTGWVGLLAKNINVPSTFLWIQPA  139

Query  191  AVFDIYYHYFTDY  229
             V DIYY++F  Y
Sbjct  140  TVLDIYYYFFNGY  152



>ref|XP_009601422.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=470

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  17   FWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAV  196
            + + +K++ S  L D+I   + EG+P T ++++  + WA  VAR F +   LLWIQPA V
Sbjct  81   YMSEIKSRGSETLKDIILKSSDEGRPVTSLVYSLLLPWAAKVAREFHIPCALLWIQPATV  140

Query  197  FDIYYHYFTDY  229
             DIYY+YF  Y
Sbjct  141  LDIYYYYFNGY  151



>ref|XP_007163802.1| hypothetical protein PHAVU_001G265400g [Phaseolus vulgaris]
 gb|ESW35796.1| hypothetical protein PHAVU_001G265400g [Phaseolus vulgaris]
Length=531

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            +V  + A +K + S    ++I +  QEGKPFT V +   + W   VAR F++   LLWIQ
Sbjct  135  NVISYMAELKLRGSEFFRNIITSAKQEGKPFTCVAYTLMLPWVAKVAREFRIPGVLLWIQ  194

Query  185  PAAVFDIYYHYFTDY  229
             A V DIYYHYF +Y
Sbjct  195  AATVLDIYYHYFHEY  209



>ref|XP_009790237.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=468

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  17   FWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAV  196
            + + +K++ S  L D+I   + EG+P T ++++  + WA  VAR F +   LLWIQPA V
Sbjct  81   YMSEIKSRGSETLKDIILKSSDEGRPVTSLVYSLLLPWAANVAREFHIPCALLWIQPATV  140

Query  197  FDIYYHYFTDY  229
             DIYY+YF  Y
Sbjct  141  LDIYYYYFNGY  151



>ref|XP_009590508.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=463

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +2

Query  11   NDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPA  190
            ++F  S +T  S  + DL+  +  +G PF R+I+ T   W G++A+   +  T LWIQPA
Sbjct  80   HEFNKSFRTNGSEFVTDLVKTRKNQGNPFKRIIYTTLTGWVGLLAKSINVPSTFLWIQPA  139

Query  191  AVFDIYYHYFTDY  229
             V DIYY++F  Y
Sbjct  140  TVLDIYYYFFNGY  152



>ref|XP_010023603.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59914.1| hypothetical protein EUGRSUZ_H02638 [Eucalyptus grandis]
Length=470

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            +V+ F + ++ + S  L DLIA+K  EG+P+T ++++  + WA  VAR F++   LLWIQ
Sbjct  74   NVSQFMSELRRRGSEKLRDLIASKVGEGRPYTCLVYSLLLPWAAEVAREFRVPSALLWIQ  133

Query  185  PAAVFDIYYHYFTDY  229
            PA V D+YY+YF  Y
Sbjct  134  PATVLDMYYYYFNGY  148



>ref|XP_007221281.1| hypothetical protein PRUPE_ppa005161mg [Prunus persica]
 gb|EMJ22480.1| hypothetical protein PRUPE_ppa005161mg [Prunus persica]
Length=474

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EG+P+T +I+   + WA   AR   L   L+WIQPA VFDIYY+YF+ Y
Sbjct  99   KEGRPYTCLIYTILLPWAAEAARELHLPSVLVWIQPATVFDIYYYYFSGY  148



>ref|XP_004247896.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=476

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +2

Query  5    SVNDF---WASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLL  175
            S N+F   ++S+K+  S  + +LI +  +   PFT VI+   M W  +VA+      TL 
Sbjct  95   SFNEFHLYYSSIKSHGSEFIFNLIKSNAKNCTPFTHVIYTVVMEWTALVAKELNTPSTLF  154

Query  176  WIQPAAVFDIYYHYFTDY  229
            WIQPA VFDIYY+ +TDY
Sbjct  155  WIQPATVFDIYYYRYTDY  172



>ref|XP_009373577.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=474

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            +++D+ + ++ + + A++DL+ +  +EG P+T +++   + WA  VA    L   LLWIQ
Sbjct  74   NIDDYMSELRRRGAQAISDLVVSSAKEGHPYTCLVYTILLPWAADVAHELHLPNVLLWIQ  133

Query  185  PAAVFDIYYHYFTDY  229
            PA VFDIYY+YF  Y
Sbjct  134  PATVFDIYYYYFNGY  148



>ref|XP_008380454.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG P+T +++ T + WA  VA    L+  LLWIQPA VFDIYY+YF  Y
Sbjct  100  EGHPYTCLVYTTFLPWAADVAYELHLQNVLLWIQPATVFDIYYYYFNGY  148



>ref|XP_009373578.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=481

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            +++D+ + ++ +   A+ DL+ A   EG P+T ++++  + WA  VA    L   LLWIQ
Sbjct  74   NIDDYMSELRRRGVQAITDLVVASANEGHPYTCLVYSLIVPWAAGVAHELHLPSVLLWIQ  133

Query  185  PAAVFDIYYHYFTDY  229
            PA VFDIYY+YF  Y
Sbjct  134  PATVFDIYYYYFNGY  148



>ref|XP_010527436.1| PREDICTED: UDP-glycosyltransferase 75C1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527437.1| PREDICTED: UDP-glycosyltransferase 75C1 isoform X2 [Tarenaya 
hassleriana]
Length=466

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTD  226
            P T VI++  + WA  VAR F L  TLLWI+PA V D+YY+YFTD
Sbjct  110  PITAVIYSILVPWAAAVAREFHLPATLLWIEPATVLDVYYYYFTD  154



>emb|CBI39411.3| unnamed protein product [Vitis vinifera]
Length=290

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  74   KNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +  EG+PFT +++   + W   VAR   L   L+W QPAAVFDIYY+YF  Y
Sbjct  99   RANEGRPFTCLLYGMLIPWVAEVARSLHLPSALVWSQPAAVFDIYYYYFNGY  150



>ref|XP_004504379.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cicer arietinum]
 gb|AGU14114.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +Q+G PFT ++++  + WA   AR F L   LLW+QPA +FDI YHYF  Y
Sbjct  100  SQKGTPFTCLVYSLLLPWAAETARGFHLPTALLWVQPATMFDILYHYFHGY  150



>ref|XP_010023602.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=470

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P+T ++++  + WA  VAR F +   LLWIQPA V D+YY+YF  Y
Sbjct  100  EGRPYTCLVYSLLLPWAAEVAREFHVPSALLWIQPATVLDMYYYYFNGY  148



>gb|KDP32590.1| hypothetical protein JCGZ_13140 [Jatropha curcas]
Length=455

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + +G PFT V+++  + W   VAR F L   LLW QPA VF IYYHYF  Y
Sbjct  98   SNDGHPFTFVVYSILIPWVAKVAREFHLPSALLWSQPATVFSIYYHYFNGY  148



>ref|XP_010673328.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P T +++   + W   VAR+F +   LLWIQPA VFDIYY+YF  Y
Sbjct  102  EGRPVTCLVYTLLLPWVAEVARKFHVPSALLWIQPATVFDIYYYYFNGY  150



>ref|XP_006307449.1| hypothetical protein CARUB_v10009073mg [Capsella rubella]
 gb|EOA40347.1| hypothetical protein CARUB_v10009073mg [Capsella rubella]
Length=462

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFT  223
            P T +I+   + WA  VARRFQL   LLWIQPA VFDIYY+YFT
Sbjct  106  PVTCLIYTILLNWAPKVARRFQLPCALLWIQPALVFDIYYNYFT  149



>gb|KHN12357.1| UDP-glycosyltransferase 75D1 [Glycine soja]
Length=424

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            QEG PFT +++ T ++W   VAR F L   +LW QPA + DI+Y+YF ++
Sbjct  56   QEGHPFTCLVYTTLLSWVAEVAREFHLPTAMLWTQPATILDIFYYYFHEH  105



>dbj|BAF49301.1| putative glycosyltransferase [Clitoria ternatea]
Length=469

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EG+PFT +++   +  A  VAR F L F LLWI+PAAV DI Y+YF DY
Sbjct  98   KEGQPFTCLVYTLLLPCAADVARSFNLPFALLWIEPAAVLDILYYYFHDY  147



>ref|XP_003531212.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=465

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            QEG PFT +++ T ++W   VAR F L   +LW QPA + DI+Y+YF ++
Sbjct  97   QEGHPFTCLVYTTLLSWVAEVAREFHLPTAMLWTQPATILDIFYYYFHEH  146



>gb|AAY27090.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Pyrus communis]
Length=481

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            +++D+ + ++ + + A+ DL+ A   EG P+T ++++  + W+  VA    L   LLWIQ
Sbjct  74   NIDDYMSELRHRGAQAITDLVVASANEGHPYTCLVYSLIVPWSAGVAHELHLPSVLLWIQ  133

Query  185  PAAVFDIYYHYFTDY  229
            PA VFDIYY+YF  Y
Sbjct  134  PATVFDIYYYYFNGY  148



>ref|XP_011024782.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=468

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EGKP T +++   + WA  VAR   L   LLWIQPA VFDIYY+YF  Y
Sbjct  99   KEGKPVTCLVYTMLLQWAAEVARAQHLPAALLWIQPATVFDIYYYYFNGY  148



>ref|XP_002301753.1| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|ABK96313.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81026.1| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
Length=472

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EGKP T +++   + WA  VAR   L   LLWIQPA VFDIYY+YF  Y
Sbjct  99   KEGKPVTCLVYTMLLHWASEVARAQHLPAALLWIQPATVFDIYYYYFNGY  148



>ref|XP_010650398.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=463

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  74   KNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +  EG+PFT +++   + W   VAR   L   L+W QPAAVFDIYY+YF  Y
Sbjct  95   RANEGRPFTCLLYGMLIPWVAEVARSLHLPSALVWSQPAAVFDIYYYYFNGY  146



>ref|XP_002263975.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=463

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  74   KNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +  EG+PFT +++   + W   VAR   L   L+W QPAAVFDIYY+YF  Y
Sbjct  95   RANEGRPFTCLLYGMLIPWVAEVARSLHLPSALVWSQPAAVFDIYYYYFNGY  146



>ref|XP_010485047.1| PREDICTED: UDP-glycosyltransferase 75B1 isoform X1 [Camelina 
sativa]
Length=465

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G P T +I+   + WA  VARR+QL   LLWIQPA VFDIYY++F  Y
Sbjct  104  GSPVTCLIYTILLNWAPKVARRYQLPCALLWIQPALVFDIYYNHFMGY  151



>gb|AAX16493.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Malus domestica]
Length=481

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            +V+D+ + ++ +   A+ DL+ A   EG P+T ++++  + W+  +A    L   LLWIQ
Sbjct  74   NVDDYMSELRRRGVQAITDLVVASANEGHPYTCLVYSLLLPWSAGMAHELHLPSVLLWIQ  133

Query  185  PAAVFDIYYHYFTDY  229
            PA VFDIYY+YF  Y
Sbjct  134  PATVFDIYYYYFNGY  148



>ref|XP_003552552.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Glycine max]
Length=465

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            S++ + + +K + S  L ++I A  QEG+PFT + +   + WA  VAR   +   LLWIQ
Sbjct  75   SLSSYMSELKRRGSEFLRNIITAAKQEGQPFTCLAYTILLPWAAKVARELHIPGALLWIQ  134

Query  185  PAAVFDIYYHYFTDY  229
             A VFDIYY+YF +Y
Sbjct  135  AATVFDIYYYYFHEY  149



>gb|KFK42892.1| hypothetical protein AALP_AA1G052200 [Arabis alpina]
Length=464

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTD  226
            P T V++   + WA  VARRFQL   LLWIQPA VFDIYY++FT+
Sbjct  106  PVTCVVYTILLNWAPKVARRFQLPSALLWIQPALVFDIYYNHFTE  150



>ref|XP_010522273.1| PREDICTED: UDP-glycosyltransferase 75B2-like [Tarenaya hassleriana]
Length=548

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  77   NQEGK-PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            N+ G+ P T +++   + WA  VARRF +  +LLWIQPA VFDIYY+YF  Y
Sbjct  161  NRRGESPVTCLVYTLLLTWAPAVARRFHIPSSLLWIQPALVFDIYYYYFNGY  212



>gb|EYU32718.1| hypothetical protein MIMGU_mgv1a005538mg [Erythranthe guttata]
Length=480

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  14   DFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAA  193
            +F A+++T  S A+ D +AA   E +PF+RVI+   + WAG VA R ++  TLLWIQPA 
Sbjct  76   NFMAALRTHGSKAVEDAVAAAAAENRPFSRVIYTLLVPWAGQVAHRLRVPVTLLWIQPAI  135

Query  194  VFDIYYHYFTDY  229
            +F +Y++YF  Y
Sbjct  136  LFGVYFYYFNKY  147



>ref|XP_002263700.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=469

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +2

Query  8    VNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQP  187
            V  + + +K + S  L +++     EG+PFT +++   + WA  VAR   +   LLWIQP
Sbjct  74   VQHYMSEIKRRGSETLREIVVRNADEGQPFTCIVYTLLLPWAAEVARGLGVPSALLWIQP  133

Query  188  AAVFDIYYHYFTDY  229
            A V DIYY+YF  Y
Sbjct  134  ATVLDIYYYYFNGY  147



>ref|XP_004298223.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P+T +++   ++W   VA   QL   L+WIQPA VFDIY++YF  Y
Sbjct  102  EGRPYTCIVYTILLSWVAKVASELQLPAALVWIQPATVFDIYFYYFNGY  150



>ref|XP_006368000.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=473

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + EG+P T +++   + WA  VAR   +   LLWIQPA V DIYY+YF  Y
Sbjct  101  SDEGRPVTSLVYTLLLPWAAEVARELHIPSALLWIQPATVLDIYYYYFNGY  151



>ref|XP_006358760.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=473

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + EG+P T +++   + WA  VAR   +   LLWIQPA V DIYY+YF  Y
Sbjct  101  SDEGRPVTSLVYTLLLPWAAEVARELHIPSALLWIQPATVLDIYYYYFNGY  151



>ref|XP_008380455.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=481

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            +++D+ + ++ +   A+ DL+ A   EG P+T ++++  + W+  +A    L   LLWIQ
Sbjct  74   NIDDYMSELRRRGVQAITDLVVASANEGHPYTCLVYSLLLPWSAGMAHELHLPSVLLWIQ  133

Query  185  PAAVFDIYYHYFTDY  229
            PA VFDIYY+YF  Y
Sbjct  134  PATVFDIYYYYFNGY  148



>ref|XP_007034187.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 ref|XP_007034188.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 ref|XP_007034189.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05113.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05114.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05115.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
Length=463

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EG  FT +++   M W  +VAR F +  TLLW QPA+VF  YY+YF DY
Sbjct  100  EEGIRFTCIVYGIMMPWVALVAREFHIPSTLLWNQPASVFVTYYYYFKDY  149



>ref|XP_010450109.1| PREDICTED: UDP-glycosyltransferase 75C1 [Camelina sativa]
Length=454

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  89   KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            +P T VI++  + WA  VAR+F L  TLLWI+PA V DIYY+YF
Sbjct  110  EPITGVIYSVLVPWAATVARKFHLPTTLLWIEPATVLDIYYYYF  153



>emb|CDY12370.1| BnaC08g08350D [Brassica napus]
Length=457

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            N   +P T VI++  + WA  VAR F L  TLLWI+PA V DIYY+YF
Sbjct  108  NAATEPITGVIYSVLVPWASTVAREFHLPATLLWIEPATVLDIYYYYF  155



>ref|XP_004247894.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=470

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + EG+P T +++   + WA  VAR   +   LLWIQPA V DIYY+YF  Y
Sbjct  101  SDEGRPVTSLVYTLLLPWAAEVARELHIPSALLWIQPATVLDIYYYYFNGY  151



>ref|XP_009108098.1| PREDICTED: UDP-glycosyltransferase 75C1 [Brassica rapa]
Length=454

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            N    P T VI++  + WA  VAR F L  TLLWI+PA V DIYY+YF
Sbjct  108  NAAKHPITGVIYSVLVPWASTVAREFHLPTTLLWIEPATVLDIYYYYF  155



>ref|XP_003629627.1| Indole-3-acetate beta-glucosyltransferase [Medicago truncatula]
 gb|AET04103.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=472

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            QE KPFT +++   + WA  VAR F LR   LWI+PA VFDI Y+YF  Y
Sbjct  108  QESKPFTCLLYTIIIPWAPRVARGFNLRSAKLWIEPATVFDILYYYFHGY  157



>emb|CDY27124.1| BnaA08g07620D [Brassica napus]
Length=454

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            N    P T VI++  + WA  VAR F L  TLLWI+PA V DIYY+YF
Sbjct  108  NAAKHPITGVIYSVLVPWASTVAREFHLPATLLWIEPATVLDIYYYYF  155



>gb|AAK54465.1| cold-induced glucosyl transferase [Solanum sogarandinum]
Length=473

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + EG+P T +++   + WA  VAR   +   LLWIQPA V DIYY+YF  Y
Sbjct  101  SDEGRPVTSLVYTLLLPWAAEVARELHIPSALLWIQPATVLDIYYYYFNGY  151



>dbj|BAG80544.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=469

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + +G+P T +++   + WA  VAR   +   LLWIQPAAV DIYY+YF  Y
Sbjct  101  SDDGRPVTSLVYTLLLPWAAEVAREHHIPCALLWIQPAAVLDIYYYYFNGY  151



>dbj|BAF49300.1| putative glycosyltransferase [Clitoria ternatea]
Length=472

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            QEG PFT +++   + WA  VAR F L   +LW QPA V DI YHYF  Y
Sbjct  99   QEGHPFTCLLYTPLLPWAAEVARGFHLPTAILWTQPATVLDILYHYFHGY  148



>dbj|BAF75879.1| glucosyltransferase [Dianthus caryophyllus]
Length=475

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EGK  T + +   + WA  VAR F +   LLWIQPAAVFD+YY+YF  Y
Sbjct  104  EGKKVTCLAYTLLLPWAAEVAREFHVPSALLWIQPAAVFDVYYYYFRGY  152



>ref|XP_010435193.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Camelina sativa]
Length=454

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  89   KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            +P T VI++  + WA  VAR+F L  TLLW++PA V DIYY+YF
Sbjct  110  EPITGVIYSVLVPWAATVARKFHLPTTLLWVEPATVLDIYYYYF  153



>ref|XP_008355875.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Malus domestica]
Length=260

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG P+T ++++  + W+  +A    L   LLWIQPA VFDIYY+YF  Y
Sbjct  100  EGHPYTCLVYSLLLPWSAGMAHELHLPRVLLWIQPATVFDIYYYYFNGY  148



>ref|XP_009337747.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=474

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG P+T +++   + WA  VA    L   LLWIQPA VFD+YY+YF  Y
Sbjct  100  EGHPYTCLVYTILLPWAADVAHELHLPNVLLWIQPATVFDVYYYYFNGY  148



>gb|AAL69494.1| putative glucosyltransferase [Arabidopsis thaliana]
Length=466

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            E +P T VI++  + W   VAR F L  TLLWI+PA V DIYY+YF
Sbjct  120  ETEPITGVIYSVLVPWVSTVAREFHLPTTLLWIEPATVLDIYYYYF  165



>ref|XP_003629628.1| UDP-glucose flavonoid 7-O-glucosyltransferase [Medicago truncatula]
 gb|AET04104.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=465

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            +QEG PFT ++ +  + WA   AR F L   LLW+QPA VFDI Y+YF
Sbjct  98   SQEGTPFTCLVHSLLLQWAAEAAREFHLPTALLWVQPATVFDILYYYF  145



>dbj|BAE98677.1| glucosyltransferase like protein [Arabidopsis thaliana]
Length=456

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            E +P T VI++  + W   VAR F L  TLLWI+PA V DIYY+YF
Sbjct  110  ETEPITGVIYSVLVPWVSTVAREFHLPTTLLWIEPATVLDIYYYYF  155



>ref|NP_193146.1| anthocyanin 5-O-glucosyltransferase [Arabidopsis thaliana]
 sp|Q0WW21.2|U75C1_ARATH RecName: Full=UDP-glycosyltransferase 75C1; AltName: Full=Anthocyanin 
5-O-glucosyltransferase; AltName: Full=UDP glucose:anthocyanin 
5-O-glucosyltransferase [Arabidopsis thaliana]
 emb|CAB10189.1| glucosyltransferase like protein [Arabidopsis thaliana]
 emb|CAB78452.1| glucosyltransferase like protein [Arabidopsis thaliana]
 gb|AAL32667.1| glucosyltransferase [Arabidopsis thaliana]
 gb|AAM47973.1| glucosyltransferase [Arabidopsis thaliana]
 gb|AAM91686.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AEE83370.1| anthocyanin 5-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AHL38699.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=456

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            E +P T VI++  + W   VAR F L  TLLWI+PA V DIYY+YF
Sbjct  110  ETEPITGVIYSVLVPWVSTVAREFHLPTTLLWIEPATVLDIYYYYF  155



>ref|XP_003601707.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula]
 gb|AES71958.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=479

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            QEG+PFT + +   + W   VAR   L   LLWIQ A VFDIYY+YF ++
Sbjct  101  QEGRPFTCLAYGIIIPWVAKVARELHLPSALLWIQAATVFDIYYYYFHEH  150



>ref|XP_004298222.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG P+T +++   ++W G VA    L   L WIQPA VFDIYY+YF  Y
Sbjct  101  EGHPYTCIVYTLLLSWVGGVATELHLPSALAWIQPATVFDIYYYYFNGY  149



>ref|XP_010099953.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB80936.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=493

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            SV+ +   ++ + S A++DL+ +  +EG P+T ++++  + WA + A    L   LLWIQ
Sbjct  84   SVDHYLNEIRRRGSQAISDLVISAAKEGHPYTCLVYSLLLPWAALTAEELCLPSVLLWIQ  143

Query  185  PAAVFDIYYHYFTDY  229
            PA VFDIYY+YF  Y
Sbjct  144  PATVFDIYYYYFHGY  158



>ref|XP_007034186.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
 gb|EOY05112.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
Length=465

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + EGKP T ++++  + WA  VAR   +   +LWIQPA V DIYY+YF  Y
Sbjct  97   DNEGKPVTCIVYSLLLPWAMEVAREHHIPSAMLWIQPATVLDIYYYYFNGY  147



>ref|XP_004297014.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P+T +++   ++W   VA    L   L WIQPA VFDIYY+YF  Y
Sbjct  101  EGRPYTCIVYTLLLSWVAEVATELHLPTALAWIQPATVFDIYYYYFNGY  149



>gb|EYU31588.1| hypothetical protein MIMGU_mgv1a005398mg [Erythranthe guttata]
Length=485

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++G+P T+++++  + WA  VAR F +   LLWIQPA V +IYY+YF  Y
Sbjct  121  EQGRPVTQLVYSLLLPWAPEVAREFHVPSALLWIQPATVLNIYYYYFNGY  170



>ref|XP_010450127.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Camelina sativa]
Length=454

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  89   KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            +P T VI++  + WA  VAR F L  TLLWI+PA V DIYY+YF
Sbjct  110  EPITGVIYSVFVPWAATVAREFHLPTTLLWIEPATVLDIYYYYF  153



>gb|EYU31585.1| hypothetical protein MIMGU_mgv1a007491mg [Erythranthe guttata]
Length=405

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++G+P T++++   + WA  VAR F +   LLWIQPA V +IYY+YF  Y
Sbjct  41   EQGRPVTQLVYTLLLPWAPEVAREFHVPSALLWIQPATVLNIYYYYFNGY  90



>ref|XP_002892298.1| UDP-glucosyl transferase 75B1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68557.1| UDP-glucosyl transferase 75B1 [Arabidopsis lyrata subsp. lyrata]
Length=474

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            P T VI+   + WA  VARRFQL   LLWIQPA VFDIYY++F
Sbjct  106  PVTCVIYTILLNWAPKVARRFQLPSALLWIQPALVFDIYYNHF  148



>ref|XP_003601706.1| UDP-glucose glucosyltransferase [Medicago truncatula]
 gb|AES71957.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=472

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            QEG+PFT + +   + W   VAR   L   LLWIQ A VFDIYY+YF ++
Sbjct  101  QEGRPFTCLAYGIIIPWVAKVARELHLPSALLWIQAATVFDIYYYYFHEH  150



>ref|XP_010246531.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=471

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            SV  F + +K + S  L +LI +  +EG+P + ++    + WA  VAR   + + LLWIQ
Sbjct  73   SVEHFLSELKRRGSETLRELILSLAREGRPVSCLVHTLLLPWAADVARNLDVPWALLWIQ  132

Query  185  PAAVFDIYYHYFTDY  229
            PA VFDIYY+ FT Y
Sbjct  133  PATVFDIYYYNFTGY  147



>ref|XP_008348418.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG P+T +++   + WA  VA    L   LLWIQPA VFDIYY+YF  +
Sbjct  100  EGHPYTCMVYTILLPWAADVAHELHLPNVLLWIQPATVFDIYYYYFNGF  148



>ref|XP_010243149.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=471

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            SV  F + +K + S  L +LI +  +EG+P + ++    + WA  VAR   + + LLWIQ
Sbjct  73   SVEHFLSELKRRGSETLRELILSLAREGRPVSCLVHTLLLPWAADVARNLDVPWALLWIQ  132

Query  185  PAAVFDIYYHYFTDY  229
            PA VFDIYY+ FT Y
Sbjct  133  PATVFDIYYYNFTGY  147



>ref|XP_008359982.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Malus domestica]
Length=218

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
             EG P+T ++++  + W+  +A    L   LLWIQPA VFDIYY+YF  Y
Sbjct  99   NEGHPYTCLVYSLLLPWSAGMAHELHLPRVLLWIQPATVFDIYYYYFNGY  148



>emb|CAN77410.1| hypothetical protein VITISV_038710 [Vitis vinifera]
Length=299

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P T ++    +AW   +AR  QL F LLWIQ A VF IY+HYF  Y
Sbjct  99   QGRPVTCLVHTILLAWVAELARSLQLSFALLWIQSATVFIIYHHYFDGY  147



>ref|XP_002868314.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44573.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=453

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  89   KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            +P T VI++  + W   VAR F L  TLLWI+PA V DIYY+YF
Sbjct  108  EPITGVIYSVLVPWVSTVAREFHLPTTLLWIEPATVLDIYYYYF  151



>sp|Q9ZR25.1|5GT_VERHY RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase; 
AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
HGT8; Flags: Precursor [Glandularia x hybrida]
 dbj|BAA36423.1| UDP-glucose:anthocyanin 5-O-glucosyltransferase [Glandularia 
x hybrida]
Length=461

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +Q+    T V+++   AWA  VAR F LR  LLWI+PA V DI+Y YF  Y
Sbjct  101  DQKSSKITFVVYSHLFAWAAKVAREFHLRSALLWIEPATVLDIFYFYFNGY  151



>emb|CDY22902.1| BnaA01g18400D [Brassica napus]
Length=462

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR FQ+   LLW+QP  VF I+YHYF  Y
Sbjct  120  RQNRPFTCVVYTILLTWVAELAREFQIPSALLWVQPVTVFSIFYHYFNGY  169



>ref|XP_010040347.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45290.1| hypothetical protein EUGRSUZ_L01046 [Eucalyptus grandis]
Length=411

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G  FT V+  T + W   VAR  Q++  L+WIQPA VFDIYYHYF+ Y
Sbjct  54   QGLSFTCVLH-TIVPWVHDVARSLQIKLVLVWIQPATVFDIYYHYFSGY  101



>ref|XP_010025793.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=413

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G  FT V+  T + W   VAR  Q++  L+WIQPA VFDIYYHYF+ Y
Sbjct  118  QGLSFTCVLH-TIVPWVHDVARSLQIKLVLVWIQPATVFDIYYHYFSGY  165



>ref|XP_011020320.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=472

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +2

Query  8    VNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQP  187
            +N ++  ++   S +LA+LI A ++ G+PFTRV+++  + W   VAR  +L  TLLW Q 
Sbjct  79   INHYFTELRLVGSKSLAELIVASSKNGRPFTRVVYSNLIPWVAKVARELKLPSTLLWNQS  138

Query  188  AAVFDIYYHYFTDY  229
             A+ DI+Y+YF  Y
Sbjct  139  PALLDIFYYYFNGY  152



>ref|XP_011069457.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like, 
partial [Sesamum indicum]
Length=372

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++G+P T +I+   + WA  VAR   +   LLWIQPA V DIYY+YF  Y
Sbjct  101  EQGRPVTCLIYTLLLPWASEVAREVNIPSALLWIQPATVLDIYYYYFNGY  150



>emb|CDY65144.1| BnaC01g41850D [Brassica napus]
Length=462

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR FQ+   LLW+QP  VF I+YHYF  Y
Sbjct  120  RQNRPFTCVVYTILLTWVAELAREFQIPSALLWVQPVTVFSIFYHYFNGY  169



>ref|XP_009146925.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Brassica rapa]
Length=477

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR FQ+   LLW+QP  VF I+YHYF  Y
Sbjct  120  RQNRPFTCVVYTILLTWVAELAREFQIPSALLWVQPVTVFSIFYHYFNGY  169



>ref|XP_009381252.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=478

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+P T +++   + WA  VAR + +R    WIQPA VF +YYHYF DY
Sbjct  112  GRPVTCIVYTMLLPWAADVAREYGIRSIHYWIQPATVFAVYYHYFHDY  159



>ref|XP_010100065.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB81236.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=402

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EG P+T ++++  + WA + A    L   LLWIQPA VFDIYY+YF  Y
Sbjct  109  KEGHPYTCLVYSLLITWAVLTAEELCLPSVLLWIQPATVFDIYYYYFHGY  158



>gb|KCW57186.1| hypothetical protein EUGRSUZ_H00001, partial [Eucalyptus grandis]
Length=388

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G  FT V+  T + W   VAR  Q++  L+WIQPA VFDIYYHYF+ Y
Sbjct  99   QGLSFTCVLH-TIVPWVHDVARSLQIKLVLVWIQPATVFDIYYHYFSGY  146



>gb|AAL24226.1| AT4g15550/dl3815c [Arabidopsis thaliana]
 gb|AAM65349.1| AT4g15550/dl3815c [Arabidopsis thaliana]
Length=418

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR F L   LLW+QP  VF I+YHYF  Y
Sbjct  62   KQNRPFTCVVYTILLTWVAELAREFHLPSALLWVQPVTVFSIFYHYFNGY  111



>gb|KDP32582.1| hypothetical protein JCGZ_13132 [Jatropha curcas]
Length=463

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EGKP T +++   + WA  VAR   L   LLWIQPA V DIYY+Y   Y
Sbjct  101  EGKPVTCLVYTLLLPWAAEVARAHHLPCALLWIQPATVLDIYYYYLNGY  149



>ref|XP_009373576.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=572

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG P+T ++    + WA  VA    L   LLWIQPA VFDIYY+YF  Y
Sbjct  198  EGHPYTCLVCTILLPWAANVAHELHLPNVLLWIQPATVFDIYYYYFNGY  246



>ref|NP_567471.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
 sp|O23406.2|U75D1_ARATH RecName: Full=UDP-glycosyltransferase 75D1 [Arabidopsis thaliana]
 gb|AEE83624.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
 gb|AHL38691.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=474

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR F L   LLW+QP  VF I+YHYF  Y
Sbjct  118  KQNRPFTCVVYTILLTWVAELAREFHLPSALLWVQPVTVFSIFYHYFNGY  167



>ref|XP_006282890.1| hypothetical protein CARUB_v10007134mg [Capsella rubella]
 gb|EOA15788.1| hypothetical protein CARUB_v10007134mg [Capsella rubella]
Length=456

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            + + +P T VI++  + W   VAR F L  TLLWI+PA V DIYY+YF
Sbjct  106  DSKTEPITGVIYSVLVPWVSSVAREFHLPTTLLWIEPATVLDIYYYYF  153



>gb|AAB58497.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
Length=474

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR F L   LLW+QP  VF I+YHYF  Y
Sbjct  118  KQNRPFTCVVYTILLTWVAELAREFHLPSALLWVQPVTVFSIFYHYFNGY  167



>ref|XP_006418014.1| hypothetical protein EUTSA_v10007593mg [Eutrema salsugineum]
 dbj|BAJ33712.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36367.1| hypothetical protein EUTSA_v10007593mg [Eutrema salsugineum]
Length=456

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  77   NQEG-KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            N++G  P T +++   + WA  VARRFQL   LLWIQPA VFDIYY +F
Sbjct  100  NRDGDSPVTCLVYTILLNWAPKVARRFQLPSALLWIQPALVFDIYYDHF  148



>ref|XP_008380634.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Malus domestica]
Length=472

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/75 (35%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            S++++ + ++ + + A+ DL+ +   EG P+T +++ + + W   VA    L   L WIQ
Sbjct  74   SIDNYLSELRRRGAQAITDLVVSSANEGHPYTCLVYTSFLPWVAEVAHELHLPNVLFWIQ  133

Query  185  PAAVFDIYYHYFTDY  229
            PA VFDI+Y+YF  Y
Sbjct  134  PATVFDIHYYYFNGY  148



>ref|XP_010485054.1| PREDICTED: UDP-glycosyltransferase 75B1 isoform X2 [Camelina 
sativa]
Length=465

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  77   NQEG-KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            N+ G  P T +I+   + WA  VARR+QL   LLWIQPA VFDIYY++F
Sbjct  100  NRNGDSPVTCLIYTILLNWAPKVARRYQLPCALLWIQPALVFDIYYNHF  148



>ref|XP_003601705.1| O-glucosyltransferase [Medicago truncatula]
 gb|AES71956.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=478

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            QE  PFT +I+   ++WA  VA    L  TLLWIQ A VFDI+Y+YF ++
Sbjct  101  QENHPFTCLIYTLILSWAPKVAHELHLPSTLLWIQAATVFDIFYYYFHEH  150



>ref|XP_004297003.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Fragaria vesca 
subsp. vesca]
Length=471

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P+T +++   + W   VA    L   L+WIQPA VFDIYY+Y   Y
Sbjct  101  EGRPYTCIVYTILLPWVAQVASELHLPAALVWIQPATVFDIYYYYLNGY  149



>ref|XP_010475249.1| PREDICTED: UDP-glycosyltransferase 75B1-like [Camelina sativa]
Length=415

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            P T +I+   + WA  VARR+QL   LLWIQPA VFDIYY++F
Sbjct  55   PVTCLIYTILLNWAPKVARRYQLPCALLWIQPALVFDIYYNHF  97



>ref|XP_003560622.2| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Brachypodium distachyon]
Length=460

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            G+P TR+++A  + WA  VAR   +   L WIQPAAVF +YYHYF
Sbjct  99   GRPVTRMVYAFLVGWAPAVARAHGIPAALYWIQPAAVFAVYYHYF  143



>dbj|BAF96596.1| UDP-glucose:anthocysnin 5-O-glucosyltransferase [Rosa hybrid 
cultivar]
Length=364

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P+T +++   ++W   VA    L   L WIQPA VFDIYY+YF  Y
Sbjct  92   EGQPYTCMVYTLLLSWVAEVATELHLPSALAWIQPATVFDIYYYYFNGY  140



>ref|XP_002321086.2| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|EEE99401.2| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
Length=467

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EGKP T +++   + WA  VAR   L    LWIQPA VFDIY++YF  Y
Sbjct  99   KEGKPITCLVYTVLLPWAVEVARAQHLPAAFLWIQPATVFDIYFYYFNCY  148



>ref|XP_010457643.1| PREDICTED: UDP-glycosyltransferase 75B1-like [Camelina sativa]
Length=465

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  77   NQEG-KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            N+ G  P T +I+   + WA  VARR+QL   LLWIQPA VFDIYY++F
Sbjct  100  NRNGDSPVTCLIYTILLNWAPKVARRYQLPCALLWIQPALVFDIYYNHF  148



>ref|XP_002262883.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=469

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +2

Query  8    VNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQP  187
            +  + + +K + S  L +++   + EG+PFT ++    + WA  VAR   + + LLW +P
Sbjct  74   IQQYMSEIKRRGSETLREIVVRNSDEGRPFTCIVHTLLVPWAAEVARGLVVPYALLWNEP  133

Query  188  AAVFDIYYHYFTDY  229
            A V DIYY+YF  Y
Sbjct  134  ATVLDIYYYYFNGY  147



>emb|CAN67608.1| hypothetical protein VITISV_036779 [Vitis vinifera]
Length=469

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +2

Query  8    VNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQP  187
            +  + + +K + S  L +++   + EG+PFT ++    + WA  VAR   + + LLW +P
Sbjct  74   IQQYMSEIKRRGSETLREIVVRNSDEGRPFTCIVHTLLVPWAAEVARGLVVPYALLWNEP  133

Query  188  AAVFDIYYHYFTDY  229
            A V DIYY+YF  Y
Sbjct  134  ATVLDIYYYYFNGY  147



>ref|XP_006414807.1| hypothetical protein EUTSA_v10025167mg [Eutrema salsugineum]
 gb|ESQ56260.1| hypothetical protein EUTSA_v10025167mg [Eutrema salsugineum]
Length=455

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  98   TRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTD  226
            T VI++  + W   VAR F L  TLLWI+PA V DIYY+YF D
Sbjct  112  TTVIYSVLVPWVSTVARDFHLPTTLLWIEPATVLDIYYYYFND  154



>gb|ABL85474.1| glycosyltransferase UGT75L4 [Maclura pomifera]
Length=472

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P+T + +   + WA + A    L   LLWIQPA VFDIYY+YF  Y
Sbjct  105  EGRPYTCLAYTILLPWAALTAEEHGLPSVLLWIQPATVFDIYYYYFHGY  153



>emb|CBI39391.3| unnamed protein product [Vitis vinifera]
Length=403

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+PF  +++   + W   VA    +   L+W QPAAVFDIYY+YF  Y
Sbjct  176  EGRPFACLLYGVQIPWVAEVAHSLHIPSALVWTQPAAVFDIYYYYFNGY  224



>ref|XP_002868197.1| indole-3-acetate beta-D-glucosyltransferase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44456.1| indole-3-acetate beta-D-glucosyltransferase [Arabidopsis lyrata 
subsp. lyrata]
Length=475

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + +PFT V++   + W   +AR F L   LLW+QP  VF I+YHYF  Y
Sbjct  120  QNRPFTCVVYTILLTWVAELAREFHLPSALLWVQPVTVFSIFYHYFNGY  168



>ref|XP_010069411.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=456

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G  FT V+  T + W   VAR  Q++  L+WIQPA VFDIYYHYF+ Y
Sbjct  99   QGLSFTCVLH-TIVPWVHDVARSLQIKSVLVWIQPATVFDIYYHYFSGY  146



>gb|EYU31586.1| hypothetical protein MIMGU_mgv1a005918mg [Erythranthe guttata]
Length=465

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++G P T++++   + WA  VAR F +   LLWIQPA V +IYY+YF  Y
Sbjct  102  EQGCPVTQLVYTLLLPWAPEVAREFHVPSALLWIQPATVLNIYYYYFNGY  151



>ref|XP_002516389.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF46006.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=460

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++G P T +I++  ++W   VAR F L    LW QPA V D+YYHYF  Y
Sbjct  100  KDGHPVTCIIYSLLVSWVAKVARDFHLPSIFLWNQPATVLDVYYHYFHGY  149



>ref|XP_002267526.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=465

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+PF  +++   + W   VA    +   L+W QPAAVFDIYY+YF  Y
Sbjct  98   EGRPFACLLYGVQIPWVAEVAHSLHIPSALVWTQPAAVFDIYYYYFNGY  146



>ref|XP_002263422.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=456

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P T ++    +AWA  +AR  Q+   LLWIQ A VF IYYHYF  Y
Sbjct  99   QGRPVTCLVHTILLAWAAELARSLQVPSVLLWIQRATVFTIYYHYFNGY  147



>emb|CAN62624.1| hypothetical protein VITISV_001657 [Vitis vinifera]
Length=456

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P T ++    +AWA  +AR  Q+   LLWIQ A VF IYYHYF  Y
Sbjct  99   QGRPVTCLVHTILLAWAAELARSLQVPSVLLWIQRATVFTIYYHYFNGY  147



>ref|XP_002301754.1| hypothetical protein POPTR_0002s23770g [Populus trichocarpa]
 gb|EEE81027.1| hypothetical protein POPTR_0002s23770g [Populus trichocarpa]
Length=469

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EGKP T +++   + WA  VAR   L   LLWIQ A VFDIYY+YF  Y
Sbjct  99   KEGKPVTCLVYTMFLHWAAEVARAQHLPAALLWIQLATVFDIYYYYFNGY  148



>gb|ADG45874.1| UDP-glucosyltransferase [Isatis tinctoria]
Length=476

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR F +   LLW+QP  VF I+YHYF+ Y
Sbjct  120  RQNRPFTCVVYTILLTWVAELARDFHIPSALLWVQPVTVFSIFYHYFSGY  169



>ref|XP_002263301.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=464

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  74   KNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +  EG+PFT +++   + W   VA+ F L   L+W Q A VFDIYY+YF  Y
Sbjct  95   RANEGRPFTCLLYGIIIPWVAEVAQSFHLPSALVWSQAATVFDIYYYYFNGY  146



>gb|EYU31587.1| hypothetical protein MIMGU_mgv1a018203mg [Erythranthe guttata]
Length=465

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++G P T++++   + WA  VAR F +   LLWIQPA V +IYY+YF  Y
Sbjct  102  EQGCPVTQLVYTLLLPWAPEVAREFHVPSALLWIQPATVLNIYYYYFNGY  151



>ref|XP_002266800.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=257

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P T ++    + WA  +AR  Q+   LLWIQ A VF IYYHYF  Y
Sbjct  100  QGRPVTCLLHTILLTWAAELARSLQVPSALLWIQSATVFTIYYHYFNGY  148



>ref|XP_003524181.2| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=488

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG PFT +++   + WA  VAR   L   +LWIQPA V DI YHYF  Y
Sbjct  129  EGHPFTCLLYTLLVPWAPQVARGLNLPTAMLWIQPATVLDILYHYFHGY  177



>ref|XP_010039940.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45599.1| hypothetical protein EUGRSUZ_L00632 [Eucalyptus grandis]
Length=456

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G  FT V+  T + W   VAR  Q++  L+WIQPA VFDIYYHYF  Y
Sbjct  99   QGLSFTCVLH-TIVPWVHDVARSLQIKSVLVWIQPATVFDIYYHYFNGY  146



>ref|XP_008793438.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=468

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+P T +I+   + WA  VAR   +R  L WIQPA VF IYYHYF  Y
Sbjct  112  GRPVTCLIYTILLPWAADVAREHGIRSFLHWIQPAIVFAIYYHYFHGY  159



>dbj|BAD90935.1| monoterpene glucosyltransferase [Eucalyptus perriniana]
Length=467

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+ F  + + T + WAG VA   Q+  TL+W QPA + DIYY+YF  Y
Sbjct  99   EGRKFECMFYTTIVPWAGQVAHSLQIPSTLIWAQPATLLDIYYYYFNGY  147



>ref|XP_003532736.2| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=512

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+PFT +++   + W   VAR+F L   LLWI+PA V DI YH+F  Y
Sbjct  137  EGRPFTCLLYTLLLPWVADVARQFYLPTALLWIEPATVLDILYHFFHGY  185



>ref|XP_003524180.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Glycine max]
Length=460

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +2

Query  74   KNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            K QEG PFT ++    + WA   AR F L   LLW QPA + DI+Y YF ++
Sbjct  95   KAQEGHPFTCLVHTVLLPWAARAARGFHLPTALLWTQPATILDIFYCYFHEH  146



>ref|XP_008793436.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=467

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+P T +I+   + WA  VAR   +R  L WIQPA VF IYYHYF  Y
Sbjct  112  GRPVTCLIYTILLPWAADVAREHGIRSFLHWIQPAFVFAIYYHYFHGY  159



>ref|XP_010039961.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Eucalyptus grandis]
Length=210

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +2

Query  17   FWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAV  196
            + A +K + S AL  LI   + +G  FT  +  T + W   VAR  Q++  L+WIQPA V
Sbjct  77   YRAEMKRRGSEALRGLIEHSSGQGLSFT-CVLHTIVPWVHDVARSLQIKSVLVWIQPATV  135

Query  197  FDIYYHYFTDY  229
            FDIYYHYF  Y
Sbjct  136  FDIYYHYFNGY  146



>gb|KCW57754.1| hypothetical protein EUGRSUZ_H00503, partial [Eucalyptus grandis]
Length=404

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  122  MAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            M W   VAR  Q++  L+WIQPA VFDIYYHYF+ Y
Sbjct  96   MPWVHDVARSLQIKSVLVWIQPATVFDIYYHYFSGY  131



>gb|KCW45598.1| hypothetical protein EUGRSUZ_L006311, partial [Eucalyptus grandis]
Length=211

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +2

Query  17   FWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAV  196
            + A +K + S AL  LI   + +G  FT  +  T + W   VAR  Q++  L+WIQPA V
Sbjct  77   YRAEMKRRGSEALRGLIEHSSGQGLSFT-CVLHTIVPWVHDVARSLQIKSVLVWIQPATV  135

Query  197  FDIYYHYFTDY  229
            FDIYYHYF  Y
Sbjct  136  FDIYYHYFNGY  146



>gb|AFJ52965.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=473

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  11   NDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPA  190
            N  W  + ++ S  L+DLI     +G PF  ++++  + WA  VAR   L  TLLWIQPA
Sbjct  73   NKQWEQLNSRGSQFLSDLIVTNANQGTPFACLVYSPLLTWAVDVARDHNLPTTLLWIQPA  132

Query  191  AVFDIYYHYFTDY  229
             V DIYY+ F  Y
Sbjct  133  TVMDIYYYLFNGY  145



>emb|CDX68805.1| BnaC01g06480D [Brassica napus]
Length=433

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR F +   LLW+QP  VF I+YHYF  Y
Sbjct  115  RQNRPFTCVVYTIFLPWVAELAREFHIPSALLWVQPVTVFSIFYHYFNGY  164



>emb|CDY09070.1| BnaC08g10240D [Brassica napus]
Length=437

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR F +   LLW+QP  VF I+YHYF  Y
Sbjct  96   RQNRPFTCVVYTIFLPWVAELAREFHIPSALLWVQPVTVFSIFYHYFNGY  145



>ref|XP_010246963.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=459

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++E +P T +I+   ++WA  VA    +   LLWIQ AAVFDIYYHYF  +
Sbjct  97   SKEHRPVTCLIYTLLLSWAADVANNLGVASALLWIQSAAVFDIYYHYFNGF  147



>ref|XP_010440288.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=473

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR   L   LLW+QP  VF I+YHYF  Y
Sbjct  118  RQNRPFTCVVYTILLTWVAELAREIHLPSALLWVQPVTVFSIFYHYFNGY  167



>ref|XP_010068983.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW57189.1| hypothetical protein EUGRSUZ_H00004 [Eucalyptus grandis]
Length=465

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  8    VNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQP  187
            V+ F A +K + S AL  LI   +  G  FT  +  T   WA  VAR FQ++  L+WIQP
Sbjct  74   VDHFMAELKRRGSEALRGLIEYSSGRGLRFTCALH-TMFRWADEVARSFQIQSVLVWIQP  132

Query  188  AAVFDIYYHYFTDY  229
            A VF IYYHYF  Y
Sbjct  133  ATVFGIYYHYFNGY  146



>emb|CDY22742.1| BnaA08g05720D [Brassica napus]
Length=463

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR F +   LLW+QP  VF I+YHYF  Y
Sbjct  115  RQNRPFTCVVYTIFLPWVAELAREFHIPSALLWVQPVTVFSIFYHYFNGY  164



>ref|XP_009107848.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Brassica rapa]
Length=464

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR F +   LLW+QP  VF I+YHYF  Y
Sbjct  115  RQNRPFTCVVYTIFLPWVAELAREFHIPSALLWVQPVTVFSIFYHYFNGY  164



>gb|KFK36297.1| hypothetical protein AALP_AA4G104100 [Arabis alpina]
Length=456

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  89   KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            +P T VI++  + W   VAR F L  TLLWI+PA V +IYY+YF
Sbjct  109  EPITGVIYSLLVPWVSTVARSFHLPTTLLWIEPATVLNIYYYYF  152



>ref|XP_010549173.1| PREDICTED: UDP-glycosyltransferase 75D1 [Tarenaya hassleriana]
Length=478

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +PFT V+F   + W   VAR F L   LLW+QPA +FDI Y+Y   Y
Sbjct  113  RPFTCVVFTLLLPWVITVAREFHLPVALLWVQPATLFDILYYYVNGY  159



>gb|ABQ02258.1| O-glucosyltransferase 3 [Vitis labrusca]
Length=464

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P T ++    + WA  +AR  Q+   LLWIQ A VF IYYHYF  Y
Sbjct  100  QGRPVTCLLHTILLTWAAELARSLQVPSALLWIQSATVFTIYYHYFNGY  148



>emb|CAN76093.1| hypothetical protein VITISV_027116 [Vitis vinifera]
Length=466

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P T ++    + WA  +AR  Q+   LLWIQ A VF IYYHYF  Y
Sbjct  100  QGRPVTCLLHTILLTWAAELARSLQVPSALLWIQSATVFTIYYHYFNGY  148



>ref|XP_010230853.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Brachypodium 
distachyon]
Length=495

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            + G+P TRV++   + WA  VAR   +   L WIQPAAVF +YYH+F
Sbjct  116  RRGRPVTRVVYTFLVPWAPDVARAHGVPAALFWIQPAAVFAVYYHFF  162



>ref|XP_004502258.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cicer arietinum]
 gb|AGU14117.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            PFT + +   + WA  VAR  QL + LLWIQ A VFDIYY+Y  ++
Sbjct  105  PFTCLAYTLLLPWAANVARELQLPYALLWIQAATVFDIYYYYLHEH  150



>emb|CDP15115.1| unnamed protein product [Coffea canephora]
Length=451

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + G+P T ++    + WA  VAR + + +TLLWIQPA V  I Y+YF  Y
Sbjct  100  ETGRPVTCIVHTLTLTWAAEVAREYHIPWTLLWIQPATVLGITYYYFNGY  149



>gb|KFK39474.1| hypothetical protein AALP_AA3G248900 [Arabis alpina]
Length=475

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +P T V++   + W   +AR F L   LLW+QP  VF I+YHYF  Y
Sbjct  119  RQNRPITCVVYTILLTWVAELAREFHLPSALLWVQPITVFSIFYHYFNGY  168



>ref|NP_563742.1| UDP-glucosyltransferase 75B1 [Arabidopsis thaliana]
 sp|Q9LR44.1|U75B1_ARATH RecName: Full=UDP-glycosyltransferase 75B1; AltName: Full=(Uridine 
5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl 
transferase 1; AltName: Full=IAA-Glu synthase 1; AltName: 
Full=Indole-3-acetate beta-glucosyltransferase 1 [Arabidopsis 
thaliana]
 gb|AAF79730.1|AC005106_11 T25N20.21 [Arabidopsis thaliana]
 gb|AAK32944.1|AF367358_1 At1g05560/T25N20_20 [Arabidopsis thaliana]
 gb|AAK37839.1|AF196777_1 UDP-glucosyltransferase [Arabidopsis thaliana]
 gb|AAL77752.1| At1g05560/T25N20_20 [Arabidopsis thaliana]
 gb|AEE27854.1| UDP-glucosyltransferase 75B1 [Arabidopsis thaliana]
 gb|AHL38968.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=469

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            P T +I+   + WA  VARRFQL   LLWIQPA VF+IYY +F
Sbjct  106  PVTCLIYTILLNWAPKVARRFQLPSALLWIQPALVFNIYYTHF  148



>ref|XP_010434517.1| PREDICTED: UDP-glycosyltransferase 75D1 [Camelina sativa]
Length=474

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR   L   LLW+QP  VF I+YHYF  Y
Sbjct  118  KQNRPFTCVVYTILLTWVSELAREIHLPSALLWVQPVTVFSIFYHYFHGY  167



>ref|XP_010434952.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR   L   LLW+QP  VF I+YHYF  Y
Sbjct  118  RQNRPFTCVVYTILLTWIAELAREIHLPSALLWVQPVTVFSIFYHYFNGY  167



>ref|XP_004965983.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Setaria italica]
Length=484

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            G+P +RV++   + WA  VAR   +   L WIQP AVF IYYHYF
Sbjct  119  GRPVSRVVYTLLLPWAADVARERGVPSALYWIQPVAVFAIYYHYF  163



>ref|XP_006414486.1| hypothetical protein EUTSA_v10027441mg [Eutrema salsugineum]
 gb|ESQ55939.1| hypothetical protein EUTSA_v10027441mg [Eutrema salsugineum]
Length=478

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + +PFT V++   + W   +AR F +   LLW+QP  VF I+YHYF  Y
Sbjct  122  QNRPFTCVVYTLLLTWVAELAREFHIPSALLWVQPITVFSIFYHYFNGY  170



>ref|XP_009403481.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=469

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + G+P T VI+   ++WA  VA    L   L WIQPA VF +YYHYF  Y
Sbjct  104  ERGRPVTCVIYTLLLSWAADVAHEHGLPSVLYWIQPATVFALYYHYFHGY  153



>ref|XP_007099701.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
 gb|EOY20331.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
Length=466

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++EGKP T ++ +  + WA  VAR   +   +LWIQPA V  IYY+YF  Y
Sbjct  97   DKEGKPVTCIVHSLLLPWAMEVAREHHIPSAILWIQPATVLGIYYYYFNGY  147



>ref|XP_010246537.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=472

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    SVNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQ  184
            S+  F + +K + S  L +LI +  +EG P T +++   + WA  VAR   +   LLWIQ
Sbjct  73   SIEHFLSELKRRGSETLRELILSLAREGCPVTCLVYTLLLPWAADVARNLDVPSALLWIQ  132

Query  185  PAAVFDIYYHYFTDY  229
             A VFDIYY+ FT Y
Sbjct  133  SATVFDIYYYNFTGY  147



>emb|CDY09069.1| BnaC08g10230D [Brassica napus]
Length=472

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR F +   +LW+QP  VF I+YHYF  Y
Sbjct  115  RQNRPFTCVVYTIFLPWVAELAREFHIPSAILWVQPVTVFSIFYHYFNGY  164



>emb|CDY09068.1| BnaC08g10220D [Brassica napus]
Length=462

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   + R F +   LLW+QP  VF I+YHYF  Y
Sbjct  120  RQNRPFTCVVYTILLTWVAELVREFHIPSALLWVQPVTVFSIFYHYFNGY  169



>ref|XP_003629629.1| UDP-glucose glucosyltransferase [Medicago truncatula]
Length=304

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFD  202
            +QEGKPFT ++ +  + WA   AR F L   LLW+QPA VFD
Sbjct  101  SQEGKPFTFLVHSILLQWAAKTAREFHLSTALLWVQPATVFD  142



>ref|XP_009107846.1| PREDICTED: UDP-glycosyltransferase 75D1-like isoform X1 [Brassica 
rapa]
Length=477

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + +PFT V++   + W   + R F +   LLW+QP  VF I+YHYF  Y
Sbjct  121  QNRPFTCVVYTILLTWVAELVREFHIPSALLWVQPVTVFSIFYHYFNGY  169



>ref|XP_010915038.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Elaeis 
guineensis]
Length=467

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+  T +I+   + WA  VAR   +R  L WIQPAAVF IYYHYF  Y
Sbjct  112  GRRVTCLIYTILLPWAADVAREHGIRSFLHWIQPAAVFAIYYHYFHGY  159



>dbj|BAM28983.1| UDP-glucose crocetin glucosyltransferase [Gardenia jasminoides]
Length=474

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G P T +++   + WA  VAR   +   LLWIQP AV DIYY+YF  Y
Sbjct  103  QGCPVTCLVYTLLLPWAATVARECHIPSALLWIQPVAVMDIYYYYFRGY  151



>sp|F8WKW0.1|UGT1_GARJA RecName: Full=Crocetin glucosyltransferase, chloroplastic; AltName: 
Full=UDP-glucose glucosyltransferase 1; Short=GjUGT1; 
AltName: Full=UDP-glycosyltransferase 75L6; Flags: Precursor 
[Gardenia jasminoides]
 dbj|BAK55736.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=474

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G P T +++   + WA  VAR   +   LLWIQP AV DIYY+YF  Y
Sbjct  103  QGCPVTCLVYTLLLPWAATVARECHIPSALLWIQPVAVMDIYYYYFRGY  151



>ref|XP_009107847.1| PREDICTED: UDP-glycosyltransferase 75D1-like isoform X2 [Brassica 
rapa]
Length=476

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + +PFT V++   + W   + R F +   LLW+QP  VF I+YHYF  Y
Sbjct  121  QNRPFTCVVYTILLTWVAELVREFHIPSALLWVQPVTVFSIFYHYFNGY  169



>emb|CDY22741.1| BnaA08g05710D [Brassica napus]
Length=444

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + +PFT V++   + W   + R F +   LLW+QP  VF I+YHYF  Y
Sbjct  104  QNRPFTCVVYTILLTWVAELVREFHIPSALLWVQPVTVFSIFYHYFNGY  152



>ref|XP_006282963.1| hypothetical protein CARUB_v10007692mg [Capsella rubella]
 gb|EOA15861.1| hypothetical protein CARUB_v10007692mg [Capsella rubella]
Length=474

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR   L   LLW+QP  VF I YHYF+ Y
Sbjct  118  RQNRPFTCVVYTILLTWVAELAREIHLPSALLWVQPVTVFSISYHYFSGY  167



>ref|XP_002437220.1| hypothetical protein SORBIDRAFT_10g023060 [Sorghum bicolor]
 gb|EER88587.1| hypothetical protein SORBIDRAFT_10g023060 [Sorghum bicolor]
Length=485

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            G+P TRV++   + W   VAR   +   L WIQPAAVF +YYHYF
Sbjct  117  GRPATRVVYTFLVPWVADVARAHGVPAALFWIQPAAVFAVYYHYF  161



>ref|XP_011101592.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Sesamum 
indicum]
Length=472

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++G+P T +I+   + WA  VAR   +   LLWIQ A V DIYY+YF  +
Sbjct  101  EQGRPITCLIYTLLLPWASEVAREVHIPSALLWIQAATVLDIYYYYFNGF  150



>gb|AET04105.2| UDP-glucose:glucosyltransferase, putative [Medicago truncatula]
Length=160

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  74   KNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFD  202
             +QEGKPFT ++ +  + WA   AR F L   LLW+QPA VFD
Sbjct  100  NSQEGKPFTFLVHSILLQWAAKTAREFHLSTALLWVQPATVFD  142



>ref|XP_010434494.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR   L   LLW+QP  VF I YHYF  Y
Sbjct  118  RQNRPFTCVVYTILLTWVAELAREIHLPSALLWVQPVTVFSISYHYFNGY  167



>emb|CDY10124.1| BnaC05g03670D [Brassica napus]
Length=466

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  77   NQEG-KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            N+ G  P T +++   + WA  VA RFQL   LLWIQPA VF+IYY++F  +
Sbjct  102  NKNGDSPVTCLVYTMLLNWAPKVASRFQLPSALLWIQPALVFNIYYNHFNGH  153



>ref|XP_010246964.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=476

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +2

Query  11   NDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPA  190
            ++F + ++ + S AL D + +  +E +P T +I+   + WA  VA    +   LLWIQPA
Sbjct  76   DNFMSELRCRGSQALTDYVESSAKERRPVTCLIYTILLPWAAEVASNLGVPSALLWIQPA  135

Query  191  AVFDIYYHYFTDY  229
            AV DIYY YF  Y
Sbjct  136  AVLDIYYFYFNGY  148



>emb|CBI39410.3| unnamed protein product [Vitis vinifera]
Length=410

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  74   KNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTD  226
            +  EG+PFT +++   + W   VA+ F L   L+W Q A VFDIYY+YF +
Sbjct  123  RANEGRPFTCLLYGIIIPWVAEVAQSFHLPSALVWSQAATVFDIYYYYFNE  173



>ref|XP_002266967.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=465

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + +G+P T ++    +AWA  +AR  QL   LLWIQ A VF I++HYF  Y
Sbjct  97   SDQGRPVTCLVHTMLLAWAAELARSLQLPSALLWIQSATVFIIFHHYFDGY  147



>ref|XP_002308970.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE92493.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=472

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ G+PFT V+++  + W   VAR   L  TLLW Q  A+ DI+Y+YF  Y
Sbjct  102  SKNGRPFTCVVYSNLVPWVAKVARELNLPSTLLWNQSPALLDIFYYYFNGY  152



>emb|CDP15112.1| unnamed protein product [Coffea canephora]
Length=469

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P T +++   + WA  VA    +   LLWIQPA V DIYY+YF  Y
Sbjct  103  QGRPVTCLVYTLLLPWAATVAHECHIPSALLWIQPATVMDIYYYYFHGY  151



>gb|AFJ52964.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=427

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G PF  ++++  + WA  V R   L  TLLWIQPA V DIYY+ F  Y
Sbjct  79   QGTPFDCLVYSPLLTWAVDVGRDLDLPTTLLWIQPATVMDIYYYLFNGY  127



>ref|XP_002266628.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=498

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P T ++    + WA  +AR  Q+   LLWIQ A VF I+YHYF  Y
Sbjct  132  QGRPVTCLLHTILLTWAAELARSLQVPSALLWIQSATVFTIFYHYFNGY  180



>gb|KGN45711.1| hypothetical protein Csa_6G007450 [Cucumis sativus]
Length=465

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            GKP T V+++    W   VAR F L   L W Q AAVF IYYH+F  Y
Sbjct  100  GKPITFVLYSLLTPWMANVARSFDLPTALFWNQSAAVFAIYYHFFNGY  147



>dbj|BAD90934.1| monoterpene glucosyltransferase [Eucalyptus perriniana]
Length=467

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+ F  + + T + W   VA   Q+  TL+W QPA + DIYY+YF  Y
Sbjct  99   EGRKFACIFYTTIIPWVAQVAHSLQIPSTLIWTQPATLLDIYYYYFNGY  147



>ref|XP_003560621.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Brachypodium distachyon]
Length=489

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            G+  TRV++   + WA  VAR   L   L WIQPAAVF +Y+HYF
Sbjct  113  GRAVTRVVYTLLLPWAADVARDRGLHSALYWIQPAAVFAVYHHYF  157



>emb|CDY21979.1| BnaC09g00850D [Brassica napus]
 emb|CDX92022.1| BnaC03g33240D [Brassica napus]
Length=472

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR F +   LLW+QP  VF I+YHYF  Y
Sbjct  115  RQNRPFTCVVYTIFLPWVAELAREFHIPSALLWVQPVTVFSIFYHYFNGY  164



>sp|B2NID7.1|5GT_GENTR RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase; 
AltName: Full=Anthocyanin 5-O-glucosyltransferase; Short=Gt5GT7 
[Gentiana triflora]
 dbj|BAG32255.1| anthocyanin 5-O-glucosyltransferase [Gentiana triflora]
Length=504

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            P TR+++ T + WA  VAR F+L   LLW QP   F  +++YFT Y
Sbjct  128  PITRILYTTLLPWAADVAREFRLPSVLLWTQPVTTFLTFHYYFTGY  173



>ref|XP_010434953.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   + W   +AR   L   LLW+QP  VF I YHYF  Y
Sbjct  118  RQNRPFTCVVYRILLTWVAELAREIHLPSALLWVQPVTVFSISYHYFNGY  167



>ref|XP_002438628.1| hypothetical protein SORBIDRAFT_10g023120 [Sorghum bicolor]
 gb|EER89995.1| hypothetical protein SORBIDRAFT_10g023120 [Sorghum bicolor]
Length=489

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            G+P +RV++   + WA  VAR   +   L WIQP AVF IY+HYF
Sbjct  121  GRPVSRVVYTLMLPWAADVARERGIPSALYWIQPVAVFAIYHHYF  165



>ref|XP_004965984.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Setaria italica]
Length=473

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+P +RV++   + WA  VAR   +   L WIQPA VF +Y+HYF  Y
Sbjct  116  GRPVSRVVYTLMLPWAADVARGRGVPSALYWIQPAVVFAVYHHYFHGY  163



>emb|CDY09754.1| BnaC07g33070D [Brassica napus]
Length=556

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +2

Query  80   QEGKPFTRVIFATAM-AWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   +  W   +AR F +   LLWIQP  +F I+YHYF  Y
Sbjct  116  EDNRPFTCVVYTMILLTWVAELAREFHIPSALLWIQPVTIFSIFYHYFNGY  166



>ref|XP_002892295.1| UDP-glucosyl transferase 75B2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68554.1| UDP-glucosyl transferase 75B2 [Arabidopsis lyrata subsp. lyrata]
Length=459

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFT  223
            P T +I+     WA  VARRF +   LLWIQPA VFDIYY+Y T
Sbjct  107  PVTCLIYTILPNWAPKVARRFHIPSVLLWIQPAFVFDIYYNYST  150



>ref|XP_002267330.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=497

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P T +I+   + W   VAR   +   L W QP +VF+IYY+YF  Y
Sbjct  131  EGRPVTCIIYGILIPWVAEVARSLHIPSALFWSQPVSVFNIYYYYFCGY  179



>ref|XP_007221288.1| hypothetical protein PRUPE_ppa016890mg [Prunus persica]
 gb|EMJ22487.1| hypothetical protein PRUPE_ppa016890mg [Prunus persica]
Length=474

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +EG P+T +++   + WA  +AR   L   L WIQ A +FD+YY+Y + Y
Sbjct  99   KEGHPYTCLVYTILLPWAADLARELHLPSVLAWIQAATLFDVYYYYLSGY  148



>gb|EYU27003.1| hypothetical protein MIMGU_mgv1a024986mg [Erythranthe guttata]
Length=450

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + +P T++++   + WA  VAR F +   LLWIQPA V  IYY+YF  Y
Sbjct  85   QDRPVTQLVYTLLLPWAPEVAREFHVPSALLWIQPATVLIIYYYYFNGY  133



>ref|XP_010925318.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Elaeis 
guineensis]
Length=474

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+P + +I+   ++WA  VAR   +   L WIQPA VF  YYHYF  Y
Sbjct  112  GRPVSCIIYTIFLSWAADVARDHGIPSALYWIQPATVFTTYYHYFHGY  159



>ref|XP_010039944.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45603.1| hypothetical protein EUGRSUZ_L00635 [Eucalyptus grandis]
Length=467

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG  F  + + T + W   VA   Q+  TL+W+QPA + DIYY+YF  Y
Sbjct  99   EGCKFACIFYTTIIPWVAQVAHSLQIPSTLVWVQPATLLDIYYYYFDSY  147



>gb|AFJ52962.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=505

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 39/73 (53%), Gaps = 0/73 (0%)
 Frame = +2

Query  11   NDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPA  190
            N  W  + T+ +  L +LIA  + EG P   +++   + W   VAR   L   LLWIQPA
Sbjct  85   NKQWVQMNTRGAEFLNELIATNSDEGTPICCLVYTLLLTWVADVARDNNLPSVLLWIQPA  144

Query  191  AVFDIYYHYFTDY  229
             VFDIYY+    Y
Sbjct  145  TVFDIYYYLANGY  157



>emb|CBI36304.3| unnamed protein product [Vitis vinifera]
Length=333

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P + +I++  +  A  +AR F +    LWIQPA V DIYY+YF  +
Sbjct  98   EGRPISCLIYSIVIPGAAELARSFNIPSAFLWIQPATVLDIYYYYFNGF  146



>ref|XP_008458151.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Cucumis melo]
Length=465

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            GKP + V+++    W   VAR F L   L W Q AAVF IYYH+F  Y
Sbjct  100  GKPISFVLYSLLTPWMANVARSFDLPAALFWNQSAAVFAIYYHFFNGY  147



>ref|XP_003571494.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Brachypodium distachyon]
Length=485

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 3/76 (4%)
 Frame = +2

Query  11   NDFWASVKTKasaaladliaaKNQ---EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWI  181
            ++ WA V+T A    A L AA ++    G+P T V++A  M WA  VAR   L   L WI
Sbjct  89   DEAWAHVETAARVGRATLSAALDRLAARGRPVTCVVYAMLMWWAADVARERGLPRALYWI  148

Query  182  QPAAVFDIYYHYFTDY  229
            QPA +  +YYHYF  Y
Sbjct  149  QPATMLAVYYHYFHGY  164



>emb|CDX90584.1| BnaA03g41970D [Brassica napus]
Length=575

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +2

Query  80   QEGKPFTRVIFATAM-AWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT V++   +  W   +AR F +   LLWIQP  +F I+YHYF  Y
Sbjct  121  RQNRPFTCVVYTMILLTWVAELAREFHIPSALLWIQPVTIFSIFYHYFNGY  171



>dbj|BAJ96117.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=497

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+P T V++A  M WA  VAR   L   L WIQPA +  +YYHYF  Y
Sbjct  125  GRPVTCVVYAMLMWWAAEVARERGLPRALYWIQPATMLAVYYHYFHGY  172



>ref|XP_011033298.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=468

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + G PFT V+++  + W   VAR+  L  TLLW Q  A+ DI+Y+YF  Y
Sbjct  100  KNGGPFTCVVYSNLIPWVAKVARQHNLPSTLLWNQSPALLDIFYYYFNGY  149



>ref|XP_006285715.1| hypothetical protein CARUB_v10007186mg [Capsella rubella]
 gb|EOA18613.1| hypothetical protein CARUB_v10007186mg [Capsella rubella]
Length=475

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ +PFT +++   + W   +AR   L   LLW+QP  V  I+YHYF  Y
Sbjct  118  RQNRPFTCLVYTILLTWVAELAREIHLPSALLWVQPVTVLSIFYHYFNGY  167



>ref|XP_009119145.1| PREDICTED: UDP-glycosyltransferase 75B1 [Brassica rapa]
Length=472

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +2

Query  77   NQEG-KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHY  217
            N++G  P T +++   + WA  VA RFQL   LLWIQPA VF+IYY++
Sbjct  101  NKKGDSPVTCLVYTILLNWAPKVASRFQLPSALLWIQPALVFNIYYNH  148



>ref|XP_006305828.1| hypothetical protein CARUB_v10010859mg [Capsella rubella]
 gb|EOA38726.1| hypothetical protein CARUB_v10010859mg [Capsella rubella]
Length=449

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query  77   NQEG-KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            N+ G  P T +I+   + WA  VA RF +   LLWIQPA VFD+YY++F
Sbjct  96   NRNGDSPVTFLIYTLLLTWAPKVAGRFHIPSALLWIQPALVFDVYYNHF  144



>dbj|BAK06770.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+P T V++A  M WA  VAR   +   L WIQPA +  +YYHYF  Y
Sbjct  127  GRPVTCVVYAMLMWWAAEVARERGVPRALYWIQPATMLAVYYHYFNGY  174



>gb|AHL68667.1| UDP-glucose: anthocyanin 5-O-glucosyltransferase [Vitis amurensis]
Length=464

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P + +I++  +  A  +AR F +    LWIQPA V DIYY+YF  +
Sbjct  98   EGRPISCLIYSILIPGAAELARSFNIPSAFLWIQPATVLDIYYYYFNGF  146



>dbj|BAP90370.1| UDP-glycose: glycosyltransferase UGT75R1 [Fagopyrum esculentum]
Length=471

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            P+T V++   + W   VARR  L   LLW+Q AA+  IYYHYF  Y
Sbjct  110  PYTCVVYTILLPWVANVARRHNLPSALLWLQNAALLSIYYHYFNGY  155



>ref|XP_002438625.1| hypothetical protein SORBIDRAFT_10g023050 [Sorghum bicolor]
 gb|EER89992.1| hypothetical protein SORBIDRAFT_10g023050 [Sorghum bicolor]
Length=478

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            + G P TRV++   + W   VAR   +   L W++PA VF +YYHYF
Sbjct  130  RRGHPVTRVVYTALVGWVPAVARAHGVPAALYWVKPATVFAVYYHYF  176



>ref|XP_003565426.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Brachypodium 
distachyon]
Length=495

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            EG+P TRV++   ++W   VAR   +   L WIQPA V   Y+HYF
Sbjct  121  EGRPVTRVVYTVLLSWVADVARGHGVPAALYWIQPATVLAAYFHYF  166



>ref|NP_001142122.1| uncharacterized protein LOC100274286 [Zea mays]
 gb|ACF87693.1| unknown [Zea mays]
 gb|ACN25507.1| unknown [Zea mays]
 gb|AFW87140.1| hypothetical protein ZEAMMB73_236238 [Zea mays]
Length=472

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            G+P +RV++   + WA  VAR   +   L WIQP +VF IY+HYF
Sbjct  115  GRPVSRVVYTLLLPWAADVARDRGIPSALYWIQPVSVFAIYHHYF  159



>ref|NP_001057976.1| Os06g0593200 [Oryza sativa Japonica Group]
 dbj|BAD32868.1| putative glucosyltransferase [Oryza sativa Japonica Group]
 dbj|BAF19890.1| Os06g0593200 [Oryza sativa Japonica Group]
Length=493

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            G+P T +++   + WA  VAR   +   + WIQPAA F +YYHYF
Sbjct  118  GRPVTCIVYTFLVVWAPAVARALGIPSAIYWIQPAAAFAVYYHYF  162



>emb|CDY47274.1| BnaA10g03720D [Brassica napus]
Length=472

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +2

Query  77   NQEG-KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYY  211
            N++G  P T +++   + WA  VA RFQL   LLWIQPA VF+IYY
Sbjct  101  NKKGDSPVTCLVYTILLNWAPKVASRFQLPSALLWIQPALVFNIYY  146



>ref|XP_006373112.1| hypothetical protein POPTR_0017s08830g, partial [Populus trichocarpa]
 gb|ERP50909.1| hypothetical protein POPTR_0017s08830g, partial [Populus trichocarpa]
Length=184

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+PFT V+++  + W   +AR   L   LLW Q  AV DI+Y+YF  Y
Sbjct  84   GQPFTCVVYSNLIPWGAKLARELNLPSILLWNQSPAVLDIFYYYFNGY  131



>ref|XP_002322699.1| hypothetical protein POPTR_0016s05290g [Populus trichocarpa]
 gb|EEF04460.1| hypothetical protein POPTR_0016s05290g [Populus trichocarpa]
Length=471

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            + G PFT V+ +  + W   VAR+  L  TLLW Q  A+ DI+Y+YF  Y
Sbjct  103  KNGGPFTCVVHSNLIPWVAKVARQHNLPSTLLWNQSPALLDIFYYYFNGY  152



>ref|XP_003632054.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=465

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P T +I+   + W   VA    +   L W QP +VF+IYY+YF  Y
Sbjct  99   EGRPVTCIIYGILIPWVAEVAHSLHIPSALFWSQPVSVFNIYYYYFCGY  147



>ref|XP_002438626.1| hypothetical protein SORBIDRAFT_10g023070 [Sorghum bicolor]
 gb|EER89993.1| hypothetical protein SORBIDRAFT_10g023070 [Sorghum bicolor]
Length=492

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+P +RV++   + WA  VAR   +   L WIQP  V  IY+HYF  Y
Sbjct  127  GRPVSRVVYTLMLPWAADVARERGVASALYWIQPVLVLAIYHHYFHGY  174



>ref|XP_008439390.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cucumis melo]
Length=186

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 1/53 (2%)
 Frame = +2

Query  74   KNQEGK-PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
             +Q+G  P T ++    + W   VAR F +   +LWIQ  AVFD+YY+YF  Y
Sbjct  95   SSQQGLLPITCIVNTLLIPWVAQVAREFHVSTAVLWIQSVAVFDVYYYYFNGY  147



>ref|XP_002266919.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=463

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P   +++     WA  VARR Q+     W Q   VFDIYY+YF  Y
Sbjct  99   QGRPVACIVYTMIFDWAQEVARRVQVLSAYFWNQATTVFDIYYYYFNGY  147



>emb|CAN62622.1| hypothetical protein VITISV_001655 [Vitis vinifera]
Length=463

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P   +++     WA  VARR Q+     W Q   VFDIYY+YF  Y
Sbjct  99   QGRPVACIVYTMIFDWAQEVARRVQVLSAYFWNQATTVFDIYYYYFNGY  147



>ref|XP_002263498.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=463

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P   +++     WA  VARR Q+     W Q   VFDIYY+YF  Y
Sbjct  99   QGRPVACIVYTMIFDWAQEVARRVQVLSAYFWNQATTVFDIYYYYFNGY  147



>ref|XP_003565425.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Brachypodium 
distachyon]
Length=502

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYF  220
            EG+P TR+++   ++W   VAR   +   L WIQPA V   Y+HY 
Sbjct  125  EGRPVTRIVYTLLLSWVAAVARAHGVPSALYWIQPATVLAAYFHYL  170



>ref|XP_010039945.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45604.1| hypothetical protein EUGRSUZ_L00636 [Eucalyptus grandis]
Length=460

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+ F  + + T + W   VA   ++  TL+W QPA + DIYY+YF  Y
Sbjct  100  GRTFACIFYTTIVPWVAQVAHSLEIPSTLIWAQPATLLDIYYYYFNGY  147



>emb|CBI39398.3| unnamed protein product [Vitis vinifera]
Length=409

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            +G+P   +++     WA  VARR Q+     W Q   VFDIYY+YF  Y
Sbjct  99   QGRPVACIVYTMIFDWAQEVARRVQVLSAYFWNQATTVFDIYYYYFNGY  147



>dbj|BAC54093.1| anthocyanin 5-glucosyltransferase [Torenia hybrid cultivar]
Length=478

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  104  VIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            V+++   +WA  VAR   +   LLWI+PA VFD+YY YF  Y
Sbjct  116  VVYSHLFSWAAEVAREVDVPSALLWIEPATVFDVYYFYFNGY  157



>emb|CBI39388.3| unnamed protein product [Vitis vinifera]
Length=597

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P T +I+   + W   VA    +   L W QP +VF+IYY+YF  Y
Sbjct  204  EGRPVTCIIYGILIPWVAEVAHSLHIPSALFWSQPVSVFNIYYYYFCGY  252



>gb|ACM66950.1| flavonoid glucosyltransferase [Crocus sativus]
Length=497

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   QEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
              G+  + VI+   ++WA  VAR+  +     WIQPA VF IYYHYF  Y
Sbjct  110  HRGRKVSCVIYTFFVSWAADVARQHAIPSVQYWIQPATVFAIYYHYFHGY  159



>ref|XP_006657100.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Oryza brachyantha]
Length=353

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   GKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            G+P + V++   + WA  VAR   +   L WIQP AV  IYYHYF  Y
Sbjct  108  GRPVSCVVYTLLLPWAADVARDRGVPSALYWIQPVAVLAIYYHYFHGY  155



>dbj|BAA89009.1| anthocyanin 5-O-glucosyltransferase [Petunia x hybrida]
Length=468

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ G+P T ++++  + WA  VAR   +   LLW QPA + DIYY  F  Y
Sbjct  100  SENGQPITCLLYSIFLPWAAEVAREVHIPSALLWSQPATILDIYYFNFHGY  150



>dbj|BAF03079.1| UDP-glucose:flavonol 5-O-glucosyltransferase homolog [Solanum 
melongena]
Length=360

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   NQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            ++ G P T ++++  + WA  VAR   +  +LLW QPA + DIYY  F  Y
Sbjct  83   SENGSPITCLLYSIFLPWAAEVAREVNIPSSLLWSQPATILDIYYFNFHGY  133



>ref|XP_008793440.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
 ref|XP_008793441.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=474

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +2

Query  8    VNDFWASVKTKasaaladliaaKNQEGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQP  187
            VN F + +K   S  ++ L+       +P + +I+   MAWA  VAR   +   L WIQ 
Sbjct  85   VNTFMSKIKLAGSRTVSTLVQDLAARDRPVSCLIYTLLMAWAADVARDHGVPSALYWIQT  144

Query  188  AAVFDIYYHYFTDY  229
            A VF  YYHYF  Y
Sbjct  145  ATVFATYYHYFHGY  158



>gb|AFI71902.1| flavonol 5-O-glucosyltransferase [Paeonia lactiflora]
Length=465

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDI  205
            EG+P T +I++  + WAG VAR   +   LLWIQPA + DI
Sbjct  100  EGRPVTCLIYSLLLPWAGKVARELHIPSALLWIQPATILDI  140



>ref|XP_010650395.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=497

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P   +I+   + W   VA    +   L W QP +VF+IYY+YF  Y
Sbjct  131  EGRPVACIIYGILIPWVAEVAHSLHIPSALFWSQPVSVFNIYYYYFCGY  179



>emb|CAN75179.1| hypothetical protein VITISV_018406 [Vitis vinifera]
Length=497

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG+P   +I+   + W   VA    +   L W QP +VF+IYY+YF  Y
Sbjct  131  EGRPVACIIYGILIPWVAEVAHSLHIPSALFWSQPVSVFNIYYYYFCGY  179



>ref|XP_010485039.1| PREDICTED: UDP-glycosyltransferase 75B2-like [Camelina sativa]
Length=379

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFT  223
            P T +I+    +W   V RRF L   LLWIQPA VFD+YY++ T
Sbjct  65   PVTCLIYTILPSWVPKVVRRFHLPSALLWIQPAFVFDVYYNHST  108



>ref|NP_172044.1| UDP-glucosyl transferase 75B2 [Arabidopsis thaliana]
 sp|Q9ZVY5.1|U75B2_ARATH RecName: Full=UDP-glycosyltransferase 75B2; AltName: Full=(Uridine 
5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl 
transferase 2; AltName: Full=IAA-Glu synthase 2; AltName: 
Full=Indole-3-acetate beta-glucosyltransferase 2 [Arabidopsis 
thaliana]
 gb|AAF79732.1|AC005106_13 T25N20.18 [Arabidopsis thaliana]
 gb|AEE27849.1| UDP-glucosyl transferase 75B2 [Arabidopsis thaliana]
 gb|AHL38969.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=455

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +2

Query  77   NQEG-KPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFT  223
            NQ G  P + +I+     W   VARRF L    LWIQPA  FDIYY+Y T
Sbjct  100  NQNGDSPVSCLIYTILPNWVPKVARRFHLPSVHLWIQPAFAFDIYYNYST  149



>ref|XP_010039943.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45602.1| hypothetical protein EUGRSUZ_L00634 [Eucalyptus grandis]
Length=467

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   EGKPFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            EG  F  + + T + W   VA   Q+  TL+W+QPA + DI Y+YF  Y
Sbjct  99   EGCKFACIFYTTIIPWVAQVAHSLQIPSTLIWVQPATLLDINYYYFDGY  147



>ref|XP_004147672.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cucumis sativus]
 gb|KGN57234.1| hypothetical protein Csa_3G172390 [Cucumis sativus]
Length=335

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +2

Query  92   PFTRVIFATAMAWAGVVARRFQLRFTLLWIQPAAVFDIYYHYFTDY  229
            P T ++    + W   VAR F +   +LW Q  AVFD+YY+YF  Y
Sbjct  102  PITCIVNTLLIPWVAQVAREFHVSTAILWTQSVAVFDVYYYYFNGY  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520931555436