BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c93748_g1_i1 len=1071 path=[1049:0-1070]

Length=1071
                                                                      Score     E

ref|XP_011082770.1|  PREDICTED: transcription factor HBP-1b(c38)-...    230   2e-68   
ref|XP_010274492.1|  PREDICTED: transcription factor TGA5-like          223   9e-67   
ref|XP_011082771.1|  PREDICTED: transcription factor HBP-1b(c38)-...    219   5e-64   
ref|XP_003634633.1|  PREDICTED: transcription factor TGA4-like          214   2e-63   
ref|XP_010064898.1|  PREDICTED: transcription factor HBP-1b(c38)-...    199   1e-57   
gb|EYU45030.1|  hypothetical protein MIMGU_mgv1a018123mg                205   2e-57   
ref|XP_011098215.1|  PREDICTED: transcription factor TGA6-like          193   3e-55   
ref|XP_011101404.1|  PREDICTED: transcription factor TGA6-like          189   6e-54   
ref|XP_002537773.1|  conserved hypothetical protein                     184   5e-52   Ricinus communis
ref|XP_010089698.1|  hypothetical protein L484_006320                   182   2e-51   
ref|XP_007025355.1|  Delay of germination 1, putative                   186   4e-51   
ref|XP_011085982.1|  PREDICTED: transcription factor HBP-1b(c38)-...    182   5e-51   
ref|XP_004293959.1|  PREDICTED: uncharacterized protein LOC101299272    181   1e-50   
gb|KDP21107.1|  hypothetical protein JCGZ_21578                         180   1e-50   
emb|CDO96811.1|  unnamed protein product                                180   3e-50   
gb|KCW69957.1|  hypothetical protein EUGRSUZ_F03275                     179   3e-50   
ref|XP_007213175.1|  hypothetical protein PRUPE_ppa027008mg             175   9e-49   
ref|XP_011101452.1|  PREDICTED: transcription factor TGA5-like          172   3e-47   
gb|EYU43340.1|  hypothetical protein MIMGU_mgv1a020768mg                170   9e-47   
ref|XP_010316826.1|  PREDICTED: transcription factor TGA5-like          166   1e-44   
gb|EYU29539.1|  hypothetical protein MIMGU_mgv1a023140mg                163   6e-44   
ref|XP_009599896.1|  PREDICTED: transcription factor TGA3-like          163   6e-44   
gb|EYU43339.1|  hypothetical protein MIMGU_mgv1a024141mg                161   8e-44   
ref|XP_010920258.1|  PREDICTED: transcription factor TGA2               160   9e-43   
gb|EYU28097.1|  hypothetical protein MIMGU_mgv1a017794mg                159   1e-42   
ref|XP_006358130.1|  PREDICTED: transcription factor TGA1-like          160   2e-42   
ref|XP_009619619.1|  PREDICTED: transcription factor TGA2-like          158   5e-42   
ref|XP_010316820.1|  PREDICTED: transcription factor HBP-1b(c38)-...    156   3e-41   
ref|XP_009589153.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    154   1e-40   
ref|XP_009758860.1|  PREDICTED: transcription factor TGA3-like          154   3e-40   
ref|XP_009789465.1|  PREDICTED: uncharacterized protein LOC104237085    154   4e-40   
ref|XP_004234088.1|  PREDICTED: transcription factor TGA6-like          153   4e-40   
ref|XP_009762839.1|  PREDICTED: transcription factor HBP-1b(c38)-...    149   1e-38   
ref|XP_009607760.1|  PREDICTED: transcription factor TGA6-like          148   3e-38   
ref|XP_004161213.1|  PREDICTED: uncharacterized LOC101207776            147   2e-37   
ref|XP_009792490.1|  PREDICTED: uncharacterized protein LOC104239538    145   2e-37   
ref|XP_004150221.1|  PREDICTED: uncharacterized protein LOC101207776    146   3e-37   
ref|XP_009395216.1|  PREDICTED: transcription factor TGA2-like          145   4e-37   
ref|XP_009792613.1|  PREDICTED: transcription factor TGA6-like          143   2e-36   
gb|EEC71515.1|  hypothetical protein OsI_03809                          144   2e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_006414070.1|  hypothetical protein EUTSA_v10027258mg             139   1e-34   
ref|XP_006830264.1|  hypothetical protein AMTR_s00130p00113960          138   1e-34   
ref|XP_010518808.1|  PREDICTED: uncharacterized protein LOC104798429    138   3e-34   
ref|XP_010449483.1|  PREDICTED: uncharacterized protein LOC104731...    137   5e-34   
ref|XP_006414069.1|  hypothetical protein EUTSA_v10025925mg             137   8e-34   
ref|XP_004134926.1|  PREDICTED: transcription factor TGA1-like          136   1e-33   
emb|CDM84316.1|  unnamed protein product                                136   1e-33   
ref|XP_010434502.1|  PREDICTED: uncharacterized protein LOC104718448    136   2e-33   
ref|XP_010317335.1|  PREDICTED: transcription factor HBP-1b(c38)-...    135   2e-33   
gb|KFK28541.1|  hypothetical protein AALP_AA7G010100                    135   3e-33   
ref|XP_011081582.1|  PREDICTED: transcription factor HBP-1b(c38)-...    134   3e-33   
dbj|BAO79416.1|  wheat delay of dormancy 1                              135   4e-33   
gb|KFK31508.1|  hypothetical protein AALP_AA6G121700                    134   5e-33   
gb|KFK28539.1|  hypothetical protein AALP_AA7G009900                    134   6e-33   
ref|XP_008439732.1|  PREDICTED: transcription factor TGA5               134   7e-33   
gb|ACG36725.1|  tumor-related protein                                   134   1e-32   Zea mays [maize]
ref|XP_010439826.1|  PREDICTED: uncharacterized protein LOC104723193    133   1e-32   
gb|EYU20277.1|  hypothetical protein MIMGU_mgv1a018018mg                132   2e-32   
emb|CAB37451.1|  putative protein                                       133   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28540.1|  hypothetical protein AALP_AA7G010000                    132   3e-32   
ref|XP_006414072.1|  hypothetical protein EUTSA_v10027005mg             132   3e-32   
ref|XP_010924633.1|  PREDICTED: uncharacterized protein LOC105047415    129   4e-32   
gb|ACV41800.1|  delay of germination 1                                  132   5e-32   Lepidium sativum
gb|AGG09198.1|  delay of germination 1a                                 132   6e-32   
gb|EMT22752.1|  hypothetical protein F775_12222                         132   6e-32   
gb|AHA62826.1|  delay of germination 1 B                                131   6e-32   
ref|XP_002870027.1|  hypothetical protein ARALYDRAFT_492990             132   7e-32   
ref|XP_008443347.1|  PREDICTED: uncharacterized protein LOC103486954    131   9e-32   
ref|XP_009132082.1|  PREDICTED: uncharacterized protein LOC103856...    130   1e-31   
ref|XP_010449481.1|  PREDICTED: uncharacterized protein LOC104731707    130   2e-31   
ref|XP_006282688.1|  hypothetical protein CARUB_v10005444mg             130   3e-31   
gb|ABK81211.1|  DOG1 alpha splice variant                               130   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285421.1|  hypothetical protein CARUB_v10006838mg             130   3e-31   
ref|XP_003560850.1|  PREDICTED: transcription factor HBP-1b(c38)-...    130   3e-31   
ref|XP_006398268.1|  hypothetical protein EUTSA_v10001138mg             129   4e-31   
ref|XP_006281774.1|  hypothetical protein CARUB_v10027949mg             129   4e-31   
ref|XP_002870029.1|  hypothetical protein ARALYDRAFT_329668             129   5e-31   
gb|ABK81207.1|  DOG1 alpha splice variant                               129   5e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KFK22875.1|  hypothetical protein AALP_AAs39777U000200               129   5e-31   
gb|AJE25537.1|  DOG1-like protein                                       129   6e-31   
ref|NP_193604.2|  uncharacterized protein                               129   6e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDY23102.1|  BnaC09g18560D                                          128   1e-30   
ref|XP_010439824.1|  PREDICTED: uncharacterized protein LOC104723191    128   1e-30   
emb|CDY52216.1|  BnaAnng11390D                                          128   1e-30   
ref|XP_009114387.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    128   1e-30   
gb|AGG09199.1|  delay of germination 1c                                 127   2e-30   
gb|ABK81208.1|  DOG1 alpha splice variant                               127   3e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CAB37454.1|  putative protein                                       129   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434499.1|  PREDICTED: uncharacterized protein LOC104718445    126   5e-30   
dbj|BAB09311.1|  tumor-related protein-like                             125   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AJE25535.1|  DOG1-like protein                                       125   2e-29   
ref|XP_004239641.1|  PREDICTED: transcription factor TGA6-like          124   3e-29   
emb|CDY66844.1|  BnaC07g50150D                                          124   3e-29   
ref|XP_002984747.1|  hypothetical protein SELMODRAFT_181239             123   4e-29   
ref|XP_002985809.1|  hypothetical protein SELMODRAFT_123200             123   5e-29   
gb|ACV41802.1|  delay of germination 1                                  123   5e-29   Brassica rapa subsp. pekinensis [bai cai]
gb|ABK81209.1|  DOG1 alpha splice variant                               124   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199395.2|  protein DELAY OF GERMINATION 1                        123   7e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494735.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    123   7e-29   
ref|XP_002456383.1|  hypothetical protein SORBIDRAFT_03g035150          124   9e-29   Sorghum bicolor [broomcorn]
ref|XP_009101563.1|  PREDICTED: transcription factor HBP-1b(c38)        123   1e-28   
emb|CDY61468.1|  BnaCnng37860D                                          122   1e-28   
tpg|DAA57542.1|  TPA: hypothetical protein ZEAMMB73_325815              121   1e-28   
gb|ABK81206.1|  DOG1 alpha splice variant                               123   1e-28   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00554.1|  tumor-related protein-like                             122   1e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY58051.1|  BnaA06g40200D                                          122   2e-28   
ref|XP_009136952.1|  PREDICTED: uncharacterized protein LOC103861007    122   3e-28   
ref|XP_004503896.1|  PREDICTED: transcription factor HBP-1b(c38)-...    121   4e-28   
ref|XP_009799260.1|  PREDICTED: transcription factor TGA6-like          121   4e-28   
ref|XP_002863451.1|  hypothetical protein ARALYDRAFT_330831             121   5e-28   
ref|XP_003630355.1|  Transcription factor HBP-1b(c1)                    120   5e-28   
emb|CDY70293.1|  BnaCnng67640D                                          120   5e-28   
ref|XP_003524316.1|  PREDICTED: transcription factor TGA4-like          120   1e-27   
ref|XP_009594445.1|  PREDICTED: transcription factor TGA6-like          119   3e-27   
ref|XP_011100139.1|  PREDICTED: transcription factor TGA1-like          118   3e-27   
gb|KHN17404.1|  Transcription factor TGA4                               120   4e-27   
ref|XP_008227573.1|  PREDICTED: transcription factor TGA2-like          117   7e-27   
ref|XP_002273632.1|  PREDICTED: transcription factor TGA2               115   2e-26   Vitis vinifera
ref|XP_007159878.1|  hypothetical protein PHAVU_002G275400g             115   3e-26   
emb|CDY34053.1|  BnaC03g62790D                                          115   6e-26   
gb|EYU35712.1|  hypothetical protein MIMGU_mgv1a011847mg                114   1e-25   
ref|XP_004288481.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    114   1e-25   
ref|XP_004289493.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    113   2e-25   
gb|EYU23355.1|  hypothetical protein MIMGU_mgv1a023684mg                113   2e-25   
gb|EYU31233.1|  hypothetical protein MIMGU_mgv1a023634mg                112   2e-25   
ref|XP_002870028.1|  hypothetical protein ARALYDRAFT_492991             110   8e-25   
ref|NP_193603.1|  uncharacterized protein                               110   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441664.1|  PREDICTED: uncharacterized protein LOC104724815    111   2e-24   
ref|XP_006380400.1|  hypothetical protein POPTR_0007s04840g             110   3e-24   
gb|AIN76390.1|  DOG1                                                    110   3e-24   
ref|XP_002310543.2|  hypothetical protein POPTR_0007s04840g             110   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_004972183.1|  PREDICTED: transcription factor HBP-1b(c38)-...    110   3e-24   
ref|XP_006345765.1|  PREDICTED: transcription factor TGA1-like          110   3e-24   
ref|XP_007214751.1|  hypothetical protein PRUPE_ppa024940mg             110   3e-24   
ref|XP_007048544.1|  TGACG-sequence-specific DNA-binding protein ...    108   4e-24   
ref|XP_009757325.1|  PREDICTED: transcription factor TGA5-like          109   5e-24   
ref|XP_011022856.1|  PREDICTED: transcription factor TGA2-like          108   2e-23   
gb|AGG09200.1|  delay of germination 1a                                 104   2e-23   
ref|XP_010920869.1|  PREDICTED: transcription factor TGA3-like          107   3e-23   
gb|EYU23363.1|  hypothetical protein MIMGU_mgv1a023034mg                107   4e-23   
gb|ABK81212.1|  DOG1 mutant                                             103   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002528014.1|  conserved hypothetical protein                     105   1e-22   Ricinus communis
ref|XP_008337157.1|  PREDICTED: transcription factor HBP-1b(c38)-...    105   2e-22   
dbj|BAA05470.1|  tumor-related protein                                  105   2e-22   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_010025725.1|  PREDICTED: transcription factor TGA2-like          103   5e-22   
ref|XP_008442174.1|  PREDICTED: transcription factor TGA2-like is...    103   7e-22   
emb|CDX76507.1|  BnaA08g08930D                                          102   8e-22   
ref|XP_011097086.1|  PREDICTED: transcription factor TGA2-like          103   1e-21   
gb|EYU23360.1|  hypothetical protein MIMGU_mgv1a019261mg                102   2e-21   
ref|XP_009379553.1|  PREDICTED: transcription factor TGA6-like          102   2e-21   
gb|EYU20609.1|  hypothetical protein MIMGU_mgv1a010868mg                102   2e-21   
ref|XP_010674364.1|  PREDICTED: transcription factor TGA6-like          101   3e-21   
gb|KFK28538.1|  hypothetical protein AALP_AA7G009900                  99.0    4e-21   
ref|XP_006432080.1|  hypothetical protein CICLE_v10002078mg             101   5e-21   
ref|XP_008442175.1|  PREDICTED: transcription factor TGA2-like is...  99.8    1e-20   
gb|AGG09201.1|  delay of germination 1c                               95.5    2e-20   
ref|XP_007159877.1|  hypothetical protein PHAVU_002G275400g           97.4    2e-20   
ref|XP_008793320.1|  PREDICTED: transcription factor HBP-1b(c38)-...  98.6    2e-20   
ref|XP_004156023.1|  PREDICTED: transcription factor TGA6-like        97.4    5e-20   
ref|XP_006643777.1|  PREDICTED: transcription factor TGA6-like        96.7    1e-19   
ref|XP_010062825.1|  PREDICTED: transcription factor HBP-1b(c38)-...  96.3    1e-19   
ref|XP_008386261.1|  PREDICTED: transcription factor TGA5-like        94.7    3e-19   
ref|XP_009402767.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  95.1    4e-19   
gb|EYU23876.1|  hypothetical protein MIMGU_mgv11b017687mg             94.7    6e-19   
gb|EYU45430.1|  hypothetical protein MIMGU_mgv1a012463mg              93.6    1e-18   
emb|CAN72574.1|  hypothetical protein VITISV_036367                   92.4    2e-18   Vitis vinifera
ref|XP_007212919.1|  hypothetical protein PRUPE_ppa022280mg           91.3    4e-18   
emb|CDP10926.1|  unnamed protein product                              92.4    5e-18   
dbj|BAJ05339.1|  hypothetical protein                                 91.7    6e-18   
ref|XP_002283108.1|  PREDICTED: transcription factor HBP-1b(c1)-like  90.5    8e-18   Vitis vinifera
emb|CDM81542.1|  unnamed protein product                              88.2    1e-16   
ref|XP_009801472.1|  PREDICTED: uncharacterized protein LOC104247209  84.3    1e-16   
ref|XP_010313918.1|  PREDICTED: transcription factor TGA5-like        87.4    1e-16   
ref|XP_006367574.1|  PREDICTED: uncharacterized protein LOC102590415  86.7    2e-16   
ref|XP_001765151.1|  predicted protein                                90.5    2e-16   
ref|NP_001118628.1|  uncharacterized protein                          86.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646344.1|  PREDICTED: transcription factor TGA5-like        85.1    3e-16   
ref|XP_002455164.1|  hypothetical protein SORBIDRAFT_03g005300        87.0    5e-16   Sorghum bicolor [broomcorn]
ref|XP_011007917.1|  PREDICTED: transcription factor HBP-1b(c38)      85.5    5e-16   
ref|XP_009798761.1|  PREDICTED: transcription factor TGA5             84.7    9e-16   
ref|XP_011075022.1|  PREDICTED: transcription factor TGA5-like        84.7    2e-15   
gb|KHG25856.1|  Transcription factor TGA1 -like protein               84.0    2e-15   
ref|XP_011082768.1|  PREDICTED: transcription factor TGA1             83.6    3e-15   
ref|NP_001237999.1|  bZIP transcription factor bZIP132                83.6    3e-15   
ref|XP_001783231.1|  predicted protein                                83.2    3e-15   
ref|XP_006370140.1|  DNA-binding family protein                       83.6    3e-15   
ref|XP_009405272.1|  PREDICTED: transcription factor HBP-1b(c1)-like  83.2    3e-15   
ref|XP_010086637.1|  hypothetical protein L484_004349                 83.2    4e-15   
ref|XP_006367571.1|  PREDICTED: probable LRR receptor-like serine...  85.9    5e-15   
ref|XP_007021794.1|  Uncharacterized protein TCM_031867               83.2    5e-15   
ref|XP_010093103.1|  hypothetical protein L484_007912                 83.2    8e-15   
gb|KHN36891.1|  Transcription factor TGA1                             81.3    1e-14   
ref|XP_010487302.1|  PREDICTED: transcription factor HBP-1b(c38)-...  82.0    1e-14   
ref|XP_010502264.1|  PREDICTED: transcription factor HBP-1b(c38)-...  81.6    1e-14   
emb|CDP06468.1|  unnamed protein product                              82.0    1e-14   
ref|XP_010465409.1|  PREDICTED: transcription factor HBP-1b(c38)-...  81.6    2e-14   
ref|XP_004489078.1|  PREDICTED: transcription factor HBP-1b(c38)-...  80.9    2e-14   
ref|XP_006477767.1|  PREDICTED: transcription factor TGA1-like        80.9    2e-14   
ref|XP_006442481.1|  hypothetical protein CICLE_v10022056mg           80.5    3e-14   
ref|XP_003596341.1|  Transcription factor TGA5                        80.1    4e-14   
ref|XP_002441508.1|  hypothetical protein SORBIDRAFT_09g028290        80.1    4e-14   Sorghum bicolor [broomcorn]
ref|XP_004968271.1|  PREDICTED: transcription factor TGA6-like        81.3    5e-14   
ref|XP_010276977.1|  PREDICTED: transcription factor TGA2             80.1    5e-14   
ref|NP_188106.2|  uncharacterized protein                             79.7    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004244373.1|  PREDICTED: transcription factor TGA5             79.3    9e-14   
ref|XP_009132089.1|  PREDICTED: uncharacterized protein LOC103856...  77.4    1e-13   
ref|XP_009618663.1|  PREDICTED: transcription factor TGA1-like        78.6    2e-13   
gb|ABI84260.1|  tumor-related protein-like                            78.2    2e-13   Arachis hypogaea [goober]
ref|NP_001152723.1|  tumor-related protein-like                       78.2    2e-13   Zea mays [maize]
gb|EPS59924.1|  hypothetical protein M569_14883                       77.0    2e-13   
gb|KDP34795.1|  hypothetical protein JCGZ_10575                       77.8    3e-13   
ref|XP_008463763.1|  PREDICTED: transcription factor TGA5             77.8    3e-13   
gb|EAY72627.1|  hypothetical protein OsI_00493                        77.8    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010695960.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  77.0    6e-13   
ref|XP_008442399.1|  PREDICTED: transcription factor HBP-1b(c38)      77.0    6e-13   
ref|XP_007149576.1|  hypothetical protein PHAVU_005G081900g           76.6    6e-13   
ref|NP_001042081.1|  Os01g0159000                                     77.0    8e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008806140.1|  PREDICTED: transcription factor TGA7-like        77.4    8e-13   
ref|XP_010449484.1|  PREDICTED: uncharacterized protein LOC104731...  74.7    1e-12   
emb|CDX78883.1|  BnaA01g09500D                                        74.3    1e-12   
ref|XP_010502248.1|  PREDICTED: transcription factor HBP-1b(c38)-...  75.9    2e-12   
ref|XP_003565204.1|  PREDICTED: transcription factor TGA2-like        76.3    2e-12   
ref|XP_010317336.1|  PREDICTED: uncharacterized protein LOC104646038  75.5    2e-12   
ref|XP_006348396.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  75.5    2e-12   
emb|CDX99444.1|  BnaC01g11080D                                        73.6    2e-12   
ref|XP_006593493.1|  PREDICTED: bZIP transcription factor bZIP132...  75.9    2e-12   
ref|XP_006449515.1|  hypothetical protein CICLE_v10017912mg           73.2    2e-12   
ref|XP_010104255.1|  hypothetical protein L484_016398                 75.1    2e-12   
ref|XP_006366944.1|  PREDICTED: transcription factor HBP-1b(c38)-...  75.1    3e-12   
ref|XP_004137901.1|  PREDICTED: transcription factor TGA7-like        75.1    3e-12   
ref|XP_002882899.1|  hypothetical protein ARALYDRAFT_341612           75.1    3e-12   
ref|XP_010487301.1|  PREDICTED: transcription factor HBP-1b(c38)-...  75.1    4e-12   
ref|XP_010502256.1|  PREDICTED: transcription factor HBP-1b(c38)-...  74.7    4e-12   
ref|XP_004961243.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  74.3    5e-12   
ref|XP_010465408.1|  PREDICTED: transcription factor HBP-1b(c38)-...  74.3    5e-12   
emb|CDX97614.1|  BnaA05g24650D                                        74.3    6e-12   
ref|XP_010552125.1|  PREDICTED: transcription factor TGA7             73.9    7e-12   
ref|XP_004246934.1|  PREDICTED: transcription factor TGA2-like        73.9    7e-12   
gb|KDO56688.1|  hypothetical protein CISIN_1g047612mg                 73.9    8e-12   
ref|XP_004146086.1|  PREDICTED: transcription factor TGA5-like        73.6    8e-12   
ref|XP_010104546.1|  hypothetical protein L484_025521                 73.2    1e-11   
gb|EAY99001.1|  hypothetical protein OsI_20960                        72.8    1e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001056306.1|  Os05g0560200                                     72.8    1e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CDY70896.1|  BnaCnng70220D                                        73.2    1e-11   
ref|NP_193601.5|  uncharacterized protein                             71.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99442.1|  BnaC01g11100D                                        72.0    2e-11   
ref|XP_006429421.1|  hypothetical protein CICLE_v10012620mg           72.8    2e-11   
ref|XP_003634664.1|  PREDICTED: transcription factor HBP-1b(c38)      72.4    2e-11   
ref|XP_006433711.1|  hypothetical protein CICLE_v10003662mg           71.6    3e-11   
ref|XP_011079057.1|  PREDICTED: transcription factor TGA5-like        72.0    4e-11   
ref|XP_007026666.1|  Response to aba and salt 1, putative             71.6    4e-11   
gb|ADX23328.1|  DOG1                                                  70.1    4e-11   
gb|ADX23279.1|  DOG1                                                  69.7    5e-11   
ref|XP_009623095.1|  PREDICTED: transcription factor HBP-1b(c38)-...  71.6    5e-11   
gb|ADX23485.1|  DOG1                                                  69.7    6e-11   
ref|XP_002263705.1|  PREDICTED: transcription factor TGA2-like        71.2    6e-11   Vitis vinifera
gb|ADX23463.1|  DOG1                                                  69.3    6e-11   
ref|XP_010674365.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.1    7e-11   
ref|XP_008673687.1|  PREDICTED: transcription factor TGA6-like        71.6    7e-11   
gb|ADX23324.1|  DOG1                                                  69.3    8e-11   
gb|ADX23444.1|  DOG1                                                  69.3    8e-11   
gb|ADX23275.1|  DOG1                                                  69.3    8e-11   
ref|XP_002972738.1|  hypothetical protein SELMODRAFT_173073           72.0    9e-11   
gb|ADX23458.1|  DOG1                                                  68.9    9e-11   
ref|XP_010922993.1|  PREDICTED: uncharacterized protein LOC105046169  72.8    1e-10   
gb|ADX23284.1|  DOG1                                                  68.9    1e-10   
ref|XP_010231035.1|  PREDICTED: uncharacterized protein LOC104582592  70.5    1e-10   
ref|XP_006472990.1|  PREDICTED: transcription factor TGA5-like        71.6    1e-10   
ref|XP_010037696.1|  PREDICTED: transcription factor HBP-1b(c38)-...  70.1    2e-10   
gb|ADX23439.1|  DOG1                                                  68.2    2e-10   
ref|XP_009789761.1|  PREDICTED: transcription factor TGA2-like        69.7    2e-10   
ref|XP_009802153.1|  PREDICTED: transcription factor HBP-1b(c38)-...  69.7    2e-10   
gb|KDP24433.1|  hypothetical protein JCGZ_24997                       69.7    2e-10   
dbj|BAJ05340.1|  hypothetical protein                                 70.1    2e-10   
gb|ADX23263.1|  DOG1                                                  67.8    3e-10   
gb|ADX23274.1|  DOG1                                                  67.8    3e-10   
ref|XP_004289492.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  67.8    3e-10   
gb|ADX23283.1|  DOG1                                                  67.8    3e-10   
gb|ADX23323.1|  DOG1                                                  67.4    3e-10   
ref|XP_008225332.1|  PREDICTED: uncharacterized protein LOC103324988  67.0    4e-10   
gb|EEE64671.1|  hypothetical protein OsJ_19526                        67.8    4e-10   
ref|XP_009339278.1|  PREDICTED: transcription factor TGA5             68.6    6e-10   
ref|XP_006407035.1|  hypothetical protein EUTSA_v10022387mg           68.6    6e-10   
ref|XP_006338981.1|  PREDICTED: transcription factor TGA6-like        68.6    7e-10   
ref|XP_009629955.1|  PREDICTED: transcription factor TGA1-like        68.2    7e-10   
ref|XP_008807787.1|  PREDICTED: transcription factor HBP-1b(c38)-...  67.8    7e-10   
ref|XP_010667750.1|  PREDICTED: transcription factor HBP-1b(c38)-...  68.6    8e-10   
ref|XP_004249821.1|  PREDICTED: transcription factor HBP-1b(c38)-...  68.2    9e-10   
ref|XP_004514219.1|  PREDICTED: uncharacterized protein LOC101514340  67.0    1e-09   
ref|XP_010676762.1|  PREDICTED: transcription factor TGA4-like        67.4    2e-09   
ref|XP_004305124.1|  PREDICTED: transcription factor TGA4-like        67.0    2e-09   
ref|XP_002532112.1|  Transcription factor HBP-1b, putative            67.0    2e-09   
ref|XP_008366197.1|  PREDICTED: transcription factor TGA5-like        67.0    2e-09   
dbj|BAG91889.1|  unnamed protein product                              66.2    2e-09   
ref|XP_009146508.1|  PREDICTED: uncharacterized protein LOC103870151  67.0    2e-09   
ref|XP_009769468.1|  PREDICTED: transcription factor TGA6-like        67.0    3e-09   
dbj|BAO45899.1|  basic leucine zipper protein                         68.2    3e-09   
gb|ADX23355.1|  DOG1                                                  64.7    3e-09   
gb|AAD34570.1|AF143442_1  NPR1-interactor protein 1                   66.2    4e-09   
ref|XP_010277052.1|  PREDICTED: transcription factor HBP-1b(c38)-...  65.9    5e-09   
gb|ADX23392.1|  DOG1                                                  63.9    5e-09   
gb|ADX23273.1|  DOG1                                                  63.9    5e-09   
ref|XP_003530288.1|  PREDICTED: transcription factor HBP-1b(c38)-...  65.1    7e-09   
dbj|BAB17733.1|  putative transcription factor HBP-1b - wheat         65.5    8e-09   
ref|XP_010277360.1|  PREDICTED: transcription factor HBP-1b(c38)-...  65.9    8e-09   
ref|XP_010277361.1|  PREDICTED: transcription factor HBP-1b(c38)-...  65.5    9e-09   
gb|ADX23264.1|  DOG1                                                  63.2    1e-08   
ref|XP_004978119.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  64.7    1e-08   
gb|EEC70410.1|  hypothetical protein OsI_01405                        66.2    1e-08   
dbj|BAH30346.1|  hypothetical protein                                 64.3    1e-08   
ref|XP_006288172.1|  hypothetical protein CARUB_v10001409mg           65.9    1e-08   
gb|EEE54337.1|  hypothetical protein OsJ_01313                        66.2    1e-08   
ref|XP_011074300.1|  PREDICTED: transcription factor TGA1             65.1    1e-08   
ref|NP_564730.1|  protein ZW2                                         64.3    1e-08   
ref|NP_001042751.1|  Os01g0279900                                     65.9    1e-08   
gb|ACV53508.1|  leucine zipper transcription factor TGA               66.2    1e-08   
dbj|BAK01043.1|  predicted protein                                    63.5    2e-08   
ref|XP_006300241.1|  hypothetical protein CARUB_v10016481mg           64.3    2e-08   
tpg|DAA57191.1|  TPA: putative bZIP transcription factor superfam...  63.5    2e-08   
ref|XP_002888220.1|  hypothetical protein ARALYDRAFT_893661           63.9    2e-08   
ref|XP_006351371.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  65.5    3e-08   
ref|XP_004249310.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  65.5    3e-08   
ref|XP_008345524.1|  PREDICTED: transcription factor TGA4-like        63.9    3e-08   
ref|XP_006830268.1|  hypothetical protein AMTR_s00130p00117930        61.2    3e-08   
emb|CDO96810.1|  unnamed protein product                              63.2    3e-08   
ref|XP_004148432.1|  PREDICTED: transcription factor TGA4-like        62.8    4e-08   
gb|AFK39309.1|  unknown                                               62.8    4e-08   
ref|XP_010055972.1|  PREDICTED: transcription factor HBP-1b(c38)-...  64.7    5e-08   
gb|KDO44920.1|  hypothetical protein CISIN_1g015258mg                 64.3    5e-08   
ref|XP_007140269.1|  hypothetical protein PHAVU_008G097900g           62.8    5e-08   
ref|XP_009759888.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  64.3    5e-08   
ref|XP_008243515.1|  PREDICTED: transcription factor TGA4-like        62.8    6e-08   
ref|XP_003564436.1|  PREDICTED: transcription factor HBP-1b(c1)       64.3    6e-08   
ref|XP_006602670.1|  PREDICTED: transcription factor HBP-1b(c38)-...  62.4    6e-08   
gb|KGN62783.1|  Transcription factor HBP-1b                           62.8    6e-08   
gb|KDO44924.1|  hypothetical protein CISIN_1g015258mg                 63.9    6e-08   
ref|XP_004970302.1|  PREDICTED: transcription factor HBP-1b(c1)-l...  64.3    6e-08   
ref|XP_004493401.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  63.9    6e-08   
ref|XP_010673023.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  63.5    7e-08   
gb|KEH23189.1|  transcription factor TGA5-like protein                62.4    7e-08   
ref|XP_010036355.1|  PREDICTED: transcription factor TGA2-like is...  63.9    7e-08   
ref|XP_010036354.1|  PREDICTED: transcription factor TGA2-like is...  63.9    7e-08   
emb|CAN60299.1|  hypothetical protein VITISV_017763                   63.9    7e-08   
ref|XP_009617985.1|  PREDICTED: transcription factor TGA5-like        62.4    7e-08   
ref|XP_006421095.1|  hypothetical protein CICLE_v10005080mg           63.9    8e-08   
ref|XP_001779430.1|  predicted protein                                63.5    8e-08   
ref|XP_010230791.1|  PREDICTED: transcription factor HBP-1b(c38)      63.2    8e-08   
ref|XP_010673021.1|  PREDICTED: transcription factor HBP-1b(c38)-...  63.5    8e-08   
ref|XP_007206845.1|  hypothetical protein PRUPE_ppa027068mg           62.4    8e-08   
ref|XP_010673022.1|  PREDICTED: transcription factor HBP-1b(c38)-...  63.5    9e-08   
emb|CDY42138.1|  BnaC05g40810D                                        63.2    1e-07   
ref|XP_006356862.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  61.6    1e-07   
tpg|DAA57190.1|  TPA: putative bZIP transcription factor superfam...  62.4    1e-07   
dbj|BAD81089.1|  putative HBP-1b                                      62.0    2e-07   
gb|EYU36422.1|  hypothetical protein MIMGU_mgv1a025661mg              61.2    2e-07   
ref|XP_002458658.1|  hypothetical protein SORBIDRAFT_03g037560        62.8    2e-07   
tpg|DAA57189.1|  TPA: LOW QUALITY PROTEIN: putative bZIP transcri...  62.4    2e-07   
ref|NP_001105735.1|  LOC542756                                        62.4    2e-07   
ref|XP_002323247.1|  DNA-binding protein VBP1                         62.8    2e-07   
ref|XP_010067716.1|  PREDICTED: transcription factor TGA2             62.4    2e-07   
ref|XP_006644065.1|  PREDICTED: transcription factor HBP-1b(c38)-...  62.0    2e-07   
gb|ACF79461.1|  unknown                                               62.8    2e-07   
gb|ACF80806.1|  unknown                                               62.4    2e-07   
ref|XP_009377744.1|  PREDICTED: transcription factor TGA4-like        61.2    2e-07   
ref|XP_002970901.1|  hypothetical protein SELMODRAFT_231689           62.0    2e-07   
ref|XP_008444975.1|  PREDICTED: transcription factor TGA4             60.8    2e-07   
ref|XP_008344751.1|  PREDICTED: transcription factor TGA5-like        59.7    2e-07   
gb|ABN09201.1|  TGA transcription factor 2                            62.0    3e-07   
ref|XP_006644064.1|  PREDICTED: transcription factor HBP-1b(c38)-...  62.0    3e-07   
gb|KHN45979.1|  hypothetical protein glysoja_030716                   59.7    3e-07   
ref|XP_002969636.1|  hypothetical protein SELMODRAFT_231344           61.6    3e-07   
ref|XP_008219160.1|  PREDICTED: transcription factor HBP-1b(c38)      60.5    3e-07   
ref|XP_010097665.1|  hypothetical protein L484_023805                 59.3    3e-07   
ref|XP_003624993.1|  TGA transcription factor                         62.0    3e-07   
gb|KHG29238.1|  hypothetical protein F383_00102                       62.0    3e-07   
gb|EPS70828.1|  hypothetical protein M569_03931                       62.0    3e-07   
ref|XP_004238547.1|  PREDICTED: transcription factor HBP-1b(c38)      60.5    3e-07   
ref|XP_006484430.1|  PREDICTED: transcription factor PERIANTHIA-like  61.2    3e-07   
ref|XP_011075426.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  62.0    3e-07   
ref|XP_011075425.1|  PREDICTED: transcription factor HBP-1b(c38)-...  62.0    3e-07   
gb|EAZ13886.1|  hypothetical protein OsJ_03813                        62.0    4e-07   
ref|XP_003624994.1|  TGA transcription factor                         61.6    4e-07   
gb|KDO70045.1|  hypothetical protein CISIN_1g018357mg                 61.6    4e-07   
gb|AES81212.2|  leucine zipper transcription factor                   61.6    4e-07   
ref|XP_010511109.1|  PREDICTED: transcription factor TGA4-like        60.1    4e-07   
gb|ADW40546.1|  bZIP transcription factor                             61.2    4e-07   
gb|KDP41541.1|  hypothetical protein JCGZ_15948                       60.1    4e-07   
gb|AFO63289.1|  bZIP10                                                61.6    5e-07   
ref|NP_001141998.1|  putative bZIP transcription factor superfami...  61.2    5e-07   
ref|XP_008654622.1|  PREDICTED: putative bZIP transcription facto...  61.2    5e-07   
ref|XP_006467638.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  60.1    5e-07   
ref|XP_006437714.1|  hypothetical protein CICLE_v10031441mg           61.2    5e-07   
gb|KDO77874.1|  hypothetical protein CISIN_1g046619mg                 59.7    5e-07   
ref|XP_002871242.1|  bZIP transcription factor TGA2                   60.8    5e-07   
ref|XP_002968543.1|  hypothetical protein SELMODRAFT_231160           60.5    5e-07   
ref|XP_002975942.1|  hypothetical protein SELMODRAFT_232668           60.8    5e-07   
ref|XP_010423270.1|  PREDICTED: transcription factor TGA2             60.8    5e-07   
gb|ABR46137.1|  bZIP transcription factor TGA2                        60.8    5e-07   
ref|NP_196312.1|  transcription factor TGA2                           60.8    5e-07   
ref|XP_006644874.1|  PREDICTED: transcription factor HBP-1b(c1)-like  60.8    6e-07   
ref|XP_006399172.1|  hypothetical protein EUTSA_v10014082mg           60.8    6e-07   
ref|XP_010439827.1|  PREDICTED: transcription factor TGA6-like        59.3    6e-07   
gb|ABR46126.1|  bZIP transcription factor TGA2                        60.5    7e-07   
dbj|BAB72064.1|  bZIP transcription factor                            60.5    7e-07   
gb|EMT32868.1|  putative Transcription factor HBP-1b(c1)              60.8    7e-07   
emb|CDP09298.1|  unnamed protein product                              60.5    7e-07   
ref|XP_010910366.1|  PREDICTED: transcription factor HBP-1b(c1)-like  59.7    7e-07   
dbj|BAJ94197.1|  predicted protein                                    60.8    7e-07   
ref|XP_003541699.1|  PREDICTED: transcription factor HBP-1b(c38)-...  59.7    8e-07   
ref|XP_010498787.1|  PREDICTED: transcription factor TGA6-like is...  60.1    8e-07   
dbj|BAD44579.1|  bZip transcription factor TGA6 / AtbZip45            60.5    8e-07   
gb|AFW84811.1|  putative bZIP transcription factor superfamily pr...  60.1    8e-07   
gb|EYU26795.1|  hypothetical protein MIMGU_mgv1a0233481mg             57.8    8e-07   
gb|AAT28675.1|  bZIP transcription factor                             60.8    8e-07   
gb|EEC71673.1|  hypothetical protein OsI_04142                        60.8    8e-07   
ref|XP_010543213.1|  PREDICTED: transcription factor TGA2-like        58.9    8e-07   
ref|XP_007025357.1|  Transcription factor-related, putative           59.3    8e-07   
ref|XP_010498795.1|  PREDICTED: transcription factor TGA6-like is...  60.1    9e-07   
dbj|BAD43215.1|  bZip transcription factor TGA6 / AtbZip45            59.3    9e-07   
ref|XP_010464986.1|  PREDICTED: transcription factor TGA6 isoform X4  60.1    9e-07   
ref|XP_009122312.1|  PREDICTED: transcription factor TGA2             60.1    9e-07   
gb|AEF30410.1|  putative TGA2-like protein 2                          60.1    9e-07   
ref|XP_009120767.1|  PREDICTED: transcription factor TGA6-like is...  60.1    9e-07   
gb|EAY98526.1|  hypothetical protein OsI_20438                        60.1    9e-07   
emb|CDX98971.1|  BnaC09g48640D                                        60.1    9e-07   
sp|Q41558.2|HBP1C_WHEAT  RecName: Full=Transcription factor HBP-1...  60.5    9e-07   
emb|CDM84630.1|  unnamed protein product                              60.5    9e-07   
ref|XP_006407351.1|  hypothetical protein EUTSA_v10021187mg           60.1    9e-07   
ref|NP_001078141.1|  transcription factor TGA6                        59.7    1e-06   
dbj|BAB03134.1|  leucine zipper transcription factor HBP-1b           60.1    1e-06   
ref|NP_974293.1|  transcription factor TGA6                           60.1    1e-06   
ref|XP_010464983.1|  PREDICTED: transcription factor TGA6 isoform X2  60.1    1e-06   
ref|XP_010486922.1|  PREDICTED: transcription factor TGA6 isoform X3  60.1    1e-06   
ref|XP_010498764.1|  PREDICTED: transcription factor TGA6-like is...  60.1    1e-06   
ref|XP_010464979.1|  PREDICTED: transcription factor TGA6 isoform X1  60.1    1e-06   
ref|NP_566415.3|  transcription factor TGA6                           60.1    1e-06   
ref|XP_001759836.1|  predicted protein                                60.5    1e-06   
ref|XP_006655440.1|  PREDICTED: transcription factor HBP-1b(c1)-like  60.1    1e-06   
ref|XP_010498804.1|  PREDICTED: transcription factor TGA6-like is...  60.1    1e-06   
ref|XP_006407352.1|  hypothetical protein EUTSA_v10021187mg           59.7    1e-06   
ref|XP_006301016.1|  hypothetical protein CARUB_v10021407mg           58.9    1e-06   
gb|KDP29256.1|  hypothetical protein JCGZ_16645                       58.2    1e-06   
ref|XP_010464987.1|  PREDICTED: transcription factor TGA6 isoform X5  60.1    1e-06   
ref|XP_009120759.1|  PREDICTED: transcription factor TGA6-like is...  59.7    1e-06   
ref|NP_001030678.1|  transcription factor TGA6                        59.7    1e-06   
gb|ABP88233.1|  transcription factor bZIP98                           59.3    1e-06   
ref|XP_006299748.1|  hypothetical protein CARUB_v10015943mg           59.3    1e-06   
gb|EYU18627.1|  hypothetical protein MIMGU_mgv1a006504mg              60.1    1e-06   
ref|NP_001060695.1|  Os07g0687700                                     59.7    1e-06   
ref|XP_008349608.1|  PREDICTED: transcription factor TGA5-like        57.8    1e-06   
ref|XP_002882771.1|  hypothetical protein ARALYDRAFT_478587           59.7    1e-06   
emb|CDY00762.1|  BnaC03g37460D                                        59.7    1e-06   
gb|EMS58753.1|  Transcription factor HBP-1b(c1)                       60.1    1e-06   
gb|EPS67211.1|  hypothetical protein M569_07557                       59.3    2e-06   
gb|EYU43338.1|  hypothetical protein MIMGU_mgv1a023322mg              58.9    2e-06   
emb|CDX70053.1|  BnaA10g24020D                                        59.3    2e-06   
ref|XP_007028142.1|  Transcription factor HBP-1b(c1) isoform 8        59.3    2e-06   
emb|CDY52616.1|  BnaCnng22950D                                        59.3    2e-06   
ref|XP_011079069.1|  PREDICTED: transcription factor HBP-1b(c38)-...  59.7    2e-06   
ref|XP_008788486.1|  PREDICTED: transcription factor HBP-1b(c38)-...  59.7    2e-06   
ref|XP_002266016.2|  PREDICTED: transcription factor TGA2             58.2    2e-06   
ref|XP_008788487.1|  PREDICTED: transcription factor HBP-1b(c38)-...  59.7    2e-06   
ref|XP_010423275.1|  PREDICTED: transcription factor TGA5-like is...  58.9    2e-06   
ref|XP_007028137.1|  Transcription factor HBP-1b(c1) isoform 3        58.9    2e-06   
ref|XP_010423276.1|  PREDICTED: transcription factor TGA5-like is...  58.9    2e-06   
gb|EEC82717.1|  hypothetical protein OsI_27401                        58.9    2e-06   
ref|XP_010423272.1|  PREDICTED: transcription factor TGA5-like is...  58.9    2e-06   
ref|XP_006598094.1|  PREDICTED: transcription factor HBP-1b(c1) i...  59.3    2e-06   
ref|XP_006449514.1|  hypothetical protein CICLE_v10017869mg           58.2    2e-06   
ref|XP_010423277.1|  PREDICTED: transcription factor TGA5-like is...  58.5    2e-06   
ref|XP_008245049.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  57.8    2e-06   
ref|XP_010263259.1|  PREDICTED: transcription factor HBP-1b(c38)-...  59.3    2e-06   
gb|KDP29258.1|  hypothetical protein JCGZ_16647                       59.3    2e-06   
ref|XP_006658160.1|  PREDICTED: transcription factor HBP-1b(c38)-...  58.9    2e-06   
ref|XP_008655436.1|  PREDICTED: octopine synthase binding factor3...  59.3    2e-06   
ref|XP_003546706.1|  PREDICTED: transcription factor HBP-1b(c1) i...  59.3    3e-06   
ref|XP_002524536.1|  conserved hypothetical protein                   56.2    3e-06   
gb|KGN59439.1|  hypothetical protein Csa_3G819960                     58.9    3e-06   
ref|XP_010263274.1|  PREDICTED: transcription factor HBP-1b(c38)-...  58.9    3e-06   
gb|KHN30362.1|  TGACG-sequence-specific DNA-binding protein TGA-2.1   58.9    3e-06   
gb|ACN31945.1|  unknown                                               58.9    3e-06   
ref|XP_004136637.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  58.9    3e-06   
ref|XP_004162630.1|  PREDICTED: LOW QUALITY PROTEIN: TGACG-sequen...  58.9    3e-06   
ref|XP_010274491.1|  PREDICTED: uncharacterized protein LOC104609805  59.3    3e-06   
ref|XP_008655434.1|  PREDICTED: octopine synthase binding factor3...  58.9    3e-06   
ref|XP_010414743.1|  PREDICTED: transcription factor TGA4-like        57.4    3e-06   
ref|XP_004309443.1|  PREDICTED: transcription factor HBP-1b(c1)-like  58.9    3e-06   
ref|NP_001105448.1|  octopine synthase binding factor3                58.9    3e-06   
gb|EYU26706.1|  hypothetical protein MIMGU_mgv1a007923mg              58.5    3e-06   
gb|KHN37699.1|  Transcription factor HBP-1b(c1)                       58.9    3e-06   
ref|XP_011000427.1|  PREDICTED: transcription factor HBP-1b(c38)-...  58.5    3e-06   
sp|P23923.1|HBP1B_WHEAT  RecName: Full=Transcription factor HBP-1...  58.5    3e-06   
ref|XP_008655435.1|  PREDICTED: octopine synthase binding factor3...  58.9    3e-06   
ref|XP_010490486.1|  PREDICTED: transcription factor TGA4-like        57.4    3e-06   
ref|NP_001237963.1|  bZIP transcription factor bZIP99                 58.9    3e-06   
ref|XP_006594375.1|  PREDICTED: transcription factor HBP-1b(c1) i...  58.9    3e-06   
gb|KCW65891.1|  hypothetical protein EUGRSUZ_G03217                   58.2    3e-06   
dbj|BAJ90602.1|  predicted protein                                    58.2    4e-06   
ref|XP_006288178.1|  hypothetical protein CARUB_v10001413mg           58.2    4e-06   
ref|XP_010093582.1|  TGACG-sequence-specific DNA-binding protein ...  58.5    4e-06   



>ref|XP_011082770.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Sesamum 
indicum]
Length=362

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 177/245 (72%), Gaps = 3/245 (1%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESN--LGDDELFGVVDRSVKHFEEYQ  892
             +++S+ +   +L C FQ+WI QQ +D+ EL  A+  N  + DDEL  +V++S+KHFEEY 
Sbjct  110   LNTSTPLLALKLMCCFQNWILQQHQDLGELVNALSLNCKVPDDELKPLVEKSIKHFEEYH  169

Query  891   QHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ  712
               RAL+AQ    P F  P+WCT+FE AF WIGGCRPSL+ RLVYS+CG +L   L   L+
Sbjct  170   GRRALMAQHYA-PSFFYPTWCTSFETAFFWIGGCRPSLAFRLVYSVCGTELSGQLSEILR  228

Query  711   GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGE  532
             GERKG+L DISA Q+  IN L  KTVREED +S+R+A+LQE++ADEPLAM+   + +VGE
Sbjct  229   GERKGNLADISAHQMEMINTLHCKTVREEDMMSTRMASLQEEIADEPLAMLATSAGRVGE  288

Query  531   SSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEW  352
              S ++ RA+D H++++  ++ +ADKLR+ TL EL+ ILTP Q   LL+  KKLHLS+HEW
Sbjct  289   WSKELVRAMDAHSLSLASILADADKLRISTLKELMAILTPFQGVDLLISIKKLHLSMHEW  348

Query  351   SKKRD  337
              K ++
Sbjct  349   GKTKE  353



>ref|XP_010274492.1| PREDICTED: transcription factor TGA5-like [Nelumbo nucifera]
Length=248

 Score =   223 bits (567),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 185/243 (76%), Gaps = 4/243 (2%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDD-ELFGVVDRSVKHFEEYQQH  886
             SSS+ +D   L   FQ WIAQQ+ D+EEL +A+    GDD  L  +V+++++HF+EY + 
Sbjct  3     SSSAQLDQPHL--CFQSWIAQQQADLEELLQALTIYKGDDTHLNLIVEKNIQHFQEYTEK  60

Query  885   RALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGE  706
             R++LA++N    F +PSWCT+ EN+F+WI GCRPSL+IRLVYSLCG++L++ L  +LQG 
Sbjct  61    RSILARENA-TSFFAPSWCTSLENSFLWIAGCRPSLAIRLVYSLCGSELEAQLNEFLQGV  119

Query  705   RKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESS  526
             RKG+LG++SA QL+ +N LQ +T+REE+KLS+++A+LQED+AD+PL    N+   +G S 
Sbjct  120   RKGNLGELSARQLSLVNDLQCRTIREEEKLSTQMASLQEDIADQPLLTKANEYGLIGASI  179

Query  525   SDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSK  346
               V+  LD HA+A+  ++ EADKLRL TL EL+ ILTPLQAA LL+ AKKLHLSIHEW K
Sbjct  180   EHVDTTLDEHALALAGILEEADKLRLSTLKELINILTPLQAADLLVAAKKLHLSIHEWGK  239

Query  345   KRD  337
             +RD
Sbjct  240   RRD  242



>ref|XP_011082771.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Sesamum 
indicum]
Length=358

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 173/245 (71%), Gaps = 7/245 (3%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESN--LGDDELFGVVDRSVKHFEEYQ  892
             +++S+ +   +L C FQ+WI QQ +D+ EL  A+  N  + DDEL  +V++S+KHFEEY 
Sbjct  110   LNTSTPLLALKLMCCFQNWILQQHQDLGELVNALSLNCKVPDDELKPLVEKSIKHFEEYH  169

Query  891   QHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ  712
               RAL+AQ    P F  P+WCT+FE AF WIGGCRPSL+ RLVYS+CG +L   L   L+
Sbjct  170   GRRALMAQHYA-PSFFYPTWCTSFETAFFWIGGCRPSLAFRLVYSVCGTELSGQLSEILR  228

Query  711   GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGE  532
             GERKG+L DISA Q+  IN L  KTVREED +S+R+    E++ADEPLAM+   + +VGE
Sbjct  229   GERKGNLADISAHQMEMINTLHCKTVREEDMMSTRM----EEIADEPLAMLATSAGRVGE  284

Query  531   SSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEW  352
              S ++ RA+D H++++  ++ +ADKLR+ TL EL+ ILTP Q   LL+  KKLHLS+HEW
Sbjct  285   WSKELVRAMDAHSLSLASILADADKLRISTLKELMAILTPFQGVDLLISIKKLHLSMHEW  344

Query  351   SKKRD  337
              K ++
Sbjct  345   GKTKE  349



>ref|XP_003634633.1| PREDICTED: transcription factor TGA4-like [Vitis vinifera]
Length=246

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 177/243 (73%), Gaps = 5/243 (2%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGD-DELFGVVDRSVKHFEEYQQ  889
             M+SSS   HR   C FQDWI QQ +D++EL + ++++  D D L  ++ +S++HF++Y  
Sbjct  1     MASSS---HRLFHCCFQDWINQQHQDLQELLQVLDTDSPDSDHLRHLIQKSLQHFQDYSA  57

Query  888   HRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQG  709
              RA L++ +  P F  PSW T+FEN+F+W+GGCRPSL+IRL+YS+ G++L + L  +L+G
Sbjct  58    TRAELSKLDA-PSFFCPSWITSFENSFLWLGGCRPSLAIRLLYSISGSELQAQLPDFLKG  116

Query  708   ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGES  529
               +G+L DISATQL  INAL    VREED+LSSR+A++QED ADEPLA+I  K + VGE 
Sbjct  117   CTRGNLADISATQLISINALHGWIVREEDRLSSRMASMQEDTADEPLAIIAKKLRTVGEY  176

Query  528   SSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWS  349
             S  V  A++ H+ A+ R++ EADKLRL T   L +ILTPLQ AH L+ +KKLHLS+HEW 
Sbjct  177   SRTVNSAIETHSQALARVLEEADKLRLSTFKGLQEILTPLQGAHFLVASKKLHLSMHEWG  236

Query  348   KKR  340
             K+R
Sbjct  237   KQR  239



>ref|XP_010064898.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
Length=268

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 126/258 (49%), Positives = 181/258 (70%), Gaps = 20/258 (8%)
 Frame = -1

Query  1062  SSSSAVDHR-RLRCVFQDWIAQQREDMEELSRAVESNLGDDE-LFGVVDRSVKHFEEYQQ  889
             +S++A+  R R  C F++W+AQQ  D++EL +AV ++ GD E L  +  +S++HF +Y +
Sbjct  9     ASATAIYMRDRFGCCFRNWMAQQHLDLDELLQAVSADSGDAEKLRSLAGKSIQHFRDYLE  68

Query  888   HRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQG  709
              R+ LAQ +  P F  P WCT+FEN+F+WIGGCRP+L+IRLVYS  G+DL++ L G   G
Sbjct  69    ARSQLAQHDA-PSFFCPPWCTSFENSFLWIGGCRPTLAIRLVYSSSGSDLEAQLDG---G  124

Query  708   ERKG-------------SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPL  568
              R+G             +LG+I+A+QL  IN L  KT+R E+KLS R+A++QE++AD+PL
Sbjct  125   ARRGDDDRSNGSGGGGGNLGEITASQLKSINELHMKTLRMEEKLSGRMASMQEEIADDPL  184

Query  567   AMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellki-lTPlqaahll  391
             A+I  +S +VGE S  VER +  HA+++ R++ EAD+LRL TL EL++  LTPLQA   L
Sbjct  185   ALIAKRSGRVGEESESVERVMKRHALSLARVLTEADELRLATLRELVEEILTPLQAVEFL  244

Query  390   lvakklhLSIHEWSKKRD  337
             +  KKLHLSIHEW K+RD
Sbjct  245   VTTKKLHLSIHEWGKRRD  262



>gb|EYU45030.1| hypothetical protein MIMGU_mgv1a018123mg [Erythranthe guttata]
Length=467

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 148/203 (73%), Gaps = 6/203 (3%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDD-ELFGVVDRSVKHFEEYQQ  889
             M SSS + H +    F DWI QQ  D+ EL   V +++ D  +   +V++ V+HFEEY  
Sbjct  1     MDSSSNL-HNQFHSCFNDWIDQQNHDLHEL---VAADISDGAQTKRLVEKGVQHFEEYCG  56

Query  888   HRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQG  709
              RA++AQ +     +SP+WCT+ ENA +W+GGCRPSLSIRLVYS+CG++LD  L+ +L+G
Sbjct  57    KRAVMAQHDA-ISLMSPAWCTSLENAALWVGGCRPSLSIRLVYSVCGSELDEQLEEFLRG  115

Query  708   ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGES  529
              RKG+L +IS  QL+ INAL  + V+EEDK+S+RIATLQE++AD+PLA+I   +++VGE 
Sbjct  116   VRKGNLAEISGQQLHMINALHCRIVKEEDKISARIATLQEEIADKPLAVIAKGAERVGEW  175

Query  528   SSDVERALDNHAVAMGRMVVEAD  460
             S DVERA + H++++  ++VEAD
Sbjct  176   SRDVERAANAHSLSLAGILVEAD  198


 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 99/178 (56%), Gaps = 4/178 (2%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEELSRAVESNLGDD---ELFGVVDRSVKHFEEYQQHRALLAQQN  862
              +C +  W +Q R+ +++LS++      D+   +L  ++++++ H+ +Y   +++ A+ +
Sbjct  243   FQCYYDTWFSQLRQLVQQLSQSPNPPTTDEHHHQLRQLINKAMSHYADYYAAKSVSAKHD  302

Query  861   GGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDI  682
                 F SP W T  E +  WIGG RP+ +  LVY+      +SH+   L+G   G LGD+
Sbjct  303   V-LEFFSPPWTTALERSLHWIGGWRPTTAFHLVYTESSILFESHVIDILRGFHTGDLGDL  361

Query  681   SATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERA  508
             S  Q  +++ LQ +TV EE+ ++  ++  Q++ +D   A+  +  +K+ +    +ERA
Sbjct  362   SPAQFARVSELQIQTVHEENDITDDLSDWQDEASDLAAAIYGDVGRKMEKLVGILERA  419



>ref|XP_011098215.1| PREDICTED: transcription factor TGA6-like [Sesamum indicum]
Length=257

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 172/239 (72%), Gaps = 8/239 (3%)
 Frame = -1

Query  1014  DWIAQQREDMEELSRAVESNLGDD--ELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             +WIAQQ +D++EL   + +N   D  +L  + D+S+K FEEY + RALLAQQ+  P  LS
Sbjct  15    EWIAQQHQDLKELLDELSTNSESDSEKLKLLSDKSMKRFEEYYERRALLAQQDA-PLLLS  73

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLD-SHLQGYLQGERKGSLGDISATQLN  664
             P+WCT FENAF WIGG RPSL +R++Y +CG ++D S L    Q +RKGSL +ISA Q++
Sbjct  74    PAWCTPFENAFFWIGGSRPSLYVRIIYLVCGLEVDGSQLAELFQSKRKGSLLEISAQQID  133

Query  663   QINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESS-SDVERALDNHAVA  487
              I+AL  KT+REE K+S+R+A+LQE++AD PLA++   +++VGESS  +++ A+D H ++
Sbjct  134   MIDALHCKTIREEQKISARMASLQEEIADVPLALV---AQEVGESSLQELDHAMDTHYLS  190

Query  486   MGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRDGAAAGRQFN  310
             +  ++ +AD+LRL TL EL+ +L PLQAA LL   KKL LS+HEW K++D     R ++
Sbjct  191   LASILTDADQLRLSTLKELIGLLKPLQAAELLFAIKKLTLSMHEWGKRKDHQQGKRDYH  249



>ref|XP_011101404.1| PREDICTED: transcription factor TGA6-like [Sesamum indicum]
Length=250

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 168/238 (71%), Gaps = 7/238 (3%)
 Frame = -1

Query  1035  RLRCVFQDWIAQQREDMEELSRAVESNL--GDD---ELFGVVDRSVKHFEEYQQHRALLA  871
             RL C F++W++ Q +D+ EL +++  N   GDD   EL  +V+++++HF+EY   R  LA
Sbjct  9     RLSC-FREWMSLQEQDLSELLQSLRLNNADGDDHTAELSQLVEKNIRHFQEYLCRRVSLA  67

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSL  691
             +++  P F SP+WCT+ E + +W GGCRPS+ IRLVY+L G ++ S L  YL G R G L
Sbjct  68    REDVYPYF-SPTWCTSLEGSMLWAGGCRPSIFIRLVYALSGKEISSRLDEYLHGNRTGGL  126

Query  690   GDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVER  511
             G++S +Q+N IN+LQ KT+REE+KLSS++A++QE+MAD+P+A+I  +     E+S++ E 
Sbjct  127   GELSPSQINSINSLQLKTIREEEKLSSKLASMQEEMADQPIAIIAKELAAHSEASTEAEE  186

Query  510   ALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
             AL + AV+M  M+ EAD LRL TL EL+ ILTP+QA   L   +KLHL IH W ++RD
Sbjct  187   ALKSLAVSMTSMLEEADNLRLNTLKELMSILTPVQAVDFLATGRKLHLCIHAWGRRRD  244



>ref|XP_002537773.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF24610.1| conserved hypothetical protein [Ricinus communis]
Length=255

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 161/239 (67%), Gaps = 12/239 (5%)
 Frame = -1

Query  1029  RCVFQDWIAQQREDMEELSRAVESNLGDDE-------LFG-VVDRSVKHFEEYQQHRALL  874
             RC F DW+  Q  D+ EL RA+   L DD+       LF  + +++++HF+EY   R  L
Sbjct  14    RC-FHDWMNVQELDLAELLRAL--TLTDDDKPPDDQSLFAQLAEKNIEHFQEYVDKRNRL  70

Query  873   AQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGS  694
             A  N    + +P+W +  EN+ +W+ GCRPS+ IRLVY+LCG+ ++S +  +LQG R G+
Sbjct  71    AH-NDVSVYFAPTWNSALENSLLWLAGCRPSIFIRLVYALCGSQVESQIAEHLQGTRTGN  129

Query  693   LGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVE  514
             LGD+S  QLN +N L  KT++ E+KL++++A+LQED+ADEP++M+  +    G+S+  V+
Sbjct  130   LGDLSLQQLNMVNVLHCKTIKHEEKLTTQLASLQEDIADEPISMVAKEQSHAGDSNEVVD  189

Query  513   RALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
             RAL NH  AM R++ EAD LRL TL EL+ ILTP+QA   L   +KLHL +HEW KKRD
Sbjct  190   RALQNHDEAMVRLLQEADNLRLTTLKELISILTPVQAVDYLAAGRKLHLCMHEWGKKRD  248



>ref|XP_010089698.1| hypothetical protein L484_006320 [Morus notabilis]
 gb|EXB38221.1| hypothetical protein L484_006320 [Morus notabilis]
Length=249

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 160/237 (68%), Gaps = 2/237 (1%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEELSRAVE-SNLGDDELFGVVDRSVKHFEEYQQHRALLAQ  868
             D  R +C F +W+  Q  D+ EL +A+  +   D EL  +  ++++HFE Y   R+ L++
Sbjct  5     DQDRSKCCFLEWMKLQERDLSELLQALTLTPQNDAELTKLAQKAIEHFESYISQRSSLSR  64

Query  867   QNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLG  688
              N    F SPSWCT +EN+  WI GCRPS  IRL+Y+L GAD++S L   L+G+  G +G
Sbjct  65    -NDVASFFSPSWCTPWENSLFWIAGCRPSAFIRLIYALDGADIESKLSEILRGKTVGDIG  123

Query  687   DISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERA  508
             D+SA Q+  ++ LQ +T+REE++L++R+A LQED+AD+P++ I     ++GE S ++E+ 
Sbjct  124   DLSARQMRAVDELQRRTIREEERLTARLAGLQEDVADQPISAIAKGVDRIGEMSGEIEKV  183

Query  507   LDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
             L+ H  +M  ++ EADKLRL TL E+L IL P+Q    L ++KKLHL +HEWSKKRD
Sbjct  184   LNEHEQSMAEVLEEADKLRLNTLKEILGILRPVQGVEFLAMSKKLHLCVHEWSKKRD  240



>ref|XP_007025355.1| Delay of germination 1, putative [Theobroma cacao]
 gb|EOY27977.1| Delay of germination 1, putative [Theobroma cacao]
Length=408

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 171/252 (68%), Gaps = 9/252 (4%)
 Frame = -1

Query  1050  AVDHRRLRCVFQDWIAQQREDMEELSRAV-----ESNLGDDELFGVVDRSVKHFEEYQQH  886
             A D++RL+C FQ+W+  Q +++ EL +A+     + N  ++    + ++S+  F+EY   
Sbjct  2     ASDNQRLQCCFQEWMTIQEQELSELLQALNLKENDVNSSENTYAKLAEKSINSFQEYIDK  61

Query  885   RALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGE  706
             R  L++Q+    F +PSW T  EN+ +WIGGCRPS+ IRL Y+LCG+ ++  L   LQG 
Sbjct  62    RNQLSRQDVSGLF-APSWNTALENSLLWIGGCRPSMYIRLTYALCGSQVEFQLLEILQGL  120

Query  705   RKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESS  526
              +G LG ISATQL +IN L  KT++EE++LS+ +A+LQE++AD+P+A+I  +  +VGESS
Sbjct  121   ARGDLGQISATQLGKINDLHMKTMKEEERLSNNLASLQENIADQPIAVIAKRLCRVGESS  180

Query  525   SDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSK  346
              +V+RALD H  +M  ++ EADKLRL TL ELL ILTP+Q    L  +KKLHL +HEW K
Sbjct  181   GEVDRALDEHESSMANILQEADKLRLSTLKELLGILTPVQGVDFLAASKKLHLCMHEWGK  240

Query  345   KRD---GAAAGR  319
              RD   G  +GR
Sbjct  241   TRDHRHGQGSGR  252



>ref|XP_011085982.1| PREDICTED: transcription factor HBP-1b(c38)-like [Sesamum indicum]
Length=253

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 162/243 (67%), Gaps = 6/243 (2%)
 Frame = -1

Query  1050  AVDHRRLRCVFQDWIAQQREDMEELSRAVESN----LGDDELFGVVDRSVKHFEEYQQHR  883
               D  R  C +Q+W+  Q E++ EL+RA+  N      D EL  ++++ + H+++Y Q R
Sbjct  3     TTDQVRESCFYQEWMNLQEEELSELNRAISLNANGRTADAELTRLIEKIMDHYQDYVQRR  62

Query  882   ALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER  703
             +L+A+ +  P F +P+WCT+ E + +WIGGCRPS  +RL+Y+LCG +++SHL  +L+G R
Sbjct  63    SLMARADVSPYF-APTWCTSLERSVLWIGGCRPSSFVRLIYALCGEEIESHLSEFLRGVR  121

Query  702   KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSK-KVGESS  526
              G LG++S  Q++ ++ LQSKT+REE KL +R+A LQE++ D PLA I  K++ +  E S
Sbjct  122   IGHLGELSGRQISMVDELQSKTIREERKLCTRLAGLQENVLDHPLASIAVKTRGRSCEVS  181

Query  525   SDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSK  346
              ++E ALD H  AM  ++ EAD+LRL TL E++ ILTP QA   L   KKL L + +W K
Sbjct  182   DNLEDALDKHGRAMAEILGEADQLRLNTLREVVGILTPRQAVDFLAAGKKLRLCMQDWGK  241

Query  345   KRD  337
             K D
Sbjct  242   KND  244



>ref|XP_004293959.1| PREDICTED: uncharacterized protein LOC101299272 [Fragaria vesca 
subsp. vesca]
Length=253

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/238 (45%), Positives = 167/238 (70%), Gaps = 3/238 (1%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEELSRAVESNLGD-DELFGVVDRSVKHFEEYQQHRALLAQ  868
             D +  +C F++W+  Q  D+ EL +AV     + ++L  +  + + HFE+Y + R  LA 
Sbjct  5     DRKESKCCFKEWMETQERDLTELLQAVTVEPENIEQLKQLAGKCITHFEDYIKKRNKLAH  64

Query  867   QNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLG  688
             ++    F +P WC+ +EN+ +WI GCRPSL  RL+Y+L G++++S+L  +L+G + G LG
Sbjct  65    KDISAYF-APDWCSPWENSLIWIAGCRPSLFFRLIYALSGSEVESNLTEFLRGTKNGYLG  123

Query  687   DI-SATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVER  511
             ++ S+TQL  +NALQSKT+ EE++L+ R+A LQED+AD+P+AMI     KVGE + +VE+
Sbjct  124   EVMSSTQLVMVNALQSKTISEEERLTMRLAALQEDIADQPIAMIAKGLSKVGEMNEEVEK  183

Query  510   ALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
             ALD+H   M +++ EAD+LR+ TL E+LKILTPLQ    L+ +KKLHL +H+W ++RD
Sbjct  184   ALDDHGQHMVKLLEEADELRMNTLKEVLKILTPLQGVDFLVASKKLHLCVHKWGRQRD  241



>gb|KDP21107.1| hypothetical protein JCGZ_21578 [Jatropha curcas]
Length=250

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 166/239 (69%), Gaps = 4/239 (2%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEELSRAVESN--LGDDELFGVVDRSVKHFEEYQQHRALLA  871
             +H   +  F DW+  Q +D+ EL + +  +    D  L  + ++S++HF++Y Q R+ L 
Sbjct  6     EHNESQKCFLDWMKLQEQDLGELLQVINQSEKPPDTVLTQLAEKSIQHFQDYIQKRSHLY  65

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSL  691
             Q N    F +P W +  EN+F+W+ GCRPS+ IRLVY+LCG++++S+L  YLQG R G+L
Sbjct  66    QNNVSHYF-APGWNSALENSFLWLAGCRPSIFIRLVYALCGSEVESNLAEYLQGARIGNL  124

Query  690   GDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIV-NKSKKVGESSSDVE  514
             G++SA QLN +N L S+T+++E+KLSS++A+LQE++ADEP++++  ++S+   E S +V+
Sbjct  125   GELSARQLNMVNNLHSRTIKQEEKLSSQLASLQEEIADEPISILAKSQSQASDEPSDEVD  184

Query  513   RALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
             RAL +  VAM R++ EAD  RL T+ EL  IL P+QA   L  AKKLHL +H+W K+RD
Sbjct  185   RALQDLDVAMARILQEADNFRLSTVKELNSILNPIQAIDFLAAAKKLHLCMHDWGKRRD  243



>emb|CDO96811.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 166/249 (67%), Gaps = 8/249 (3%)
 Frame = -1

Query  1062  SSSSAVDHR-RLRCVFQDWIAQQREDMEELSRA--VESNLGDDELF--GVVDRSVKHFEE  898
             SS S   HR + +C F +W+  Q  D+ E+ +A  VE N GD ++    +V ++V+HF+ 
Sbjct  4     SSPSPSTHRGQQKCCFHEWMILQEADLSEMLQALTVEDNFGDRDVLLRQLVQKNVEHFQA  63

Query  897   YQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGY  718
             Y   R  LAQ +  P F +PSWC++ EN+ +W+ GCRPSL I L+Y+L G +++SH+  +
Sbjct  64    YADERTRLAQDHVSP-FFAPSWCSSLENSLLWLAGCRPSLFITLIYALSGIEIESHIPEF  122

Query  717   LQGERKGSLGDIS--ATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSK  544
             LQG R   L ++S  A QL+ IN LQ +T+++E++LS ++A LQE +AD+P A+I  +S 
Sbjct  123   LQGTRTSELSELSLAAPQLSMINQLQRRTIKQEEELSQQLACLQEKIADQPFALIAKESS  182

Query  543   KVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLS  364
              V   +   + ALD H+ +M R++ EADKLR++TL E++ IL+P+QA   L+  KKLHL 
Sbjct  183   HVASQNVQADEALDEHSTSMVRILEEADKLRIKTLKEMMNILSPVQAVDFLVAGKKLHLC  242

Query  363   IHEWSKKRD  337
             IH+W +KRD
Sbjct  243   IHDWGQKRD  251



>gb|KCW69957.1| hypothetical protein EUGRSUZ_F03275, partial [Eucalyptus grandis]
Length=228

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 136/197 (69%), Gaps = 18/197 (9%)
 Frame = -1

Query  1008  IAQQREDMEELSRAVESNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSW  832
             +AQQ  D++EL +AV ++ GD E L  +  +S++HF +Y + R+ LAQ +  P F  P W
Sbjct  1     MAQQHLDLDELLQAVSADSGDAEKLRSLAGKSIQHFRDYLEARSQLAQHDA-PSFFCPPW  59

Query  831   CTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKG-------------SL  691
             CT+FEN+F+WIGGCRP+L+IRLVYS  G+DL++ L G   G R+G             +L
Sbjct  60    CTSFENSFLWIGGCRPTLAIRLVYSSSGSDLEAQLDG---GARRGDDDRSNGSGGGGGNL  116

Query  690   GDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVER  511
             G+I+A+QL  IN L  KT+R E+KLS R+A++QE++AD+PLA+I  +S +VGE S  VER
Sbjct  117   GEITASQLKSINELHMKTLRMEEKLSGRMASMQEEIADDPLALIAKRSGRVGEESESVER  176

Query  510   ALDNHAVAMGRMVVEAD  460
              +  HA+++ R++ EAD
Sbjct  177   VMKRHALSLARVLTEAD  193



>ref|XP_007213175.1| hypothetical protein PRUPE_ppa027008mg, partial [Prunus persica]
 gb|EMJ14374.1| hypothetical protein PRUPE_ppa027008mg, partial [Prunus persica]
Length=230

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 136/197 (69%), Gaps = 3/197 (2%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEELSRAVESN-LGDDELFGVVDRSVKHFEEYQQHRALLAQ  868
             D  + +C F++W+  Q +D+ EL +A++ +    D+L  + ++ + HF++Y   R  LA+
Sbjct  5     DREQSKCCFKEWMELQEQDLSELLQALKLDPQNKDQLKHLAEKGICHFQDYINKRTQLAR  64

Query  867   QNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLG  688
             ++    F +P+WCT++EN+ +WI GCRPSL  RLVY L G+ ++S L  +LQ  R+GSLG
Sbjct  65    RDVSA-FFAPTWCTSWENSLLWIAGCRPSLFFRLVYVLGGSKMESKLSEFLQDTREGSLG  123

Query  687   DI-SATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVER  511
             ++ + +QL  +N+LQSKT+REE++L+  +A LQED+AD+P+AMI     ++GE + +VE 
Sbjct  124   EVLTCSQLVVVNSLQSKTIREEERLTGELAALQEDIADQPIAMIAKGLSQLGEMNREVEE  183

Query  510   ALDNHAVAMGRMVVEAD  460
             ALD H  AM R++ EAD
Sbjct  184   ALDEHGQAMVRILEEAD  200



>ref|XP_011101452.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=249

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 162/236 (69%), Gaps = 7/236 (3%)
 Frame = -1

Query  1029  RCVFQDWIAQQREDMEELSRAVESNL--GDD---ELFGVVDRSVKHFEEYQQHRALLAQQ  865
             RC F +W+  Q +D+ EL +++  N   GDD   +L  +VD++++HF+EY   RA LA+ 
Sbjct  10    RC-FNEWMNLQEQDLSELLQSLSLNDADGDDHTADLRELVDKNIRHFQEYASQRARLAR-  67

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGD  685
             N   PF SP+WCT+ E + +W GGCRPS+ +RLVY L G +L SHL  YL G R G LG+
Sbjct  68    NHVSPFFSPTWCTSLEGSMLWAGGCRPSIFVRLVYVLSGKELASHLDEYLHGGRSGGLGE  127

Query  684   ISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERAL  505
             +SA+Q+N IN+LQ +T+++EDKLS+ +A++QE+MAD+P+ +I  +     ++S++ + AL
Sbjct  128   LSASQINSINSLQLRTIQQEDKLSANLASIQEEMADQPIFIIAKELAACSQTSTEADEAL  187

Query  504   DNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
             +    ++  ++ EAD LRL TL EL  ILTP+Q+   +  A+KLHL +H W ++RD
Sbjct  188   NALTASLIGVLGEADSLRLNTLKELTSILTPVQSVDFIATARKLHLCVHAWGRRRD  243



>gb|EYU43340.1| hypothetical protein MIMGU_mgv1a020768mg, partial [Erythranthe 
guttata]
Length=244

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 105/250 (42%), Positives = 162/250 (65%), Gaps = 16/250 (6%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVE-------SNLGDDELFGVVDRSVKH  907
             M++SS  D  +  C++++W+  Q +++ EL++A+        +    DEL  ++D+ + H
Sbjct  1     MAASS--DQTKEACIYKEWMKLQEQELSELNQALTLTAAGCTTTGAADELSHLIDKIMAH  58

Query  906   FEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHL  727
             F EY Q R+ +AQ +  P F +P+WCT+ E + +WIGGCRPS  IRL+Y+L G +++S L
Sbjct  59    FVEYTQIRSCMAQADVSPYF-APTWCTSLERSVLWIGGCRPSSFIRLIYALSGLEIESRL  117

Query  726   QGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKS  547
               +L+G R G+LG +S  Q+  ++ LQ +T+ EE KLS+R+A+LQED+ D PLA I  KS
Sbjct  118   SEFLRGARIGNLGGLSGDQIFMVDELQGRTIGEERKLSTRMASLQEDLLDHPLASIAVKS  177

Query  546   KKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhL  367
             +       +++ ALD+H  AM  M+ EAD+LRL +L EL+ ILTP QA   +   KKL L
Sbjct  178   E------GNLDAALDDHGRAMAEMLAEADQLRLSSLKELIGILTPRQAVDFMAAGKKLRL  231

Query  366   SIHEWSKKRD  337
              + +W KKRD
Sbjct  232   CMQDWGKKRD  241



>ref|XP_010316826.1| PREDICTED: transcription factor TGA5-like [Solanum lycopersicum]
Length=279

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 160/251 (64%), Gaps = 12/251 (5%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDD----------ELFGVVDRSVKHFEEYQQHRALLA  871
             F++W+  Q++D+ EL    +S+               L  ++++S+KHF+EY   R  LA
Sbjct  19    FEEWMELQQQDLLELIHNSDSSSSSSTSNTSASSDFNLKQLIEKSIKHFQEYIDTRRHLA  78

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSL  691
               +    +L+P+WCTT E++ +WI GCRPS  IRL+Y++ G + +SHL  YLQG R G L
Sbjct  79    CSDV-TAYLAPTWCTTLESSMLWISGCRPSSYIRLLYAMSGKEFESHLSNYLQGNRSGHL  137

Query  690   GDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVER  511
               +   QLN ++ LQ KT+R+ED+LS+++A+LQE++AD+P A+I N+    GE   + E 
Sbjct  138   SGLLTVQLNSVDELQRKTIRQEDQLSNKLASLQEEIADQPFAIIANEVGNPGEICREAEE  197

Query  510   ALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRDGA  331
             ALD HA  +  +V EADKLR+ TL EL+ IL+PLQA   L+ +KKLHL ++ W KKRD  
Sbjct  198   ALDRHAKFLVNVVEEADKLRMVTLKELINILSPLQAVDFLIASKKLHLCVNAWGKKRDH-  256

Query  330   AAGRQFNTTQD  298
               GR   T Q+
Sbjct  257   QHGRNRETKQE  267



>gb|EYU29539.1| hypothetical protein MIMGU_mgv1a023140mg, partial [Erythranthe 
guttata]
Length=243

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 129/206 (63%), Gaps = 19/206 (9%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVE--------SNLGDDELFGVVDRSVKHFEEYQQHRA-LLAQ  868
             F +WI  ++ D++EL  A          +N  D+ L  +V++ + HFEEY + R  ++  
Sbjct  4     FNEWIELEKNDLDELVTAYSFSNDNNNSNNSDDERLKRLVEKGINHFEEYCKKRGEIIMD  63

Query  867   QNG---GPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER--  703
             QN       F+ P W  +F NAF+W GGCRPSL IRLVYS+ G++ D HL   L   R  
Sbjct  64    QNDIYDATSFMCPVWGNSFGNAFLWFGGCRPSLFIRLVYSVGGSEFDQHLSDQLHTRRGG  123

Query  702   -----KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKV  538
                  +G+L DIS  QL+ +NAL  +T++EE K+SS++ATLQE +AD+PLA+I   ++ V
Sbjct  124   DGIITRGNLADISGQQLHMVNALHCRTMKEEHKISSKMATLQEQIADKPLAVIAKNAEPV  183

Query  537   GESSSDVERALDNHAVAMGRMVVEAD  460
             GE S +VERA+  H+V++G ++ EAD
Sbjct  184   GEWSEEVERAMKAHSVSLGGILAEAD  209



>ref|XP_009599896.1| PREDICTED: transcription factor TGA3-like [Nicotiana tomentosiformis]
Length=261

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 147/234 (63%), Gaps = 6/234 (3%)
 Frame = -1

Query  1023  VFQDWIAQQREDMEELSRAV----ESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGG  856
             +++ W+  QRE++ EL  AV      ++ D EL  ++ +   +F+EY  +R  LAQ +  
Sbjct  18    LYETWMNLQREELTELEHAVTQARNGHMNDQELTKLIQKITNNFQEYSNNRKRLAQIDAS  77

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
             P F +P+ CT  EN+ +WIGGCRPS  IR +Y+LCG +++SHL  +LQG + G  G+++A
Sbjct  78    P-FFAPTSCTPLENSVLWIGGCRPSSFIRFIYALCGIEIESHLTEFLQGTKIGEFGELTA  136

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK-SKKVGESSSDVERALDN  499
              Q++ ++ LQ KT++EE +L SR+A+LQE + D+P+A  + K S   G    + +  LD 
Sbjct  137   KQISMVDELQGKTIKEERELCSRLASLQEHIVDQPVASKLKKDSGDEGNYCENADELLDE  196

Query  498   HAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
             H   M  +V EAD LR++TL E+  +LTP QA   L  AK++ L   +W KKRD
Sbjct  197   HIHEMATVVEEADDLRMKTLQEITSLLTPAQAVEYLAAAKRMRLCFQQWGKKRD  250



>gb|EYU43339.1| hypothetical protein MIMGU_mgv1a024141mg, partial [Erythranthe 
guttata]
Length=199

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 124/198 (63%), Gaps = 19/198 (10%)
 Frame = -1

Query  1053  SAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALL  874
             +A D  +  C++Q+W+  Q +++ EL+RAV       EL  +++R + HF +Y Q R+ +
Sbjct  2     AASDQTKEACIYQEWMNLQEQELTELTRAVSGGATGAELSQLIERVMAHFVDYMQKRSRM  61

Query  873   AQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGS  694
             A+ +  P F +P+WCT+ E + +WIGGCRPS  IRL+Y+LCG +++SHL  +L+G R G+
Sbjct  62    ARVDVSPYF-APTWCTSLERSVLWIGGCRPSSFIRLIYALCGLEIESHLAEFLRGARIGN  120

Query  693   LGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVE  514
             LG+++A Q+  ++ LQ+KT+REE KLS+R+A    +M                  S ++E
Sbjct  121   LGELTAAQVAMVDGLQAKTIREERKLSARMAGRSSEM------------------SGNLE  162

Query  513   RALDNHAVAMGRMVVEAD  460
              ALD H  AM  ++ EAD
Sbjct  163   AALDKHGRAMAEILEEAD  180



>ref|XP_010920258.1| PREDICTED: transcription factor TGA2 [Elaeis guineensis]
Length=257

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 106/248 (43%), Positives = 161/248 (65%), Gaps = 16/248 (6%)
 Frame = -1

Query  1035  RLRCVFQDWIAQQREDMEELSRAVESNL--GDDELFGVVDRSVKHFEEYQQHRALLAQQN  862
             R R  F +W+ +Q  D+ EL  +++S     D  L  +V++S++H++EY + R  LA+++
Sbjct  4     RFRSCFDEWVREQESDLNELLESMQSERRESDSRLRELVEKSMRHYKEYSEKRRALARED  63

Query  861   GGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQ-----GYLQGERKG  697
             G P F  P WCT FEN+F+W+GGCRP+LSIRL+Y+L G +L++HL      G L    + 
Sbjct  64    G-PTFFCPPWCTAFENSFLWLGGCRPTLSIRLLYALSGYELEAHLDDILAPGGLAAAFQR  122

Query  696   SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMI-VNKSKK---VGES  529
              L  +SA QL  +N L  +T++EED+LS+++ATLQED+AD+PL  I V+++++   V E 
Sbjct  123   GLVGLSAAQLATVNDLHCRTLKEEDRLSAKMATLQEDVADKPLLPIAVDRARRRAEVAEG  182

Query  528   SSD---VERALDNHAVAMGRMVVEADklrlrtltellki-lTPlqaahlllvakklhLSI  361
             S     VE  +  H   +  MV EAD+LR+ TL  L+   LTPLQA  LL+ AK+L LS+
Sbjct  183   SGGREVVEATMKEHEEKLAGMVEEADQLRVATLRTLVTEILTPLQAVELLVAAKQLQLSV  242

Query  360   HEWSKKRD  337
              +W ++RD
Sbjct  243   RQWGQRRD  250



>gb|EYU28097.1| hypothetical protein MIMGU_mgv1a017794mg, partial [Erythranthe 
guttata]
Length=237

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 125/200 (63%), Gaps = 6/200 (3%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEELSRAVESN----LGDDELFGVVDRSVKHFEEYQQHRAL  877
             D  +  C +Q W+A Q  ++ EL+RA+  N      D EL  ++DR + +F+ Y + R +
Sbjct  5     DEAKETCFYQQWMALQEHELSELNRAITLNANGSTSDFELTQLIDRILTNFKNYVKMRRV  64

Query  876   LAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKG  697
             +A+++  P +++P+WCTT E + +WIGGCRPS  IRL+Y+LCG   +S+L  +L G    
Sbjct  65    MAKEDVSP-YMAPTWCTTLERSVLWIGGCRPSSYIRLIYALCGMLTESNLTEFLNGSNTV  123

Query  696   SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMI-VNKSKKVGESSSD  520
             +LG++S  Q++ ++ LQ KT+ EE ++S+R+A LQED+ D+PLA+I V        SS  
Sbjct  124   NLGELSGAQMSMVDELQKKTIAEERRISTRMAGLQEDVLDDPLAVIAVGSEGGSCGSSGT  183

Query  519   VERALDNHAVAMGRMVVEAD  460
             VE AL  H  AM   +  AD
Sbjct  184   VEEALTEHGGAMAATLEAAD  203



>ref|XP_006358130.1| PREDICTED: transcription factor TGA1-like [Solanum tuberosum]
Length=280

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 139/212 (66%), Gaps = 3/212 (1%)
 Frame = -1

Query  930  VVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
            ++++S+KHF+EY   R  LA  +    +L+P+WCTT E++ +WI GCRPS  IRL+Y++ 
Sbjct  59   LIEKSIKHFQEYMDTRRHLAGSDV-TAYLAPTWCTTLESSMLWISGCRPSSYIRLLYAMS  117

Query  750  GADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP  571
            G + +SHL  YLQG R G L  +   QLN ++ LQ KT+R+ED+LS+++A+LQE++AD+P
Sbjct  118  GKEFESHLSNYLQGNRSGHLSGLLTVQLNSVDELQRKTIRQEDQLSNKLASLQEEIADQP  177

Query  570  LAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADkl-rlrtltellkilTPlqaahl  394
              +I N+   +GE   + E ALD HA  +  +V EADKL        ++ IL+PLQA   
Sbjct  178  FTIIANEVGNLGEICYEAEEALDRHAKFLMNVVEEADKLRMETLKELVINILSPLQAVDF  237

Query  393  llvakklhLSIHEWSKKRDGAAAGRQFNTTQD  298
            L+ +KKLHL ++ W K RD    GR   TTQ+
Sbjct  238  LIASKKLHLCVNAWGKTRDH-QHGRNRETTQE  268



>ref|XP_009619619.1| PREDICTED: transcription factor TGA2-like [Nicotiana tomentosiformis]
Length=255

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 135/205 (66%), Gaps = 2/205 (1%)
 Frame = -1

Query  948  DDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIR  769
            D  L  ++ +S+KHF++Y  +R   A+ N    +LSP+WCTT E++ +WI GC PS  IR
Sbjct  33   DCHLKQLISKSIKHFQDYIDNRRHFAR-NDVSAYLSPTWCTTLESSMLWISGCHPSSFIR  91

Query  768  LVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQE  589
            LVY+L G +L+SHL  YLQG+R G L ++S  QL  ++ LQ KT+ +E++LS+++A+LQE
Sbjct  92   LVYALSGRELESHLSNYLQGKRYGDLSELSTIQLKSVDELQMKTISQENRLSNKLASLQE  151

Query  588  DMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADkl-rlrtltellkilTP  412
            ++AD P+A+I N+     E   + E ALD HA  +  +V EADKL        ++ ILTP
Sbjct  152  EIADHPIAIIANEVGNFAEICGEAEEALDKHAKCLMNVVEEADKLRMETFKELVMNILTP  211

Query  411  lqaahlllvakklhLSIHEWSKKRD  337
             QA   L+ +KKLHL I+ W KKRD
Sbjct  212  FQALEFLVASKKLHLCINAWGKKRD  236



>ref|XP_010316820.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum lycopersicum]
Length=248

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 137/210 (65%), Gaps = 18/210 (9%)
 Frame = -1

Query  1065  MSSSSAVDH-RRLRCVFQDWIAQQREDMEELSRA-VESNLG---DDELFGVVDRSVKHFE  901
             M+SS++ D      CV++ W+  QR+++ EL +A V++  G   ++EL  +++++V++F+
Sbjct  1     MASSTSSDSPTEQECVYETWMILQRKEVIELEQAAVQAKNGLKNENELTQLIEKTVENFQ  60

Query  900   EYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQG  721
             +Y  +R+ LA+ +  P  L+P+ CT+ EN+ +WI GCRPS  IR  Y+LCG D++SHL  
Sbjct  61    DYANNRSRLARIDVSP-LLAPTSCTSLENSILWIAGCRPSSLIRFAYALCGMDIESHLTE  119

Query  720   YLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKK  541
             +LQG++ G L +++  Q+  I+ALQ+KT+REE  LSS++A+LQED  D+P A        
Sbjct  120   FLQGKKVGVLSELTNKQMKMIDALQAKTIREETNLSSKLASLQEDAVDQPFA--------  171

Query  540   VGESSSDVERA---LDNHAVAMGRMVVEAD  460
              G+  +D E A   LD H+  M  ++ +AD
Sbjct  172   -GKMENDCENADDVLDEHSRYMADVLRDAD  200



>ref|XP_009589153.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-1A-like 
[Nicotiana tomentosiformis]
Length=254

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/248 (39%), Positives = 158/248 (64%), Gaps = 9/248 (4%)
 Frame = -1

Query  1056  SSAVDHRRLRCVFQDWIAQQREDMEELSRAV----ESNLGDDELFGVVDRSVKHFEEYQQ  889
             SS   +  L C+++ W+  Q E++ EL +A      S   +++   ++D+ + HF++Y  
Sbjct  3     SSNNKNNELECLYESWMNLQHEELRELEQAAAAPKNSPKDEEKQTQLIDKIINHFQDYCN  62

Query  888   HRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSL-CGADLDSHLQGYLQ  712
             +R+ LA+++  P F +P+ CT  EN+ +WIGGCRPS  +RL+Y+L CG +++SH+  +L+
Sbjct  63    NRSRLAKKDVSP-FFAPTSCTPLENSVLWIGGCRPSSFVRLIYALFCGMEIESHITQFLK  121

Query  711   G-ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
             G  R G + + +A Q+N ++ LQ+KT+REE KLSSR+A+LQE++ D+PL     K K   
Sbjct  122   GITRNGEIREFTAKQMNMVDELQNKTIREEGKLSSRLASLQEEIVDQPLISKTKKKKDGD  181

Query  534   ES--SSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSI  361
             +     + +  LD H+  M  ++ EAD+LR++TL E++ IL P QA   L  AKK+ L I
Sbjct  182   DDVECENADEPLDKHSKYMAAIMEEADELRMKTLKEIVVILEPAQAVEYLAAAKKIRLCI  241

Query  360   HEWSKKRD  337
              +W KKRD
Sbjct  242   QQWGKKRD  249



>ref|XP_009758860.1| PREDICTED: transcription factor TGA3-like [Nicotiana sylvestris]
Length=263

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 148/249 (59%), Gaps = 8/249 (3%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAV----ESNLGDDELFGVVDRSVKHFEEY  895
             SSS+  + +    +++ W+  QRE++ EL +A       ++ D EL  ++ +   +F+EY
Sbjct  5     SSSTRTNRKEEESLYETWMNLQREELTELEQAATQARNGHINDQELTKLIQKITNNFQEY  64

Query  894   QQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL  715
               +R  LAQ +  P F +P  CT  EN+ +WIGGCRPS  IR +YSLCG +++SHL  + 
Sbjct  65    SNNRKRLAQIDA-PTFFAPISCTPLENSVLWIGGCRPSSFIRFIYSLCGIEIESHLTEFF  123

Query  714   QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSK---  544
             QG + G L D++A Q+  ++ LQ KT+ EE +L SR+++LQ ++ D+PL   + K     
Sbjct  124   QGTKIGELSDLTAKQITMVDELQGKTITEERELCSRLSSLQANIVDQPLPSKLKKDNGDD  183

Query  543   KVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLS  364
             +  + S +    LD     M  +V EAD+LR++TL E+  +LTP QA   L  AK+L L 
Sbjct  184   QGDQYSENAYERLDEQIHEMATVVEEADELRMKTLQEITSLLTPAQAVEYLAAAKRLRLC  243

Query  363   IHEWSKKRD  337
               +W KKRD
Sbjct  244   FQQWGKKRD  252



>ref|XP_009789465.1| PREDICTED: uncharacterized protein LOC104237085 [Nicotiana sylvestris]
Length=275

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 132/206 (64%), Gaps = 2/206 (1%)
 Frame = -1

Query  951  GDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSI  772
             D  L  ++ +S+KHF++Y  +R   A+ N    +L+P+WCTT E++ +WI GC PS  I
Sbjct  52   SDCHLKQLIAKSIKHFQDYIDNRRHFAR-NDVSAYLAPTWCTTLESSMIWISGCHPSSFI  110

Query  771  RLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQ  592
            RL+Y+L G +L+SHL  YLQG+R G L ++S  QL  I+ L  KT+R+E++LS  + +LQ
Sbjct  111  RLIYALSGRELESHLSNYLQGKRYGDLSELSTIQLKSIDELHMKTIRQENRLSKMLTSLQ  170

Query  591  EDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADkl-rlrtltellkilT  415
            E++AD+P+A+I N+     E   + E ALD HA  +  ++ EADKL         + IL+
Sbjct  171  EEIADQPIAIIANEVGNFAEICGEAEEALDKHAKCLRHVIEEADKLRMETFKELAMNILS  230

Query  414  PlqaahlllvakklhLSIHEWSKKRD  337
            P QA   L+ +KKLHL ++ W KKRD
Sbjct  231  PFQALEFLVASKKLHLCVNAWGKKRD  256



>ref|XP_004234088.1| PREDICTED: transcription factor TGA6-like [Solanum lycopersicum]
Length=251

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/247 (38%), Positives = 152/247 (62%), Gaps = 11/247 (4%)
 Frame = -1

Query  1059  SSSAVDHRRLRCVFQDWIAQQREDMEELS----RAVESNLGDDELFGVVDRSVKHFEEYQ  892
             ++S+ + +    ++  W+  Q+E+++EL     RA ++ L DDEL  ++ + V +F+ Y 
Sbjct  2     ANSSSNRKNEENLYNSWMNNQQEELKELQNAIVRARKNELNDDELNELLRKMVNNFQGYA  61

Query  891   QHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ  712
               R+ LA+ +  P F +P+WCT  EN+ +WIGGCRPS  IRL+Y+LCG ++ SH   YLQ
Sbjct  62    NGRSRLARVDVSP-FFAPTWCTPLENSVLWIGGCRPSTFIRLIYALCGIEIQSHTARYLQ  120

Query  711   GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGE  532
             G + G  G +S  Q+  I+ LQ + + EE + SSR+A+LQED+ D+P AM    + ++ +
Sbjct  121   GMKIGEFGHLSGEQITMIDKLQRQIILEERRFSSRLASLQEDVVDQPFAM----AARIYD  176

Query  531   SSSDVE--RALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIH  358
             +  D      L+ H   M  ++ E D+LR++TL E+L ILTP+Q    L   K++ L + 
Sbjct  177   TERDENEIEPLNKHGEDMSNLLEEVDELRMKTLKEILGILTPIQGVEYLAATKRIRLCLQ  236

Query  357   EWSKKRD  337
             +W KKR+
Sbjct  237   QWGKKRE  243



>ref|XP_009762839.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana sylvestris]
Length=255

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 150/236 (64%), Gaps = 8/236 (3%)
 Frame = -1

Query  1023  VFQDWIAQQREDMEELSRAVESNLGDDE--LFGVVDRSVKHFEEYQQHRALLAQQNGGPP  850
             +++ W+  Q E++ EL +A  +N   DE     ++++ + HF++Y  +R+ LAQ++  P 
Sbjct  16    LYESWMNLQHEELRELEQAAAANSPKDEHKQTQLIEKIINHFQDYSNNRSRLAQKDVSP-  74

Query  849   FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSL-CGADLDSHLQGYLQG-ERKGSLGDISA  676
             F +P+ CT  EN+ +WIGGCRPS  IRL+Y+L CG +++SH+  +LQG    G L   +A
Sbjct  75    FFAPTSCTPLENSVLWIGGCRPSSFIRLIYALFCGMEIESHITQFLQGITANGELPKFTA  134

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERA---L  505
              Q+N ++ LQSKT+REE KLSSR+A+LQE + D+PL     K K  G+     E A   L
Sbjct  135   EQMNMVDELQSKTIREEGKLSSRLASLQEAIIDQPLISKSKKKKDDGDDDVVCENADEPL  194

Query  504   DNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
             D H   M  ++ EAD+LR++TL E++ IL P QA   L  AKK+ L + +W KKR+
Sbjct  195   DKHNKYMAAIMEEADELRMKTLKEIVVILEPDQAVEYLAAAKKIRLCLQQWGKKRE  250



>ref|XP_009607760.1| PREDICTED: transcription factor TGA6-like [Nicotiana tomentosiformis]
Length=255

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 140/233 (60%), Gaps = 12/233 (5%)
 Frame = -1

Query  1023  VFQDWIAQQREDMEELSRAV----ESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGG  856
             ++Q W+  Q +++ EL  A     E+   D EL  ++ R V +F+ Y   R+ LA+ +  
Sbjct  26    LYQSWMYNQNQELNELENAATLARENQKNDTELNQLLARMVNNFQGYVNGRSRLARVDVS  85

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
             P F +P+WCT  EN+ +WIGGCRPS  IRL+Y+LCG +++SHL  +LQG + G  G +S 
Sbjct  86    PYF-APTWCTPLENSVLWIGGCRPSSFIRLIYALCGMEIESHLNEFLQGTKIGDFGQLSG  144

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNH  496
              Q+  I+ LQ K + EE K  S++A+LQED+ D+P+A          ++  + E  L+ H
Sbjct  145   EQVTMIDKLQRKIIVEERKHCSKLASLQEDVVDQPIAT-------AAKNRENEEEPLNKH  197

Query  495   AVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
                M  ++ EAD+LR+  L E+L ILTP+Q    L  AK++ L +  W KKR+
Sbjct  198   GQGMTTLLEEADELRMNALKEILGILTPIQGVEYLAAAKRIRLCLQRWGKKRE  250



>ref|XP_004161213.1| PREDICTED: uncharacterized LOC101207776 [Cucumis sativus]
Length=293

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/247 (37%), Positives = 148/247 (60%), Gaps = 15/247 (6%)
 Frame = -1

Query  1035  RLRCVFQDWIAQQREDMEELSRAVESNLGDDELFG---VVDRSVKHFEEYQQHRALLAQQ  865
             R RC F++W+  QRED+  L +++     +D       V+   + HFE Y  +R LLAQ+
Sbjct  34    RSRCCFEEWMQLQREDLTHLLKSLHQPTNNDTTTTTTTVIRNCISHFEHYISNRTLLAQE  93

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSL--CGAD--LDSHLQGYLQGERKG  697
             +  P F +P+WCT+ EN+ +W+ GCRPS+ IRL+Y+L  C ++  + +            
Sbjct  94    HPSPLF-APTWCTSLENSLLWMAGCRPSIFIRLIYALTSCSSEPLITNDDGNKNGNNTVT  152

Query  696   SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGE-----  532
             S+G++S +Q+ ++N L  +TV+ E+KL+S +A+ QE++ADEP+A+I  K     E     
Sbjct  153   SIGELSPSQMTRVNGLHMRTVKAEEKLTSELASWQEELADEPIALIAAKGDCGDEVVLNN  212

Query  531   -SSSDVERALDNHAVAMGRMVVEADkl-rlrtltellkilTPlqaahlllvakklhLSIH  358
               + + E AL  H   MG+++ +AD+L        +L+IL P QA   L+ +KKLHLS+H
Sbjct  213   MMNEEAEMALKEHEKVMGKVIGKADELRLNTMKELVLEILKPTQALQFLVASKKLHLSLH  272

Query  357   EWSKKRD  337
             +W K+RD
Sbjct  273   QWGKRRD  279



>ref|XP_009792490.1| PREDICTED: uncharacterized protein LOC104239538 [Nicotiana sylvestris]
Length=246

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 151/248 (61%), Gaps = 12/248 (5%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRA---VESNLGDD-ELFGVVDRSVKHFEE  898
             MSSS   D +    + + W+  Q E++ EL +A   +++ + DD +L  ++ + + +F++
Sbjct  1     MSSSINSDQKEEESLHESWLNLQHEELIELEQAAAQIKNGVKDDHKLTQLIAKIINNFQD  60

Query  897   YQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGY  718
             Y  +R+ LA+++  P F +P  CT FEN+ +WIGGCRPS  IRL+Y+L G +++SHL  +
Sbjct  61    YCNNRSRLAKKDVSP-FFAPKSCTPFENSVLWIGGCRPSSFIRLIYALSGMEIESHLIEF  119

Query  717   LQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKV  538
             L+G + G    ++  Q+  I+ LQ+KT++EE KL S++A+LQED+ D+PLA       K+
Sbjct  120   LEGIKTGEFHGLTIEQMTVIDKLQTKTIQEERKLCSKLASLQEDIVDQPLA------SKM  173

Query  537   GESSSDVERALDNHAVAMGRMVVEADkl-rlrtltellkilTPlqaahlllvakklhLSI  361
              +   + +  LD H+  M  ++ EADKL        +  ++TP QA   L  AK++ L +
Sbjct  174   MKDQENADEDLDKHSHNMATVMEEADKLRMKTLKQIVSILITPAQAVEYLAAAKRIRLCL  233

Query  360   HEWSKKRD  337
              +W KKRD
Sbjct  234   KQWGKKRD  241



>ref|XP_004150221.1| PREDICTED: uncharacterized protein LOC101207776 [Cucumis sativus]
 gb|KGN65627.1| hypothetical protein Csa_1G470430 [Cucumis sativus]
Length=293

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 148/247 (60%), Gaps = 15/247 (6%)
 Frame = -1

Query  1035  RLRCVFQDWIAQQREDMEELSRAVESNLGDDELFG---VVDRSVKHFEEYQQHRALLAQQ  865
             R RC F++W+  QRED+  L +++     +D       V+   + HFE Y  +R LLAQ+
Sbjct  34    RSRCCFEEWMQLQREDLTHLLKSLHQPTNNDTTTTTTTVIRNCISHFEHYISNRTLLAQE  93

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSL--CGAD--LDSHLQGYLQGERKG  697
             +  P F +P+WCT+ EN+ +W+ GCRPS+ IRL+Y+L  C ++  + +            
Sbjct  94    HPSPLF-APTWCTSLENSLLWMAGCRPSIFIRLIYALTSCSSEPLITNDDDNKNGNNTVT  152

Query  696   SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGE-----  532
             S+G++S +Q+ ++N L  +T++ E+KL+S +A+ QE++ADEP+A+I  K     E     
Sbjct  153   SIGELSPSQMTRVNGLHMRTIKAEEKLTSELASWQEELADEPIALIAAKGDCGDEVVLNN  212

Query  531   -SSSDVERALDNHAVAMGRMVVEADkl-rlrtltellkilTPlqaahlllvakklhLSIH  358
               + + E AL  H   MG+++ +AD+L        +L+IL P QA   L+ +KKLHLS+H
Sbjct  213   MMNEEAEMALKEHEKVMGKVIGKADELRLNTMKELVLEILKPTQALQFLVASKKLHLSLH  272

Query  357   EWSKKRD  337
             +W K+RD
Sbjct  273   QWGKRRD  279



>ref|XP_009395216.1| PREDICTED: transcription factor TGA2-like [Musa acuminata subsp. 
malaccensis]
Length=261

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 126/210 (60%), Gaps = 19/210 (9%)
 Frame = -1

Query  1035  RLRCVFQDWIAQQREDMEELSRAVESNLG-----DDELFGVVDRSVKHFEEYQQHRALLA  871
             R    +++W+  Q  D++EL +A+ +  G     D EL  +V+R ++H+EEY + R  L 
Sbjct  4     RFLACYEEWLGIQEADLDELLQAISTQHGNRERSDAELRELVERCMRHYEEYHERRRGLV  63

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQ---GYLQGERK  700
             + +  P FL P WC +FEN+ +W GGCRPS+ IRL+YSL  + L++HL    G       
Sbjct  64    RDDS-PTFLCPPWCNSFENSMIWAGGCRPSMFIRLIYSLSSSGLEAHLDAPAGRAVSSHG  122

Query  699   GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSK--------  544
               L  +S++QL ++N +   T++EEDK++S++ATLQE++AD PL  IV K +        
Sbjct  123   EGLMGLSSSQLARVNEIHRSTLQEEDKITSQMATLQENVADGPLLPIVKKRQMWQWSGTS  182

Query  543   --KVGESSSDVERALDNHAVAMGRMVVEAD  460
               + G   ++VE A++ +  +M R+V EAD
Sbjct  183   RVENGGGDAEVEAAMEEYTESMERLVQEAD  212



>ref|XP_009792613.1| PREDICTED: transcription factor TGA6-like [Nicotiana sylvestris]
Length=260

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 142/233 (61%), Gaps = 12/233 (5%)
 Frame = -1

Query  1023  VFQDWIAQQREDMEELSRAV----ESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGG  856
             +++ W+  Q +++ EL  A     ++   D EL  ++ R V +F+ Y   R+ LA+ +  
Sbjct  26    LYESWMENQNQELNELQNAATLARKNQKTDTELNQLLARMVNNFQGYVNGRSRLARVDIS  85

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
             P F +P+WCT  EN+ +WIGGCRPS  IR +Y+LCG +++SHL  +LQG      G +S 
Sbjct  86    PYF-APTWCTPLENSVLWIGGCRPSSFIRPIYALCGMEIESHLTEFLQGMEISDFGQLSG  144

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNH  496
              Q+  I+ L  K++ EE KLSS++A+LQED+ D+P+    N       +S + E  L+ H
Sbjct  145   KQIMLIDKLHRKSIVEERKLSSKLASLQEDVVDQPIITAAN-------NSENEEEPLNKH  197

Query  495   AVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
                M  ++ EAD+LR+ TL E+L ILTP+Q    L  AK++ LS+ +W KKR+
Sbjct  198   GQGMTTLLEEADELRMNTLKEILGILTPIQGVEYLASAKRIRLSLQQWGKKRE  250



>gb|EEC71515.1| hypothetical protein OsI_03809 [Oryza sativa Indica Group]
Length=294

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 127/231 (55%), Gaps = 42/231 (18%)
 Frame = -1

Query  1038  RRLRCVFQDWIAQQREDMEEL----SRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             R + C +Q WIA Q   + EL    + A      D EL  VV+R ++ + EY   R  LA
Sbjct  5     RHVAC-YQRWIAGQEAGLGELEASSANAAAGRATDGELRAVVERCMRGYAEYVSTRRALA  63

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSL  691
             +++G   F +P WCT+FEN+ +WIGGCRPSL+IRL+YSL G  L+ H++ ++ G  +G+L
Sbjct  64    REDGAALF-APPWCTSFENSVLWIGGCRPSLTIRLLYSLSGEGLEEHIEEFISG--RGAL  120

Query  690   G--------DISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIV-------  556
             G         I+A QL  +N L  +T+R+ED LS R+ATLQED+AD PL  IV       
Sbjct  121   GAARGMGLLGITARQLELVNDLHRRTLRDEDALSDRLATLQEDVADRPLLPIVRERATAA  180

Query  555   --------------NKSKKV-----GESSSDVERALDNHAVAMGRMVVEAD  460
                            +++ V     G    +V+ A+  +   +GR++ EAD
Sbjct  181   AAALGAGASCDGLATRTRLVVATPEGAVDHEVDAAIGRYKAGLGRLLEEAD  231



>ref|XP_006414070.1| hypothetical protein EUTSA_v10027258mg [Eutrema salsugineum]
 gb|ESQ55523.1| hypothetical protein EUTSA_v10027258mg [Eutrema salsugineum]
Length=264

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/271 (37%), Positives = 164/271 (61%), Gaps = 19/271 (7%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELFG-VVDRSVKHFEEYQQ  889
             M++S+ ++  +  C + +W++ Q + + +L  A+ +   DD   G +V   V  F++Y +
Sbjct  1     MATSNGIEQLQKGC-YHEWMSLQAKRIVDLKEALTTK--DDRKLGELVGEIVDEFQKYTK  57

Query  888   HRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL--  715
              R+ L+ ++    F +PSW ++ EN+ +W+GGCRPS  IR++Y+ CG+  ++ L  YL  
Sbjct  58    KRSELSDRSCSSYF-APSWNSSLENSLLWMGGCRPSSFIRVIYATCGSQAETQLSQYLLK  116

Query  714   ------QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVN  553
                   +    GSL D+++ QL QIN L  K + +EDKLS + A LQED+AD P+A+   
Sbjct  117   IDENIHENHGDGSLSDLTSVQLGQINELHMKVIEKEDKLSKKAANLQEDVADMPIAVTAY  176

Query  552   KSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakkl  373
              +  V E+   VE  LD H   +G ++ EADKLR+ TL ++++++TP+QAA  LL  K+L
Sbjct  177   ATDLV-EAGVAVENVLDKHEECLGVLMAEADKLRVETLKKIVEVMTPVQAAEFLLAGKRL  235

Query  372   hLSIHEWSKKRDGAAAGRQFNTTQ-DAAAAA  283
             H+S+HEW + R+     R+F     D AAAA
Sbjct  236   HVSLHEWGRVRE----ERRFGCAHVDHAAAA  262



>ref|XP_006830264.1| hypothetical protein AMTR_s00130p00113960 [Amborella trichopoda]
 gb|ERM97680.1| hypothetical protein AMTR_s00130p00113960 [Amborella trichopoda]
Length=255

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 142/229 (62%), Gaps = 4/229 (2%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             F++WIA+Q   + EL  A  +++ +  L  +++R + H+E Y   ++  A++N    F S
Sbjct  15    FEEWIAEQERQLHELMAASHAHINEKTLRSLIERVMAHYEAYYDAKSKAAKENIVGMF-S  73

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQ  661
             P+W +  ENAF+WI G RP++  RL+Y+  G  LDS L   LQG  + +L D+S +QL  
Sbjct  74    PTWTSKLENAFLWIAGWRPAMVFRLLYAKAGLQLDSDLADLLQGLSRRNLADLSPSQLMA  133

Query  660   INALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMG  481
             +N LQ KT++EE+++S ++A LQE +AD+PL  +V   + V      VE AL+     + 
Sbjct  134   VNELQMKTIKEEEEISRKMAKLQEGVADQPLVGLV---QMVNAEEDGVEAALEEQEEGLE  190

Query  480   RMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRDG  334
             R++  AD+LRL TL  ++ +L  +QA  LL+ A +LHL IHEW  KRDG
Sbjct  191   RVLECADRLRLETLKSVVGVLNLIQAVDLLVAAAQLHLKIHEWGMKRDG  239



>ref|XP_010518808.1| PREDICTED: uncharacterized protein LOC104798429 [Tarenaya hassleriana]
Length=293

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 157/274 (57%), Gaps = 31/274 (11%)
 Frame = -1

Query  1071  IEMSSSSAVDHRRLRCVFQDWIAQQREDMEELS------RAVESNLG-------DDELFG  931
             +E S+   +D  +  C F  W++ Q ++M +L       R+V+ N G       D+ L  
Sbjct  1     MENSNGGDIDETQRSC-FDAWMSLQAQNMVDLKHALVDHRSVDQNHGLGHRNCIDEALRE  59

Query  930   VVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
             +  + V+ FE+Y + R  LA++   P F +P W +  ENA +W+GGCRPS  IRL+Y+LC
Sbjct  60    LNQKIVRDFEQYMRKRYELARRFSSPYF-APPWNSQLENALLWMGGCRPSSFIRLIYALC  118

Query  750   GADLDSHLQGYL----------------QGERKGSLGDISATQLNQINALQSKTVREEDK  619
             GA+ +  L  ++                + E   S+G ++ TQ+ ++N +   TV+ EDK
Sbjct  119   GAETEMFLSKFIDLSSCPNYSPATDVIGEVETGCSIGGLTTTQMRKLNDIHIATVQAEDK  178

Query  618   LSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtl  439
             L+SR+A++QED +D+P A++      VG S   VERALD    A+  +V EADKLRL T+
Sbjct  179   LTSRVASVQEDTSDKPAALVAYYVDSVGGSHEAVERALDKQEAALAEIVSEADKLRLSTM  238

Query  438   tellkilTPlqaahlllvakklhLSIHEWSKKRD  337
               ++ IL+ +QA+  L  AKKLHLS+HEW   RD
Sbjct  239   KSIIGILSTVQASDFLFAAKKLHLSMHEWGSLRD  272



>ref|XP_010449483.1| PREDICTED: uncharacterized protein LOC104731709 isoform X1 [Camelina 
sativa]
Length=279

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 98/246 (40%), Positives = 151/246 (61%), Gaps = 19/246 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDD-ELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFL  844
             + +W++ Q   M EL +A+ +   DD +L  +   +++ FE+Y + R+  +++     + 
Sbjct  16    YNEWMSLQARRMTELKQALSNGEKDDAKLRDLARTAIRDFEDYARKRSKHSRRYS-SNYY  74

Query  843   SPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL-----------QGERKG  697
             +P+W T  ENA +WIGGCRPS  IRL+Y++CG+  +     +L            GE  G
Sbjct  75    APTWNTCLENALLWIGGCRPSSFIRLIYAMCGSQTEHRFSSFLCNNNIDDLSMALGETHG  134

Query  696   SLG------DISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
              +G      D++A QL +IN L  KTV+ E+KLS + A+LQED AD P+AM     +++G
Sbjct  135   EIGGEDSMSDLTAEQLFKINELHLKTVQAENKLSKQSASLQEDTADIPMAMAAFYKEEIG  194

Query  534   ESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHE  355
             E+   VERALD H   M  ++VEADKLRL T+T++++ILT +QA   LL  KKLHL++HE
Sbjct  195   ETDVVVERALDKHEEDMAGLLVEADKLRLTTMTKIVEILTAVQAVDFLLAGKKLHLAMHE  254

Query  354   WSKKRD  337
             W + R+
Sbjct  255   WGRCRE  260



>ref|XP_006414069.1| hypothetical protein EUTSA_v10025925mg [Eutrema salsugineum]
 gb|ESQ55522.1| hypothetical protein EUTSA_v10025925mg [Eutrema salsugineum]
Length=284

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 95/253 (38%), Positives = 154/253 (61%), Gaps = 13/253 (5%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQRE--DMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQ  889
             SSS  ++  +  C ++  I Q +   D++E   + +SN  D +L  +V   V  F++Y +
Sbjct  6     SSSYEIEKLQKGCYYEWMILQAKHIVDLKEALTSQQSNKNDHKLGELVGEIVDDFQKYTK  65

Query  888   HRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL--  715
              R+ L+ Q+    F +PSW ++ EN  +W+GG RPS  IR++Y++CG+  ++ L  YL  
Sbjct  66    RRSELSHQSCSSYF-APSWNSSLENGLLWMGGSRPSSFIRVIYAMCGSQTETQLSQYLFI  124

Query  714   -------QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIV  556
                    +    GS+  +++TQL QIN L  K ++EEDK+S + A+LQED AD P+A+  
Sbjct  125   KIDENIHENHGDGSMSQLTSTQLWQINELHMKVIKEEDKISKKAASLQEDAADMPIAVTA  184

Query  555   NKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakk  376
               +  V E+   VE ALD H   M  ++VEADKLR  TL ++++++TP+QAA  LL  K+
Sbjct  185   YATDLV-EAGVAVEDALDKHEECMAVLMVEADKLRFETLRKIVEVVTPVQAAEFLLAKKR  243

Query  375   lhLSIHEWSKKRD  337
             L++S+HEW + R+
Sbjct  244   LYVSLHEWGRVRE  256



>ref|XP_004134926.1| PREDICTED: transcription factor TGA1-like [Cucumis sativus]
 ref|XP_004155627.1| PREDICTED: transcription factor TGA1-like [Cucumis sativus]
 gb|KGN49311.1| hypothetical protein Csa_6G519630 [Cucumis sativus]
Length=263

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 153/242 (63%), Gaps = 13/242 (5%)
 Frame = -1

Query  1029  RCVFQDWIAQQREDMEELSRAVE-------SNLGDDE--LFGVVDRSVKHFEEYQQHRAL  877
             RC F +W+  Q +  +EL +A++       SN  + E  L  +VD+S++ F++Y   R  
Sbjct  15    RC-FLEWMKIQEDSQKELFQALKAIENRPNSNHEETERQLTQLVDKSIEQFQDYIDRRMQ  73

Query  876   LAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKG  697
             LA+ N    F +P WC+T E + +WI GCRPS+ IRL YSL G +L++ +  +LQG +  
Sbjct  74    LAK-NDVSLFFAPVWCSTREASLLWIAGCRPSVFIRLAYSLTGYELETRMAEFLQGMKSM  132

Query  696   S--LGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSS  523
                 G+++  Q+ Q+++LQ +T++EE++L+S +A +QE+MAD+ +  I  +S K    S 
Sbjct  133   EELAGELTPQQMEQLDSLQMRTIKEEERLTSELARVQEEMADQTVVGIAMRSMKEEGGSE  192

Query  522   DVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKK  343
             ++ERAL+     M R++ +ADKLR+RTL EL +I  PLQA   L  +KKLHLSI EW ++
Sbjct  193   ELERALEKQDGEMVRLIQQADKLRIRTLNELTEIFRPLQAVLFLAFSKKLHLSIREWGQR  252

Query  342   RD  337
              D
Sbjct  253   SD  254



>emb|CDM84316.1| unnamed protein product [Triticum aestivum]
Length=295

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 129/231 (56%), Gaps = 36/231 (16%)
 Frame = -1

Query  1047  VDHRRLRCVFQDWIAQQREDMEELSRAVESNLG----DDELFGVVDRSVKHFEEYQQHRA  880
             +D  R     Q WIA Q+  + EL+ A  +       D EL  VV+R ++ ++EY   R 
Sbjct  1     MDMARYVAFHQQWIAGQQAGLGELAEAAANAAAGRATDAELKTVVERCMRGYQEYAASRR  60

Query  879   LLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERK  700
              +A++NG   F++P WCT FEN+ +W+GGCRPSL+IRL+YS+ G  L+  ++ ++ G  +
Sbjct  61    AMARENGAA-FVAPPWCTAFENSVLWLGGCRPSLAIRLLYSISGEGLEEDIEEFVSGRGR  119

Query  699   G-----SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK-----  550
             G      L  I+ATQL QIN L   T+R+E  L+ R+A+LQE++AD PL  IV +     
Sbjct  120   GLAEEMGLIGITATQLQQINDLHRCTLRDEGYLTERLASLQENIADRPLLPIVREHAVAA  179

Query  549   ---------------------SKKVGESSSDVERALDNHAVAMGRMVVEAD  460
                                  ++  G  +++V+ A+++++  + R++ EAD
Sbjct  180   TALVGQDRSVKRDDIPGRLAAAESSGGLAAEVDAAMESYSAGLARLLEEAD  230



>ref|XP_010434502.1| PREDICTED: uncharacterized protein LOC104718448 [Camelina sativa]
Length=279

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 98/246 (40%), Positives = 151/246 (61%), Gaps = 19/246 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDD-ELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFL  844
             + +W++ Q   M EL +A+ +   DD +L  +   +++ FE+Y   R+  +++     + 
Sbjct  16    YNEWMSLQARRMTELKQALSNGEKDDAKLRDLARTALRDFEDYAGKRSKHSRRYS-SNYY  74

Query  843   SPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ-----------GERKG  697
             +P+W T  ENA +WIGGCRPS  IRL+Y++CG+  +     +L+           GE  G
Sbjct  75    APTWNTCLENALLWIGGCRPSSFIRLIYAMCGSQTEHRFSNFLRNDNIDDLSMALGETHG  134

Query  696   ------SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
                   S+ D++A QL +IN L  KTV+ E+KLS + A+LQED AD P+AM     +++G
Sbjct  135   ETGGEDSMSDLTAEQLFKINELHLKTVQAENKLSKQSASLQEDTADIPMAMAAFYKEEIG  194

Query  534   ESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHE  355
             E+   VERALD H   M  ++VEADKLRL T+T++++ILT +QA   LL  KKLHL++HE
Sbjct  195   ETDVVVERALDKHEEDMAGLLVEADKLRLTTMTKIVEILTAVQAVDFLLAGKKLHLAMHE  254

Query  354   WSKKRD  337
             W + R+
Sbjct  255   WGRCRE  260



>ref|XP_010317335.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum lycopersicum]
Length=250

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 145/239 (61%), Gaps = 18/239 (8%)
 Frame = -1

Query  1029  RCVFQDWIAQQREDMEELSRAVESNLGDDE-----LFGVVDRSVKHFEEYQQHRALLAQQ  865
             +CV   W++ Q E++ EL  A  + + D E     L  + ++ ++HF+E+  +R  LA++
Sbjct  17    KCV---WMSLQHEELTELEDAA-AQIQDGEKDEGKLTQLAEKIIQHFQEHSDNRLRLARK  72

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGY---LQGERKGS  694
             +  P F +P  C+  EN+ +WI GCRPS  IRL+Y+LCG + D  +QG    L+G     
Sbjct  73    DVSP-FFAPVTCSPLENSVLWIAGCRPSSFIRLIYALCGFEPD--VQGTDPCLEGIVTED  129

Query  693   LGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVE  514
             L ++S  QL  IN LQ KT+REE ++S++ A+LQED  D+PLA    K KK G      +
Sbjct  130   LRELSEKQLRMINELQGKTIREERRISTKFASLQEDTVDQPLA---GKMKKEGHGCEKAD  186

Query  513   RALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
              ALD H+  M  ++ EAD+LR++TL E++ IL P+QA   L  AKK+   + +W +KRD
Sbjct  187   EALDEHSGHMADVIEEADRLRMKTLKEIVNILEPVQAVEYLAAAKKMRFCVQQWGEKRD  245



>gb|KFK28541.1| hypothetical protein AALP_AA7G010100 [Arabis alpina]
Length=267

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 159/255 (62%), Gaps = 11/255 (4%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAV---ESNLGDDELFGVVDRSVKHFEEYQ  892
             SSS  ++     C ++ W++ Q + +  L  A+    SN  D +L  +V   +  F++Y 
Sbjct  5     SSSYGIEQLEKGCYYE-WMSLQAKHIANLKEALVSQRSNENDHKLEELVRVIINDFQKYA  63

Query  891   QHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ  712
             + R  L+ ++    F +PSW ++ EN+ +W+GGCRPS  IR++Y+LCG+ +++ +  YL 
Sbjct  64    EKRLKLSHRSCSSYF-APSWNSSLENSLLWMGGCRPSSFIRVIYALCGSQVETQIFQYLH  122

Query  711   ---GERK--GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKS  547
                G +K  G + +++ATQL +IN L  K +++EDK+S + A +QED+AD P+A +   +
Sbjct  123   KIDGNKKDDGLMSELTATQLAKINELHMKVIKKEDKISKKSANMQEDVADMPIA-VTAYT  181

Query  546   KKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhL  367
             K + E+   VE ALD +   M  ++ EADKLR+ TL ++++++TP+QAA  +L  K+LH+
Sbjct  182   KDLVEAGVVVEDALDKYEEGMAVLMAEADKLRVETLRKIVEVVTPVQAAEFILAGKRLHV  241

Query  366   SIHEWSKKRDGAAAG  322
             S+HEW + R+    G
Sbjct  242   SLHEWGRVREDGRFG  256



>ref|XP_011081582.1| PREDICTED: transcription factor HBP-1b(c38)-like [Sesamum indicum]
Length=249

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/246 (37%), Positives = 147/246 (60%), Gaps = 7/246 (3%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEEL-----SRAVESNLGDDELFGVVDRSVKHFEEYQQHRA  880
             D  + +C++++W+  Q +++ EL     +    ++  D E   ++++ ++HF++Y  +R 
Sbjct  5     DKSQEQCLYKEWMRLQEQELSELLHHSLNLNNTTDTNDAETTQLLEKIIQHFQDYCDNRR  64

Query  879   LLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERK  700
              LA ++    F SPSWCTT EN+  WI GCRPS    LVY+LCG+++DS L  +LQ +  
Sbjct  65    HLAHRHVSA-FFSPSWCTTLENSMSWIAGCRPSSFFNLVYALCGSNIDSSLSQFLQ-DGN  122

Query  699   GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSD  520
                   SA+QL+ I+ LQ +T  EE+ L++++A+LQ+DM D PLA+I  +     E + D
Sbjct  123   SDFPKFSASQLSAIDKLQRRTTIEEEMLTAQMASLQQDMTDMPLALIARELSPRNELNLD  182

Query  519   VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKR  340
             V++ L     AM   + +AD LR+ T+ EL KIL P+QA   ++ AKKL L I  W  ++
Sbjct  183   VQKRLGKFEQAMRSAMNDADNLRINTVKELFKILKPVQALEYIIAAKKLRLCIQSWGIEK  242

Query  339   DGAAAG  322
             D    G
Sbjct  243   DREHGG  248



>dbj|BAO79416.1| wheat delay of dormancy 1 [Triticum aestivum]
Length=295

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 127/227 (56%), Gaps = 36/227 (16%)
 Frame = -1

Query  1035  RLRCVFQDWIAQQREDMEELSRAVESNLG----DDELFGVVDRSVKHFEEYQQHRALLAQ  868
             R     Q WIA Q+  + EL+ A  +       D EL  VV+R ++ ++EY   R  +A+
Sbjct  5     RYVAFHQQWIAGQQAGLGELAEAAANAAAGRATDAELKTVVERCMRGYQEYAASRRAMAR  64

Query  867   QNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKG---  697
             +NG   F++P WCT FEN+ +W+GGCRPSL+IRL+YS+ G  L+  ++ ++ G  +G   
Sbjct  65    ENGAA-FVAPPWCTAFENSVLWLGGCRPSLAIRLLYSISGEGLEEDIEEFVSGRGRGLAE  123

Query  696   --SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK---------  550
                L  I+ATQL QIN L   T+R+E  L+ R+A+LQE++AD PL  IV +         
Sbjct  124   EMGLIGITATQLQQINDLHRCTLRDEGYLTERLASLQENIADRPLLPIVREHAVAATALV  183

Query  549   -----------------SKKVGESSSDVERALDNHAVAMGRMVVEAD  460
                              ++  G  +++V+ A+++++  + R++ EAD
Sbjct  184   GQDRSVKRDDIPGRLAAAESSGGLAAEVDAAMESYSAGLARLLEEAD  230



>gb|KFK31508.1| hypothetical protein AALP_AA6G121700 [Arabis alpina]
Length=278

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 149/256 (58%), Gaps = 16/256 (6%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNL------GDDELFGVVDRSVKHFE  901
             SS+  ++  +  C +Q W+A Q   + EL +A+           D  L  ++ + +  F+
Sbjct  6     SSTKNIEQAQESC-YQGWMAIQSGRVPELKQALAHRRSQNDPNADKTLRELIGKIIGDFK  64

Query  900   EYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQG  721
              Y   RA L+   G   + +PSW T  ENA +W+GGCRPS   RL+Y+LCG+  +  +  
Sbjct  65    NYAGKRAHLSNLCGSN-YYAPSWNTHLENALIWMGGCRPSSFFRLIYALCGSQTEIRVYQ  123

Query  720   YLQ--------GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLA  565
             +L+        G    SL D++A QL +IN L  K + EE+KL+ +I++LQED AD P+A
Sbjct  124   FLRNIDGYDPSGGGGASLSDLTAEQLAKINVLHVKIIDEEEKLTKKISSLQEDAADIPIA  183

Query  564   MIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllv  385
              +    + VGE ++ V++ALD    AM  ++ +AD LR+ TLT++++ILTP Q A  LL 
Sbjct  184   TVAYSEEHVGEPNAMVDKALDKQEEAMASLLAQADHLRVDTLTKIVEILTPTQGADFLLA  243

Query  384   akklhLSIHEWSKKRD  337
              KKLHLS+HEW   RD
Sbjct  244   GKKLHLSMHEWGTVRD  259



>gb|KFK28539.1| hypothetical protein AALP_AA7G009900 [Arabis alpina]
Length=274

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 157/250 (63%), Gaps = 14/250 (6%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAV---ESNLGDDELFGVVDRSVKHFEEYQ  892
             SSS  ++  +  C + +W+  Q + +  L  A+   +S   D +L GV+   V  F++Y 
Sbjct  5     SSSYEIEQLQKGCYY-EWMGLQAKHIANLKEALMSQQSYENDHKLVGVI---VNDFQKYA  60

Query  891   QHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ  712
             + R  L+ ++    F +PSW ++ EN  +W+GGCRPS  IR++Y+LCG+ +++ +  YL 
Sbjct  61    EKRRELSHRSCSSYF-APSWNSSLENGLLWMGGCRPSSFIRVIYALCGSQIETQISQYLH  119

Query  711   ---GERK--GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKS  547
                G  K  G + +++ATQL +IN L  K + +EDK+S + A++QED+AD P+A +   +
Sbjct  120   KIDGNEKVDGLMSELTATQLAKINELHIKVIEKEDKISKKSASMQEDVADMPIA-VTAYA  178

Query  546   KKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhL  367
             K + E+   VE ALD H   M  ++ EADKLR+ TL ++++++TP+QAA  LL  K+LH+
Sbjct  179   KDLVEAGVVVEDALDKHEEGMAVLMEEADKLRVETLRKIVEVVTPVQAAEFLLAGKRLHV  238

Query  366   SIHEWSKKRD  337
             S+HEW + R+
Sbjct  239   SLHEWGRVRE  248



>ref|XP_008439732.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
 ref|XP_008439733.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
 ref|XP_008439734.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
 ref|XP_008439735.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
 ref|XP_008439736.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
Length=263

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 153/242 (63%), Gaps = 13/242 (5%)
 Frame = -1

Query  1029  RCVFQDWIAQQREDMEELSRA-------VESNLGDDE--LFGVVDRSVKHFEEYQQHRAL  877
             RC F +W+  Q +  +EL +A       V SN  + E  L  +VD+S++ F++Y   R  
Sbjct  15    RC-FLEWMKLQEDSQKELFQALSAIENRVNSNHEEAERQLTQLVDKSIEEFQDYIDRRMQ  73

Query  876   LAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER--  703
             LA+ N    F +P WC+T E + +WI GCRP++ IRL YSL G +L++ +  +LQG +  
Sbjct  74    LAK-NDVSLFFAPVWCSTREASLLWIAGCRPTIFIRLAYSLTGYELETRMAQFLQGMKSM  132

Query  702   KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSS  523
             +   G+++  Q+ Q+++LQ +T++EE++L+S +A +QE+MAD+ +  I  +S K      
Sbjct  133   EDIAGELTPQQMEQLDSLQMRTIKEEERLTSELARVQEEMADQTVVGIAMRSMKEQIGIE  192

Query  522   DVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKK  343
             ++ERAL+     M R++ +ADKLR+RTL EL +IL PLQA   L  +KKLHLS+ EW ++
Sbjct  193   ELERALEKQDGEMVRLIQQADKLRIRTLNELTEILRPLQAVLFLAFSKKLHLSVREWGQR  252

Query  342   RD  337
              D
Sbjct  253   ND  254



>gb|ACG36725.1| tumor-related protein [Zea mays]
 gb|ACG48754.1| tumor-related protein [Zea mays]
Length=297

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 156/282 (55%), Gaps = 40/282 (14%)
 Frame = -1

Query  1047  VDHRRLRCVFQDWIAQQREDMEELSRAVESNL----GDDELFGVVDRSVKHFEEYQQHRA  880
             +D  R    ++ WIA Q   + EL  A  +       D EL  VV+R +  +++Y   R 
Sbjct  1     MDMARYESCYRHWIAGQEAGLAELEAASANAAAGRATDAELRTVVERCMLGYQDYATRRR  60

Query  879   LLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERK  700
              L++++G   F +P WCT FEN+ +W+GGCRPSL++RL+Y+L G  L++ ++  L G   
Sbjct  61    ALSREDG-VAFFAPPWCTAFENSVLWLGGCRPSLTVRLLYNLSGEGLEAQVEELLGGLSN  119

Query  699   -----GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
                  G+LG I++ QL  IN L S+TV +E+ LS R+ATLQED+AD PL  IV + +   
Sbjct  120   GVIPTGALG-ITSAQLVLINDLHSRTVHQENALSDRLATLQEDIADRPLLPIVRQRELAA  178

Query  534   ESS----------------------------SDVERALDNHAVAMGRMVVEADklrlrtl  439
              +                             ++V+ ALD++  A+ R++VEAD+LR+ T 
Sbjct  179   AARLGAAAAASGSCDGAARRRLRAARLGAADAEVDAALDSYKAALSRLLVEADELRMATA  238

Query  438   tellki-lTPlqaahlllvakklhLSIHEWSKKRDGAAAGRQ  316
               L    LTP QA  +L   K LHLS+ +WS++R+ AA  +Q
Sbjct  239   RALATEILTPRQAVEMLAAGKHLHLSVRDWSRRREAAAGAQQ  280



>ref|XP_010439826.1| PREDICTED: uncharacterized protein LOC104723193 [Camelina sativa]
Length=279

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 98/246 (40%), Positives = 150/246 (61%), Gaps = 19/246 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGD-DELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFL  844
             + +W++ Q   M EL +A+ +   D  +L  +   +++ FE+Y   R+  +++     + 
Sbjct  16    YNEWMSLQARRMTELKQALSNGEKDYAKLRDLARTALRDFEDYAGKRSKHSRRYS-SNYY  74

Query  843   SPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ-----------GERKG  697
             +P+W T  ENA +WIGGCRPS  IRL+Y++CG+  +     +L+           GE  G
Sbjct  75    APTWNTCLENALLWIGGCRPSSFIRLIYAMCGSQTEHRFSNFLRNDNIDDLSMALGETHG  134

Query  696   SLG------DISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
              +G      D++A QL +IN L  KTV+ E+KLS + A+LQED AD P+AM     +++G
Sbjct  135   EIGGGDSMSDLTAEQLFKINELHLKTVQAENKLSKQSASLQEDTADIPMAMAAFYKEEIG  194

Query  534   ESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHE  355
             E+   VERALD H   M  ++VEADKLRL TLT++++ILT +QA   LL  KKLHL++HE
Sbjct  195   EADVVVERALDKHEEDMAGLLVEADKLRLTTLTKIVEILTAVQAVDFLLAGKKLHLAMHE  254

Query  354   WSKKRD  337
             W + R+
Sbjct  255   WGRCRE  260



>gb|EYU20277.1| hypothetical protein MIMGU_mgv1a018018mg [Erythranthe guttata]
Length=258

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/237 (37%), Positives = 145/237 (61%), Gaps = 9/237 (4%)
 Frame = -1

Query  1023  VFQDWIAQQREDMEELSRAVESNL-------GDDELFGVVDRSVKHFEEYQQHRALLAQQ  865
             ++++W++ Q +++ EL  ++  N         D E+  ++D++ + F++Y + R  LA++
Sbjct  14    MYKEWMSFQEQELTELIHSLNLNKTTATTSDNDAEINALLDKATQSFQDYIERRNRLARR  73

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGD  685
             +    F SP WC++FE++ +WI GCRPS    L Y+LCG+D+DS L  +LQ  +      
Sbjct  74    DTSA-FFSPRWCSSFESSMLWIAGCRPSSFFNLFYALCGSDIDSRLSQFLQDGKSDEFPQ  132

Query  684   ISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSK-KVGESSSDVERA  508
             +S +QL  I+ LQ +T+ EE+KL+S+ A+LQ+D AD PLA+I  K +    E + DV   
Sbjct  133   LSPSQLVAIDNLQRRTIVEEEKLTSQFASLQQDKADVPLALIARKLEGPQYELNEDVRET  192

Query  507   LDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
             +     AM  ++ EAD LRL T  E++KIL P+QA   ++ AKKL + +  W ++RD
Sbjct  193   IAEIEKAMVCLMEEADNLRLETFKEMVKILKPVQALEFIIAAKKLRVCVRSWGEERD  249



>emb|CAB37451.1| putative protein [Arabidopsis thaliana]
 emb|CAB78868.1| putative protein [Arabidopsis thaliana]
Length=281

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 152/249 (61%), Gaps = 22/249 (9%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDD-ELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFL  844
             + +W++ Q + + EL  A+ +   DD +L  ++  +++ F +Y + R+  +++     F 
Sbjct  16    YNEWMSLQAKRITELKEAISTGEKDDNKLLDLIRTAIRDFGDYARKRSEHSRRFSSNYF-  74

Query  843   SPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGA---------------DLDSHLQGYLQG  709
             +P+W T  ENA +W+GGCRPS  IRLVY++CG+               D+DS+L   L  
Sbjct  75    APTWNTCLENALLWMGGCRPSSFIRLVYAMCGSQTEHRLTNFFNNTNHDIDSNLSMALGE  134

Query  708   ERKG-----SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSK  544
              R G     S+ D++A QL +IN L  KTV  E+KL+   A+LQED AD P+A+     +
Sbjct  135   TRGGIGGGESMSDLTAEQLFKINELHLKTVEAENKLTKVSASLQEDTADTPIAVAAFYKE  194

Query  543   KVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLS  364
              +G++   VERALD H   MG ++VEADKLR+ TLT+++ ILT +QAA  LL  KKLHL+
Sbjct  195   VIGQADVVVERALDKHEEDMGGLLVEADKLRMTTLTKIVDILTAVQAADFLLAGKKLHLA  254

Query  363   IHEWSKKRD  337
             +HEW K R+
Sbjct  255   MHEWGKSRE  263



>gb|KFK28540.1| hypothetical protein AALP_AA7G010000 [Arabis alpina]
Length=284

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 168/289 (58%), Gaps = 26/289 (9%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAV---ESNLGD----DELFGVVDRSVKHF  904
             SSS  ++  +  C ++ W++ Q + +  L  A+   +SN  D    +EL GVV   V  F
Sbjct  5     SSSHGIEQLQQGCYYE-WMSLQAKHIVNLKEALINQQSNNDDHHKLEELVGVV---VDDF  60

Query  903   EEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQ  724
             ++Y + R+ L+ ++    F +PSW ++ EN  +W+GGCRPS  IR++Y+LCG+  ++   
Sbjct  61    QKYAEKRSELSDRSCSSYF-APSWNSSLENGLLWMGGCRPSSFIRVIYALCGSQTETQYS  119

Query  723   GYLQG--------ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPL  568
              YLQ         E  G + +++A QL +IN +  K + +EDK++ + A +QED+AD P+
Sbjct  120   QYLQKMDESEKVDESAGIMSELTAMQLAKINEVHIKVIEKEDKITKKYAHMQEDVADMPI  179

Query  567   AMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlll  388
             A +   S+ + E    VE ALD H   MG ++ EADKLR+ TL ++++I+TP+QAA  LL
Sbjct  180   A-VTAYSRDLVEVGVSVEDALDKHEEGMGVLMAEADKLRIETLRKIVEIMTPVQAAEFLL  238

Query  387   vakklhLSIHEWSKKRDGAAAGRQFNTTQ-DAAAAACSVSPG*SIHSKT  244
               K+LH+S+HEW + R+     R+F   + DA A    V    S  S T
Sbjct  239   AGKRLHVSLHEWGRVRE----ERRFGCARADAVAGGAGVGSEKSKRSTT  283



>ref|XP_006414072.1| hypothetical protein EUTSA_v10027005mg [Eutrema salsugineum]
 gb|ESQ55525.1| hypothetical protein EUTSA_v10027005mg [Eutrema salsugineum]
Length=283

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 106/256 (41%), Positives = 152/256 (59%), Gaps = 22/256 (9%)
 Frame = -1

Query  1059  SSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSV-KHFEEYQQHR  883
             SSS ++  +  C + +W+  Q + M EL +A+ +   D+E    + R+V   F++Y   R
Sbjct  6     SSSNIEKLQRDC-YNEWMRLQSKGMTELKQALSNGEKDEEEIREMIRTVIGEFKDYAVKR  64

Query  882   ALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL----  715
             +   ++     F +P W T  ENA +W+GGCRPS  IRLVY+LCG+  +     +L    
Sbjct  65    SEHCRRYSSNSF-APKWNTCLENALLWMGGCRPSSFIRLVYALCGSQTELRYANFLNGNT  123

Query  714   ------QGERKGS---------LGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMA  580
                   QGE +G          + +++A QL +IN L  KTV +E+KL+ + A+LQED A
Sbjct  124   DDLSMAQGETRGGIDGRGGGEPMSELTAEQLFKINELHLKTVDQENKLTKQSASLQEDTA  183

Query  579   DEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaa  400
             D PLA+     + +GE   DVERALD H   MG ++ EADKLRL TLT+++ ILTP+QAA
Sbjct  184   DVPLAVTAFYKEVIGECDVDVERALDKHEEVMGGLLAEADKLRLSTLTKIVDILTPVQAA  243

Query  399   hlllvakklhLSIHEW  352
               LL  KKLHLS+HEW
Sbjct  244   DFLLAGKKLHLSMHEW  259



>ref|XP_010924633.1| PREDICTED: uncharacterized protein LOC105047415 [Elaeis guineensis]
Length=180

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 108/170 (64%), Gaps = 8/170 (5%)
 Frame = -1

Query  1038  RRLRCVFQDWIAQQREDMEELSRAVESNLGDDE--LFGVVDRSVKHFEEYQQHRALLAQQ  865
             RR R  F + + +Q  D+ EL  A++S   ++E  L  +V+++++H EEY + R  LA++
Sbjct  3     RRYRSCFDESVREQDADLHELLEAMQSERRENEAELRELVEKTMRHHEEYAEKRWALARE  62

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER-----K  700
             +G P F SP WC++FEN+F W+GG  P+LSIR +Y+L   +L++HL   L          
Sbjct  63    DG-PTFCSPPWCSSFENSFFWLGGGPPTLSIRFLYALSSHELEAHLDDILASASSGDALP  121

Query  699   GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK  550
             G L  +SA QL  +N + S T++EE+KLS+R+ATLQED+ D  L  IV +
Sbjct  122   GGLVVLSAAQLALVNDVHSWTLKEENKLSARLATLQEDVEDSTLLPIVRR  171



>gb|ACV41800.1| delay of germination 1 [Lepidium sativum]
 gb|ACV41801.1| delay of germination 1 A [Lepidium sativum]
Length=279

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 159/257 (62%), Gaps = 17/257 (7%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELS------RAVESNL-GDDELFGVVDRSVKHF  904
             SS   ++  +  C +Q+W+  Q + + +L       R+ ++N   D++L  ++++ +  F
Sbjct  3     SSKKNIEEAQESC-YQEWMNLQSQRVPDLKHLLAQRRSNKANTDNDNKLRELLEKIIGDF  61

Query  903   EEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQ  724
             ++Y   RA L+ +     + +PSW T  ENA +W+GGCRPS   RLVY+LCG++ +  + 
Sbjct  62    KKYAGKRADLSHR-CSSNYYAPSWNTPLENALLWMGGCRPSSFFRLVYALCGSETEIRVT  120

Query  723   GYLQ--------GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPL  568
              YL+        G    SL D++A QL +IN L  K + +E+K++ ++A+LQED AD P+
Sbjct  121   QYLRDIDGLESSGGMGTSLSDLTAEQLAKINILHVKIIEDEEKMTKKVASLQEDAADIPI  180

Query  567   AMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlll  388
             A +  + + VG+ +  V++ALD    +M +++ EAD LR+ TL ++++IL+P++AA+ LL
Sbjct  181   ATVAYEEEHVGKPNMVVDQALDKQEESMAKLLGEADNLRVETLVKIVEILSPVEAANFLL  240

Query  387   vakklhLSIHEWSKKRD  337
               KKLHLS+HEW   RD
Sbjct  241   AGKKLHLSMHEWGTMRD  257



>gb|AGG09198.1| delay of germination 1a [Lepidium papillosum]
Length=279

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 157/257 (61%), Gaps = 17/257 (7%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWI---AQQREDMEELSRAVESNLG----DDELFGVVDRSVKHF  904
             SS   ++  +  C +Q+W+   +Q+  D++ LS    SN      D +L  ++++ +  F
Sbjct  3     SSKKNIEEAQESC-YQEWMNLQSQRIPDLKHLSAQRRSNKANTDNDKKLRELLEKIIGDF  61

Query  903   EEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQ  724
             + Y   RA L+ +     + +PSW T  ENA +W+GGCRPS   RLVY+LCG++ +  + 
Sbjct  62    KIYAGKRADLSHR-CSSNYYAPSWNTPLENALLWMGGCRPSSFFRLVYALCGSETEIRVT  120

Query  723   GYLQ--------GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPL  568
              YL+        G    SL D++A QL +IN L  K + +E+K++ ++A+LQED AD P+
Sbjct  121   QYLRDIDGLESSGGMGTSLSDLTAEQLAKINILHVKIIEDEEKMTKKVASLQEDAADIPI  180

Query  567   AMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlll  388
             A +  + + VG+ +  V++ALD    +M +++ EAD LR+ TL ++++IL+P++AA+ LL
Sbjct  181   ATVAYEEEHVGKPNMVVDQALDKQEESMAKLLGEADNLRVETLVKIVEILSPVEAANFLL  240

Query  387   vakklhLSIHEWSKKRD  337
               KKLHLS+HEW   RD
Sbjct  241   AGKKLHLSMHEWGTMRD  257



>gb|EMT22752.1| hypothetical protein F775_12222 [Aegilops tauschii]
Length=308

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 114/194 (59%), Gaps = 32/194 (16%)
 Frame = -1

Query  948  DDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIR  769
            D EL  VV+R ++ ++EY   R  +A++NG   F++P WCT FEN+ +W+GGCRPSL+IR
Sbjct  54   DAELRAVVERCMRGYQEYAASRRAMARENGAA-FVAPPWCTAFENSVLWLGGCRPSLAIR  112

Query  768  LVYSLCGADLDSHLQGYLQGERKG-----SLGDISATQLNQINALQSKTVREEDKLSSRI  604
            L+YS+ G  L+  ++ ++ G  +G      L  I+ATQL QIN L   T+R+E  L+ R+
Sbjct  113  LLYSISGEGLEEDIEEFVSGRGRGLAEEMGLIGITATQLQQINDLHRCTLRDEGYLTERL  172

Query  603  ATLQEDMADEPLAMIVNK--------------------------SKKVGESSSDVERALD  502
            A+LQE++AD PL  IV +                          ++  G  +++V+ A++
Sbjct  173  ASLQENIADRPLLPIVRERAAAAAALVGQGRSAKRDDIAGRLAAAESSGGLAAEVDAAME  232

Query  501  NHAVAMGRMVVEAD  460
            +++  + R++ EAD
Sbjct  233  SYSAGLARLLEEAD  246



>gb|AHA62826.1| delay of germination 1 B, partial [Lepidium sativum]
Length=260

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 158/257 (61%), Gaps = 17/257 (7%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWI---AQQREDMEELSRAVESNLGD----DELFGVVDRSVKHF  904
             SS   ++  +  C +Q+W+   +Q+  D+++L     SN  D    ++L  ++++ +  F
Sbjct  3     SSKKNIEEAQESC-YQEWMDLQSQRIPDLKQLLAQRRSNEADTDNDNKLRELLEKIIGDF  61

Query  903   EEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQ  724
             ++Y   RA L+ +     + +PSW +  ENA +W+GGCRPS   RLVY+LCG+  +  + 
Sbjct  62    KKYAGKRADLSHRCSSN-YYAPSWNSPLENALLWMGGCRPSSFFRLVYALCGSQTEIRVT  120

Query  723   GYLQ--------GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPL  568
              YL+        G    SL D++A QL +IN L  K + EE+K++ ++A+LQED AD P+
Sbjct  121   QYLRDMDGLESSGGIGTSLSDLTAEQLAKINVLHVKIIEEEEKMTKKVASLQEDAADIPI  180

Query  567   AMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlll  388
             A +  + + VG+ +  V++ALD    AM +++ EAD LR+ T+T++++IL+P+QAA  LL
Sbjct  181   ATVAYEEEHVGKPNMVVDQALDKQEEAMAKLLGEADSLRVDTITKVVEILSPVQAADFLL  240

Query  387   vakklhLSIHEWSKKRD  337
               KKLHLS+H+W   RD
Sbjct  241   AGKKLHLSMHQWGTMRD  257



>ref|XP_002870027.1| hypothetical protein ARALYDRAFT_492990 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46286.1| hypothetical protein ARALYDRAFT_492990 [Arabidopsis lyrata subsp. 
lyrata]
Length=281

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 92/251 (37%), Positives = 156/251 (62%), Gaps = 12/251 (5%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDE--LFGVVDRSVKHFEEYQQ  889
             SSS  ++  +  C ++ W++ Q   + +L  A+ S+   D+  L  +V + V  F++Y +
Sbjct  5     SSSCGIEQLQKGCYYE-WMSVQATHIVDLKEALTSHRSKDDHKLEELVGKIVNDFQKYTE  63

Query  888   HRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL--  715
              R+ L++++    F +PSW ++ EN  +W+GGCRPS  IR++YSLCG+  ++ L  YL  
Sbjct  64    KRSELSRRSCSSYF-APSWNSSLENGLLWMGGCRPSSFIRVIYSLCGSQAETQLSQYLLK  122

Query  714   -----QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK  550
                  +  + GS+ D++ATQL +IN L  + + +ED+++ + A LQED+AD P+A+    
Sbjct  123   VDENVEENQGGSMSDLNATQLAKINDLHIQVIEKEDQITKKSANLQEDVADMPIAIAAYA  182

Query  549   SKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklh  370
             +  V +    VE ALD H   M  ++ EADKLR  TL ++++++TP+QAA  LL  K+LH
Sbjct  183   TDLV-DGDMLVEDALDKHEEGMAVLMTEADKLRFETLRKIVEVVTPVQAAEFLLAGKRLH  241

Query  369   LSIHEWSKKRD  337
             +S+HEW + R+
Sbjct  242   ISLHEWGRVRE  252



>ref|XP_008443347.1| PREDICTED: uncharacterized protein LOC103486954 [Cucumis melo]
Length=291

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 91/254 (36%), Positives = 145/254 (57%), Gaps = 19/254 (7%)
 Frame = -1

Query  1053  SAVDHRRLRCVFQDWIAQQREDMEELSRAVE------SNLGDDELFGVVDRSVKHFEEYQ  892
             S     R R  F++W+  QRED+  L  ++       S   ++    V+   + HF+ Y 
Sbjct  28    STTHEERCRRCFEEWMQLQREDLTHLLESLHQPTNNNSQETNNTTSTVIRNCISHFDHYI  87

Query  891   QHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ  712
               R LLAQ+   P F +P+WCT+ E + +W+ GCRPS+ IRL Y+L     +        
Sbjct  88    SKRNLLAQEYPSPLF-APTWCTSLEKSLLWMAGCRPSIFIRLTYALTSCSTEPLTN---D  143

Query  711   GERKGS-----LGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK-  550
             G+ K S     +G++S +Q+ ++N L  +T++ E KL+  +A+ QE++AD+P+A+IV K 
Sbjct  144   GDNKNSDSFIGIGELSPSQMTRVNGLHMRTIKAEQKLTDELASWQEELADDPIAVIVAKG  203

Query  549   --SKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellki-lTPlqaahlllvak  379
                 +V  ++ + E AL  H   MG ++ +ADKLRL T+ EL+   L P QA   L+ +K
Sbjct  204   DCGDEVVMNNEEAEMALKEHEKVMGEVIGKADKLRLNTMKELVLEILKPTQALQFLVASK  263

Query  378   klhLSIHEWSKKRD  337
             KL LS+H+W K+RD
Sbjct  264   KLQLSLHQWGKRRD  277



>ref|XP_009132082.1| PREDICTED: uncharacterized protein LOC103856711 isoform X1 [Brassica 
rapa]
Length=259

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 152/242 (63%), Gaps = 19/242 (8%)
 Frame = -1

Query  1008  IAQQREDMEELSRAVESNLGDD-ELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSW  832
             ++ Q + M +L RA+ +   +D  L  ++   ++ F++Y + R+  +++     F +P+W
Sbjct  1     MSLQAKRMTDLKRALANGEKNDGALRELIQSVIEDFKDYARKRSEHSRRYSSNYF-APTW  59

Query  831   CTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ----------GERKG-----  697
              T  ENA +W+GGCRPS  IRLVY++CG+  +  L  + +          GE  G     
Sbjct  60    NTCLENALLWMGGCRPSSFIRLVYAMCGSQTELRLTNFFRDNIGGLSMALGETPGRVDGA  119

Query  696   --SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSS  523
               S+ D++A QL +IN L  KTV+EE+ L+ + ATLQED AD P+A+     +++GE+  
Sbjct  120   GESMSDLTAEQLFKINELHMKTVQEENMLTKQSATLQEDTADMPIAVAAFHKERIGEADV  179

Query  522   DVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKK  343
             +VERALD +   + RM+ EADKLRL TLT++++ILT +QAA  LL  KKLHLS+HEW ++
Sbjct  180   EVERALDKYEDEIARMLAEADKLRLTTLTKIVEILTAVQAADFLLAGKKLHLSMHEWGRQ  239

Query  342   RD  337
             R+
Sbjct  240   RE  241



>ref|XP_010449481.1| PREDICTED: uncharacterized protein LOC104731707 [Camelina sativa]
Length=282

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 99/271 (37%), Positives = 161/271 (59%), Gaps = 16/271 (6%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNL---GDDELFG-VVDRSVKHFEEY  895
             SSS  ++  R  C +Q W+  Q + + +L  A+ ++    GDD   G +V + +  F+ Y
Sbjct  5     SSSFGIEQLRKGCYYQ-WMGLQAKHIVDLKEALINHHRASGDDHKLGELVGQILNDFKRY  63

Query  894   QQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL  715
              + R+ L+ ++    +LSPSW ++ EN  +W+GGCRPS  IR++Y+LCG+  ++ L  YL
Sbjct  64    AEKRSELSGRSC-SSYLSPSWNSSLENGLLWMGGCRPSSFIRVIYALCGSQAETQLSQYL  122

Query  714   -------QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIV  556
                    +    G + D++ATQL +IN L  K + +EDK++ + A LQE++AD P+A I 
Sbjct  123   LKIDESVEVNHSGFMSDLTATQLAKINELHMKVIEKEDKITKKSANLQENVADMPIA-IA  181

Query  555   NKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakk  376
               +  + + +  V+ ALD H   M  ++ EADKLR  TL ++++I+TP+QAA  LL  K+
Sbjct  182   AYTMDLVDGNVVVKDALDKHEEDMAALMAEADKLRFETLRKIVEIVTPVQAAEFLLAGKR  241

Query  375   lhLSIHEWSKKRDGAAAGRQFNTTQDAAAAA  283
             LH+S+HEW + R+    G      +DA AA 
Sbjct  242   LHVSLHEWGRVREEGRFG--CARAEDATAAG  270



>ref|XP_006282688.1| hypothetical protein CARUB_v10005444mg [Capsella rubella]
 gb|EOA15586.1| hypothetical protein CARUB_v10005444mg [Capsella rubella]
Length=280

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 147/246 (60%), Gaps = 19/246 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDD-ELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFL  844
             + +W++ Q   M EL +A+ +   D+ +L  ++   +  FE+Y + R+  +++     F 
Sbjct  16    YDEWMSLQARRMTELRQALSNGERDNAKLRDLIRAVISDFEDYARKRSKHSRRYSSNYF-  74

Query  843   SPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ-----------GERKG  697
             +P+W T  ENA +WIGGCRPS  IRLVY++CG+  +     + +           GE  G
Sbjct  75    APTWNTCLENALLWIGGCRPSSFIRLVYAMCGSQTEHRFTNFFRNNNIESLSMALGETHG  134

Query  696   SLG------DISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
              +G      D++A QL +IN L  KTV+ E+KLS + A+LQED  D P+ +     +++G
Sbjct  135   EMGGGESMSDLTAEQLFKINELHLKTVKAENKLSKQSASLQEDTVDMPIGITAFYKEEIG  194

Query  534   ESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHE  355
             E+   VERALD H   M  ++ EADKLRL TLT +++ILT +QAA  LL  KKLHL++HE
Sbjct  195   ETDVVVERALDKHEEDMAGLLAEADKLRLTTLTNMVEILTAVQAADFLLAGKKLHLAMHE  254

Query  354   WSKKRD  337
             W + R+
Sbjct  255   WGRCRE  260



>gb|ABK81211.1| DOG1 alpha splice variant [Arabidopsis thaliana]
Length=292

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 150/255 (59%), Gaps = 20/255 (8%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAV--------ESNLGDDELFGVVDRSVK  910
             M SSS    +   C + +W++ Q + + EL + +        E N  D++L  +  + + 
Sbjct  1     MGSSSKNIEQAQECCYLEWMSLQSQRIPELKQLLAQRRSHGDEDN--DNKLRELTGKIIG  58

Query  909   HFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSH  730
              F+ Y   RA LA +     + +P+W +  ENA +W+GGCRPS   RLVY+LCG+  +  
Sbjct  59    DFKNYAAKRADLAHR-CSSNYYAPTWNSPLENALIWMGGCRPSSFFRLVYALCGSQTEIR  117

Query  729   LQGYLQG---------ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMAD  577
             +  +L+              SL D+SA QL +IN L  K + EE+K++ ++++LQED AD
Sbjct  118   VTQFLRNIDGYESSGGGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAAD  177

Query  576   EPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaah  397
              P+A +  + + VGES+  V++ALD    AM R++VEAD LR+ TL ++L IL+P+Q A 
Sbjct  178   IPIATVAYEMENVGESNVVVDQALDKQEEAMARLLVEADNLRVDTLAKILGILSPVQGAD  237

Query  396   lllvakklhLSIHEW  352
              LL  KKLHLS+HEW
Sbjct  238   FLLAGKKLHLSMHEW  252



>ref|XP_006285421.1| hypothetical protein CARUB_v10006838mg [Capsella rubella]
 gb|EOA18319.1| hypothetical protein CARUB_v10006838mg [Capsella rubella]
Length=281

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 94/269 (35%), Positives = 163/269 (61%), Gaps = 15/269 (6%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLG--DDELFG-VVDRSVKHFEEYQ  892
             SSS  ++ RR  C ++ W++ Q + + +L  A+ ++ G  DD   G +V + +  F++Y 
Sbjct  5     SSSYGIEQRRKGCYYE-WMSLQAKHILDLKEALLNHHGSSDDHKLGELVGKILNDFKKYA  63

Query  891   QHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL-  715
             + R+ L+ ++    +L+PSW +  EN  +W+GGCRPS  +R++Y+LCG+  ++ L  YL 
Sbjct  64    EKRSELSNRSC-SSYLTPSWNSALENGLLWMGGCRPSSFVRVIYALCGSQAETQLSQYLL  122

Query  714   ------QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVN  553
                   +      + D++ATQL +IN L  K + +EDK++ + A+LQE++AD P+A I  
Sbjct  123   DIDENVKVNHGVFMSDLTATQLAKINELHMKVIEKEDKVTKKSASLQENVADMPIA-IAA  181

Query  552   KSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakkl  373
              +  + + +  V+ ALD H   M  ++ EAD LR  TL ++++++TP+QAA  LL  K+L
Sbjct  182   YAMDLVDGNVVVKDALDKHEEGMAALMGEADTLRFETLRKIVEVITPVQAAEFLLAGKRL  241

Query  372   hLSIHEWSKKRDGAAAGRQFNTTQDAAAA  286
             H+S+HEW + R+  + G      +DA AA
Sbjct  242   HVSLHEWGRVREEGSFG--CARAEDATAA  268



>ref|XP_003560850.1| PREDICTED: transcription factor HBP-1b(c38)-like [Brachypodium 
distachyon]
Length=301

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 153/282 (54%), Gaps = 45/282 (16%)
 Frame = -1

Query  1047  VDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDE----LFGVVDRSVKHFEEYQQHRA  880
             +D  R     Q WIA Q   + EL+ A  +          L  VV+R ++ +EEY   R 
Sbjct  1     MDMTRYFACHQQWIAGQEAGLGELTAAAANAAARRATEAELRAVVERCLRGYEEYATTRR  60

Query  879   LLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERK  700
              +A ++G   F +P WCTTFE A +W+GGCRPSLSIRL+Y +    L++ LQ +L G  +
Sbjct  61    AMAPEDGAA-FFAPPWCTTFEKAVLWLGGCRPSLSIRLLYCVSSEGLEAQLQEFLSGHGR  119

Query  699   ------------GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIV  556
                         G LG I+A QL QIN L  +T+ EE  LS R+A+LQE +AD PL  IV
Sbjct  120   AGGDDMIRPTGSGLLG-INAMQLEQINNLHGRTIHEEGILSERLASLQEKIADRPLLPIV  178

Query  555   NKSKK---------VGESSS-----------------DVERALDNHAVAMGRMVVEADkl  454
              + ++          G +SS                 +V+ A++++   + +++ EAD+L
Sbjct  179   REREQERARAAALPRGSASSNGLVGRFAAMGLAGVDAEVDAAMESYTAGLAKLLEEADQL  238

Query  453   rlrtltellki-lTPlqaahlllvakklhLSIHEWSKKRDGA  331
             RL T  EL    LTP QA  +L  AK+LHLSI +WS++++GA
Sbjct  239   RLSTTRELATEILTPRQAVEMLAAAKQLHLSICDWSRRKEGA  280



>ref|XP_006398268.1| hypothetical protein EUTSA_v10001138mg [Eutrema salsugineum]
 gb|ESQ39721.1| hypothetical protein EUTSA_v10001138mg [Eutrema salsugineum]
Length=281

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 93/246 (38%), Positives = 146/246 (59%), Gaps = 20/246 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAV----------ESNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             +Q+W+  Q   + E+ +A+          E+N  DD+L  +    +  F  Y + RA L+
Sbjct  17    YQEWMGLQSRRIPEIKQALSQRRSHDGAAEAN-ADDKLRDLTKMIIGDFRYYAEKRANLS  75

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLD-------SHLQGYLQ  712
              +     + +PSW T  ENA +W+GGCRPS   RLVY+LCG+  +        ++ GY  
Sbjct  76    HR-CSSNYYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEFRVTQFLRNIDGYDY  134

Query  711   GERKG-SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
              +  G SL D++A QL +IN L  K + +E+K++ ++++LQED AD P+A      + VG
Sbjct  135   SDGSGASLSDLTAEQLAKINVLHVKVIDDEEKMTKKVSSLQEDAADIPIATAAYAEEHVG  194

Query  534   ESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHE  355
             E ++ V++ALD    A+  ++ EAD LR+ TL ++++ILTP+QAA  +L  KKLHLS+HE
Sbjct  195   EPNAAVDQALDKQEEALASLLAEADNLRVDTLAKIIEILTPVQAADFMLAGKKLHLSMHE  254

Query  354   WSKKRD  337
             W   RD
Sbjct  255   WGTMRD  260



>ref|XP_006281774.1| hypothetical protein CARUB_v10027949mg [Capsella rubella]
 gb|EOA14672.1| hypothetical protein CARUB_v10027949mg [Capsella rubella]
Length=291

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 154/258 (60%), Gaps = 18/258 (7%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAV---ESNLGD----DELFGVVDRSVKHF  904
             SSS  ++  +  C + +W++ Q E + EL + +   +S  GD    D+L  +  + +  F
Sbjct  3     SSSKNIEQAQESC-YLEWMSLQSERIPELKQLLAQRQSQHGDKDNDDKLRELTGKIIGDF  61

Query  903   EEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQ  724
             +EY   RA LA++     + +PSW T  ENA +W+GGCRPS   RLVY+LCG+  +  + 
Sbjct  62    KEYAGKRASLARR-CSSNYYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVT  120

Query  723   GYLQG---------ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP  571
              +L+              SL D+SA QL +IN L  K + EE+K++ +I++LQED AD P
Sbjct  121   QFLRNIDGYESSGGGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKISSLQEDAADIP  180

Query  570   LAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahll  391
             +A +  + + VG  ++ V++ALD    AM  ++ EAD LR+ TL ++++IL+P+Q A  L
Sbjct  181   IATVAYEVEHVGVPNTVVDQALDKQEEAMASLLAEADHLRVDTLAKIVEILSPVQGADFL  240

Query  390   lvakklhLSIHEWSKKRD  337
             L  KKLHLS+HEW   RD
Sbjct  241   LAGKKLHLSMHEWGCMRD  258



>ref|XP_002870029.1| hypothetical protein ARALYDRAFT_329668 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46288.1| hypothetical protein ARALYDRAFT_329668 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 147/248 (59%), Gaps = 21/248 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESN-LGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFL  844
             + +W++ Q + M EL  A+ +    DD+L  ++  ++K FE+Y   R+  + +     F 
Sbjct  16    YNEWMSLQAKRMTELKEALSTGEKDDDKLRDLIRTAIKDFEDYAGKRSEHSCRFSSNYF-  74

Query  843   SPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ-------------GER  703
             +P W T  ENA +W+GGCRPS  IRLVY++CG+  +  L  +               GE 
Sbjct  75    APKWNTCLENALLWMGGCRPSSFIRLVYAMCGSQTEHRLSNFFNNTNEDIHGLSMALGET  134

Query  702   KGSLG------DISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKK  541
             +G +G      D++A Q+ +IN L  KT++ E+KL+   A+LQED AD P+A+     + 
Sbjct  135   RGGIGAGESMSDLTAEQIIKINELHLKTIKAENKLTKLSASLQEDTADMPIAVAAFYKEV  194

Query  540   VGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSI  361
             +G++   VERALD H   M  ++V+A+KLRL TLT+++ ILT  QAA  LL  KKLHL++
Sbjct  195   IGQADMAVERALDKHEEDMAGLLVQAEKLRLTTLTKIVDILTAGQAAEFLLAGKKLHLAM  254

Query  360   HEWSKKRD  337
             HEW + R+
Sbjct  255   HEWGRSRE  262



>gb|ABK81207.1| DOG1 alpha splice variant [Arabidopsis thaliana]
Length=291

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 149/254 (59%), Gaps = 19/254 (7%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAV--------ESNLGDDELFGVVDRSVK  910
             M SSS    +   C + +W++ Q + + EL + +        E N  D++L  +  + + 
Sbjct  1     MGSSSKNTEQAQECCYLEWMSLQSQRIPELKQLLAQRRSHGDEDN--DNKLRELTGKIIG  58

Query  909   HFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSH  730
              F+ Y   RA LA +     + +P+W +  ENA +W+GGCRPS   RLVY+LCG+  +  
Sbjct  59    DFKNYAAKRADLAHR-CSSNYYAPTWNSPLENALIWMGGCRPSSFFRLVYALCGSQTEIR  117

Query  729   LQGYLQG--------ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADE  574
             +  +L+             SL D+SA QL +IN L  K + EE+K++ ++++LQED AD 
Sbjct  118   VTQFLRNIDGYESSGGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADI  177

Query  573   PLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahl  394
             P+A +  + + VGE +  V++ALD    AM R++VEAD LR+ TL ++L IL+P+Q A  
Sbjct  178   PIATVAYEMENVGEPNVVVDQALDKQEEAMARLLVEADNLRVDTLAKILGILSPVQGADF  237

Query  393   llvakklhLSIHEW  352
             LL  KKLHLS+HEW
Sbjct  238   LLAGKKLHLSMHEW  251



>gb|KFK22875.1| hypothetical protein AALP_AAs39777U000200 [Arabis alpina]
Length=283

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 101/284 (36%), Positives = 170/284 (60%), Gaps = 33/284 (12%)
 Frame = -1

Query  1065  MSSSSAVDHRRLR--CVFQDWIAQQREDMEELSRAV---ESNLGD----DELFGVVDRSV  913
             M SSS+   ++L+  C ++ W++ Q + +  L+ A+    SN  D    +EL G++   V
Sbjct  1     MDSSSSCGIKQLQKDCYYE-WMSIQAKHIVNLNEALMNQRSNSDDHHKLEELVGII---V  56

Query  912   KHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIR-----LVYSLCG  748
               F+ Y + R+ L+ ++    F +PSW ++ EN+F+W+GGCRP+  IR     ++Y+LCG
Sbjct  57    NDFQRYAEKRSELSDKSCSNYF-APSWNSSLENSFLWMGGCRPTSFIRVIYALVIYALCG  115

Query  747   ADLDSHLQGYLQG--------ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQ  592
             +  ++H+  Y Q         E  G + +++  QL +IN L  K +++EDK++ + A +Q
Sbjct  116   SQTETHISQYFQKVDGSENVDESDGFMSELTGMQLGKINDLHLKVIKKEDKITKKYAIMQ  175

Query  591   EDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTP  412
             ED+AD P+A I   S+   E+   VE A+D H   M  ++ EADKLR+ TL +++++LTP
Sbjct  176   EDVADMPIA-ITAYSRDFVEAGEAVEDAIDKHEEGMAVLMAEADKLRIETLKKIVEVLTP  234

Query  411   lqaahlllvakklhLSIHEWSKKRDGAAAGRQF-NTTQDAAAAA  283
             +QAA  LL  K+LH+S+HEW + R+     R+F + + DA A A
Sbjct  235   VQAAEFLLAEKRLHVSLHEWGRVRE----ERRFCSASADAVAGA  274



>gb|AJE25537.1| DOG1-like protein [Brassica napus]
Length=280

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 91/246 (37%), Positives = 145/246 (59%), Gaps = 19/246 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAV----------ESNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             +Q W++ Q + + EL +A+          ++   D++L  +    +  F+ Y   RA L+
Sbjct  16    YQQWMSLQSQRVPELKQALAQRRTHEGTADAAADDNKLRELTQNIIGDFKNYAGKRADLS  75

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLD-------SHLQGY-L  715
              +     + +PSW T  ENA +W+GGCRPS   RLVY+LCG+  D        ++ GY  
Sbjct  76    HR-CSSNYYAPSWNTPLENALLWMGGCRPSSFSRLVYALCGSQTDILVTQFLRNIDGYNY  134

Query  714   QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
              G    SL D++A QL +IN L  K + EE+K++ ++++LQED AD P++ +    + VG
Sbjct  135   SGSGGASLSDLTAEQLAEINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEEHVG  194

Query  534   ESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHE  355
             E ++ V++ALD    AM  ++ EAD LR+ TLT++++ILTP+QA    +  KKLHLS+H+
Sbjct  195   EPNAMVDQALDKQEEAMATLLAEADNLRVDTLTKIIEILTPVQAGDFFMAGKKLHLSMHQ  254

Query  354   WSKKRD  337
             W   RD
Sbjct  255   WGALRD  260



>ref|NP_193604.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAX55185.1| hypothetical protein At4g18690 [Arabidopsis thaliana]
 gb|AAZ52737.1| hypothetical protein At4g18690 [Arabidopsis thaliana]
 gb|AEE84076.1| uncharacterized protein AT4G18690 [Arabidopsis thaliana]
Length=282

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 92/251 (37%), Positives = 154/251 (61%), Gaps = 12/251 (5%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLG--DDELFGVVDRSVKHFEEYQQ  889
             SSS  ++  +  C ++ W++ Q + + +L  A+ S+    D +L  +V + V  F++Y +
Sbjct  5     SSSYGIEQLQKGCYYE-WMSVQAKHIVDLKEALMSHRSKEDHKLEELVGKIVNDFQKYTE  63

Query  888   HRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL--  715
              R+ L++++    F +PSW +  EN  +W+GGCRPS  IR++YSLCG+  ++ L  YL  
Sbjct  64    KRSELSRRSCSSYF-APSWNSPLENGLLWMGGCRPSSFIRVIYSLCGSQAETQLSQYLLK  122

Query  714   -----QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK  550
                  +    GS+ D++A+QL +IN L  K + +EDK++ + A LQE++AD P+A I   
Sbjct  123   IDENVEVNHGGSMSDLNASQLAKINDLHIKVIEKEDKITKKSANLQENVADMPIA-IAAY  181

Query  549   SKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklh  370
             +  +      VE ALD +   M  ++VEADKLR  TL +++ ++TP+QAA  LL  K+LH
Sbjct  182   ATDLMNGDVVVEDALDKYEEGMAVLMVEADKLRFETLRKIVDVVTPVQAAEFLLAGKRLH  241

Query  369   LSIHEWSKKRD  337
             +S+HEW + R+
Sbjct  242   ISLHEWGRVRE  252



>emb|CDY23102.1| BnaC09g18560D [Brassica napus]
Length=280

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/246 (37%), Positives = 145/246 (59%), Gaps = 19/246 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAV----------ESNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             +Q W++ Q + + EL +A+          ++   D++L  +    +  F+ Y   RA L+
Sbjct  16    YQQWMSLQSQRVPELKQALPQRRTHEGTADAAADDNKLRELTQNIIGDFKNYAGKRADLS  75

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLD-------SHLQGY-L  715
              +     + +PSW T  ENA +W+GGCRPS   RLVY+LCG+  +        ++ GY  
Sbjct  76    HRCSSN-YYAPSWNTPLENALLWMGGCRPSSFFRLVYALCGSQTEILVTQFLRNIDGYDY  134

Query  714   QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
              G    SL D++A QL +IN L  K + EE+K++ ++++LQED AD P++ +    + VG
Sbjct  135   SGSGGASLSDLTAEQLAEINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEEHVG  194

Query  534   ESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHE  355
             E ++ V++ALD    AM  ++ EAD LR+ TLT++++ILTP+QA    +  KKLHLS+H+
Sbjct  195   EPNAMVDQALDKQEEAMATLLAEADNLRVDTLTKIIEILTPVQAGDFFMAGKKLHLSMHQ  254

Query  354   WSKKRD  337
             W   RD
Sbjct  255   WGALRD  260



>ref|XP_010439824.1| PREDICTED: uncharacterized protein LOC104723191 [Camelina sativa]
Length=279

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 160/270 (59%), Gaps = 16/270 (6%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAV----ESNLGDDELFGVVDRSVKHFEEY  895
             SSS  ++  R  C ++ W+  Q + + +L  A+     ++  D +L  +V + +  FE+Y
Sbjct  5     SSSYGIEQLRKGCYYE-WMGLQAKHIVDLKEALINHHRASDDDHKLGELVGQILNDFEKY  63

Query  894   QQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL  715
              + R+ L+ ++    +LSPSW ++ EN  +W+GGCRPS  IR++Y+LCG+  ++ L  YL
Sbjct  64    AEKRSELSHRSC-SSYLSPSWNSSLENGLLWMGGCRPSSFIRVIYALCGSQAETQLSQYL  122

Query  714   -------QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIV  556
                    +    G + D++ATQL +IN L  + + +EDK++ + A LQE++AD P+A I 
Sbjct  123   LKIDESVEVNHSGFMSDLTATQLAKINELHMEVIEKEDKITKKSANLQENVADMPIA-IA  181

Query  555   NKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakk  376
               +  + + +  V+ ALD H   M  +V E DKLR  TL ++++++TP+QAA  LL  K+
Sbjct  182   AYTMDLVDGNVVVKDALDKHEEDMAALVTEGDKLRFETLRKIVEVVTPVQAAEFLLAGKR  241

Query  375   lhLSIHEWSKKRDGAAAGRQFNTTQDAAAA  286
             LH+S+HEW + R+    G      +DA AA
Sbjct  242   LHVSLHEWGRVREEGRFG--CARAEDATAA  269



>emb|CDY52216.1| BnaAnng11390D [Brassica napus]
Length=280

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 144/246 (59%), Gaps = 19/246 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAV----------ESNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             +Q W++ Q + + EL +A+          ++   D++L  +    +  F+ Y   RA L+
Sbjct  16    YQQWMSLQSQRVPELKQALAQRRTHEGTADAAADDNKLRELTQNIIGDFKNYAGKRADLS  75

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ-------  712
              +     + +PSW T  ENA +W+GGCRPS   RLVY+LCG+  +  +  +L+       
Sbjct  76    HR-CSSSYYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGYDY  134

Query  711   -GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
              G    SL D++A QL +IN L  K + EE+K++ ++++LQED AD P++ +    + VG
Sbjct  135   SGSGGASLSDLTAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEEHVG  194

Query  534   ESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHE  355
             E ++ V++ALD    AM  ++ EAD LR+ TL ++++ILTP+QA   L+  KKLHLS+H 
Sbjct  195   EPNAMVDQALDKQEEAMATLLAEADNLRVDTLAKIIEILTPVQAGDFLMAGKKLHLSMHH  254

Query  354   WSKKRD  337
             W   RD
Sbjct  255   WGALRD  260



>ref|XP_009114387.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Brassica rapa]
Length=280

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 144/246 (59%), Gaps = 19/246 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAV----------ESNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             +Q W++ Q + + EL +A+          ++   D++L  +    +  F+ Y   RA L+
Sbjct  16    YQQWMSIQSQRVPELKQALAQRRTHEGTADAAADDNKLRELTQNIIGDFKNYAGKRADLS  75

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ-------  712
              +     + +PSW T  ENA +W+GGCRPS   RLVY+LCG+  +  +  +L+       
Sbjct  76    HR-CSSSYYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGYDY  134

Query  711   -GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
              G    SL D++A QL +IN L  K + EE+K++ ++++LQED AD P++ +    + VG
Sbjct  135   SGSGGASLSDLTAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEEHVG  194

Query  534   ESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHE  355
             E ++ V++ALD    AM  ++ EAD LR+ TL ++++ILTP+QA   L+  KKLHLS+H 
Sbjct  195   EPNAMVDQALDKQEEAMATLLAEADNLRVDTLAKIIEILTPVQAGDFLMAGKKLHLSMHH  254

Query  354   WSKKRD  337
             W   RD
Sbjct  255   WGALRD  260



>gb|AGG09199.1| delay of germination 1c [Lepidium papillosum]
Length=281

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/259 (36%), Positives = 152/259 (59%), Gaps = 19/259 (7%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAV--------ESNLGDDELFGVVDRSVKH  907
             SS   ++  +  C +Q W+  Q + + EL + +        +    D++L  ++++ +  
Sbjct  3     SSKKNIEQAQESC-YQKWMNLQSQRIPELKQLLAQRRSNDSDHTDNDNKLRDLLEKIIGD  61

Query  906   FEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHL  727
             F+ Y   RA L+ +     + +PSW T  ENA +W+GGCRPS   RLVY+LCG+  +  +
Sbjct  62    FKSYAGKRADLSHR-CSSSYYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEIRV  120

Query  726   QGYLQ---------GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADE  574
               +L+         G    SL D++A QL +IN L    + +E+K++ ++A+LQED AD 
Sbjct  121   TQFLRDIDGLDSSDGVDGTSLSDLTAEQLAKINVLHVNVIDDEEKMTKKVASLQEDAADI  180

Query  573   PLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahl  394
             P+A +  +  ++G  +  V++ALD    AM +++VEAD LR+ TL +++KIL+P+QAA  
Sbjct  181   PIATVAYEEDQLGGPNMMVDQALDKQEEAMAKLLVEADDLRVDTLAKIVKILSPVQAADF  240

Query  393   llvakklhLSIHEWSKKRD  337
             LL  KKLHLS+HEW   RD
Sbjct  241   LLTGKKLHLSMHEWGTMRD  259



>gb|ABK81208.1| DOG1 alpha splice variant [Arabidopsis thaliana]
Length=285

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 147/254 (58%), Gaps = 19/254 (7%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEEL--------SRAVESNLGDDELFGVVDRSVK  910
             M SSS    +   C + +W++ Q + + EL        S   E N  D++L  +  + + 
Sbjct  1     MGSSSKNIEQAQECCYLEWMSLQSQRIPELKPLLAQRRSHGDEDN--DNKLRELTGKIIG  58

Query  909   HFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSH  730
              F+ Y   RA LA +     + +P+W +  ENA +W+GGCRPS   R VY+LCG+  +  
Sbjct  59    DFKNYAAKRADLAHRCSSN-YYAPTWNSPLENALIWMGGCRPSSFFRFVYALCGSQTEIR  117

Query  729   LQGYLQG--------ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADE  574
             +  +L+             SL D+SA QL +IN L  K + EE+K++ ++++LQED AD 
Sbjct  118   VTQFLRNIDGYESSGGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADI  177

Query  573   PLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahl  394
             P+A +  + + VGE +  V++ALD    AM R++VEAD LR+ TL ++L IL+P+Q A  
Sbjct  178   PIATVAYEMENVGEPNVVVDQALDKQEEAMARLLVEADNLRVDTLAKILGILSPVQGADF  237

Query  393   llvakklhLSIHEW  352
             LL  KKLHLS+HEW
Sbjct  238   LLAGKKLHLSMHEW  251



>emb|CAB37454.1| putative protein [Arabidopsis thaliana]
 emb|CAB78871.1| putative protein [Arabidopsis thaliana]
Length=368

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 92/251 (37%), Positives = 154/251 (61%), Gaps = 12/251 (5%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLG--DDELFGVVDRSVKHFEEYQQ  889
             SSS  ++  +  C ++ W++ Q + + +L  A+ S+    D +L  +V + V  F++Y +
Sbjct  5     SSSYGIEQLQKGCYYE-WMSVQAKHIVDLKEALMSHRSKEDHKLEELVGKIVNDFQKYTE  63

Query  888   HRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL--  715
              R+ L++++    F +PSW +  EN  +W+GGCRPS  IR++YSLCG+  ++ L  YL  
Sbjct  64    KRSELSRRSCSSYF-APSWNSPLENGLLWMGGCRPSSFIRVIYSLCGSQAETQLSQYLLK  122

Query  714   -----QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK  550
                  +    GS+ D++A+QL +IN L  K + +EDK++ + A LQE++AD P+A I   
Sbjct  123   IDENVEVNHGGSMSDLNASQLAKINDLHIKVIEKEDKITKKSANLQENVADMPIA-IAAY  181

Query  549   SKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklh  370
             +  +      VE ALD +   M  ++VEADKLR  TL +++ ++TP+QAA  LL  K+LH
Sbjct  182   ATDLMNGDVVVEDALDKYEEGMAVLMVEADKLRFETLRKIVDVVTPVQAAEFLLAGKRLH  241

Query  369   LSIHEWSKKRD  337
             +S+HEW + R+
Sbjct  242   ISLHEWGRVRE  252



>ref|XP_010434499.1| PREDICTED: uncharacterized protein LOC104718445 [Camelina sativa]
Length=282

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 159/271 (59%), Gaps = 16/271 (6%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAV----ESNLGDDELFGVVDRSVKHFEEY  895
             SSS  ++  R  C ++ W+  Q + + +L  A+     ++  D +L  +V + +  F++Y
Sbjct  5     SSSYGIEQLREGCYYE-WMGLQAKHIVDLKEALINHHRASDDDHKLGELVGQILNDFKKY  63

Query  894   QQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL  715
              + R+ L+ ++    +LSPSW ++ EN  +W+GGCRPS  IR++Y+LCG+  ++ L  YL
Sbjct  64    AEKRSELSHRSC-SSYLSPSWNSSLENGLLWMGGCRPSSFIRVIYALCGSQAETQLSQYL  122

Query  714   -------QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIV  556
                    +    G + D +ATQL +IN L  K + +EDK++ +   LQE++AD P+A I 
Sbjct  123   LKIDESVEVNHSGFMSDFTATQLAKINELHMKVIEKEDKITKKSENLQENVADMPIA-IA  181

Query  555   NKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakk  376
               +  + + +  V+ ALD H   M  +V EADKLR  TL ++++++TP+QAA  LL  K+
Sbjct  182   AYTMDLVDGNVVVKDALDKHEEDMAALVTEADKLRFETLRKIVEVVTPVQAAEFLLAGKR  241

Query  375   lhLSIHEWSKKRDGAAAGRQFNTTQDAAAAA  283
             LH+S+HEW + R+    G      +DA AA 
Sbjct  242   LHVSLHEWGRVREEGRFG--CARAEDATAAG  270



>dbj|BAB09311.1| tumor-related protein-like [Arabidopsis thaliana]
Length=283

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/247 (38%), Positives = 145/247 (59%), Gaps = 27/247 (11%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAV--------ESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQ  865
             + +W++ Q + + EL + +        E N  D++L  +  + +  F+ Y   RA LA +
Sbjct  15    YLEWMSLQSQRIPELKQLLAQRRSHGDEDN--DNKLRKLTGKIIGDFKNYAAKRADLAHR  72

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQG----ERKG  697
                  + +P+W +  ENA +W+GGCRPS   RLVY+LCG+  +  +  +L+     E  G
Sbjct  73    -CSSNYYAPTWNSPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGYESSG  131

Query  696   ------------SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVN  553
                         SL D+SA QL +IN L  K + EE+K++ ++++LQED AD P+A +  
Sbjct  132   KGLDVFGGGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPIATVAY  191

Query  552   KSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakkl  373
             + + VGE +  V++ALD    AM R++VEAD LR+ TL ++L IL+P+Q A  LL  KKL
Sbjct  192   EMENVGEPNVVVDQALDKQEEAMARLLVEADNLRVDTLAKILGILSPVQGADFLLAGKKL  251

Query  372   hLSIHEW  352
             HLS+HEW
Sbjct  252   HLSMHEW  258



>gb|AJE25535.1| DOG1-like protein [Brassica napus]
Length=280

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 131/212 (62%), Gaps = 9/212 (4%)
 Frame = -1

Query  948  DDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIR  769
            D +L  +  + +  F++Y + RA L+ +     + +PSW T  ENA +W+GGCRPS   R
Sbjct  50   DKKLRELTQKIIGDFKDYARKRADLSHRCSSS-YYAPSWNTPLENALIWMGGCRPSSFFR  108

Query  768  LVYSLCGADLDSHLQGYLQ--------GERKGSLGDISATQLNQINALQSKTVREEDKLS  613
            LVY+LCG+  +  +  +L+        G    SL D++A QL +IN L  K + EE+K++
Sbjct  109  LVYALCGSQTEIRVTQFLRNIDGYDASGSGGASLSDLTAEQLAKINVLHVKIIDEEEKMT  168

Query  612  SRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtlte  433
             ++++LQED AD P++ +    + VGE +  V++ALD    AM  ++ EAD LR+ TL++
Sbjct  169  KKVSSLQEDAADIPISTVAYAEEHVGEPNLAVDQALDKQEEAMATLLAEADNLRVYTLSK  228

Query  432  llkilTPlqaahlllvakklhLSIHEWSKKRD  337
            ++++L P+QAA  LL  KKLHLS+H W   RD
Sbjct  229  IIEVLAPMQAADFLLAGKKLHLSMHAWGALRD  260



>ref|XP_004239641.1| PREDICTED: transcription factor TGA6-like [Solanum lycopersicum]
Length=273

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 95/266 (36%), Positives = 152/266 (57%), Gaps = 25/266 (9%)
 Frame = -1

Query  1056  SSAVDHRRLRCVFQDWIAQQREDMEELSRAVE--SNLGDDELFGVVDRSVKHFEEYQQHR  883
             SS+ + +     F+ W+ +Q ED++EL RA E   N  D  L  ++   VKH+EEY + +
Sbjct  3     SSSKNGKSFHKFFESWLVKQSEDLDELVRASEEYKNNNDMLLSPLIHSVVKHYEEYYREK  62

Query  882   ALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER  703
             +  A  +     L PSW +  E+AF+WIGG RPS++  L+YS  G  L+++L   ++G  
Sbjct  63    SQYAASDV-LGMLHPSWLSNLEDAFLWIGGWRPSMAFHLLYSKSGIQLEANLHELIRGFS  121

Query  702   KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMAD---------------EPL  568
             K  LG++S  QL  I+ LQ KT+ EE KLS ++A +QE +AD               E L
Sbjct  122   KEDLGNLSGQQLGLIDELQHKTISEERKLSEKLAIVQESVADTSMVELSHVVSELMREQL  181

Query  567   AMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlll  388
              +   + KK+G++ S  E +L +       ++ +AD LRL T+ E+L+I TP+Q+ H L+
Sbjct  182   VVHEEEEKKIGKNISKKEESLLD-------LLKKADDLRLSTIKEILRISTPIQSVHFLI  234

Query  387   vakklhLSIHEWSKKRDGAAAGRQFN  310
              A +LHL +HEW K +D   +  +++
Sbjct  235   AAAELHLRVHEWGKNKDALLSPHKWS  260



>emb|CDY66844.1| BnaC07g50150D [Brassica napus]
Length=285

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 153/255 (60%), Gaps = 16/255 (6%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQRE---DMEELSRAVESNLGDD-ELFGVVDRSVKHFEEY  895
             SS   + H +  C ++ W+  Q +   D++E+  +  SN  D  +L  +V R V  F+ Y
Sbjct  6     SSICGIGHLQKECYYE-WMRTQSKHIVDLKEVLMSQRSNAYDHHKLEELVGRIVNDFQNY  64

Query  894   QQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL  715
                R+ LA ++    F +PSW ++ EN  +W+GGCRPS  +R++Y+LCG+  ++ L  YL
Sbjct  65    ADKRSELADRSCSSYF-APSWNSSLENGLLWMGGCRPSSFMRIIYALCGSHAETQLSQYL  123

Query  714   ---QGER------KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAM  562
                 GE         S+ +++ATQL +IN L  + + +EDKLS   A +QED+AD P+A 
Sbjct  124   LKMDGEVVDGHDGDSSMSELNATQLAKINDLHVEVIDKEDKLSKLSANMQEDVADMPIA-  182

Query  561   IVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllva  382
             +   S+   E+   VE ALD H   M  ++ +ADKLRL TL +++++LTP+QAA  LL  
Sbjct  183   VTAFSRDSVEADVAVEDALDKHEEGMAVLIADADKLRLETLKKIVEVLTPVQAAEFLLSG  242

Query  381   kklhLSIHEWSKKRD  337
             K+LH+S+HEW + R+
Sbjct  243   KRLHVSLHEWGRVRE  257



>ref|XP_002984747.1| hypothetical protein SELMODRAFT_181239 [Selaginella moellendorffii]
 gb|EFJ13997.1| hypothetical protein SELMODRAFT_181239 [Selaginella moellendorffii]
Length=245

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 111/195 (57%), Gaps = 5/195 (3%)
 Frame = -1

Query  1041  HRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQN  862
             + R    + DW   Q + +EEL RA+ SN+ + E+  +VD++  H++ Y   +   A+QN
Sbjct  9     NERYTDFYDDWSNTQLQQLEELERALNSNMSESEIKALVDKAKMHYDYYYGAKDNAAKQN  68

Query  861   GGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDI  682
                  ++P+W T  E AFMW GG RP++  +L Y+L G  +++ L   L G    SL  +
Sbjct  69    V-LQVMTPAWKTPLETAFMWTGGWRPTMVFQLAYALAGQLVEAELSDLLSGVDSPSLASL  127

Query  681   SATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSD-VERAL  505
             SA QL +IN +Q K  ++ED +S R+A LQ+ MAD+P   I   ++ +  S  D +E A+
Sbjct  128   SARQLEKINEMQVKVQKQEDDISHRMAVLQQGMADQPFVGI---TQTLAASEDDKMEAAV  184

Query  504   DNHAVAMGRMVVEAD  460
             D+    +  ++ EAD
Sbjct  185   DSKLKDLESLLEEAD  199



>ref|XP_002985809.1| hypothetical protein SELMODRAFT_123200 [Selaginella moellendorffii]
 gb|EFJ12986.1| hypothetical protein SELMODRAFT_123200 [Selaginella moellendorffii]
Length=245

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 109/188 (58%), Gaps = 5/188 (3%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             + DW   Q + +EEL RA+ SN+ + E+  +VD++  H++ Y   +   A+QN     ++
Sbjct  16    YDDWSNTQLQQLEELERALNSNMSESEIKALVDKAKMHYDYYYGAKDNAAKQNV-LQVMT  74

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQ  661
             P+W T  E AFMW GG RP++  +L Y+L G  +++ L   L G    SL  +SA QL +
Sbjct  75    PAWKTPLETAFMWTGGWRPTMVFQLAYALAGQLVEAELSELLSGVDSPSLASLSARQLER  134

Query  660   INALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSD-VERALDNHAVAM  484
             IN +Q K  ++ED +S R+A LQ+ MAD+P   I   ++ +  S  D +E ALD+    +
Sbjct  135   INEMQVKVQKQEDDISHRMAVLQQGMADQPFVGI---TQTLAASEDDKMEAALDSKLKDL  191

Query  483   GRMVVEAD  460
               ++ EAD
Sbjct  192   ESLLEEAD  199



>gb|ACV41802.1| delay of germination 1, partial [Brassica rapa subsp. pekinensis]
Length=258

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 130/212 (61%), Gaps = 9/212 (4%)
 Frame = -1

Query  948  DDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIR  769
            D +L  +  + +  F++Y + RA L+ +     + +PSW T  ENA +W+GGCRPS   R
Sbjct  28   DKKLRELTQKIIGDFKDYARKRADLSHRCSSS-YYAPSWNTPLENALIWMGGCRPSSFFR  86

Query  768  LVYSLCGADLDSHLQGYLQ--------GERKGSLGDISATQLNQINALQSKTVREEDKLS  613
            LVY+LCG+  +  +  +L+        G    SL D++  QL +IN L  K + EE+K++
Sbjct  87   LVYALCGSQTEIRVTQFLRNIDGYDASGSGGASLSDLTGEQLAKINVLHLKIIDEEEKMT  146

Query  612  SRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtlte  433
             ++++LQED AD P++ +    + VGE +  V++ALD    AM  ++ EAD LR+ TL++
Sbjct  147  KKVSSLQEDAADIPISTVAYAEEHVGEPNLAVDQALDKQEEAMATLLAEADNLRVYTLSK  206

Query  432  llkilTPlqaahlllvakklhLSIHEWSKKRD  337
            ++++L P+QAA  LL  KKLHLS+H W   RD
Sbjct  207  IIEVLAPMQAADFLLAGKKLHLSMHAWGALRD  238



>gb|ABK81209.1| DOG1 alpha splice variant [Arabidopsis thaliana]
Length=291

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 91/240 (38%), Positives = 143/240 (60%), Gaps = 20/240 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAV--------ESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQ  865
             + +W++ Q + + EL + +        E N  D++L  +  + +  F+ Y   RA LA +
Sbjct  15    YLEWMSLQSQRIPELKQLLAQRRSHGDEDN--DNKLRKLTGKIIGDFKNYAAKRADLAHR  72

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQG--------  709
                  + +P+W +  ENA +W+GGCRPS   RLVY+LCG+  +  +  +L+         
Sbjct  73    CSSN-YYAPTWNSPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGYESSG  131

Query  708   -ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGE  532
                  SL D+SA QL +IN L  K + EE+K++ ++++LQED AD P+A +  + + VGE
Sbjct  132   GGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPIATVAYEMENVGE  191

Query  531   SSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEW  352
              +  V++ALD    AM R++VEAD LR+ TL ++L IL+P+Q A  LL  KKLHLS+HEW
Sbjct  192   PNVVVDQALDKQEEAMARLLVEADNLRVDTLAKILGILSPVQGADFLLAGKKLHLSMHEW  251



>ref|NP_199395.2| protein DELAY OF GERMINATION 1 [Arabidopsis thaliana]
 gb|ABK81210.1| DOG1 alpha splice variant [Arabidopsis thaliana]
 gb|ABK81213.1| DOG1 alpha splice variant [Arabidopsis thaliana]
 gb|AED95304.1| delay of germination 1 protein [Arabidopsis thaliana]
Length=291

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 91/240 (38%), Positives = 143/240 (60%), Gaps = 20/240 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAV--------ESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQ  865
             + +W++ Q + + EL + +        E N  D++L  +  + +  F+ Y   RA LA +
Sbjct  15    YLEWMSLQSQRIPELKQLLAQRRSHGDEDN--DNKLRKLTGKIIGDFKNYAAKRADLAHR  72

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQG--------  709
                  + +P+W +  ENA +W+GGCRPS   RLVY+LCG+  +  +  +L+         
Sbjct  73    CSSN-YYAPTWNSPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGYESSG  131

Query  708   -ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGE  532
                  SL D+SA QL +IN L  K + EE+K++ ++++LQED AD P+A +  + + VGE
Sbjct  132   GGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPIATVAYEMENVGE  191

Query  531   SSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEW  352
              +  V++ALD    AM R++VEAD LR+ TL ++L IL+P+Q A  LL  KKLHLS+HEW
Sbjct  192   PNVVVDQALDKQEEAMARLLVEADNLRVDTLAKILGILSPVQGADFLLAGKKLHLSMHEW  251



>ref|XP_010494735.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Camelina sativa]
Length=279

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 95/253 (38%), Positives = 150/253 (59%), Gaps = 17/253 (7%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDE------LFGVVDRSVKHFE  901
             SSS  ++  + RC + +W++ Q + + +L + +     D +      L  + +  +  F+
Sbjct  3     SSSKNIEQAQERC-YLEWMSLQSQRIPDLKQLLAQRQSDSDKDHDKKLRELTEMIIGDFK  61

Query  900   EYQQHRALLAQQN-GGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQ  724
             +Y   R+ LA ++     + +PSW T  ENA +W+GGCRPS   RLVY+LCG+  +  + 
Sbjct  62    DYAGKRSNLAHRHRCSSNYYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVT  121

Query  723   GYLQG---------ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP  571
              +L               SL D+SA QL +IN L  K + EE+K++ +I++LQED AD P
Sbjct  122   QFLPNIDGYDSSGGGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKISSLQEDAADIP  181

Query  570   LAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahll  391
             +A +  + + VGE +  V++ALD    AM R++ EAD LR+ TL ++++IL+PLQAA  L
Sbjct  182   IATVAYEMEHVGEHNMVVDQALDKQEEAMARLLTEADTLRVDTLAKIVEILSPLQAADFL  241

Query  390   lvakklhLSIHEW  352
             L  KKLHLS+HEW
Sbjct  242   LAGKKLHLSMHEW  254



>ref|XP_002456383.1| hypothetical protein SORBIDRAFT_03g035150 [Sorghum bicolor]
 gb|EES01503.1| hypothetical protein SORBIDRAFT_03g035150 [Sorghum bicolor]
Length=308

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 106/175 (61%), Gaps = 11/175 (6%)
 Frame = -1

Query  1047  VDHRRLRCVFQDWIAQQREDMEELSRAVESNLG----DDELFGVVDRSVKHFEEYQQHRA  880
             +D  R    ++ WIA Q   + EL  A  +       D EL  VV+R +  +++Y   R 
Sbjct  1     MDMARYESCYRHWIAGQEAGLAELEAASANAAAGRATDAELRAVVERCMLGYQDYATRRR  60

Query  879   LLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER-  703
              L++++G   F +P WCT FEN+ +W+GGCRPSL++RL+Y++ G  L++ ++  L G   
Sbjct  61    ALSREDGAA-FFAPPWCTAFENSLLWLGGCRPSLTVRLLYNISGEGLEAQVEEMLGGLTH  119

Query  702   ----KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK  550
                  G+LG I++ QL  IN L S+TV +E+ L+ R+ATLQED+AD PL  IV +
Sbjct  120   GVIPTGALG-ITSAQLLLINDLHSRTVHQENALTDRLATLQEDIADRPLLPIVRQ  173



>ref|XP_009101563.1| PREDICTED: transcription factor HBP-1b(c38) [Brassica rapa]
Length=280

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 130/212 (61%), Gaps = 9/212 (4%)
 Frame = -1

Query  948  DDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIR  769
            D +L  +  + +  F++Y + RA L+ +     + +PSW T  ENA +W+GGCRPS   R
Sbjct  50   DKKLRELTQKIIGDFKDYARKRADLSHRCSSS-YYAPSWNTPLENALIWMGGCRPSSFFR  108

Query  768  LVYSLCGADLDSHLQGYLQ--------GERKGSLGDISATQLNQINALQSKTVREEDKLS  613
            LVY+LCG+  +  +  +L+        G    SL D++  QL +IN L  K + EE+K++
Sbjct  109  LVYALCGSQTEIRVTQFLRNIDGYDASGSGGASLSDLTGEQLAKINVLHLKIIDEEEKMT  168

Query  612  SRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtlte  433
             ++++LQED AD P++ +    + VGE +  V++ALD    AM  ++ EAD LR+ TL++
Sbjct  169  KKVSSLQEDAADIPISTVAYAEEHVGEPNLAVDQALDKQEEAMATLLAEADNLRVYTLSK  228

Query  432  llkilTPlqaahlllvakklhLSIHEWSKKRD  337
            ++++L P+QAA  LL  KKLHLS+H W   RD
Sbjct  229  IIEVLAPMQAADFLLAGKKLHLSMHAWGALRD  260



>emb|CDY61468.1| BnaCnng37860D [Brassica napus]
 gb|AJE25536.1| DOG1-like protein [Brassica napus]
Length=280

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 127/206 (62%), Gaps = 9/206 (4%)
 Frame = -1

Query  930  VVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
            +  + +  F++Y + RA L+ +     + +PSW T  ENA +W+GGCRPS   RLVY+LC
Sbjct  56   LTQKIIGDFKDYARKRADLSHRCSSN-YYAPSWNTPLENALIWMGGCRPSSFFRLVYALC  114

Query  750  GADLDSHLQGYLQ--------GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATL  595
            G+  +  +  +L+        G    SL D++A QL +IN L  K + EE+K++ ++++L
Sbjct  115  GSQTEIRVTQFLRNVDGYDTSGSGGASLSDLTAEQLAKINVLHVKIIDEEEKMTKKVSSL  174

Query  594  QEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilT  415
            QED AD P++ +    + VGE +  V++ALD    AM  ++ EAD LR+ TL++++++L 
Sbjct  175  QEDAADIPISTVAYAEEHVGEPNLAVDQALDKQEEAMATLLAEADNLRVYTLSKIIEVLA  234

Query  414  PlqaahlllvakklhLSIHEWSKKRD  337
            P+QAA  LL   KLHLS+H W   RD
Sbjct  235  PMQAADFLLAGIKLHLSMHSWGALRD  260



>tpg|DAA57542.1| TPA: hypothetical protein ZEAMMB73_325815 [Zea mays]
Length=229

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 106/175 (61%), Gaps = 11/175 (6%)
 Frame = -1

Query  1047  VDHRRLRCVFQDWIAQQREDMEELSRAVESNL----GDDELFGVVDRSVKHFEEYQQHRA  880
             +D  R    ++ WIA Q   + EL  A  +       D EL  VV+R +  +++Y   R 
Sbjct  1     MDMARYESCYRHWIAGQEAGLAELEAASANAAAGRATDAELRTVVERCMLGYQDYATRRR  60

Query  879   LLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERK  700
              L++++G   F +P WCT FEN+ +W+GGCRPSL++RL+Y+L G  L++ ++  L G   
Sbjct  61    ALSREDG-VAFFAPPWCTAFENSVLWLGGCRPSLTVRLLYNLSGEGLEAQVEELLGGLSN  119

Query  699   -----GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK  550
                  G+LG I++ QL  IN L S+TV +E+ LS R+ATLQED+AD PL  IV +
Sbjct  120   GVIPTGALG-ITSAQLVLINDLHSRTVHQENALSDRLATLQEDIADRPLLPIVRQ  173



>gb|ABK81206.1| DOG1 alpha splice variant [Arabidopsis thaliana]
Length=291

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/240 (38%), Positives = 143/240 (60%), Gaps = 20/240 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAV--------ESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQ  865
             + +W++ Q + + EL + +        E N  D++L  +  + +  F+ Y   RA LA +
Sbjct  15    YLEWMSLQSQRIPELKQLLAQRRSHGDEDN--DNKLRELTGKIIGDFKNYAAKRADLAHR  72

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQG--------  709
                  + +P+W +  ENA +W+GGCRPS   RLVY+LCG+  +  +  +L+         
Sbjct  73    CSSN-YYAPTWNSPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGYESSG  131

Query  708   -ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGE  532
                  SL D+SA QL +IN L  K + EE+K++ ++++LQED AD P+A +  + + VGE
Sbjct  132   GGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPIATVAYEMENVGE  191

Query  531   SSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEW  352
              +  V++ALD    AM R++VEAD LR+ TL ++L IL+P+Q A  LL  KKLHLS+HEW
Sbjct  192   PNVVVDQALDKQEEAMARLLVEADNLRVDTLAKILGILSPVQGADFLLAGKKLHLSMHEW  251



>dbj|BAF00554.1| tumor-related protein-like [Arabidopsis thaliana]
Length=274

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 141/237 (59%), Gaps = 20/237 (8%)
 Frame = -1

Query  1011  WIAQQREDMEELSRAV--------ESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGG  856
             W++ Q + + EL + +        E N  D++L  +  + +  F+ Y   RA LA +   
Sbjct  1     WMSLQSQRIPELKQLLAQRRSHGDEDN--DNKLRKLTGKIIGDFKNYAAKRADLAHRCSS  58

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQG---------ER  703
               + +P+W +  ENA +W+GGCRPS   RLVY+LCG+  +  +  +L+            
Sbjct  59    N-YYAPTWNSPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGYESSGGGG  117

Query  702   KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSS  523
               SL D+SA QL +IN L  K + EE+K++ ++++LQED AD P+A +  + + VGE + 
Sbjct  118   GASLSDLSAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPIATVAYEMENVGEPNV  177

Query  522   DVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEW  352
              V++ALD    AM R++VEAD LR+ TL ++L IL+P+Q A  LL  KKLHLS+HEW
Sbjct  178   VVDQALDKQEEAMARLLVEADNLRVDTLAKILGILSPVQGADFLLAGKKLHLSMHEW  234



>emb|CDY58051.1| BnaA06g40200D [Brassica napus]
Length=280

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 144/246 (59%), Gaps = 19/246 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAV----------ESNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             +  W++ Q + + +L +A+          ++   D +L  +  + +  F++Y + RA L+
Sbjct  16    YLGWMSLQSQRVLDLKQALAQRRSHEGTADAAANDKKLRELTQKIIGDFKDYARKRADLS  75

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ-------  712
              +     + +PSW +  ENA +W+GGCRPS   RLVY+LCG+  +  +  +L+       
Sbjct  76    HRCSSS-YYAPSWNSPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGYDA  134

Query  711   -GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
              G    SL D++A QL +IN L  K + EE+K++ ++++LQED AD P++ +    + VG
Sbjct  135   SGSGGASLSDLTAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEEHVG  194

Query  534   ESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHE  355
             E +  V++ALD    AM  ++ E D LR+ TL++++++L P+QAA  LL  KKLHLS+H 
Sbjct  195   EPNLAVDQALDKQEEAMATLLAEGDNLRVYTLSKIIEVLAPMQAADFLLAGKKLHLSMHA  254

Query  354   WSKKRD  337
             W   RD
Sbjct  255   WGALRD  260



>ref|XP_009136952.1| PREDICTED: uncharacterized protein LOC103861007 [Brassica rapa]
Length=287

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 98/247 (40%), Positives = 150/247 (61%), Gaps = 18/247 (7%)
 Frame = -1

Query  990  DMEELSRAVESNLGDD-ELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFEN  814
            D++E+  +  SN  D  +L  +V R V  F++Y   R+ LA ++    F +PSW ++ EN
Sbjct  34   DLKEVLMSQRSNAYDHHKLEELVGRIVNDFQKYADKRSELADRSCSCYF-APSWNSSLEN  92

Query  813  AFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL---QGER------KGSLGDISATQLNQ  661
              +W+GGCRPS  +R++Y+LCG+  ++ L  YL    GE         S+ +++ATQL +
Sbjct  93   GLLWMGGCRPSSFMRIIYALCGSHAETQLSQYLLKMDGEVVDGHDGDSSMSELNATQLAK  152

Query  660  INALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMG  481
            IN L  + + +EDKLS   A +QED+AD P+A+    S  V E+   VE ALD H   M 
Sbjct  153  INDLHVEVIAKEDKLSKLSANMQEDVADMPIAVTAFSSDSV-EADVAVEDALDKHEEGMA  211

Query  480  RMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRDGAAAGRQFNT--  307
             ++ +ADKLRL TL +++++LTP+QAA  LL  K+LH+S+HEW + R+     R+F    
Sbjct  212  VLIADADKLRLETLKKIVEVLTPVQAAEFLLSGKRLHVSLHEWGRVRE----ERRFGCAR  267

Query  306  TQDAAAA  286
             +DAA A
Sbjct  268  AEDAAPA  274



>ref|XP_004503896.1| PREDICTED: transcription factor HBP-1b(c38)-like [Cicer arietinum]
Length=277

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 84/248 (34%), Positives = 144/248 (58%), Gaps = 15/248 (6%)
 Frame = -1

Query  1023  VFQDWIAQQREDMEEL--SRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPP  850
              F+ W+ +Q + + EL  +++ +  L  D +  ++D+ V+H++ Y + ++  A+++    
Sbjct  22    FFECWLVEQNQHLNELVAAKSSQPQLAIDRMHTLIDKVVEHYQFYYKEKSRYAKKDVLSM  81

Query  849   FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQ  670
             F SPSW ++ E AF+WIGG RPS++  LVYS C     + L   +QG +   LGD+S++Q
Sbjct  82    F-SPSWISSLEEAFLWIGGWRPSMAFHLVYSKCSMQFQARLNDLIQGLKTCDLGDLSSSQ  140

Query  669   LNQINALQSKTVREEDKLSSRIATLQEDMADEPL-------AMIVNKSKKVGESSSD---  520
             L + + LQ +T++EE +++  +A  QE +AD P+       + I+    ++GE +     
Sbjct  141   LAEFDDLQKRTIKEEREITGLMAEHQETVADAPMVELSHVVSEIIRDDNQIGEENEKKLE  200

Query  519   --VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSK  346
               +E  L+     + +++  AD LRLRTL  ++ ILTP Q  H L+ A +LHL +HEW K
Sbjct  201   ERIESTLEPKVEGLEKILHRADDLRLRTLQGIVSILTPQQGIHFLIAAAELHLRLHEWGK  260

Query  345   KRDGAAAG  322
             K D A  G
Sbjct  261   KMDDAKRG  268



>ref|XP_009799260.1| PREDICTED: transcription factor TGA6-like [Nicotiana sylvestris]
Length=286

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 105/172 (61%), Gaps = 7/172 (4%)
 Frame = -1

Query  1062  SSSSAVDHRR-LRCVFQDWIAQQREDMEELSRAVESNLGDDE-----LFGVVDRSVKHFE  901
             +S +AV +R      F+ W+ +Q +D+++L RA +   G +E     L  ++ R ++H+E
Sbjct  9     NSRNAVQNRETFHKFFESWLVEQNQDLDQLVRASKEVNGIEENNRIMLSPIIQRVIQHYE  68

Query  900   EYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQG  721
              Y + ++  A+++     L+P+W +  E+AF+WIGG RPS++  L+YS  G  L++    
Sbjct  69    NYYKEKSRSAKEDV-LGMLNPTWRSNLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAGFHD  127

Query  720   YLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLA  565
               +G   G LGD+S  QL +I+ LQ+KT++EE KLS R+A +QE MAD  + 
Sbjct  128   LFRGISTGDLGDLSGIQLGKIDELQNKTLKEEKKLSERLAKVQETMADTSMV  179



>ref|XP_002863451.1| hypothetical protein ARALYDRAFT_330831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39710.1| hypothetical protein ARALYDRAFT_330831 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 89/264 (34%), Positives = 150/264 (57%), Gaps = 24/264 (9%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELS------RAVESNLGDDELFGVVDRSVKHFE  901
             SS+  ++  +  C + +W++ Q + + E+       R+      D +L  +  + +  F+
Sbjct  3     SSTKNIEQAQESC-YHEWMSLQSQRINEVKQLLVQRRSHRDEEHDKKLRELTGKILGDFK  61

Query  900   EYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQG  721
             +Y   RA LA +     + +P+W T  ENA +W+GGCRPS   RL+Y+LCG+  +  +  
Sbjct  62    DYAGKRADLAHR-CSSNYYAPTWNTRLENALIWMGGCRPSSFFRLIYALCGSQTEIRVTQ  120

Query  720   YLQ----------------GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQE  589
             +L+                G    SL ++SA QL +IN L  K + EE+K++ ++++LQE
Sbjct  121   FLRNIDGYESSGRVLDVFGGGGGASLSNLSAEQLAKINVLHVKIIDEEEKMTKKVSSLQE  180

Query  588   DMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPl  409
             D AD P+A +  + + +GE +  V++A D    AM  ++ +AD LR+ TL ++++IL+P+
Sbjct  181   DAADIPIATVAYEMENIGEPNMVVDQAFDKQEEAMAGLLAQADNLRVDTLAKIVEILSPV  240

Query  408   qaahlllvakklhLSIHEWSKKRD  337
             QAA  LL  KKLHLS+HEW   RD
Sbjct  241   QAADFLLAGKKLHLSMHEWGTTRD  264



>ref|XP_003630355.1| Transcription factor HBP-1b(c1) [Medicago truncatula]
 gb|AET04831.1| transcription factor TGA5-like protein [Medicago truncatula]
Length=272

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 144/245 (59%), Gaps = 11/245 (4%)
 Frame = -1

Query  1056  SSAVDHRRLRCVFQDWIAQQREDMEEL--SRAVESNLGDDELFGVVDRSVKHFEEYQQHR  883
             S+  D       F+ W+ +Q + + EL  +++ +  L +D +  ++D+ V+H+E Y + +
Sbjct  7     SNGNDAESFNKFFECWMVEQNKYLNELVAAKSAQPQLTNDRMHTLIDKVVEHYECYYKTK  66

Query  882   ALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER  703
             +  A+++    F SP W +T E AF+WIGG RPS++  L+YS C     + L   +QG++
Sbjct  67    SSFAKKDVLSMF-SPPWLSTLEEAFLWIGGWRPSMAFHLLYSKCSMQFQARLNDLIQGQK  125

Query  702   KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP---LAMIVNKSKKVGE  532
                LGD++A+QL + + LQ KT+REE +++  +A  QE +AD P   L+ +V++  + GE
Sbjct  126   TCDLGDLTASQLAEFDDLQKKTIREEREITDMLAEHQETVADAPMVELSHVVSEMIRGGE  185

Query  531   SSSD-----VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhL  367
             +        +E  L+     + +++  AD LRLR L  ++ ILTP QA H L+ A +LHL
Sbjct  186   NEKKELEERIESVLEPKVEGLEKILYRADDLRLRALQGIVNILTPKQAIHFLIAAAELHL  245

Query  366   SIHEW  352
              +HEW
Sbjct  246   RLHEW  250



>emb|CDY70293.1| BnaCnng67640D [Brassica napus]
Length=248

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 139/226 (62%), Gaps = 17/226 (8%)
 Frame = -1

Query  930  VVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
            +V R V  F++Y   R+ LA ++    F +PSW ++ EN  +W+GGCRPS  +R++Y+LC
Sbjct  16   LVGRIVNDFQKYADKRSELADRSCSCYF-APSWNSSLENGLLWMGGCRPSSFMRIIYALC  74

Query  750  GADLDSHLQGYL---QGER------KGSLGDISATQLNQINALQSKTVREEDKLSSRIAT  598
            G+  ++ L  YL    GE         S+ +++ATQL +IN L  + + +EDKLS   A 
Sbjct  75   GSHAETQLSQYLLKMDGEVVDGHDGDSSMSELNATQLAKINDLHVEVIAKEDKLSKLSAN  134

Query  597  LQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkil  418
            +QED+AD P+A+    S  V E+   VE ALD H   M  ++ +ADKLRL TL +++++L
Sbjct  135  MQEDVADMPIAVTAFSSDSV-EADVAVEDALDKHEEGMAVLIADADKLRLETLKKIVEVL  193

Query  417  TPlqaahlllvakklhLSIHEWSKKRDGAAAGRQFNT--TQDAAAA  286
            TP+QAA  LL  K+LH+S+HEW + R+     R+F     +DAA A
Sbjct  194  TPVQAAEFLLSGKRLHVSLHEWGRVRE----ERRFGCARAEDAAPA  235



>ref|XP_003524316.1| PREDICTED: transcription factor TGA4-like [Glycine max]
Length=285

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/249 (35%), Positives = 149/249 (60%), Gaps = 14/249 (6%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNL-GDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFL  844
             F+ WI++Q++ +++L  A  + L  D+EL  + D+ V+H+E Y + ++  A+Q+     L
Sbjct  28    FECWISEQKQHLKDLLAAESTQLISDEELQALNDKVVEHYEYYYKAKSRCAKQDV-LAML  86

Query  843   SPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLN  664
             SP+W ++ E AF+WIGG RPS++  L+YS  G   ++ L   LQG R   LGD+SA+QL 
Sbjct  87    SPTWMSSLEEAFLWIGGWRPSMAFHLIYSKSGLQFEARLDEVLQGLRTHDLGDLSASQLA  146

Query  663   QINALQSKTVREEDKLSSRIATLQEDMADEPLA--------MIVNKSKKVGESSSDVERA  508
             Q++ +Q +T+ EE +++  +A  QE +AD  +         MI    +   + S ++E  
Sbjct  147   QLDEMQRRTILEEREITDLMARHQETVADASMVELSHVVSEMIRANQRGEVDQSKEIENK  206

Query  507   LDNHAV----AMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKR  340
             +++  V     + +++++AD+LR  TL +++ +LTP QA H L+ A +LHL +HEW KK 
Sbjct  207   VESTLVLKEEGLEKILLKADELRFITLKDVVDVLTPKQAIHFLIAAAELHLRLHEWGKKM  266

Query  339   DGAAAGRQF  313
             D     + F
Sbjct  267   DARKCNQGF  275



>ref|XP_009594445.1| PREDICTED: transcription factor TGA6-like [Nicotiana tomentosiformis]
Length=286

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 98/157 (62%), Gaps = 6/157 (4%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDE-----LFGVVDRSVKHFEEYQQHRALLAQQNGG  856
             F+ W+ +Q +D+E+L RA +   G +E     L  ++ R + H+E Y + ++  A+++  
Sbjct  24    FESWLVEQNQDLEQLVRASKEVNGVEENNRRMLSPLIQRVIHHYENYYKEKSRSAKEDV-  82

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
                L+P+W +  E+AF+WIGG RPS++  L+YS  G  L++      +G  +G LGD+S 
Sbjct  83    LGMLNPTWRSNLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAGFHDLFRGISRGDLGDLSG  142

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLA  565
              QL +I+ LQ+KT+REE KL+ R+A +QE +AD  + 
Sbjct  143   IQLGKIDELQNKTLREEKKLTERLAKVQETVADTSMV  179



>ref|XP_011100139.1| PREDICTED: transcription factor TGA1-like, partial [Sesamum indicum]
Length=276

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 148/260 (57%), Gaps = 36/260 (14%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRA-------------------VESNLGDDELFGVVDRSVKHFEE  898
             F+ WI +Q + ++EL  A                   VE ++ D  L  +++R ++H+E 
Sbjct  8     FECWIVEQDQHLQELISAAREYEERRGRGCRQDDGTTVEEDVQDRTLRPLLERVIQHYEH  67

Query  897   YQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGY  718
             Y + ++  A+ +    F +PSW ++ E+AFMWIGG RPS++  L+YS  G  L++ L   
Sbjct  68    YYRAKSRWAKSDVLSMF-NPSWRSSLEDAFMWIGGWRPSMTFHLLYSKSGLQLEARLTEL  126

Query  717   LQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP---LAMIVNKS  547
             LQG   G LGD+S +QL+Q+N LQ +T+REE  ++ ++A  QE +AD     L  +V + 
Sbjct  127   LQGLSTGDLGDLSPSQLDQVNELQKQTIREEKDITEKLAKQQETVADSSMVELTHVVTEM  186

Query  546   KKVGESSSDVERALDNHAV---------AMGRMVVEADklrlrtltellkilTPlqaahl  394
              + G+    V++A+D   V          +  ++  AD LRL+TL E+L IL+P+Q  + 
Sbjct  187   MREGQ----VDQAMDTERVDETLAPKEEGLVEVLQRADGLRLKTLKEVLNILSPIQGVYF  242

Query  393   llvakklhLSIHEWSKKRDG  334
             L+ A +LHL +HEW KKRD 
Sbjct  243   LIAAAELHLRVHEWGKKRDA  262



>gb|KHN17404.1| Transcription factor TGA4 [Glycine soja]
Length=402

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 86/249 (35%), Positives = 149/249 (60%), Gaps = 14/249 (6%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNL-GDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFL  844
             F+ WI++Q++ +++L  A  + L  D+EL  + D+ V+H+E Y + ++  A+Q+     L
Sbjct  28    FECWISEQKQHLKDLLAAESTQLISDEELQALNDKVVEHYEYYYKAKSRCAKQDV-LAML  86

Query  843   SPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLN  664
             SP+W ++ E AF+WIGG RPS++  L+YS  G   ++ L   LQG R   LGD+SA+QL 
Sbjct  87    SPTWMSSLEEAFLWIGGWRPSMAFHLIYSKSGLQFEARLDEVLQGLRTHDLGDLSASQLA  146

Query  663   QINALQSKTVREEDKLSSRIATLQEDMADEPLA--------MIVNKSKKVGESSSDVERA  508
             Q++ +Q +T+ EE +++  +A  QE +AD  +         MI    +   + S ++E  
Sbjct  147   QLDEMQRRTILEEREITDLMARHQETVADASMVELSHVVSEMIRANQRGEVDQSKEIENK  206

Query  507   LDNHAV----AMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKR  340
             +++  V     + +++++AD+LR  TL +++ +LTP QA H L+ A +LHL +HEW KK 
Sbjct  207   VESTLVLKEEGLEKILLKADELRFITLKDVVDVLTPKQAIHFLIAAAELHLRLHEWGKKM  266

Query  339   DGAAAGRQF  313
             D     + F
Sbjct  267   DARKCNQGF  275



>ref|XP_008227573.1| PREDICTED: transcription factor TGA2-like [Prunus mume]
Length=272

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 90/263 (34%), Positives = 143/263 (54%), Gaps = 22/263 (8%)
 Frame = -1

Query  1047  VDHRRLRCVFQDWIAQQREDMEELSRAVESNLGD------------DELFGVVDRSVKHF  904
             V+H      F+ W+A+Q + +++L  A ++NL +              L  +V+R VKH+
Sbjct  8     VEHESFHNFFECWLAEQNQHLQDLIIASKNNLYNGNPTTTAAANTNTSLRTLVERVVKHY  67

Query  903   EEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQ  724
             E+Y + ++   +Q+     LSPSW T+ E+AF+WIGG RPS++  L YS  G  L++ L 
Sbjct  68    EQYYEAKSRWVKQDV-LRMLSPSWTTSLEDAFLWIGGWRPSMTFHLFYSKSGLQLEARLT  126

Query  723   GYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLA-------  565
               ++G   G L DIS  QL Q++ LQ +TV+EE  ++ ++A  QE +AD           
Sbjct  127   ELIEGLGTGDLADISQHQLMQVDHLQRRTVKEERDITEKMAKQQESVADTSTVELSHVIT  186

Query  564   --MIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahll  391
               M  N   +    +  VE  L +    +  ++  AD LRL+TL  +  ILTP+QA H  
Sbjct  187   ELMSANGGHEHEVEADRVESVLASKERGLEEILQRADSLRLKTLKAITHILTPIQAVHFF  246

Query  390   lvakklhLSIHEWSKKRDGAAAG  322
             + A +LHL +H+W KK D ++ G
Sbjct  247   IAAAELHLRLHDWGKKEDASSRG  269



>ref|XP_002273632.1| PREDICTED: transcription factor TGA2 [Vitis vinifera]
 emb|CBI21619.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 86/249 (35%), Positives = 140/249 (56%), Gaps = 9/249 (4%)
 Frame = -1

Query  1059  SSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDE----LFGVVDRSVKHFEEYQ  892
             +SS  +H      F+ W+ +Q + ++EL  A  +N   D+    L  +V+R V H+  Y 
Sbjct  2     ASSPANHEGFHKFFESWLTEQNQHLQELISASRNNQHTDDSDQILCPLVERVVSHYHNYY  61

Query  891   QHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ  712
              H   L+ ++     L+P W +  E+AF+W+GG RPS++  L+YS  G   +S L   ++
Sbjct  62    -HAKSLSTRDNILSMLTPPWRSLLEDAFLWVGGWRPSVAFHLLYSKSGLQFESGLADLIR  120

Query  711   GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMI----VNKSK  544
             G   G LGD+S  QL +++ LQ KT+REE +++  +A +QE +AD  +  +      +  
Sbjct  121   GLSTGDLGDMSHEQLCRVDELQRKTIREEREMTENMARIQETVADSKMVELSEAATEEGG  180

Query  543   KVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLS  364
                +    VE AL +    +  M+++AD LRLRTL  +L ILTP+Q  H L+ A +LHL 
Sbjct  181   GGDDLGERVESALKHKEEGLAEMLLKADDLRLRTLKGVLDILTPMQCVHFLIAAAELHLR  240

Query  363   IHEWSKKRD  337
             +H+W K +D
Sbjct  241   LHKWGKNKD  249



>ref|XP_007159878.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
 gb|ESW31872.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
Length=278

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 150/265 (57%), Gaps = 25/265 (9%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQ  865
             D       F+ WI++Q + +++L    E      EL  V D+ V+H+E Y + ++  A+Q
Sbjct  20    DTESFHHFFEGWISEQNQHLKDLLVVGE------ELQSVKDKVVEHYESYYKTKSRCAKQ  73

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGD  685
             +     LSP+W ++ E+AF+WIGG RPS++  L+YS  G   ++ LQ  +QG R   LGD
Sbjct  74    DV-LAMLSPTWTSSLEDAFLWIGGWRPSMAFHLLYSKSGLQFEARLQELVQGLRTHDLGD  132

Query  684   ISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLA--------MI-VNKSKKVGE  532
             +SA+Q++Q++ +Q + + EE +++  +A  QE +AD  +         MI  N+  +V E
Sbjct  133   LSASQISQLDEMQKRVILEERQITDLMAGHQETVADASMVELSHVASEMIRANERGEVEE  192

Query  531   SSS---DVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSI  361
             S      VE  L      + +++ +AD+LRL TL  ++ +LTP QA H L+ A +LHL +
Sbjct  193   SKEFEDKVESTLVQKEEGLEKILQKADELRLGTLKAIVNVLTPKQAIHFLIAAAELHLRL  252

Query  360   HEWSKKRD------GAAAGRQFNTT  304
             HEW KK D      G   G+ +N++
Sbjct  253   HEWGKKIDARKENHGTGEGKNYNSS  277



>emb|CDY34053.1| BnaC03g62790D [Brassica napus]
Length=326

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 134/234 (57%), Gaps = 34/234 (15%)
 Frame = -1

Query  951  GDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGC------  790
            G  EL G +   V  F+ Y + R+ L  ++    F +PSW ++ EN  +W+GGC      
Sbjct  59   GPSELVGKI---VNDFQSYAKGRSELTDKSCSSYF-APSWNSSLENGLLWMGGCLKSSHT  114

Query  789  --------------RPSLSIRLVYSLCGADLDSHLQGYL---------QGERKGSLGDIS  679
                          RP+  +R++Y+LCG+  ++HL  YL         + +   S+ D++
Sbjct  115  RTDVKKKWVGSFQCRPASFVRVIYALCGSCAEAHLSRYLLQMDENIDDRHDGDSSMSDLT  174

Query  678  ATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDN  499
            ATQL +IN L  K +REED+++ + A LQED+AD P+A+       V E+   VE ALD 
Sbjct  175  ATQLEKINDLHVKVIREEDEITKKCANLQEDVADMPIAVTAFWRDSV-EADVAVENALDK  233

Query  498  HAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
            H   MG ++ EADK+RL TL  ++++LTP+QAA  LL  K+LH+S+HEW + R+
Sbjct  234  HEECMGVLMAEADKVRLETLRRIVEVLTPVQAAEFLLSRKRLHMSLHEWGRARE  287



>gb|EYU35712.1| hypothetical protein MIMGU_mgv1a011847mg [Erythranthe guttata]
Length=269

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 138/251 (55%), Gaps = 19/251 (8%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEELSRAVE--------SNLGDDE--LFGVVDRSVKHFEEYQQHR  883
                 F+ W+ +Q   +EEL  A +        S   DD+  L   + R + H+E+Y + +
Sbjct  13    FHSFFESWLVEQDHYLEELVSASKRRRVHHHPSAADDDDTVLRQKIARVIDHYEQYYRAK  72

Query  882   ALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER  703
             +  A+ +  P F +P W ++ E+AF+WIGG RP+++  L+YS  G  L   L   LQG  
Sbjct  73    STCAKTDALPMF-NPPWRSSLEDAFLWIGGWRPTMAFHLLYSKSGLQLQDKLADLLQGLA  131

Query  702   KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKV--GES  529
              G L D+S  Q+NQIN LQ  TVREE ++S ++A  QE +AD  +  + N   +     +
Sbjct  132   AGDLADLSPPQVNQINDLQRATVREEKEISEKLAKQQEKVADTSMVELSNAVTEAMRNPA  191

Query  528   SSD------VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhL  367
             ++D      V  AL    V +  ++  AD LRL+TL ++L +L+P+Q  H L+ A +LHL
Sbjct  192   AADDGGGGRVAAALAPKEVGLAEVLQRADDLRLKTLKKVLGVLSPIQGVHFLIAAAELHL  251

Query  366   SIHEWSKKRDG  334
              +HEW  KRD 
Sbjct  252   RLHEWGMKRDA  262



>ref|XP_004288481.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Fragaria vesca subsp. vesca]
Length=280

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 89/255 (35%), Positives = 145/255 (57%), Gaps = 21/255 (8%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEEL---SRAVESNLGDDELF--GVVDRSVKHFEEYQQHRALLAQ  868
              +  F+ WIA+Q + +++L   S+A + N   D++    +V+R +KH+E+Y   +   A+
Sbjct  26    FQAFFKCWIAEQNQHLDDLVVASKAADYNGDHDQVLLSSLVERVLKHYEQYYNAKFQWAK  85

Query  867   QNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGA---DLDSHLQGYLQGERKG  697
             Q      LSP W ++ E+AF+WIGG RPS++  L+YS  G    D  + L   L+    G
Sbjct  86    QEV-LSMLSPPWRSSLEDAFLWIGGWRPSMAFHLLYSKSGLHPEDCSAELMRGLRFSNTG  144

Query  696   SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMI-------VNKSKKV  538
              LGD+S  QL  ++ LQ +T++EE  +S ++A LQE +AD PL  +       + K+  V
Sbjct  145   DLGDLSQWQLTMVDELQRRTIQEEKHISEKMAKLQETLADNPLVELSHLATDKMRKNNNV  204

Query  537   GESSSD-----VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakkl  373
              E   D     VE  L +    + +++ +AD LR+ TL  + +IL+PLQA H L+ A +L
Sbjct  205   HEEGGDDHMERVESTLASKEEGLEKILHKADDLRITTLKNITQILSPLQAVHFLIAAAEL  264

Query  372   hLSIHEWSKKRDGAA  328
             +L +H+W  K+D A 
Sbjct  265   NLRVHDWGIKKDDAT  279



>ref|XP_004289493.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 86/253 (34%), Positives = 149/253 (59%), Gaps = 21/253 (8%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEEL---SRAVESNLGDDE----LFGVVDRSVKHFEEYQQHRALL  874
              +  F+ W+++Q + +++L   S+  +    DD+    L  +V+R VKH+E+Y   ++  
Sbjct  13    FQAFFESWLSEQDQHLQDLIIASKQHQKRAADDDDRVLLSSLVERVVKHYEQYYNKKSQW  72

Query  873   AQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER--K  700
             A+Q+     LSP W ++ E+AF+WIGG RPS++  L+YS  G  L++     ++G R   
Sbjct  73    AKQDV-LRMLSPPWRSSLEDAFLWIGGWRPSMAFHLLYSKSGLQLEASFAELMRGLRLST  131

Query  699   GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVN------KSKKV  538
             G LGD+S  QL  ++ +Q +T+ +E  LS ++A LQE +AD  L  + +      ++ +V
Sbjct  132   GDLGDLSHCQLTMVDKVQRRTIEDEKHLSEKMAKLQETVADATLVELAHEATEMMRNNEV  191

Query  537   GESSSD-----VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakkl  373
              E  +D     VE  L +    + +++ +AD LR++TL  + +IL+PLQA H L+ A +L
Sbjct  192   HEGGADDHMERVESTLASKEEGLEKILHKADDLRMKTLRNITQILSPLQAVHFLIAAAEL  251

Query  372   hLSIHEWSKKRDG  334
             HL +H+W KK+D 
Sbjct  252   HLRVHDWGKKKDA  264



>gb|EYU23355.1| hypothetical protein MIMGU_mgv1a023684mg, partial [Erythranthe 
guttata]
Length=261

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/251 (34%), Positives = 142/251 (57%), Gaps = 10/251 (4%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQ  865
             +H      F  W+ +Q   ++EL  A +   G  +   VV++ V H+E Y + +++ A++
Sbjct  4     EHVSFHMFFDSWMVEQNYQLQELVSATKEWGGRSD---VVEQVVHHYEHYYKTKSMWAKK  60

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ---GERKGS  694
             +    F SP+W ++ E AFMW+GG RP+ +  L+YS CG  L++ L+ Y     G   G 
Sbjct  61    DILSMF-SPTWTSSLEKAFMWVGGWRPTTAFHLLYSKCGLQLEAALEDYHHLPSGLNTGD  119

Query  693   LGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSD--  520
             LGD+S +Q+ +++ L   T+REE  ++ ++A  QE +AD  +  +  +     E      
Sbjct  120   LGDLSHSQMVRVDELHKSTLREEKMITEKLAKKQETIADSSMVRLTTELMVHMEEHDQQV  179

Query  519   -VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKK  343
              V+ AL +    + R++  AD LRL+TL EL+ IL+P+Q A+ L+ A +LHL IHEW K 
Sbjct  180   VVDAALASKENGLVRVLQMADDLRLKTLKELILILSPIQGAYFLIAAAELHLKIHEWGKN  239

Query  342   RDGAAAGRQFN  310
             RD +   R+ +
Sbjct  240   RDASRKRRRHH  250



>gb|EYU31233.1| hypothetical protein MIMGU_mgv1a023634mg, partial [Erythranthe 
guttata]
Length=216

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 93/169 (55%), Gaps = 10/169 (6%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEEL------SRAVESNLGDDE---LFGVVDRSVKHFEEYQQHRA  880
                 F+ W+ +Q   +EEL       R    +  DD+   L   + R + H+E+Y + ++
Sbjct  13    FHSFFESWLVEQDHYLEELVSASKRRRVHHPSAADDDDTVLRQKIARVIDHYEQYYRAKS  72

Query  879   LLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERK  700
               A+ +  P F +P W ++ E+AF+WIGG RP+++  L+YS  G  L   L   LQG   
Sbjct  73    TCAKTDALPMF-NPPWRSSLEDAFLWIGGWRPTMAFHLLYSKSGLQLQDKLADLLQGLAA  131

Query  699   GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVN  553
             G L D+S  Q+NQIN LQ  TVREE ++S ++A  QE +AD  +  + N
Sbjct  132   GDLADLSPAQVNQINDLQRATVREEKEISEKLAKQQEKVADTSMVELSN  180



>ref|XP_002870028.1| hypothetical protein ARALYDRAFT_492991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46287.1| hypothetical protein ARALYDRAFT_492991 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 83/231 (36%), Positives = 136/231 (59%), Gaps = 16/231 (7%)
 Frame = -1

Query  993  EDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFEN  814
            ED++E     ++N  D ++  +V + V  F+ Y + R+ L+ +     F +PSW +  EN
Sbjct  9    EDLKEALMCQQNN--DHKVEDLVGKIVNDFQTYARKRSELSHRCCANYF-APSWNSPIEN  65

Query  813  AFMWIGGCRPSLSIRLVYSLCGADLDS-------HLQGYLQGERKGSLGDISATQLNQIN  655
            + +W+GGCRPS  IRL+Y+LCG+  ++       H+         G + D++ATQL +IN
Sbjct  66   SMLWMGGCRPSSFIRLIYALCGSQAETLLTQNLLHIDENFDVNHGGFMSDLTATQLEKIN  125

Query  654  ALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRM  475
             L  K +++EDK++   A  Q+D+AD P+A +V      G+++  VE ALD H   M  +
Sbjct  126  ELHMKVIKKEDKITKTSANFQDDVADMPIADVVVH----GDAA--VEDALDKHEEGMAVL  179

Query  474  VVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRDGAAAG  322
            + EADKLR  TL ++++++TP+QAA  LL  K+LH S+H+  + R     G
Sbjct  180  LAEADKLRFETLRKIVEVMTPVQAAEFLLAGKRLHFSLHDRGRARADVCGG  230



>ref|NP_193603.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB37453.1| putative protein [Arabidopsis thaliana]
 emb|CAB78870.1| putative protein [Arabidopsis thaliana]
 dbj|BAH30521.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84075.1| uncharacterized protein AT4G18680 [Arabidopsis thaliana]
Length=235

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 96/170 (56%), Gaps = 15/170 (9%)
 Frame = -1

Query  948  DDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIR  769
            DD+L  +V + V  +  Y   R+ L+ +     F +PSW T  EN+ +W+GGCRPS  IR
Sbjct  22   DDKLEDLVGKIVNDYHTYAGKRSELSYRCCAHYF-APSWNTPIENSMLWMGGCRPSSFIR  80

Query  768  LVYSLCGADLDSHLQGYLQG-------ERKGSLGDISATQLNQINALQSKTVREEDKLSS  610
            L+Y+LCG+  ++ L  YL            G + D++ATQL ++N L  + +++EDK++ 
Sbjct  81   LIYALCGSQAETQLSQYLLKIDDDFDINHGGFMSDLTATQLGKLNDLHLEVIKKEDKITK  140

Query  609  RIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEAD  460
              A  Q+D+AD P+A +V+       +   VE ALD H   M  ++ EAD
Sbjct  141  TSANFQDDVADLPIADVVH-------ADVAVEDALDKHEEGMAVLLAEAD  183



>ref|XP_010441664.1| PREDICTED: uncharacterized protein LOC104724815 [Camelina sativa]
Length=279

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 95/253 (38%), Positives = 147/253 (58%), Gaps = 17/253 (7%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNL------GDDELFGVVDRSVKHFE  901
             SSS  ++  +  C  Q W+  Q + + EL + +           D +L  + +  +  F+
Sbjct  3     SSSKNIEQVQEICYLQ-WMGLQSQRIPELKQLLAKRQSHGDKDNDKKLRELTEMIIGDFK  61

Query  900   EYQQHRALLAQQN-GGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQ  724
             +Y   RA LA ++     + +PSW T  ENA +W+GGCRPS   RLVY+LCG+  +  + 
Sbjct  62    DYAGKRANLAHRHRCSSNYYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVT  121

Query  723   GYLQG---------ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP  571
              +L+              SL D+SA QL +IN L  K + EE+K++ +I++LQED AD P
Sbjct  122   QFLRNIDGYDSSGGGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKISSLQEDAADIP  181

Query  570   LAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahll  391
             +A +  + + VGE +  V++ALD    AM  ++ EAD LR+ TL ++++IL+P+QAA  L
Sbjct  182   IATVAYEMEHVGEPNMVVDQALDKQEEAMAALLAEADTLRVDTLAKIVEILSPVQAADFL  241

Query  390   lvakklhLSIHEW  352
             L  KKLHLS+HEW
Sbjct  242   LAGKKLHLSMHEW  254



>ref|XP_006380400.1| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
 gb|ERP58197.1| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
Length=277

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 86/262 (33%), Positives = 147/262 (56%), Gaps = 16/262 (6%)
 Frame = -1

Query  1071  IEMSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDE---------LFGVVDR  919
             +  S++S+      R  F+ W+A+Q   +E+L  + +    + +         L  +++R
Sbjct  12    VSTSTNSSPSRETFRKFFECWLAEQNNYLEQLISSCKDYDHNKKNSPQSSQATLQPLINR  71

Query  918   SVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADL  739
              ++H+E Y + ++  A+ +     LSPSW +T E+AF+WIGG RPS++  L+YS  G  L
Sbjct  72    VLEHYEYYYRAKSRWAKDDV-LSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQL  130

Query  738   DSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMI  559
             ++ L   + G   G LGD+S +QL +++ LQ KT+REE++L+ +    QE +AD  +  +
Sbjct  131   EAQLHELICGLGTGDLGDLSGSQLTRVDQLQRKTIREENELTEKHVKHQETVADSSMVEL  190

Query  558   VN------KSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaah  397
              +      +S+  G     VE  L      +  ++  AD LR+RT+  ++ ILTP+QA H
Sbjct  191   AHEVTELLRSENTGTDEERVESTLAPRKDGLQEILQMADDLRVRTIKGVIDILTPIQAVH  250

Query  396   lllvakklhLSIHEWSKKRDGA  331
              L+ A +LHL +H+W KK D A
Sbjct  251   FLIAAAELHLRLHDWGKKGDWA  272



>gb|AIN76390.1| DOG1 [Sisymbrium officinale]
Length=280

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 91/246 (37%), Positives = 147/246 (60%), Gaps = 19/246 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVE----------SNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             +  W++ Q + + EL +A+           ++  D++L  ++ + +  F++Y   R+ L+
Sbjct  16    YVKWMSLQSQRIPELKQALAQRRSHEGTAAASADDNKLRDLIQKIIGDFKDYAGKRSDLS  75

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQG------  709
              +     + +PSW T  ENA +W+GGCRPS   RLVY+LCG+  +  +  +L+       
Sbjct  76    TRCSSS-YYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRNIDGYDS  134

Query  708   --ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
                   SL DI+A QL +IN L  K + EE+K++ ++++LQED AD P++ +    + VG
Sbjct  135   SGSGGVSLSDITAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADIPISTVAYAEEHVG  194

Query  534   ESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHE  355
             E +  V++ALD    AM  ++ EAD LR+ TL+++++ILTPLQAA  LL  KKLHLS+HE
Sbjct  195   EPNVAVDQALDKQEEAMAALLAEADNLRVDTLSKIIEILTPLQAADFLLAGKKLHLSMHE  254

Query  354   WSKKRD  337
             W   RD
Sbjct  255   WGVLRD  260



>ref|XP_002310543.2| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
 gb|EEE90993.2| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
Length=269

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 146/256 (57%), Gaps = 12/256 (5%)
 Frame = -1

Query  1071  IEMSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDE---------LFGVVDR  919
             +  S++S+      R  F+ W+A+Q   +E+L  + +    + +         L  +++R
Sbjct  12    VSTSTNSSPSRETFRKFFECWLAEQNNYLEQLISSCKDYDHNKKNSPQSSQATLQPLINR  71

Query  918   SVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADL  739
              ++H+E Y + ++  A+ +     LSPSW +T E+AF+WIGG RPS++  L+YS  G  L
Sbjct  72    VLEHYEYYYRAKSRWAKDDV-LSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQL  130

Query  738   DSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMI  559
             ++ L   + G   G LGD+S +QL +++ LQ KT+REE++L+ +    QE +AD  +  +
Sbjct  131   EAQLHELICGLGTGDLGDLSGSQLTRVDQLQRKTIREENELTEKHVKHQETVADSSMVEL  190

Query  558   VNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvak  379
              +++   G     VE  L      +  ++  AD LR+RT+  ++ ILTP+QA H L+ A 
Sbjct  191   AHEN--TGTDEERVESTLAPRKDGLQEILQMADDLRVRTIKGVIDILTPIQAVHFLIAAA  248

Query  378   klhLSIHEWSKKRDGA  331
             +LHL +H+W KK D A
Sbjct  249   ELHLRLHDWGKKGDWA  264



>ref|XP_004972183.1| PREDICTED: transcription factor HBP-1b(c38)-like [Setaria italica]
Length=291

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 141/270 (52%), Gaps = 33/270 (12%)
 Frame = -1

Query  1047  VDHRRLRCVFQDWIA-QQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             +D  R    ++ WIA Q+    E  +    +   D EL  VV+R ++ +++Y   R  ++
Sbjct  1     MDMERGAACYRQWIAGQEAGLAELEAALANAGATDAELRAVVERCMRGYQDYVAGRRAVS  60

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERK---  700
               +G   F++P WCT FE + +W+GGCRP+++IRL+Y+L G  L++ L+  + G      
Sbjct  61    PHDGTA-FIAPPWCTAFERSVLWLGGCRPTVAIRLLYNLSGEGLEAQLEELINGLGPMGP  119

Query  699   ---GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGES  529
                GS+G I+  Q+  +  L  +T+ +E+ LS R+ATL ED+AD+PL  IV +       
Sbjct  120   LPVGSMG-ITPGQMVLVTDLHRRTLLQENVLSDRLATLHEDIADQPLFPIVRQRAAPAAQ  178

Query  528   S-----------------------SDVERALDNHAVAMGRMVVEA-Dklrlrtltellki  421
                                     ++V+ A +++  AM ++V EA D           +I
Sbjct  179   PRAGGGDCDGPVGPPGGAGRGAVDAEVDAAFNSYRAAMAQLVAEADDLRMATARAMATEI  238

Query  420   lTPlqaahlllvakklhLSIHEWSKKRDGA  331
             LTP QA  +L  AK+LHLS+ +WS + +GA
Sbjct  239   LTPRQAVEMLAAAKQLHLSVRDWSCRAEGA  268



>ref|XP_006345765.1| PREDICTED: transcription factor TGA1-like [Solanum tuberosum]
Length=285

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/251 (34%), Positives = 147/251 (59%), Gaps = 15/251 (6%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDE------LFGVVDRSVKHFEEYQQHRALLAQQNG  859
             F+ W+ +Q +D+++L RA + +  +++      L  ++   VKH+EEY + ++  A  + 
Sbjct  19    FESWLVKQNQDLDQLVRASKDDDNNNKNNNDMMLSSLIHSVVKHYEEYYREKSRYAISDI  78

Query  858   GPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDIS  679
                 L PSW +  E+AF+WIGG RPS++  L+YS  G  L+++L   ++G     LG++S
Sbjct  79    -LGMLHPSWLSNLEDAFLWIGGWRPSMAFHLLYSKSGIQLEANLHELIRGFNTKDLGNLS  137

Query  678   ATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP---LAMIVNKSKK-----VGESSS  523
               QL  I+ LQ KT+ EE KLS  +A +QE +AD     L+ +V++  +     V +   
Sbjct  138   GNQLVLIDELQHKTISEERKLSENLAKVQETLADASMVELSHVVSELMRDDQLVVNDEEE  197

Query  522   DVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKK  343
              +++ +     ++  ++ +AD LRL T+ E+L+ILT  Q  H L+ A +LHL IHEW KK
Sbjct  198   KIKKNISKKEESLLDLLKKADDLRLSTIKEILRILTSTQGVHFLIAAAELHLRIHEWGKK  257

Query  342   RDGAAAGRQFN  310
             +D A +  +++
Sbjct  258   KDAAVSHHKWS  268



>ref|XP_007214751.1| hypothetical protein PRUPE_ppa024940mg [Prunus persica]
 gb|EMJ15950.1| hypothetical protein PRUPE_ppa024940mg [Prunus persica]
Length=277

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 147/268 (55%), Gaps = 28/268 (10%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEELSRAVESN-LGDDELFG-----------------VVDR  919
             +H      F+ W+++Q + +++L  A E+N    + L+                  +V+R
Sbjct  8     EHESFHNFFECWLSEQNQHLQDLIIASENNQTTRNNLYNGNTTTTAAANTNTSLRTLVER  67

Query  918   SVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADL  739
              VKH+E+Y + ++   +Q+     LSPSW T+ E+AF+WIGG RPS++  L YS  G  L
Sbjct  68    VVKHYEQYYEAKSRWVKQDV-LRMLSPSWTTSLEDAFLWIGGWRPSMAFHLFYSKSGLQL  126

Query  738   DSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMI  559
             ++ L   ++G   G L DIS  QL Q++ LQ +TV+EE  ++ ++A  QE +AD  +  +
Sbjct  127   EARLTELIEGLGTGDLADISQHQLMQVDHLQRRTVKEERDITEKMAKQQESVADTSMVEL  186

Query  558   VNKSKKV--------GESSSD-VERALDNHAVAMGRMVVEADklrlrtltellkilTPlq  406
              + + ++         E+  D VE  + +    +  ++  AD LRL+TL  +  ILTP+Q
Sbjct  187   AHMTTELMSTNGGHEHEAEEDRVECVVASKEQCLEEILQRADSLRLKTLKAITHILTPIQ  246

Query  405   aahlllvakklhLSIHEWSKKRDGAAAG  322
             A H L+ A +LHL +H+W KK D  + G
Sbjct  247   AVHFLIAAAELHLRLHDWGKKEDARSRG  274



>ref|XP_007048544.1| TGACG-sequence-specific DNA-binding protein TGA-2.1, putative 
[Theobroma cacao]
 gb|EOX92701.1| TGACG-sequence-specific DNA-binding protein TGA-2.1, putative 
[Theobroma cacao]
Length=245

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = -1

Query  1056  SSAVDHRRLRCVFQDWIAQQREDMEEL---SRAVESNLGDDELFGVVDRSVKHFEEYQQH  886
             S A +    +  F+ W+ +Q + ++EL   S+   S   DD L  ++ R ++++E Y + 
Sbjct  7     SPAPERETFQNFFECWLVEQNQHLQELIAASQQHHSTADDDSLCSLIKRVLENYEHYYKA  66

Query  885   RALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGE  706
             +A   +++     LSP+W +TF++AF+WIGG RP ++  L+Y   G  L+  L   ++G 
Sbjct  67    KARWGKEDV-LAMLSPAWTSTFKDAFLWIGGWRPIMAFHLLYFKSGLQLEDQLNELIRGM  125

Query  705   RKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMAD  577
              +G LGD+S  QL++I+ LQ+KT++EE +++ ++A  QE +AD
Sbjct  126   GRGDLGDLSPCQLSRIDELQAKTIKEEKEVTEKMAKHQETVAD  168



>ref|XP_009757325.1| PREDICTED: transcription factor TGA5-like [Nicotiana sylvestris]
Length=275

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 89/248 (36%), Positives = 143/248 (58%), Gaps = 20/248 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEEL---SRAV--ESNLGDDE--LFGVVDRSVKHFEEYQQHRALLAQQN  862
             F+ W+A+Q ++++EL   SR V  ++N+  +E  L  +++R ++H+E Y   ++   +++
Sbjct  22    FETWLAEQNQELKELVSASRDVSKDNNIVVEERVLVPLIERVIQHYEGYYGEKSKYTEED  81

Query  861   GGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDI  682
                  L+P+W +  E AF+WIGG RPS++  L+YS  G   +  L   ++G   G LGD+
Sbjct  82    VFG-MLNPTWRSNLEGAFLWIGGWRPSMAFHLLYSKSGLQFEPRLPQLIRGITTGDLGDL  140

Query  681   SATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP----------LAMIVNKSKKVGE  532
             S  Q+++++ LQ KT+REE   S ++A +QE +AD            L MI      + E
Sbjct  141   SPDQISKVDELQKKTIREEKDSSEKLAKVQETVADASMVELSHVVTQLMMISGGGGGILE  200

Query  531   SSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEW  352
                +VE  L      +  ++ +AD LRL TL E+L ILTP QA H L+ A +LHL +HEW
Sbjct  201   --EEVEANLATKEEGLVIILQKADNLRLNTLKEILAILTPTQAIHFLIAAAELHLRLHEW  258

Query  351   SKKRDGAA  328
              KK+D A 
Sbjct  259   GKKKDAAT  266



>ref|XP_011022856.1| PREDICTED: transcription factor TGA2-like [Populus euphratica]
Length=280

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 89/265 (34%), Positives = 151/265 (57%), Gaps = 19/265 (7%)
 Frame = -1

Query  1071  IEMSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDE----------LFGVVD  922
             +  S++ +      R  F+ W+A+Q   +E+L    +    + +          L  +++
Sbjct  12    VSTSTNGSPSRESFRKFFECWLAEQSNYLEQLISTCKDYDHNKKNSPQSSSQAILQPLIN  71

Query  921   RSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGAD  742
             R ++H+E Y + ++  A+ +     LSPSW +T E+AF+WIGG RPS++  L+YS  G  
Sbjct  72    RVLEHYEHYYRAKSRWAKDDV-LSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQ  130

Query  741   LDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAM  562
             L++ L   + G   G LGD+SA+QL +++ LQ KT+REE++L+ + A  QE +AD  +  
Sbjct  131   LEAQLHELICGLGTGDLGDLSASQLTRVDQLQRKTIREENELTEKHAKHQEAVADSSMVE  190

Query  561   IVNKSKKV--GESSSD------VERALDNHAVAMGRMVVEADklrlrtltellkilTPlq  406
             + ++  ++   ES+ D      VE  L      +  ++  AD LRLRT+  +++ILTP+Q
Sbjct  191   LSHEVTELLRSESTGDEVDEERVESTLAPKKDGLQEILQMADDLRLRTIKGVIEILTPMQ  250

Query  405   aahlllvakklhLSIHEWSKKRDGA  331
             A H L+ A +LHL +H+W KK D A
Sbjct  251   AVHFLIAAAELHLRLHDWGKKGDWA  275



>gb|AGG09200.1| delay of germination 1a, partial [Lepidium papillosum]
Length=147

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 82/129 (64%), Gaps = 8/129 (6%)
 Frame = -1

Query  822  FENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ--------GERKGSLGDISATQL  667
             ENA +W+GGCRPS   RLVY+LCG++ +  +  YL+        G    SL D++A QL
Sbjct  2    LENALLWMGGCRPSSFFRLVYALCGSETEIRVTQYLRDIDGLESSGGMGTSLSDLTAEQL  61

Query  666  NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVA  487
             +IN L  K + +E+K++ ++A+LQED AD P+A +  + + VG+ +  V++ALD    +
Sbjct  62   AKINILHVKIIEDEEKMTKKVASLQEDAADIPIATVAYEEEHVGKPNMVVDQALDKQEES  121

Query  486  MGRMVVEAD  460
            M +++ EAD
Sbjct  122  MAKLLGEAD  130



>ref|XP_010920869.1| PREDICTED: transcription factor TGA3-like [Elaeis guineensis]
Length=260

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/242 (34%), Positives = 139/242 (57%), Gaps = 13/242 (5%)
 Frame = -1

Query  1023  VFQDWIAQQREDMEELSRAV---------ESNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             +++ W+A++  D++ L  A          E    D  L   V+R + H E Y + +A  A
Sbjct  12    LYECWLAEKHSDLQALRAAASAPRPKTPEEEAEEDRRLKLPVERVLGHCENYYRAKAACA  71

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSL  691
              ++  P F SP+W ++ EN F+W+GG RPS++  L+YS  G  L++ L   ++G     L
Sbjct  72    TRDVTPMF-SPTWTSSTENLFLWVGGWRPSVAFHLLYSKSGLQLEAQLGEVIRGVPTRDL  130

Query  690   GDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADE---PLAMIVNKSKKVGESSSD  520
              D+S  QL +IN LQ +T+R+E ++S   A  QE +AD     L+ +++++    E++  
Sbjct  131   ADLSLEQLQRINELQCRTIRKEKEISEEEARTQEGVADTQMVELSHVLSETGGTAEAAEM  190

Query  519   VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKR  340
             +E A+      MGR++ +AD+LRL TL  +++IL P+QA H L+ A +L L +HE+  K+
Sbjct  191   METAMQEKREGMGRVLEKADELRLETLKGVVEILRPMQAVHFLIAAAELQLWLHEYGTKK  250

Query  339   DG  334
             D 
Sbjct  251   DA  252



>gb|EYU23363.1| hypothetical protein MIMGU_mgv1a023034mg [Erythranthe guttata]
Length=292

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 88/261 (34%), Positives = 142/261 (54%), Gaps = 19/261 (7%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEELSRAVESNL-----------GDDELFGVVDRSVKHFEE  898
             +H      F  WI +Q   +++L  A +              G   L  VV++ V H+E 
Sbjct  21    EHVSFHMFFDSWIVEQNHHLQKLVSASKEWGGGGGGVAFDVSGRSVLIPVVEQVVHHYEH  80

Query  897   YQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQG-  721
             Y + +++ A+++    F SP+W  + E AFMW+GG RP+ +I L+YS CG  L++  +G 
Sbjct  81    YYKTKSMWAKKDILSMF-SPTWTHSLEKAFMWVGGWRPATAIHLLYSKCGLQLEAAFEGD  139

Query  720   YL-QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSK  544
             YL +G   G LGD+S +Q+ +++ L   T+ EE  ++ ++A  QE +AD  +  +  +  
Sbjct  140   YLPRGLNTGDLGDLSHSQMVRVDELHKSTLWEEKMITEKLAKQQETIADSSMVGLTTELM  199

Query  543   -KVGESSSD----VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvak  379
              +V E   D    V+ AL +    +  ++  AD LRL+TL  L+ ILTP+Q  H L+ A 
Sbjct  200   IRVEEHDHDQQVVVDAALASKEKGLVVILQMADDLRLKTLKGLILILTPIQGVHFLIAAA  259

Query  378   klhLSIHEWSKKRDGAAAGRQ  316
             +LHL IHEW K RD +   R+
Sbjct  260   ELHLKIHEWGKNRDASRNHRR  280



>gb|ABK81212.1| DOG1 mutant [Arabidopsis thaliana]
Length=193

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 101/185 (55%), Gaps = 19/185 (10%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAV--------ESNLGDDELFGVVDRSVK  910
             M SSS    +   C + +W++ Q + + EL + +        E N  D++L  +  + + 
Sbjct  1     MGSSSKNTEQAQECCYLEWMSLQSQRIPELKQLLAQRRSHGDEDN--DNKLRELTGKIIG  58

Query  909   HFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSH  730
              F+ Y   RA LA +     + +P+W +  ENA +W+GGCRPS   RLVY+LCG+  +  
Sbjct  59    DFKNYAAKRADLAHR-CSSNYYAPTWNSPLENALIWMGGCRPSSFFRLVYALCGSQTEIR  117

Query  729   LQGYLQG--------ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADE  574
             +  +L+             SL D+SA QL +IN L  K + EE+K++ ++++LQED AD 
Sbjct  118   VTQFLRNIDGYESSGGGGASLSDLSAEQLAKINVLHVKIIDEEEKMTKKVSSLQEDAADI  177

Query  573   PLAMI  559
             P+A +
Sbjct  178   PIATV  182



>ref|XP_002528014.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34370.1| conserved hypothetical protein [Ricinus communis]
Length=271

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 98/178 (55%), Gaps = 6/178 (3%)
 Frame = -1

Query  1056  SSAVDHRRLRCVFQDWIAQQREDMEELSRA-----VESNLGDDELFGVVDRSVKHFEEYQ  892
             S++  H      F+ W+ +Q+++++EL  A        N   D L  +++R ++H+E+Y 
Sbjct  14    STSSSHNSFHDFFEWWLVEQKQELDELISASKQKLNNKNNNHDSLQPLINRVLEHYEQYY  73

Query  891   QHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ  712
               ++  A+ +    F SPSW +  E+AF+WIGG RPS++  L+YS  G  L++ L   ++
Sbjct  74    SAKSKWAKHDVLAMF-SPSWTSPLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAQLHDVIR  132

Query  711   GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKV  538
             G   G LGD+S  QL Q++  Q + +REE  ++  +A  Q  +AD  +  + +   K 
Sbjct  133   GLCTGDLGDLSPNQLVQVDEFQRRIIREEKNITENMAKHQATVADTSMVELTHAISKT  190



>ref|XP_008337157.1| PREDICTED: transcription factor HBP-1b(c38)-like [Malus domestica]
Length=284

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 140/268 (52%), Gaps = 35/268 (13%)
 Frame = -1

Query  1041  HRRLRCVFQDWIAQQREDMEELSRAVESNL---------------GDDELFGVVDRSVKH  907
             HR   C    W+A+Q + + +L  A ++N                    L  +V+R VKH
Sbjct  15    HRFFEC----WLAEQNQHLHDLITAAKNNTTSAATNPTTTAXINTSSRSLGTLVERVVKH  70

Query  906   FEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLD---  736
             +E Y + ++   +Q+     LSPSW ++ E+AF+WIGG RPS++  L +S  G  L+   
Sbjct  71    YEHYYEVKSRWVKQDV-LGMLSPSWLSSLEDAFLWIGGWRPSMAFHLFHSKSGLQLEVRV  129

Query  735   -SHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP---L  568
                ++G+     KG L D+S+ QL Q++ +Q +TV+EE  +S ++A  QE +AD     L
Sbjct  130   AEFIRGFCSSGSKGDLADLSSHQLTQVDQMQQRTVKEERDISEKMAKRQEAVADSSLVGL  189

Query  567   AMIVNKSKKVGESSSD--------VERALDNHAVAMGRMVVEADklrlrtltellkilTP  412
             + ++ +    G    D        VE AL +    +  ++  AD LRL TL  +  ILTP
Sbjct  190   SHVITELMDAGNGXDDPVAEEDPRVEYALASKEEGLEEVLHRADNLRLXTLKAITHILTP  249

Query  411   lqaahlllvakklhLSIHEWSKKRDGAA  328
             +QA H L+ A +LHL +H+W KK+D   
Sbjct  250   IQAVHFLIAAAELHLRLHDWGKKKDATT  277



>dbj|BAA05470.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=287

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 98/155 (63%), Gaps = 8/155 (5%)
 Frame = -1

Query  1020  FQDWIAQQREDMEEL---SRAV---ESNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQQN  862
             F+ W+A+Q+++++EL   SR V    +N+ ++  L  ++ R ++H+E Y + ++   +++
Sbjct  22    FETWLAEQKQELKELVSASRDVSKGNNNVVEERVLVPLIKRVIQHYEGYYEEKSKYTEED  81

Query  861   GGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDI  682
                  L+P+W +  E AF+WIGG RPS++  L+YS  G   ++ L   ++G   G LG +
Sbjct  82    VFG-MLNPTWRSNLEGAFLWIGGWRPSMAFHLLYSKSGLQFEARLPQLIRGITTGDLGYL  140

Query  681   SATQLNQINALQSKTVREEDKLSSRIATLQEDMAD  577
             S  Q+++++ LQ KT+REE K S ++A +QE +AD
Sbjct  141   SPDQIDKVDELQKKTIREEKKSSEKLARVQETVAD  175



>ref|XP_010025725.1| PREDICTED: transcription factor TGA2-like [Eucalyptus grandis]
 gb|KCW62438.1| hypothetical protein EUGRSUZ_H05080 [Eucalyptus grandis]
Length=285

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 92/264 (35%), Positives = 146/264 (55%), Gaps = 16/264 (6%)
 Frame = -1

Query  1071  IEMSSSSAVDHRRLRCVFQDWIAQQREDMEEL-SRAVESNLGDDE-LFGVVDRSVKHFEE  898
             I  + S A +       F+ W+ +Q + + +L S +  +  GDD+ L  ++DR + H+E+
Sbjct  11    IRRNGSFAPERESFHKFFECWLVEQNQHLHDLISASSPARDGDDQALRPLIDRVMLHYEQ  70

Query  897   YQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGY  718
             Y + ++  A+QN    F SP+W ++FE+AF+WIGG RPS++  L+YS  G  L++ L   
Sbjct  71    YYKAKSRSAKQNVLAMF-SPTWRSSFEDAFLWIGGWRPSMAFHLLYSKSGLQLEAQLAEL  129

Query  717   LQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP---LAMIVNKS  547
             ++G     L D+S +QL  I+  Q  T+ +E  ++ + A  QE +AD     L+  + + 
Sbjct  130   IRGLATSDLADLSPSQLALIDDRQRTTIHQEKAITEKFAKHQETVADASMVELSHTITEM  189

Query  546   KKVGESSS----------DVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaah  397
              + G   +          +VE AL      +  M+  AD LRL TL E+L ILT +QA H
Sbjct  190   MRAGGGDAAVENEAAMEEEVESALAAKEEGLEEMLQMADDLRLSTLKEILNILTSMQAVH  249

Query  396   lllvakklhLSIHEWSKKRDGAAA  325
              L+ A +LHL IHEW KK+D A A
Sbjct  250   FLIAAAELHLRIHEWGKKKDEAQA  273



>ref|XP_008442174.1| PREDICTED: transcription factor TGA2-like isoform X1 [Cucumis 
melo]
Length=281

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 100/182 (55%), Gaps = 5/182 (3%)
 Frame = -1

Query  1053  SAVDHRRLRCVFQDWIAQQREDMEELSRAVES-----NLGDDELFGVVDRSVKHFEEYQQ  889
             + +D       F+ W+ +Q + + EL   V+      N GD     ++ R ++H+E Y +
Sbjct  19    TNMDQESFGEFFKKWMKEQNQYLTELISTVKGGGNKDNDGDIVAEALMKRVMEHYEHYYR  78

Query  888   HRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQG  709
              ++   +++     LSPSW ++FE+AF+W+GG RP+++  L+YS  G  L+  L   + G
Sbjct  79    VKSHWVEKDALAGILSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHG  138

Query  708   ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGES  529
                G L D+S+ Q+ +I+ LQ   V++E +++ ++A  QE +AD  +  + + + K    
Sbjct  139   LSTGDLADLSSHQVVKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKME  198

Query  528   SS  523
             +S
Sbjct  199   TS  200



>emb|CDX76507.1| BnaA08g08930D [Brassica napus]
Length=239

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 103/191 (54%), Gaps = 19/191 (10%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAV---ESN-LGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGP  853
             + +W++ Q + + +L  A+    SN     +L  +V + V  F+ Y + R+ L  ++   
Sbjct  19    YYEWMSLQAKHIVDLKEALMRQRSNAYNHHKLEELVGKIVNDFQSYAKRRSELTDKSCSS  78

Query  852   PFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISAT  673
              F +PSW ++ EN  +W+GGCRPS  I           D ++     G+   S+ D++AT
Sbjct  79    YF-APSWNSSLENGLLWMGGCRPSSFI-----------DENIHDGHDGD--SSMSDLTAT  124

Query  672   QLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHA  493
             QL +IN L  K +REEDKL+ + A  QED+AD P+A+       V E+   VE ALD H 
Sbjct  125   QLEKINDLHVKVIREEDKLTKKYANFQEDVADMPIAVTAFWRDSV-EADVAVEDALDKHE  183

Query  492   VAMGRMVVEAD  460
               MG ++ EAD
Sbjct  184   ECMGVLMAEAD  194



>ref|XP_011097086.1| PREDICTED: transcription factor TGA2-like [Sesamum indicum]
Length=300

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 91/271 (34%), Positives = 140/271 (52%), Gaps = 34/271 (13%)
 Frame = -1

Query  1056  SSAVDHRRLRCVFQDWIAQQREDMEELSRAVESN-----LGDDELFGVVDRSV-------  913
             S A ++      F+ W+++Q   +EEL  A + +      G D+   V  + V       
Sbjct  17    SEAEEYETFHEFFECWLSEQSRHLEELVLASKESERLQEQGHDDHRPVTQQEVDERILRP  76

Query  912   ------KHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
                   +H+E+Y   ++L A+ N      + SW ++ E+AF+WIGG RPS++  L+YS  
Sbjct  77    KIAEVIEHYEQYYHVKSLWAE-NDVLLMFNQSWRSSLEDAFLWIGGWRPSIAFHLLYSKS  135

Query  750   GADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP  571
             G  L++ L    QG     LG +S TQLNQ+N LQ  T+REE +++ ++A  QE +AD  
Sbjct  136   GLQLEARLDELRQGLTVNDLGGLSYTQLNQVNELQRGTIREEKEITEKLAKQQEKVAD--  193

Query  570   LAMIVNKSKKVGESSSD------------VERALDNHAVAMGRMVVEADklrlrtltell  427
              +++V  S  V ES  +            +E  L         ++  AD LRL+TL EL+
Sbjct  194   -SLMVELSHAVTESIREGNQAGPIVADERIEATLAVKEEGFTEIIKRADDLRLKTLRELI  252

Query  426   kilTPlqaahlllvakklhLSIHEWSKKRDG  334
               LTP Q  H L+ A +LH+ +HEW KKRD 
Sbjct  253   NTLTPSQGVHFLIAAAELHMRLHEWGKKRDA  283



>gb|EYU23360.1| hypothetical protein MIMGU_mgv1a019261mg [Erythranthe guttata]
Length=289

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 85/255 (33%), Positives = 136/255 (53%), Gaps = 21/255 (8%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELF--GVVDRSVKHFEEYQQHRALLA  871
             +H      F  W+ +Q   ++EL  A +   G   L    VV++ V H+E Y + +++ A
Sbjct  23    EHVSFHMFFDSWMVEQNYQLQELVSATKEWGGGSVLLIPDVVEQVVHHYEHYYKTKSMWA  82

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADL------DSHLQGYLQG  709
             +++    F SP+W  + E AFMW GG RP+ +  L+YS CG  L      D HL     G
Sbjct  83    KKDILSMF-SPTWTHSLEKAFMWAGGWRPATTFHLLYSKCGLQLEAAFEDDYHLPS---G  138

Query  708   ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSK-----  544
                G LGD+S +Q+ +++ L  +T+ EE  ++ ++A  QE +AD  +  + +        
Sbjct  139   LNTGDLGDLSHSQMVRVDELHKRTLWEEKMITEKLAKKQETIADSSMVGLTHSVATELMI  198

Query  543   KVGESSSD----VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakk  376
             +V E   D    V+ AL +    +  ++  AD LRL+TL +L+ IL+P+Q  H L+ A +
Sbjct  199   RVEEHDHDQQVVVDAALASKEKGLVVILQMADDLRLKTLKQLILILSPIQGVHFLIAAAE  258

Query  375   lhLSIHEWSKKRDGA  331
             LHL IHEW K RD +
Sbjct  259   LHLKIHEWGKNRDAS  273



>ref|XP_009379553.1| PREDICTED: transcription factor TGA6-like [Pyrus x bretschneideri]
Length=285

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 129/215 (60%), Gaps = 15/215 (7%)
 Frame = -1

Query  930  VVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
            +V+R VKH+E Y + ++  A+Q+     LSPSW ++ E+AF+WIGG RPS++  L +S  
Sbjct  65   LVERVVKHYEHYYEVKSRWAKQDV-LGMLSPSWLSSLEDAFLWIGGWRPSMAFHLFHSKS  123

Query  750  GADLDSHLQGYLQG----ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDM  583
            G  L++ +  +++G      KG+L D+S+ QL Q++ +Q +TV+EE  +S ++A  QE +
Sbjct  124  GLQLEARVSEFIRGFCSSSSKGNLADLSSHQLTQMDQMQQRTVKEERDISEKMAKRQEAV  183

Query  582  ADEP---LAMIVNKSKKVG-------ESSSDVERALDNHAVAMGRMVVEADklrlrtlte  433
            AD     L+ ++ +    G       E    VE AL +    +  ++  AD LRLRTL  
Sbjct  184  ADSSMVNLSHVITELMNAGSGDDPVAEEDPRVESALASKEQGLEEILHRADNLRLRTLKS  243

Query  432  llkilTPlqaahlllvakklhLSIHEWSKKRDGAA  328
            +  ILTP+QA H L+ A +LHL +H+W K++D  +
Sbjct  244  VTHILTPIQAVHFLIAAAELHLRVHDWGKEKDATS  278



>gb|EYU20609.1| hypothetical protein MIMGU_mgv1a010868mg [Erythranthe guttata]
Length=299

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/252 (33%), Positives = 139/252 (55%), Gaps = 24/252 (10%)
 Frame = -1

Query  1020  FQDWIAQQREDMEEL---SRAVE----------SNLGDDELFGVVDRSVKHFEEYQQHRA  880
             F+ WI +Q   + EL   S+ +E          + L    L  +++R V+H+E Y + ++
Sbjct  29    FECWIVEQDHHLHELVSASKDIEDRHQHHGGATAELNGRVLRPLLERVVQHYEHYYRAKS  88

Query  879   LLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSH-LQGYLQGER  703
               A+ N      +PSW ++ E+AF+WIGG RPS++  L+YS  G  L++  +   + G  
Sbjct  89    RWAK-NDVLSMFNPSWRSSLEDAFLWIGGWRPSMAFHLLYSKSGLQLEARAIDDLILGLT  147

Query  702   KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVN---------K  550
              G L D+S  QL +++ALQ  T+REE +++ ++A LQE +AD  +  + +          
Sbjct  148   NGDLSDLSTGQLGRVDALQKVTLREEKEITEKLAKLQETVADSSMVELSHAVSELIQEEA  207

Query  549   SKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklh  370
               +V E    VE AL      +  ++ +AD+LR++TL  ++ IL+P Q  H L+ A +LH
Sbjct  208   GDRVAEQEGRVEAALAPKEEGLVGVLEKADELRMKTLKGVIDILSPTQGVHFLIAAAELH  267

Query  369   LSIHEWSKKRDG  334
             L +H+W KKRD 
Sbjct  268   LRVHDWGKKRDA  279



>ref|XP_010674364.1| PREDICTED: transcription factor TGA6-like [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 89/257 (35%), Positives = 138/257 (54%), Gaps = 23/257 (9%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRA----VESNLGDDE----LFGVVDRSVKHFEEYQQHRALLAQQ  865
             F+ W+ +Q  D+EEL  A     ES   D E    L  +V+R + H+E Y + ++  A  
Sbjct  30    FETWLLEQEHDLEELKAAATCYTESTQSDTEWNQQLTSLVNRVMCHYENYYRVKSESADH  89

Query  864   NGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGD  685
             +     LSPSW +  E AF+W+GG RPS +  L+YS+ G  L++     L+G   G+L D
Sbjct  90    DV-LTMLSPSWRSNLEEAFLWVGGWRPSTAFHLLYSVTGLQLEAGFHELLRGLGSGNLAD  148

Query  684   ISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKK------------  541
             +S  QL +++ LQ +TV EE +L+   A +QE +AD  +  + + + +            
Sbjct  149   LSPDQLVRVDELQRQTVWEERELTENFAAIQETVADSTMVELSHVATELIRDPNSVTTGP  208

Query  540   VGESSSD--VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhL  367
             VG  S +  VE  +      +  ++  AD LRLRTL  +L ILTP+QA   L+ A +LHL
Sbjct  209   VGPESVNERVESTIGTKENKLKEILGRADDLRLRTLKNVLDILTPIQAVDFLIAAAELHL  268

Query  366   SIHEWSKKRDGAAAGRQ  316
              +H+W  K+D  A  +Q
Sbjct  269   RVHQWGVKKDEGANNQQ  285



>gb|KFK28538.1| hypothetical protein AALP_AA7G009900 [Arabis alpina]
Length=185

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 110/160 (69%), Gaps = 6/160 (4%)
 Frame = -1

Query  801  IGGCRPSLSIRLVYSLCGADLDSHLQGYLQ---GERK--GSLGDISATQLNQINALQSKT  637
            +GGCRPS  IR++Y+LCG+ +++ +  YL    G  K  G + +++ATQL +IN L  K 
Sbjct  1    MGGCRPSSFIRVIYALCGSQIETQISQYLHKIDGNEKVDGLMSELTATQLAKINELHIKV  60

Query  636  VREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADk  457
            + +EDK+S + A++QED+AD P+A +   +K + E+   VE ALD H   M  ++ EADK
Sbjct  61   IEKEDKISKKSASMQEDVADMPIA-VTAYAKDLVEAGVVVEDALDKHEEGMAVLMEEADK  119

Query  456  lrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
            LR+ TL ++++++TP+QAA  LL  K+LH+S+HEW + R+
Sbjct  120  LRVETLRKIVEVVTPVQAAEFLLAGKRLHVSLHEWGRVRE  159



>ref|XP_006432080.1| hypothetical protein CICLE_v10002078mg [Citrus clementina]
 ref|XP_006464938.1| PREDICTED: transcription factor TGA2-like [Citrus sinensis]
 gb|ESR45320.1| hypothetical protein CICLE_v10002078mg [Citrus clementina]
 gb|KDO52212.1| hypothetical protein CISIN_1g023115mg [Citrus sinensis]
Length=287

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 136/252 (54%), Gaps = 16/252 (6%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEEL---SRAVESNLGDDELFGVVDRSVKHFEEYQQHRALL  874
             D    +  F+ W+ +Q + ++ L   S+  E+N         V   V+H+E+Y + ++  
Sbjct  27    DGESFQKFFESWLVEQNQHLQALISASKQQENNSSSSNFEEQVRVVVEHYEQYYRAKSRW  86

Query  873   AQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGS  694
              + +     L+PSW ++ E++F+WIGG RPS++  L+YS  G  L+  L   ++G   G 
Sbjct  87    VKLDV-LGMLTPSWRSSLEDSFLWIGGWRPSMAFHLLYSKSGLQLEGKLHDLIRGLSSGD  145

Query  693   LGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP---LAMIVNKSKKVGESSS  523
             LGD+S TQL +++ LQ   ++EE  LS ++A  QE +AD     L+ +V +     +   
Sbjct  146   LGDLSPTQLTRVDGLQRVIIKEEKDLSEKLAKYQETVADSSLVELSHVVTELMSTNDDRQ  205

Query  522   DVERALDNHAVAMGRMVVE---------ADklrlrtltellkilTPlqaahlllvakklh  370
             D +R L +  +    +  E         AD LRL+T   ++ ILTP+QA H L+ A +LH
Sbjct  206   DSDRRLMDDQIESNFVTKEAKLEEIFHKADDLRLKTFKAVIDILTPIQAVHFLIAAAELH  265

Query  369   LSIHEWSKKRDG  334
             L +H+W K+RD 
Sbjct  266   LRLHDWGKQRDA  277



>ref|XP_008442175.1| PREDICTED: transcription factor TGA2-like isoform X2 [Cucumis 
melo]
Length=280

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 100/182 (55%), Gaps = 6/182 (3%)
 Frame = -1

Query  1053  SAVDHRRLRCVFQDWIAQQREDMEELSRAVES-----NLGDDELFGVVDRSVKHFEEYQQ  889
             + +D       F+ W+ +Q + + EL   V+      N GD     ++ R ++H+E Y +
Sbjct  19    TNMDQESFGEFFKKWMKEQNQYLTELISTVKGGGNKDNDGDIVAEALMKRVMEHYEHYYR  78

Query  888   HRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQG  709
              ++   +++     LSPSW ++FE+AF+W+GG RP+++  L+YS  G  L+  L   + G
Sbjct  79    VKSHWVEKDA-LGILSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHG  137

Query  708   ERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGES  529
                G L D+S+ Q+ +I+ LQ   V++E +++ ++A  QE +AD  +  + + + K    
Sbjct  138   LSTGDLADLSSHQVVKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKME  197

Query  528   SS  523
             +S
Sbjct  198   TS  199



>gb|AGG09201.1| delay of germination 1c, partial [Lepidium papillosum]
Length=128

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 70/114 (61%), Gaps = 9/114 (8%)
 Frame = -1

Query  849  FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ---------GERKG  697
            + +PSW T  ENA +W+GGCRPS   RLVY+LCG+  +  +  +L+         G    
Sbjct  9    YYAPSWNTPLENALIWMGGCRPSSFFRLVYALCGSQTEIRVTQFLRDIDGLDSSDGVDGT  68

Query  696  SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
            SL D++A QL +IN L    + +E+K++ ++A+LQED AD P+A +  +  ++G
Sbjct  69   SLSDLTAEQLAKINVLHVNVIDDEEKMTKKVASLQEDAADIPIATVAYEEDQLG  122



>ref|XP_007159877.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
 gb|ESW31871.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
Length=201

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 118/200 (59%), Gaps = 18/200 (9%)
 Frame = -1

Query  849  FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQ  670
             LSP+W ++ E+AF+WIGG RPS++  L+YS  G   ++ LQ  +QG R   LGD+SA+Q
Sbjct  1    MLSPTWTSSLEDAFLWIGGWRPSMAFHLLYSKSGLQFEARLQELVQGLRTHDLGDLSASQ  60

Query  669  LNQINALQSKTVREEDKLSSRIATLQEDMADEPLA--------MI-VNKSKKVGESSS--  523
            ++Q++ +Q + + EE +++  +A  QE +AD  +         MI  N+  +V ES    
Sbjct  61   ISQLDEMQKRVILEERQITDLMAGHQETVADASMVELSHVASEMIRANERGEVEESKEFE  120

Query  522  -DVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSK  346
              VE  L      + +++ +AD+LRL TL  ++ +LTP QA H L+ A +LHL +HEW K
Sbjct  121  DKVESTLVQKEEGLEKILQKADELRLGTLKAIVNVLTPKQAIHFLIAAAELHLRLHEWGK  180

Query  345  KRD------GAAAGRQFNTT  304
            K D      G   G+ +N++
Sbjct  181  KIDARKENHGTGEGKNYNSS  200



>ref|XP_008793320.1| PREDICTED: transcription factor HBP-1b(c38)-like [Phoenix dactylifera]
Length=274

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 110/200 (55%), Gaps = 13/200 (7%)
 Frame = -1

Query  1023  VFQDWIAQQREDMEELSRAVESNLGDD---------ELFGVVDRSVKHFEEYQQHRALLA  871
             +F+ W+A+++  ++ L  A  +   +           L  +V R + H E Y + +A  A
Sbjct  26    LFECWLAERKLHLQALRAAASAPRPETPDEEAEEERRLTLLVRRVLGHCEYYYRAKAASA  85

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSL  691
             +++  P F SP+W ++ EN F+W+GG RPS++  L+YS  G  L+S L   ++G     L
Sbjct  86    KRDVTPMF-SPTWTSSSENLFLWVGGWRPSVAFHLIYSKSGIQLESQLAEVIRGASTRDL  144

Query  690   GDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAM---IVNKSKKVGESSSD  520
              D+S  QL +I+ LQ +T+R E ++S   A  QE +AD+ + +   ++ +  + G+++  
Sbjct  145   ADLSQGQLKRIDELQRRTIRIEKEISEEEARTQEGVADKQMVLLSHVLREMGRDGKAAEM  204

Query  519   VERALDNHAVAMGRMVVEAD  460
             +E A+ +    M R++  AD
Sbjct  205   MEPAMQDKRAGMERVLERAD  224



>ref|XP_004156023.1| PREDICTED: transcription factor TGA6-like [Cucumis sativus]
 gb|KGN54766.1| hypothetical protein Csa_4G463190 [Cucumis sativus]
Length=255

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 97/168 (58%), Gaps = 6/168 (4%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFG--VVDRSVKHFEEYQQHRALLAQQNGGPPF  847
             FQ W+ +Q + + EL   + +  G + +    ++ R ++H+E Y + ++   +++     
Sbjct  11    FQKWMKEQNQYLTEL---ISTAKGGNNMVAEALMKRVMEHYEHYYKVKSRWVEKDT-LGI  66

Query  846   LSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQL  667
             LSPSW ++FE+AF+W+GG RP+++  L+YS  G  L+  L   + G   G L D+S+ Q+
Sbjct  67    LSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHGLSTGDLADLSSHQV  126

Query  666   NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSS  523
              +I+ LQ   V++E +++ ++A  QE +AD  +  + + + K    +S
Sbjct  127   IKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKMGTS  174



>ref|XP_006643777.1| PREDICTED: transcription factor TGA6-like [Oryza brachyantha]
Length=266

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 104/191 (54%), Gaps = 8/191 (4%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLG--DDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPF  847
             F+ WI++Q  D+  L  A  ++    D +L G+VDR + H+E Y + ++  A  N     
Sbjct  27    FECWISEQSRDLAALRSAASASPAPPDVDLRGLVDRVLGHYEYYYRTKSA-AASNDVLCM  85

Query  846   LSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGS--LGDISAT  673
              SPSW +T EN ++W GG RP+ ++ L+YS  GA L++ L  +L G   G+  LGD+SA 
Sbjct  86    FSPSWTSTTENLYLWCGGWRPTAALHLLYSKSGAQLEAQLPMFLTGGSLGTNDLGDLSAE  145

Query  672   QLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHA  493
             QL   + LQ  TVR+E ++ + +A+ QE +A   +  +       G     +E  + + A
Sbjct  146   QLQAADQLQRSTVRKEREIENAVASAQESLATVKMVALAGGG---GMDVEAMETEMKSKA  202

Query  492   VAMGRMVVEAD  460
               M R++  AD
Sbjct  203   EGMKRVLEMAD  213



>ref|XP_010062825.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 gb|KCW69956.1| hypothetical protein EUGRSUZ_F03274 [Eucalyptus grandis]
Length=234

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 102/188 (54%), Gaps = 6/188 (3%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDD---ELFGVVDRSVKHFEEYQQHRALLAQQNGGPP  850
             +  W  Q R  +++L+ A +  +  D   +L  +V + + H+ EY + +AL   ++    
Sbjct  8     YGGWQEQLRHLVDQLAAAPKPPISPDHHHQLHHLVSKFMDHYAEYHRTKALEVDRDVLSV  67

Query  849   FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQ  670
               +P W T  E +  WIGGCRP+    LVY+      +SH+   L+G R G LGD+S +Q
Sbjct  68    LAAP-WITALERSLQWIGGCRPTTVFHLVYTESSILFESHMIDILRGYRTGDLGDLSPSQ  126

Query  669   LNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAV  490
                ++ LQ  TVREE+ ++  ++  Q+ M+D  +A   N  +K+G+  + V++A D+  +
Sbjct  127   FRGVSELQCDTVREENAITEELSEWQDGMSDLMVAS-SNLEEKIGKLGAIVKKA-DDLRL  184

Query  489   AMGRMVVE  466
                R VVE
Sbjct  185   KTVRRVVE  192



>ref|XP_008386261.1| PREDICTED: transcription factor TGA5-like [Malus domestica]
Length=227

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 99/188 (53%), Gaps = 6/188 (3%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDD---ELFGVVDRSVKHFEEYQQHRALLAQQNGGPP  850
             ++ W  Q    + +LS         D   +L  VV + + H+ EY + ++L A+++    
Sbjct  8     YETWFEQLHHLVHQLSTCPRPPTTPDHHHQLLHVVQKVMAHYAEYYRVKSLAAERDALSV  67

Query  849   FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQ  670
             F++P W TT E +  WIGG RP+ +  LVYS      ++H+   L+G R G LGD++ +Q
Sbjct  68    FVAP-WATTLERSLHWIGGWRPTTAFHLVYSESSIHFEAHIVDILRGYRTGDLGDLTPSQ  126

Query  669   LNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAV  490
               +++ LQ +TV+EE+ +S  ++  Q D A E +    N    +G   S +++A D   +
Sbjct  127   FRRVSDLQCETVKEENAISDELSEWQ-DGACELMGEYTNLETNMGLLVSVLKKA-DELRL  184

Query  489   AMGRMVVE  466
                R VVE
Sbjct  185   KTLRKVVE  192



>ref|XP_009402767.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-1A-like 
[Musa acuminata subsp. malaccensis]
Length=270

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 128/229 (56%), Gaps = 2/229 (1%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             F+ W+A+Q  D++ L  A  S   +  L  +VDR + H+E Y   +A   +++  P F +
Sbjct  31    FECWLAEQERDLQVLRTAAASAGEELRLRPLVDRVLGHYEYYYCAKAASVRRDVLPMF-N  89

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQ  661
             P+W ++ EN F+W GG RP+++  L+YS  G   +  L   + G     L D+S  QL +
Sbjct  90    PTWTSSTENLFLWAGGWRPTMAFHLLYSKSGLQFEPRLLELIVGNPTRDLADLSPDQLER  149

Query  660   INALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSD-VERALDNHAVAM  484
             I+ L   TVR E ++S   A +QE +AD  +  + +   +  E  +D +E+ +      M
Sbjct  150   IDGLHRLTVRLEKEISEEEAQVQESVADARMVELTHALAESEEVEADAMEQEMKRKRDRM  209

Query  483   GRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
               ++  AD+LRL TL  L++IL P+QA H L+ A +LHL +HE+ K +D
Sbjct  210   NEVLQRADQLRLETLKGLVEILKPVQAVHFLIAAAELHLKVHEFGKSKD  258



>gb|EYU23876.1| hypothetical protein MIMGU_mgv11b017687mg [Erythranthe guttata]
Length=270

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 102/197 (52%), Gaps = 11/197 (6%)
 Frame = -1

Query  1050  AVDHRRLRCVFQDWIAQQREDMEELSRAVESNL----GDDELFGVVDRSVKHFEEYQQHR  883
             A      +  +  W  +  + + EL+ A ++       D  L G+V+R + H+EEY + +
Sbjct  3     ATSENNFQEFYVKWQNKHNQHLYELTNASKTQPQQPQSDSSLSGLVERVISHYEEYYRIK  62

Query  882   ALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER  703
                A+ +     LSP W +  E+AF+W+GG RP+ +  L+YS  G    +     L G +
Sbjct  63    TKWAKTDVYL-LLSPPWNSPLEDAFLWVGGWRPTTAFHLLYSKSGLQFQAQFSNMLIGAK  121

Query  702   KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSS  523
              G LGD+S  QL +I+  Q  T++EE +++ + A  Q+ +AD+ +  + +      ++SS
Sbjct  122   TGDLGDLSLDQLGRIDIFQKGTIQEEREITEKEAKQQDRVADKEMVGLSH------DASS  175

Query  522   DVERALDNHAVAMGRMV  472
             +  R +   ++ +G +V
Sbjct  176   ESTRPVGGTSLDIGSLV  192



>gb|EYU45430.1| hypothetical protein MIMGU_mgv1a012463mg [Erythranthe guttata]
Length=250

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 137/253 (54%), Gaps = 18/253 (7%)
 Frame = -1

Query  1071  IEMSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQ  892
             I  ++    +H      F  WI +Q   ++EL  A  ++    E   ++   V+H+E Y 
Sbjct  8     ITHTAHGVGEHVSFHMFFDSWIVEQNHQLQELVSAASASASASEASVLIPLVVQHYEHYY  67

Query  891   QHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ  712
             + +++ A+++    F  PSW ++ E A+MW+GG RP+++  L+YS CG          LQ
Sbjct  68    KTKSMWAKKDILSMF-RPSWRSSLEKAYMWVGGWRPTMTFHLLYSKCG----------LQ  116

Query  711   GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGE  532
              +  G+L   S +Q+ +++ L   T+ +E  ++ ++A LQE MAD  +  + + S+  G+
Sbjct  117   FQDTGNL---SHSQMERVDKLHKTTLWKEKMITEKLAKLQETMADSSMVELTDHSRHGGD  173

Query  531   SSSD----VERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLS  364
                     V+ AL      +  ++  AD+LRL TL +L+ IL+P+Q  + L+ A +LHL 
Sbjct  174   QVVHHQGLVDAALAPKEKGLVGILQMADELRLNTLKDLILILSPIQGVYFLIAAAELHLR  233

Query  363   IHEWSKKRDGAAA  325
             +H+W KKRD  A+
Sbjct  234   MHDWGKKRDDDAS  246



>emb|CAN72574.1| hypothetical protein VITISV_036367 [Vitis vinifera]
Length=227

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 81/146 (55%), Gaps = 3/146 (2%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDE--LFGVVDRSVKHFEEYQQHRALLAQQNGGPPF  847
             +  W       + +L+ A +     D   L  +V + + H+ +Y + +++ AQ +    F
Sbjct  7     YASWFDHLNXLVHQLTLAPKPTTPQDNPALLQLVQKVISHYSQYYRAKSVAAQNDAVSLF  66

Query  846   LSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQL  667
              +P W ++ E +  W+ G RP++   L+Y+   A  +SH+   L G R G LGD+S  QL
Sbjct  67    AAP-WSSSLERSLHWVAGWRPTIVFHLIYTETSARFESHIADILHGVRTGDLGDLSTAQL  125

Query  666   NQINALQSKTVREEDKLSSRIATLQE  589
             ++++ LQ +TVREE++++S +A  QE
Sbjct  126   HRVSELQCETVREENEITSELAKWQE  151



>ref|XP_007212919.1| hypothetical protein PRUPE_ppa022280mg [Prunus persica]
 gb|EMJ14118.1| hypothetical protein PRUPE_ppa022280mg [Prunus persica]
Length=229

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 103/203 (51%), Gaps = 12/203 (6%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVV---DRSVKHFEEY  895
             MSSSS          ++ W  Q    + +LS         D    ++    + + H++EY
Sbjct  1     MSSSS------FTSFYETWFEQLHNLVHQLSTCPRPPTTPDHHHHLLHVVQKVMSHYDEY  54

Query  894   QQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL  715
              + +AL A+++    F++P W TT E +  WI G RP+ +  LVYS      ++H+   L
Sbjct  55    YRVKALAAERDALAVFVAP-WATTLERSLHWIAGWRPTTAFHLVYSESSIHFEAHIVDIL  113

Query  714   QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
             +G   G LGD+S +Q  +++ LQ +TV+EE+ +S  ++  QE  A E +    N   K+G
Sbjct  114   RGFSTGDLGDLSPSQFRRVSELQCETVKEENAISEELSEWQEG-ASELMGACTNLDMKMG  172

Query  534   ESSSDVERALDNHAVAMGRMVVE  466
                + +++A DN  +   R VVE
Sbjct  173   RLVTVLKKA-DNLRLRTVRKVVE  194



>emb|CDP10926.1| unnamed protein product [Coffea canephora]
Length=307

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 76/121 (63%), Gaps = 2/121 (2%)
 Frame = -1

Query  939  LFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVY  760
            L  +V R V+H+EEY + ++  A +N     LSP W ++ E+AF+WIGG RP+++I L+Y
Sbjct  77   LSNLVKRVVEHYEEYYKTKSEWADKNT-LQILSPPWTSSLEDAFLWIGGWRPTMAIHLLY  135

Query  759  SLCGADLDSHLQGYLQGE-RKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDM  583
            S      +S    ++QG+  K  LGD++ +Q++ I+ LQ  T+ EE +++ ++A  QE  
Sbjct  136  SKSSLQFESKFNDWMQGKLTKHDLGDLTESQISLIDELQKNTIIEEKEITGKMAKQQEKA  195

Query  582  A  580
            A
Sbjct  196  A  196



>dbj|BAJ05339.1| hypothetical protein [Triticum aestivum]
Length=260

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 133/234 (57%), Gaps = 5/234 (2%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             F+ WI +Q  D+  L  A  +   D +L  +VDR + H+E Y + ++  A  +  P F +
Sbjct  28    FECWILEQSRDLAALRAAATARPDDADLRRLVDRVLGHYEHYYRAKSAAASADVLPMF-A  86

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGY--LQGERKGSLGDISATQL  667
             PSW +  E+ ++W GG RP+ +I+L+YS  G  L++ L  +        G LG +SA QL
Sbjct  87    PSWISATESLYLWCGGWRPTAAIQLLYSKSGVQLEAKLPAFLDGGSLGDGDLGGLSAEQL  146

Query  666   NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVA  487
                + LQ +T+R E ++    A  QE +A   +  +  K     +++  +ER +D  A A
Sbjct  147   QAADQLQRRTIRGEREIEEAAAGAQESLATTKMVELAGKGGV--DAAEGMEREMDAKAEA  204

Query  486   MGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRDGAAA  325
             M R++  AD LRL TL  ++ +L P QA H L+ A +LHL++H++ +++DGAAA
Sbjct  205   MKRVLEMADALRLETLRGVVGLLRPAQAVHFLVAAAELHLAVHKFGRRKDGAAA  258



>ref|XP_002283108.1| PREDICTED: transcription factor HBP-1b(c1)-like [Vitis vinifera]
Length=227

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 80/146 (55%), Gaps = 3/146 (2%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDE--LFGVVDRSVKHFEEYQQHRALLAQQNGGPPF  847
             +  W       + +L+ A +     D   L  +V + + H+ +Y + +++ AQ +    F
Sbjct  7     YASWFDHLNHLVHQLTLAPKPTTPQDNPALLQLVQKVISHYSQYYRAKSVAAQNDAVSLF  66

Query  846   LSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQL  667
              +P W ++ E +  W+ G RP++   L+Y+   A  +SH+   L G R G LGD+S  QL
Sbjct  67    AAP-WSSSLERSLHWVAGWRPTIVFHLIYTETSARFESHIADILHGVRTGDLGDLSTAQL  125

Query  666   NQINALQSKTVREEDKLSSRIATLQE  589
             ++++ LQ +TVREE++++  +A  QE
Sbjct  126   HRVSELQCETVREENEITRELAKWQE  151



>emb|CDM81542.1| unnamed protein product [Triticum aestivum]
 emb|CDM84782.1| unnamed protein product [Triticum aestivum]
Length=260

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 131/235 (56%), Gaps = 5/235 (2%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             F+ WI +Q  D+  L  A  +   D +L  +VDR + H+E Y + ++  A  +  P F +
Sbjct  28    FECWILEQSRDLAALRAAATARPDDSDLRRLVDRVLGHYEHYYRAKSAAASADVLPMF-A  86

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGY--LQGERKGSLGDISATQL  667
             PSW +  E+ ++W GG RP+ +I+L++S  G  L++ L  +        G LG +SA QL
Sbjct  87    PSWISATESLYLWCGGWRPTSAIQLLHSKSGLQLEAQLPAFLDGGSLGDGDLGGLSAEQL  146

Query  666   NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVA  487
                + LQ +TVR E  +    A  QE +A   +  +  K     +++  +E  +D  A A
Sbjct  147   QAADQLQRRTVRRERAIEEVAAGAQESLATTKMVELAGKGGM--DAAEGMELEMDAKAEA  204

Query  486   MGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRDGAAAG  322
             M R++  AD LRL TL  ++ +L P QA H L+ A +LHL++HE+ +++DGAAA 
Sbjct  205   MKRVLEMADALRLETLRGVVGLLRPAQAVHFLVAAAELHLAVHEFGRRKDGAAAA  259



>ref|XP_009801472.1| PREDICTED: uncharacterized protein LOC104247209 [Nicotiana sylvestris]
Length=101

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = -1

Query  915  VKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLD  736
            V +F+ Y   R+ LA+ +  P + +P+WCT  EN+ +WIGG R S  + L+Y+LCG +++
Sbjct  2    VSNFQGYVNGRSRLARVDVSP-YFAPTWCTPLENSVLWIGGFRQSSFLWLIYALCGMEIE  60

Query  735  SHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKL  616
            S L  +LQG + G  G +S  Q+  I+  Q + + EE KL
Sbjct  61   SRLTEFLQGTKLGDFGQLSGEQITMIDNSQRQIIVEERKL  100



>ref|XP_010313918.1| PREDICTED: transcription factor TGA5-like [Solanum lycopersicum]
Length=232

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 91/173 (53%), Gaps = 8/173 (5%)
 Frame = -1

Query  1017  QDWIAQQRE---DMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPF  847
             ++W    RE    M +L +   +N  +     ++ + + H  EY + ++L A+ +    F
Sbjct  9     EEWHGHLRELVQQMSKLPKFCTTNQDEQNTKLLIQKVISHINEYYRVKSLAAKNDILYIF  68

Query  846   LSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQL  667
              +P W  + E +  WI G RP+ +  ++YS CG  L+SH+   L G R G L D+S  QL
Sbjct  69    SAP-WSNSLERSLYWIAGWRPTTAFHIIYSECGIQLESHITNILNGFRNGDLADLSPDQL  127

Query  666   NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERA  508
              + + LQ +T+++E+ ++ +++  Q+ + D    +I N  KK+      ++RA
Sbjct  128   TRFSELQCETIQQENNITEQLSNWQDSVND----IIENIDKKMETLLGILKRA  176



>ref|XP_006367574.1| PREDICTED: uncharacterized protein LOC102590415 [Solanum tuberosum]
Length=216

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 62/92 (67%), Gaps = 4/92 (4%)
 Frame = -1

Query  990  DMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENA  811
            ++E LS  V   L DDEL  ++ + V +F+EY   R+ LA+ +  P F +P+WC+  EN+
Sbjct  129  ELELLSSEV---LNDDELNELLRKMVNNFQEYANGRSRLARVDISP-FFAPTWCSPLENS  184

Query  810  FMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL  715
             +WIGGCRPS  IRL+Y+L G +++SH+  YL
Sbjct  185  VLWIGGCRPSSFIRLIYALSGIEIESHIVEYL  216



>ref|XP_001765151.1| predicted protein [Physcomitrella patens]
 gb|EDQ69879.1| predicted protein [Physcomitrella patens]
Length=625

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 98/189 (52%), Gaps = 3/189 (2%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             +  W+ Q+   + EL R++E+   + E   +V +  + + E   H  + A         +
Sbjct  124   YNTWVQQEDNLLSELKRSLENPRNEQEFARLVRKCYQLYAE-AAHAKIRAAHEDVSYITA  182

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQ  661
              +W T FE   MW+GG RP+ +I L YSL G  ++S L+  L+G    S+  +SA QL++
Sbjct  183   GTWKTPFEAGMMWMGGWRPTAAIVLTYSLMGIQMESELERLLEGITLPSMATLSAKQLSR  242

Query  660   INALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGES--SSDVERALDNHAVA  487
             +N +Q +T   ED++S+R++ LQ  +AD+             ES   ++++  + +  V 
Sbjct  243   LNVMQQRTSSAEDEISTRLSVLQMLVADQQTTRATTADPPPSESFNMAEIKEVMKSKLVE  302

Query  486   MGRMVVEAD  460
             +  + +EA+
Sbjct  303   LRHLFIEAE  311



>ref|NP_001118628.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAY78741.1| DNA-binding protein-related [Arabidopsis thaliana]
 gb|AEE75583.1| uncharacterized protein AT3G14880 [Arabidopsis thaliana]
Length=237

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 92/188 (49%), Gaps = 8/188 (4%)
 Frame = -1

Query  1017  QDWIAQQREDMEELSRAVE----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQQNGGP  853
             Q WI Q R  +  L  A      S  GD+E L   VDR ++HF EY  HRA  A  +   
Sbjct  15    QSWIEQLRNHLNHLRSAQNHHRNSATGDEERLREAVDRVMEHFREY--HRAKWAATDKDV  72

Query  852   -PFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
                ++  W +  E +  W+GG RP+    LVY+      +S +   L+G R G L D+S 
Sbjct  73    IEVMASPWASALERSLQWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSP  132

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNH  496
             +Q   ++ LQ +TV+EE+ ++  ++  Q+D +D  +    +  +++   +  V R  D  
Sbjct  133   SQFRTVSELQCETVKEENAITEELSEWQDDASDLVMGTSSDPDQRIRRLAEIVHRTDDLR  192

Query  495   AVAMGRMV  472
                + R+V
Sbjct  193   LRTITRVV  200



>ref|XP_006646344.1| PREDICTED: transcription factor TGA5-like [Oryza brachyantha]
Length=172

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 76/138 (55%), Gaps = 12/138 (9%)
 Frame = -1

Query  1038  RRLRCVFQDWIAQQREDMEEL----SRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             R + C +Q WIA Q   + EL    + A      D EL   ++R ++ + EY   R  LA
Sbjct  5     RHVAC-YQRWIAGQEASLGELEAASANAAAGRATDAELRAALERCMRGYAEYVASRRTLA  63

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQ------GYLQG  709
             +++    F +P WCT+FEN+ +W+GG  PSL+IRL+YSL G  L+ H++      G L  
Sbjct  64    REDSTALF-APPWCTSFENSVLWLGGGPPSLTIRLLYSLSGEGLEEHIEELISGAGALGA  122

Query  708   ERKGSLGDISATQLNQIN  655
              R   L  I+A QL Q++
Sbjct  123   ARSMGLLGITARQLEQLH  140



>ref|XP_002455164.1| hypothetical protein SORBIDRAFT_03g005300 [Sorghum bicolor]
 gb|EES00284.1| hypothetical protein SORBIDRAFT_03g005300 [Sorghum bicolor]
Length=323

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 82/149 (55%), Gaps = 5/149 (3%)
 Frame = -1

Query  1023  VFQDWIAQQREDMEEL--SRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPP  850
              F+ WI +Q  D+EEL  + + E    + +L  +VD+ + H+ +Y   +A  A  +    
Sbjct  75    FFESWIGEQSRDLEELRAAASAEPAAPEADLRRLVDQVMGHYAQYYSTKAAAAAGDVSMM  134

Query  849   FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGE--RKGSLGDISA  676
             F +PSW +T EN ++W GG RP+ +I+L+Y+ CG  L+  L  +L G    K  L D+S 
Sbjct  135   F-TPSWTSTTENLYLWCGGWRPTAAIQLLYTKCGMQLEHRLPVFLDGGGLNKDDLSDLSV  193

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQE  589
              QL   + LQ +T+  E ++    AT QE
Sbjct  194   AQLRAADQLQHRTISREREIEEVAATAQE  222



>ref|XP_011007917.1| PREDICTED: transcription factor HBP-1b(c38) [Populus euphratica]
Length=232

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/201 (27%), Positives = 97/201 (48%), Gaps = 9/201 (4%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDE---LFGVVDRSVKHFEEY  895
             MSS+S+         +  W  Q  + +E+L  A +     D+   L  +  + V H+ E+
Sbjct  1     MSSTSSFTR-----FYDTWFDQLNQLLEQLRTAPKPPSSQDDRSHLSSLAQKIVSHYAEF  55

Query  894   QQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL  715
              + +++  + +    F +P W + FE +  WI G RP+    LVY+      + H+   L
Sbjct  56    YRMKSMAIESDVLSVFTAP-WASCFERSLHWIAGWRPTTLFHLVYTESSILFEFHIADIL  114

Query  714   QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
             +G   G LGD+S  Q  +++ LQ +TV+EE+ ++  ++  Q+   +  L    N   KVG
Sbjct  115   KGRSTGDLGDLSPNQFRRVSELQCETVKEENAITGELSDWQDSANEVMLGSFTNLGDKVG  174

Query  534   ESSSDVERALDNHAVAMGRMV  472
                S V++A D     + R+V
Sbjct  175   RLVSVVKKADDLRLRTIRRVV  195



>ref|XP_009798761.1| PREDICTED: transcription factor TGA5 [Nicotiana sylvestris]
Length=226

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 95/178 (53%), Gaps = 5/178 (3%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEELSRAVESNLGDD--ELFG-VVDRSVKHFEEYQQHRALLAQQN  862
              +  ++ W  Q +  + +L +A      D   EL   +V + + H+ EY + ++L A+ +
Sbjct  3     FQLFYETWFEQLKGMVHQLGQAPRPATNDQHHELHQQLVQKVMSHYSEYYRVKSLAAKND  62

Query  861   GGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDI  682
                 F +P WCT+ E +  WI G RP+ +  L+Y+      +SH+   L+G R G LGD+
Sbjct  63    ILSVFSAP-WCTSLERSLHWISGWRPTTAFHLIYTESSVLFESHIIDILRGLRYGDLGDL  121

Query  681   SATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERA  508
             S  QL +++ LQ + V+EE+ ++  ++  Q D A E + ++ +   K+    S +ERA
Sbjct  122   SPDQLRRVSELQCQAVQEENAIADELSDWQ-DGASEVIGLMGDIDAKMEGLVSILERA  178



>ref|XP_011075022.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=262

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 84/165 (51%), Gaps = 1/165 (1%)
 Frame = -1

Query  1071  IEMSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQ  892
             + + + + +D +     +  W  +Q   + +L               +VDR + H+EEY 
Sbjct  3     LALENGTVLDRKNFEEFYIRWKEKQNLHLHDLITTATKPSPSSSFPALVDRVISHYEEYY  62

Query  891   QHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ  712
             + ++  + +      LS  W T  E AF W+GG RPS +  L+YS  G  L++ L    +
Sbjct  63    RVKSK-SIKTDVLLILSAPWKTGLEVAFNWVGGWRPSAAFHLLYSKSGLQLEAKLSELTK  121

Query  711   GERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMAD  577
             G   G L D+S+ QL++++ LQ  T+++E ++S ++A  QE  AD
Sbjct  122   GVDMGDLSDLSSAQLSRMDKLQRITIQQEREISEKVAKRQERAAD  166



>gb|KHG25856.1| Transcription factor TGA1 -like protein [Gossypium arboreum]
Length=226

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 70/118 (59%), Gaps = 1/118 (1%)
 Frame = -1

Query  930  VVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
            +V++ + H+ EY + +A  A+++    F +P W + FE +  WI G RP+    LVY+  
Sbjct  41   LVNKVLSHYAEYYRVKAAAAERDVLDIFAAP-WASAFEKSLHWIAGWRPTTVFHLVYTES  99

Query  750  GADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMAD  577
                +SH+   L+G R G LGD+S TQ  +++ LQ +TV+EE+ ++  ++  Q  ++D
Sbjct  100  SILFESHIVDILRGVRTGDLGDLSPTQFRRVSELQCETVKEENAITDELSEWQHSVSD  157



>ref|XP_011082768.1| PREDICTED: transcription factor TGA1 [Sesamum indicum]
Length=227

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 93/175 (53%), Gaps = 4/175 (2%)
 Frame = -1

Query  1023  VFQDWIAQQREDMEELSRAVESNLGDD---ELFGVVDRSVKHFEEYQQHRALLAQQNGGP  853
              +  W  Q R+ +++LS A      ++   +L  +V +++ H+ EY + ++  A+ +   
Sbjct  6     FYDTWFEQLRQLVQQLSEAPIPPTTEEHHLQLRQLVHKAMSHYAEYYRAKSAAAKHDV-L  64

Query  852   PFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISAT  673
              F S  W T+ E +  WIGG RP+ +  LVY+      +SH+   L+G   G LGD+S  
Sbjct  65    AFFSAPWTTSLERSLHWIGGWRPTTAFHLVYTESSILFESHVVDILRGFHTGDLGDLSPG  124

Query  672   QLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERA  508
             Q  +++ LQ +TV++E+ ++  ++  Q+D  D       +  +K+ + +  +ERA
Sbjct  125   QFRRVSELQIETVQQENDITDELSDWQDDTTDILGTKYGDGDRKMEKLAKILERA  179



>ref|NP_001237999.1| bZIP transcription factor bZIP132 [Glycine max]
 gb|ABI34670.1| bZIP transcription factor bZIP132 [Glycine max]
Length=225

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 92/173 (53%), Gaps = 5/173 (3%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             F D+  Q  E+++ L + +      +E   V+++ + H + Y   ++  A+++    FLS
Sbjct  13    FADFYEQWFEELQSLMQQLRGEGRKEE---VMEKVMWHHQNYYVAKSAAAEKDPLNVFLS  69

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQ  661
             P W TT E +  WI G RP+ +  L+Y+      +SH+   LQG R G LGD+S +Q  +
Sbjct  70    P-WATTLERSLHWITGWRPTTAFHLIYTESSLMFESHIIDILQGLRTGDLGDLSPSQFRR  128

Query  660   INALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALD  502
             ++ +Q  TV+EE+ ++  ++  Q D   E +    N + K+G     +++A D
Sbjct  129   VSDIQCDTVKEENAITEELSEWQ-DSVSEMMGPGANINDKIGRLVCIIKKADD  180



>ref|XP_001783231.1| predicted protein [Physcomitrella patens]
 gb|EDQ51926.1| predicted protein [Physcomitrella patens]
Length=214

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 67/119 (56%), Gaps = 1/119 (1%)
 Frame = -1

Query  948  DDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIR  769
            + E   +V +   H+ E   H  + A         + +W T FE   MW+GG RP+ +I 
Sbjct  2    EQECAKLVKKCYDHYTE-AAHAKVRAAHEDASYIATGAWKTPFEAGMMWMGGWRPTTAIV  60

Query  768  LVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQ  592
            LV+SL G  +++ LQ  L+G    S+  +SA QL ++NALQ  T  EED++S+R+A LQ
Sbjct  61   LVFSLIGLQIENELQRLLEGINVSSMAALSAKQLAKLNALQQHTSTEEDEISNRLAVLQ  119



>ref|XP_006370140.1| DNA-binding family protein [Populus trichocarpa]
 gb|ERP66709.1| DNA-binding family protein [Populus trichocarpa]
Length=232

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 97/201 (48%), Gaps = 9/201 (4%)
 Frame = -1

Query  1065  MSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDE---LFGVVDRSVKHFEEY  895
             MSS+S+         +  W  Q  + +E+L  A +     D+   L  +  + V H+ E+
Sbjct  1     MSSTSSFTR-----FYDTWFDQLNQLLEQLRTAPKPPSSQDDRSHLSSLAQKIVSHYAEF  55

Query  894   QQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL  715
              + +++  + +    F +P W + FE +  WI G RP+    LVY+      + H+   L
Sbjct  56    YRVKSMAIESDVLSVFTAP-WASCFERSLHWIAGWRPTTLFHLVYTESSILFEFHIADIL  114

Query  714   QGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG  535
             +G   G LGD+S  Q  +++ LQ +TV+EE+ ++  ++  Q+   +  L    +   KVG
Sbjct  115   KGRSTGDLGDLSPNQFRRVSELQCETVKEENAITGELSEWQDSANEVMLGSFTDLGDKVG  174

Query  534   ESSSDVERALDNHAVAMGRMV  472
                S V++A D     + R+V
Sbjct  175   RLVSVVKKADDLRLRTIKRVV  195



>ref|XP_009405272.1| PREDICTED: transcription factor HBP-1b(c1)-like [Musa acuminata 
subsp. malaccensis]
Length=226

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 89/168 (53%), Gaps = 2/168 (1%)
 Frame = -1

Query  1011  WIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSW  832
             ++A    ++  L R +    GD +   +VDR++  +E + + R+  A+ +    + +P W
Sbjct  8     FVAVWPRELSRLRRDLRCARGDADR-ALVDRAIALYECFFRARSTAARSDPVRAYAAP-W  65

Query  831   CTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQINA  652
              T  E A  W+ G RP+  I L+YS      +S L   L G   G LGD+S+ QL +I+ 
Sbjct  66    ATALERAAHWVAGWRPNALIHLLYSESSLRFESQLPDLLLGVHSGDLGDLSSAQLGRIDE  125

Query  651   LQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERA  508
             LQ +T+R E ++S+ +A +QE +A+           KVGE +  +ERA
Sbjct  126   LQRRTIRGELEISAEMAAVQEGLAEPFPRSDAELEGKVGELTRVMERA  173



>ref|XP_010086637.1| hypothetical protein L484_004349 [Morus notabilis]
 gb|EXB22356.1| hypothetical protein L484_004349 [Morus notabilis]
Length=232

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 90/176 (51%), Gaps = 5/176 (3%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGV---VDRSVKHFEEYQQHRALLAQQNGGPP  850
             ++ W+ Q    + +L+ A       D  + +   V + + H+ EY + +++ A+++    
Sbjct  13    YETWLEQLHHLVRQLTAAPRPPTTPDHHYDLDVLVGKVMSHYAEYYRVKSVAAERDTLSV  72

Query  849   FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQ  670
             F +P W +  E +  WI G RP+    LVYS      +SH+   L+G R G LGD+S +Q
Sbjct  73    FAAP-WASALERSLHWIAGWRPTTVFHLVYSESSILFESHIIDILRGLRTGDLGDLSPSQ  131

Query  669   LNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALD  502
               +++ LQ  TVREE+ ++   +  Q D A E +    +  +K+G   S + +A D
Sbjct  132   FRRVSELQCDTVREENAITEEFSEWQ-DSASELVNARADLKEKIGRLVSVLRKADD  186



>ref|XP_006367571.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Solanum tuberosum]
Length=450

 Score = 85.9 bits (211),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 16/93 (17%)
 Frame = -1

Query  846  LSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQL  667
            L P+WCT  EN+ +WIGGCRPS  IRL+Y                G + G  G +S  Q+
Sbjct  48   LRPTWCTPLENSVLWIGGCRPSSFIRLIY----------------GMKIGDFGQLSGKQI  91

Query  666  NQINALQSKTVREEDKLSSRIATLQEDMADEPL  568
              I+ LQ + + EE + SSR+A+LQED+ D+P+
Sbjct  92   TMIDKLQRQIILEERRFSSRLASLQEDVVDQPM  124



>ref|XP_007021794.1| Uncharacterized protein TCM_031867 [Theobroma cacao]
 gb|EOY13319.1| Uncharacterized protein TCM_031867 [Theobroma cacao]
Length=261

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 93/188 (49%), Gaps = 5/188 (3%)
 Frame = -1

Query  1026  CVFQDWIAQQREDMEELSRAVESNLGDDELFGV---VDRSVKHFEEYQQHRALLAQQNGG  856
               +  W  Q    + +L  A +     D L  +   V + + H+ EY + +A  A+++  
Sbjct  43    AFYNTWSDQLHHLLRQLCSAPKPPTMQDHLHHLNHLVTKLLSHYSEYYRVKAAAAERDVF  102

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
               F +P W ++ E +  WI G RP+    LVY+      +SH+   L+G R G LGD+S 
Sbjct  103   DIFAAP-WASSLEKSLHWIAGWRPTTVFHLVYTESSILFESHIVDILRGVRTGDLGDLSP  161

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNH  496
             +Q  +++ LQ +TV+EE+ ++  ++  Q  + D  +    +  + +G   S V++A D  
Sbjct  162   SQFRRVSELQCETVKEENAITDELSEWQHSVTDL-VGSFTDAEQMIGRLVSIVQKADDLR  220

Query  495   AVAMGRMV  472
                + R+V
Sbjct  221   LRTLKRVV  228



>ref|XP_010093103.1| hypothetical protein L484_007912 [Morus notabilis]
 gb|EXB53541.1| hypothetical protein L484_007912 [Morus notabilis]
Length=292

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 91/264 (34%), Positives = 145/264 (55%), Gaps = 28/264 (11%)
 Frame = -1

Query  1044  DHRRLRCVFQDWIAQQREDMEEL-SRAVESNLGDDE--LFGVVDRSVKHFEEYQQHRALL  874
             +H   +  F+ W++ Q + ++EL S A       DE  L  +++R VKH+E Y + +A  
Sbjct  21    EHESFQKFFECWLSGQNQHLQELISAAKSPASAADEAALRSLIERVVKHYECYYRAKATW  80

Query  873   AQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLD-----SHLQGYLQG  709
             ++++     L+PSW +T E+AF+WIGG RPS++  L+YS  G  L+     S L   +  
Sbjct  81    SRRDV-LAMLTPSWRSTLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAPGRLSELINAMTT  139

Query  708   ER------KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADE---PLAMIV  556
                     +  L DIS  QL++++ LQ +T++EE ++S  +A  QE +A      L+ +V
Sbjct  140   TTATATAIREDLADISPEQLSRVDGLQRRTIKEEKEISEEMAKRQETLAAPDIVELSHVV  199

Query  555   NKSKKVGESSS----------DVERALDNHAVAMGRMVVEADklrlrtltellkilTPlq  406
             ++    G   S           VE AL      +  ++  AD+LRLRTL +++ +LTP+Q
Sbjct  200   SEQMTAGGGGSRDGDEEEEEERVETALKPKEKGLEEVLERADELRLRTLKDVIHLLTPIQ  259

Query  405   aahlllvakklhLSIHEWSKKRDG  334
             A H L+ A +LHL IHEW KKRD 
Sbjct  260   AVHFLIAAAELHLRIHEWGKKRDA  283



>gb|KHN36891.1| Transcription factor TGA1 [Glycine soja]
Length=198

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 79/143 (55%), Gaps = 2/143 (1%)
 Frame = -1

Query  930  VVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
            V+++ + H + Y   ++  A+++    FLSP W TT E +  WI G RP+ +  L+Y+  
Sbjct  13   VMEKVMWHHQNYYVAKSAAAEKDPLNVFLSP-WATTLERSLHWITGWRPTTAFHLIYTES  71

Query  750  GADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP  571
                +SH+   LQG R G LGD+S +Q  +++ +Q  TV+EE+ ++  ++  Q D   E 
Sbjct  72   SLMFESHIIDILQGLRTGDLGDLSPSQFRRVSDIQCDTVKEENAITEELSEWQ-DSVSEM  130

Query  570  LAMIVNKSKKVGESSSDVERALD  502
            +    N + K+G     +++A D
Sbjct  131  MGPGANINDKIGRLVCIIKKADD  153



>ref|XP_010487302.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Camelina 
sativa]
Length=237

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 92/188 (49%), Gaps = 8/188 (4%)
 Frame = -1

Query  1017  QDWIAQQREDMEELSRAVE----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQ-QNGG  856
             Q WI Q +  +  L  A      S  GD+E L   V+R ++HF EY  HRA  A  +   
Sbjct  15    QSWIEQLQHHLNHLRSAQNHHRNSVTGDEERLREAVERVMEHFREY--HRAKWATTEKDV  72

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
                ++  W +  E +  W+GG RP+    LVY+      +S +   L+G R G L D+S 
Sbjct  73    VGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSP  132

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNH  496
             +Q   ++ LQ +TV+EE+ ++  ++  Q+D ++  +    N  +++   +  V R  D  
Sbjct  133   SQFRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRRLAGIVHRTDDLR  192

Query  495   AVAMGRMV  472
                + R+V
Sbjct  193   LRTITRVV  200



>ref|XP_010502264.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Camelina 
sativa]
Length=237

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 92/188 (49%), Gaps = 8/188 (4%)
 Frame = -1

Query  1017  QDWIAQQREDMEELSRAVE----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQ-QNGG  856
             Q WI Q +  +  L  A      S  GD+E L   V+R +KHF E+  HRA  A  +   
Sbjct  15    QSWIEQLQHHLNYLRSAQNHHRNSVTGDEERLREAVERVMKHFREF--HRAKWATTETDV  72

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
                ++  W +  E +  W+GG RP+    LVY+      +S +   L+G R G L D+S 
Sbjct  73    VGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSP  132

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNH  496
             +Q   ++ LQ +TV+EE+ ++  ++  Q+D ++  +    N  +++   +  V R  D  
Sbjct  133   SQFRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRRLAEIVHRTDDLR  192

Query  495   AVAMGRMV  472
                + R+V
Sbjct  193   LRTITRVV  200



>emb|CDP06468.1| unnamed protein product [Coffea canephora]
Length=249

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 96/202 (48%), Gaps = 32/202 (16%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEELSRAVESN-----LGDDELFG-VVDRSVKHFEEYQQHRALLA  871
              +  F+DW+ +Q+  ++EL  A ES+     + D ++ G ++ R + H++EY   ++ +A
Sbjct  16    FQAFFEDWLVRQQRFLDELLSAQESSSTTSRIDDTDVVGDLIARVLAHYQEYYDEKSRMA  75

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSL  691
              +N    F SP+W T  E  F+WI G +P L  RL                      GSL
Sbjct  76    HRNVFLAF-SPTWFTPLERTFLWIAGFKPGLVCRLAL--------------------GSL  114

Query  690   GDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK-----SKKVGESS  526
              D++  Q+++IN L  +T  +E  L  ++A +QE +A  PL  +            G   
Sbjct  115   DDLTEDQIHRINGLSRETNWQEKLLDQKMAKIQESVASPPLVDLARSEGMQIQSATGSDI  174

Query  525   SDVERALDNHAVAMGRMVVEAD  460
              DV+  ++    AM  ++ +AD
Sbjct  175   DDVDNQIEPLKSAMQNILRDAD  196



>ref|XP_010465409.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Camelina 
sativa]
Length=237

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 91/188 (48%), Gaps = 8/188 (4%)
 Frame = -1

Query  1017  QDWIAQQREDMEELSRAVE----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQ-QNGG  856
             Q WI Q +  +  L  A      S  GD E L   V+R ++HF EY  HRA  A  +   
Sbjct  15    QSWIEQLQHHLNHLRSAQNHHRNSVTGDVERLREAVERVMEHFREY--HRAKWATTEKDV  72

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
                ++  W +  E +  W+GG RP+    LVY+      +S +   L+G R G L D+S 
Sbjct  73    VGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSP  132

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNH  496
             +Q   ++ LQ +TV+EE+ ++  ++  Q+D ++  +    N  +++   S  V R  D  
Sbjct  133   SQFRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRRLSEIVHRTDDLR  192

Query  495   AVAMGRMV  472
                + R+V
Sbjct  193   LRTITRVV  200



>ref|XP_004489078.1| PREDICTED: transcription factor HBP-1b(c38)-like [Cicer arietinum]
Length=223

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 93/190 (49%), Gaps = 19/190 (10%)
 Frame = -1

Query  1035  RLRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGG  856
             +  C+ Q      + D EEL R V S                H E+Y   +++ A+++  
Sbjct  17    QFHCLVQQLNTPNQTDAEELIRKVMS----------------HHEDYYNAKSMAAEKDPL  60

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
                 SP W TT E +  WI G RP+ +  L+Y+      +SH+   L+G R G LGD+S 
Sbjct  61    HVLASP-WATTLERSLYWIAGWRPTTAFHLIYTESSLLFESHIIDILRGLRTGDLGDLSP  119

Query  675   TQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNH  496
             TQ  +++ LQ  TV+EE+ ++  ++  Q D A E +    + ++ +G     +++A D+ 
Sbjct  120   TQFRRVSDLQCDTVKEENAITEELSEWQ-DNASELMGSEDDINENIGRLVCIIKKA-DDL  177

Query  495   AVAMGRMVVE  466
              +   R VVE
Sbjct  178   RLRTLRSVVE  187



>ref|XP_006477767.1| PREDICTED: transcription factor TGA1-like [Citrus sinensis]
 gb|KDO35852.1| hypothetical protein CISIN_1g040790mg [Citrus sinensis]
Length=231

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 80/144 (56%), Gaps = 4/144 (3%)
 Frame = -1

Query  1011  WIAQQREDMEELSRAVESNLGDDE---LFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             W  Q  + +++LS A       D+   L  +V +++ H+ EY + ++  AQ++    F +
Sbjct  13    WFEQLNQLVQQLSAAARPPTTYDQHQDLEKLVAKTLTHYTEYYKVKSAEAQRDVFNVFAA  72

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQ  661
             P W ++ E +  WI G RP+    LVY+      +SH+   L+G R G LGD+S +Q  +
Sbjct  73    P-WASSLERSLHWIAGWRPTTVFHLVYTESSTLFESHIVDILRGLRTGDLGDLSPSQFRR  131

Query  660   INALQSKTVREEDKLSSRIATLQE  589
             ++ LQ +TV+EE+ ++  ++  Q+
Sbjct  132   VSELQCETVKEENAITDELSEWQD  155



>ref|XP_006442481.1| hypothetical protein CICLE_v10022056mg [Citrus clementina]
 gb|ESR55721.1| hypothetical protein CICLE_v10022056mg [Citrus clementina]
Length=231

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 80/144 (56%), Gaps = 4/144 (3%)
 Frame = -1

Query  1011  WIAQQREDMEELSRAVESNLGDDE---LFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             W  Q  + +++LS A       D+   L  +V +++ H+ EY + ++  AQ++    F +
Sbjct  13    WFEQLNQLVQQLSAAPRPPTTHDQHQDLEKLVAKTLTHYTEYYKVKSAEAQRDVFNVFAA  72

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQ  661
             P W ++ E +  WI G RP+    LVY+      +SH+   L+G R G LGD+S +Q  +
Sbjct  73    P-WASSLERSLHWIAGWRPTTVFHLVYTESSTLFESHIVDILRGLRTGDLGDLSPSQFRR  131

Query  660   INALQSKTVREEDKLSSRIATLQE  589
             ++ LQ +TV+EE+ ++  ++  Q+
Sbjct  132   VSELQCETVKEENAITDELSEWQD  155



>ref|XP_003596341.1| Transcription factor TGA5 [Medicago truncatula]
 gb|ABD32966.1| tumor-related protein-like, putative [Medicago truncatula]
 gb|AES66592.1| transcription factor TGA5-like protein [Medicago truncatula]
Length=222

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 78/148 (53%), Gaps = 4/148 (3%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             ++ W  Q    + +L  +  +    +EL   + + + H ++Y   +++ A+++      S
Sbjct  8     YESWHTQFNNLIHQLKLSTSTQTDSEEL---IQKVLSHHQDYYNAKSMAAEKDPLHVLAS  64

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQ  661
             P W TT E +  WI G RP+ +  L+Y+      +SH+   L+G R G LGD+S  Q  +
Sbjct  65    P-WATTLERSLHWIAGWRPTTAFHLIYTESSLLFESHIIDILRGFRTGDLGDLSPNQFRR  123

Query  660   INALQSKTVREEDKLSSRIATLQEDMAD  577
             ++ LQ  TV+EE+ ++  ++  Q+  +D
Sbjct  124   VSDLQCDTVKEENAITEELSEWQDSASD  151



>ref|XP_002441508.1| hypothetical protein SORBIDRAFT_09g028290 [Sorghum bicolor]
 gb|EES19938.1| hypothetical protein SORBIDRAFT_09g028290 [Sorghum bicolor]
Length=231

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPF--  847
             F  W    R    +L+ A  S+    +L  +V R V H E Y   RA      G  P   
Sbjct  12    FHLWFRGLRSLRRDLASARWSDDAAAQLPALVGRFVAHLESYCAARA------GLDPVWT  65

Query  846   LSPSWCTTFE-NAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQ  670
             LS  W T  E  A  W+ G RP+  + L+Y+  G  L++ L   L G R G+LGD++  Q
Sbjct  66    LSAPWATPAERGAAYWLAGWRPTTLVHLLYTESGRRLEAQLPDLLLGVRSGNLGDLTPAQ  125

Query  669   LNQINALQSKTVREEDKLSSRIATLQE  589
             L Q++ LQ +TV EED L+  +A +QE
Sbjct  126   LAQVDDLQRRTVAEEDALAREMALVQE  152



>ref|XP_004968271.1| PREDICTED: transcription factor TGA6-like [Setaria italica]
Length=310

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 128/235 (54%), Gaps = 6/235 (3%)
 Frame = -1

Query  1023  VFQDWIAQQREDMEELSRAVESNLGDDE--LFGVVDRSVKHFEEYQQHRALLAQQNGGPP  850
              F+ WIA+Q  D+  L  A  ++    E  L  + DR + H+E Y + +A  A  +    
Sbjct  68    FFESWIAEQSRDLAALRAAASADPPTREADLRRLADRVLGHYEHYYRTKAAAAAVDLLRM  127

Query  849   FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQ-GERKGSLGDISAT  673
             F +PSW +T EN F+W GG RP+ ++ L+Y+  G  L+  L  +L  G  K  LGD+SA 
Sbjct  128   F-TPSWTSTTENLFLWCGGWRPTAALHLLYTKSGMQLEHQLPAFLNGGSLKADLGDLSAG  186

Query  672   QLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHA  493
             QL   + LQ +T++ E ++    A+ QE +A   +  +      V   +  +ER +   A
Sbjct  187   QLQDADQLQRRTIKREREIEDAAASAQEALATAKILELAGGGGGV--DADAMEREMKTKA  244

Query  492   VAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRDGAA  328
               M R++  AD LRL T+  ++ +L P QA H LL A ++HL++H++  ++DG A
Sbjct  245   DGMKRVLEMADALRLETMRGVVALLRPAQAVHFLLAAAEIHLAVHDFGCRKDGHA  299



>ref|XP_010276977.1| PREDICTED: transcription factor TGA2 [Nelumbo nucifera]
Length=232

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = -1

Query  939  LFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVY  760
            L  + DR + H+E+Y + ++  A+ +    F +P W T+ E++  WI G RP+    +VY
Sbjct  43   LSQLADRVMTHYEDYYRIKSHAAKHDVLAMFSAP-WTTSLESSLHWIAGWRPTTVFHIVY  101

Query  759  SLCGADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMA  580
            +      ++ +   L+G R G LGD++  QL +++ LQ +TVREE++++  ++  Q +  
Sbjct  102  TESSVRFEAQIVDLLRGHRTGDLGDLTPRQLTRVSELQCQTVREENEITEELSQWQNNSC  161

Query  579  D  577
            D
Sbjct  162  D  162



>ref|NP_188106.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA97051.1| tumor-related protein-like [Arabidopsis thaliana]
 gb|ABE65942.1| DNA-binding protein-like protein [Arabidopsis thaliana]
 dbj|BAH30453.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75582.1| uncharacterized protein AT3G14880 [Arabidopsis thaliana]
Length=244

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 92/195 (47%), Gaps = 15/195 (8%)
 Frame = -1

Query  1017  QDWIAQQREDMEELSRAVE----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQQNGGP  853
             Q WI Q R  +  L  A      S  GD+E L   VDR ++HF EY  HRA  A  +   
Sbjct  15    QSWIEQLRNHLNHLRSAQNHHRNSATGDEERLREAVDRVMEHFREY--HRAKWAATDKDV  72

Query  852   -PFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
                ++  W +  E +  W+GG RP+    LVY+      +S +   L+G R G L D+S 
Sbjct  73    IEVMASPWASALERSLQWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSP  132

Query  675   TQL-------NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDV  517
             +Q          ++ LQ +TV+EE+ ++  ++  Q+D +D  +    +  +++   +  V
Sbjct  133   SQFRVPFVKGRTVSELQCETVKEENAITEELSEWQDDASDLVMGTSSDPDQRIRRLAEIV  192

Query  516   ERALDNHAVAMGRMV  472
              R  D     + R+V
Sbjct  193   HRTDDLRLRTITRVV  207



>ref|XP_004244373.1| PREDICTED: transcription factor TGA5 [Solanum lycopersicum]
Length=226

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 92/174 (53%), Gaps = 5/174 (3%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDD--ELFGV-VDRSVKHFEEYQQHRALLAQQNGGPP  850
             ++ W  Q +E + +L++       D   EL  + V + V H  EY + ++L A+ +    
Sbjct  7     YETWFDQLKEIVRQLNQVPRPATSDHHRELHQLLVQKVVSHIYEYYRVKSLAAKNDILSV  66

Query  849   FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQ  670
             F +P W T+ E +  WI G RP+ +  L+Y+      +SH+   L+G R G LGD+S  Q
Sbjct  67    FSAP-WSTSLERSLHWIAGWRPTTAFHLIYTESSILFESHIIDILRGLRYGDLGDLSPEQ  125

Query  669   LNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERA  508
             L +++  Q +TV EE+ ++  +   Q D A E + ++ +  +K+ +    +E+A
Sbjct  126   LARVSEFQCETVHEENSITDELNDWQ-DGASEIIGLMGDIEEKMEKLVEILEKA  178



>ref|XP_009132089.1| PREDICTED: uncharacterized protein LOC103856711 isoform X2 [Brassica 
rapa]
Length=153

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = -1

Query  696  SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDV  517
            S+ D++A QL +IN L  KTV+EE+ L+ + ATLQED AD P+A+     +++GE+  +V
Sbjct  16   SMSDLTAEQLFKINELHMKTVQEENMLTKQSATLQEDTADMPIAVAAFHKERIGEADVEV  75

Query  516  ERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
            ERALD +   + RM+ EADKLRL TLT++++ILT +QAA  LL  KKLHLS+HEW ++R+
Sbjct  76   ERALDKYEDEIARMLAEADKLRLTTLTKIVEILTAVQAADFLLAGKKLHLSMHEWGRQRE  135



>ref|XP_009618663.1| PREDICTED: transcription factor TGA1-like [Nicotiana tomentosiformis]
Length=228

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 80/141 (57%), Gaps = 2/141 (1%)
 Frame = -1

Query  930  VVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
            +V + + H+ EY + ++L A+ +    F +P W T+ E +  WI G RP+ +  L+Y+  
Sbjct  40   LVQKVMSHYYEYYRVKSLAAKNDIFSVFSAP-WSTSLERSLHWIAGWRPTTAFHLIYTES  98

Query  750  GADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEP  571
                +SH+   L+G R G LGD+S  QL++++ LQ + V+EE+ ++  ++  Q D A E 
Sbjct  99   SILFESHIIDILRGLRYGDLGDLSPDQLHRVSELQCEAVQEENAIADELSDWQ-DGASEV  157

Query  570  LAMIVNKSKKVGESSSDVERA  508
            + +  +   K+    S +ERA
Sbjct  158  IGLTGDIDVKMEGLVSILERA  178



>gb|ABI84260.1| tumor-related protein-like [Arachis hypogaea]
Length=219

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 70/120 (58%), Gaps = 1/120 (1%)
 Frame = -1

Query  948  DDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIR  769
            +++L  ++ + + H EEY + ++L+ + +      SP W TT E +  W+ G RP+ +  
Sbjct  48   EEKLAQLIGKVMLHHEEYFRAKSLITENDPLSVVASP-WATTLERSLHWVTGWRPTTAFH  106

Query  768  LVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQE  589
            LVY+      +SH+   L+G   G LGD+S TQ  +++ LQ  TV+EE++++  ++  Q+
Sbjct  107  LVYTESSVLFESHIGDILRGVNTGDLGDLSPTQFRRVSELQCDTVKEENQITDELSDWQD  166



>ref|NP_001152723.1| tumor-related protein-like [Zea mays]
 gb|ACG49152.1| tumor-related protein-like [Zea mays]
 gb|AFW79131.1| tumor protein-like protein [Zea mays]
Length=232

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 73/147 (50%), Gaps = 9/147 (6%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPF--  847
             F  W    R    +L+ A  S+    +L   V R V H E Y   RA      G  P   
Sbjct  12    FHLWFRGLRSLRRDLASARWSDDPTAQLPAQVGRFVAHLESYCAARA------GLDPVWT  65

Query  846   LSPSWCTTFE-NAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQ  670
             LS  W T  E  A  W+ G RP+  + L+Y+  G  L++ L   L G R G+LGD++  Q
Sbjct  66    LSAPWATPAERGAAYWLAGWRPTTLVHLLYTESGRRLEAQLPDLLLGVRSGNLGDLTPAQ  125

Query  669   LNQINALQSKTVREEDKLSSRIATLQE  589
             L Q++ LQ +TV EED L+  +A +QE
Sbjct  126   LAQVDDLQRRTVAEEDALAREMALVQE  152



>gb|EPS59924.1| hypothetical protein M569_14883, partial [Genlisea aurea]
Length=163

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = -1

Query  930  VVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
            +V+++++H+ EY + +++ A+ +    FL+P   T  E +  WIGG RP+ +  L Y+  
Sbjct  8    LVNKAIEHYREYYRAKSVAAENDLLVFFLAPC-ATKLERSLSWIGGFRPTTAFHLAYTKI  66

Query  750  GADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKL  616
            G   +S +   L+G R G  GDIS  QL +I+ LQ +TV EE++L
Sbjct  67   GMMFESGVMHILRGIRTGDFGDISPPQLQKISELQIETVDEENRL  111



>gb|KDP34795.1| hypothetical protein JCGZ_10575 [Jatropha curcas]
Length=229

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 98/190 (52%), Gaps = 10/190 (5%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDD---ELFGVVDRSVKHFEEYQQHRALLAQQNGGPP  850
             ++ W  Q    + +L +  +     D    L   VD+ + H+ EY + ++  A+++    
Sbjct  11    YETWFDQLHHMVNQLRKTSKPPPNQDAAAHLSHFVDKLMNHYAEYYRVKSAAAERDVLSV  70

Query  849   FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQ  670
             F +P W ++ E +  WI G RP+    L+Y+      +SH+   L+G R G LGD+S TQ
Sbjct  71    FTAP-WASSLERSLHWIAGWRPTTLFHLMYTESSILFESHIVDILRGLRTGDLGDLSPTQ  129

Query  669   LNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMI--VNKSKKVGESSSDVERALDNH  496
               +++ LQ +TV+EE+ L+ +++  Q D A E        +  +K+G   S V RA D+ 
Sbjct  130   --RVSELQCETVKEENALTDQLSEWQ-DGASELAGSTSGTDVDEKIGRLVSIVHRA-DDL  185

Query  495   AVAMGRMVVE  466
              +   RM+V+
Sbjct  186   RLRTVRMIVD  195



>ref|XP_008463763.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
Length=235

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 82/152 (54%), Gaps = 5/152 (3%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGD----DELFGVVDRSVKHFEEYQQHRALLAQQNGGP  853
             +  W  Q    +++LS   + N       D L  +V   + H+ +Y + +++ A+++   
Sbjct  12    YATWFDQLHRLVDQLSSTAKDNHNSSSAADHLARLVQTVMSHYCDYYRVKSMAAERDPLS  71

Query  852   PFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISAT  673
              F +P W T+ E +  WI G RP+ +  L+YS      +S +   L+G   G LGD+S +
Sbjct  72    VFSAP-WATSLERSLHWIAGWRPTTTFHLIYSESSILFESRIVDILRGLHTGDLGDLSPS  130

Query  672   QLNQINALQSKTVREEDKLSSRIATLQEDMAD  577
             Q+ +++ LQ +TV EE+ ++  ++  Q+D+++
Sbjct  131   QIRRVSELQCETVEEENAITEELSEWQDDVSE  162



>gb|EAY72627.1| hypothetical protein OsI_00493 [Oryza sativa Indica Group]
Length=269

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 133/241 (55%), Gaps = 12/241 (5%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLG------DDELFGVVDRSVKHFEEYQQHRALLAQQNG  859
             F+ WI++Q  D+  L  A  +         D EL  +VDR + H+E Y + ++  A  + 
Sbjct  28    FECWISEQSRDLAALRSAASAATNPAAPPDDAELRRLVDRVLGHYEHYYRTKSAAASTDV  87

Query  858   GPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGY--LQGERKGSLGD  685
                F SPSW +T EN ++W GG RP+ ++ L+YS  GA L++ L  +    G   G LGD
Sbjct  88    LRMF-SPSWTSTTENLYLWCGGWRPTAALHLLYSKSGAQLETQLPVFLAGGGLGTGDLGD  146

Query  684   ISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERAL  505
             +SA QL   + LQ  T+ +E ++ +  A+ QE +A      +V  +   G  +  +E  +
Sbjct  147   LSAEQLQAADQLQRITISKEREIENAAASAQESLAT---VKMVELAGGGGVDAEGMEMEM  203

Query  504   DNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRDGAAA  325
              + A  M R++  AD LRL T+ E++ +L P QA H L+ A +LHL++HE+ +++DG  A
Sbjct  204   RSKADGMRRVLEMADGLRLETMREVVALLRPSQAVHFLIAAAELHLAVHEFGRRKDGDGA  263

Query  324   G  322
              
Sbjct  264   A  264



>ref|XP_010695960.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor TGA5 [Beta 
vulgaris subsp. vulgaris]
Length=242

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 69/121 (57%), Gaps = 2/121 (2%)
 Frame = -1

Query  930  VVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
            +VD+ V H+ +Y + +A  A  +    F +P W +  E +  W+ G RP+    L+Y+  
Sbjct  42   LVDKVVTHYAQYYEKKAATAXTDVLSLFAAP-WASALERSLNWVAGFRPTTLFHLIYTES  100

Query  750  GADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMA-DE  574
                +SH+   L+G R G LG+++  QL +++ LQ  TV++E+++   + T QE++A  E
Sbjct  101  SIRFESHVADILRGCRTGDLGELTPGQLARVSELQCLTVQDENQIGDELGTWQEEVARSE  160

Query  573  P  571
            P
Sbjct  161  P  161



>ref|XP_008442399.1| PREDICTED: transcription factor HBP-1b(c38) [Cucumis melo]
Length=235

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 78/155 (50%), Gaps = 21/155 (14%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGP  853
              +  F+ W+ +QR  +++L  A   +  + +L   + R + H+E+Y + ++ +AQ +   
Sbjct  11    FKAFFEAWLLRQRNYLDDLLSAAHGSPHNRDLQVSISRILSHYEDYYEKKSRIAQTDIFL  70

Query  852   PFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISAT  673
              F +P W TT+E   +WIGG RP L IRLV                      S+ D+S  
Sbjct  71    VF-TPPWFTTYERTLLWIGGFRPGLIIRLV--------------------NQSIDDLSDE  109

Query  672   QLNQINALQSKTVREEDKLSSRIATLQEDMADEPL  568
             Q+ +I  L+  T  EE  L++ +A +QE +A  PL
Sbjct  110   QVVRIRRLKDDTKIEERLLNNDLAKIQEKVAAPPL  144



>ref|XP_007149576.1| hypothetical protein PHAVU_005G081900g [Phaseolus vulgaris]
 gb|ESW21570.1| hypothetical protein PHAVU_005G081900g [Phaseolus vulgaris]
Length=215

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 78/148 (53%), Gaps = 5/148 (3%)
 Frame = -1

Query  996  REDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFE  817
            R   E+L   V+  L D+    V+D+ ++  ++Y + +    +++    FLSP W TT E
Sbjct  10   RRWFEQLQEMVQ-RLKDEHNEEVMDKVMRQHQDYYRAKWAAVEKDPLCVFLSP-WTTTLE  67

Query  816  NAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKT  637
             +  WI G RP+ +  L+Y+      +SH+   L G R G LGD++ +Q   ++ LQ  T
Sbjct  68   RSLHWITGWRPTTAFHLIYTESSLLFESHIIDILHGLRTGDLGDLTPSQFRHVSDLQCDT  127

Query  636  VREEDKLSSRIATLQE---DMADEPLAM  562
            V+EE+ +   ++  Q+   +M D  + M
Sbjct  128  VKEENAIQEELSEWQDSASEMGDPDMDM  155



>ref|NP_001042081.1| Os01g0159000 [Oryza sativa Japonica Group]
 dbj|BAB08196.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF03995.1| Os01g0159000 [Oryza sativa Japonica Group]
 gb|EAZ10627.1| hypothetical protein OsJ_00459 [Oryza sativa Japonica Group]
Length=269

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 133/241 (55%), Gaps = 12/241 (5%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLG------DDELFGVVDRSVKHFEEYQQHRALLAQQNG  859
             F+ WI++Q  D+  L  A  +         D EL  +V+R + H+E Y + ++  A  + 
Sbjct  28    FECWISEQSRDLAALRSAASAATNPAAPPDDAELHRLVNRVLGHYEHYYRTKSAAASTDV  87

Query  858   GPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGY--LQGERKGSLGD  685
                F SPSW +T EN ++W GG RP+ ++ L+YS  GA L++ L  +    G   G LGD
Sbjct  88    LRMF-SPSWTSTTENLYLWCGGWRPTAALHLLYSKSGAQLETQLPVFLAGGGLGAGDLGD  146

Query  684   ISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERAL  505
             +SA QL   + LQ  TV +E ++ +  A+ QE +A      +V  +   G  +  +E  +
Sbjct  147   LSAEQLQAADQLQRITVSKEREIENAAASAQESLAT---VKMVELAGGGGMDAEGMEMEM  203

Query  504   DNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRDGAAA  325
              + A  M R++  AD LRL T+ E++ +L P QA H L+ A +LHL++HE+ +++DG  A
Sbjct  204   RSKADGMRRVLEMADGLRLETMREVVALLRPSQAVHFLIAAAELHLAVHEFGRRKDGDGA  263

Query  324   G  322
              
Sbjct  264   A  264



>ref|XP_008806140.1| PREDICTED: transcription factor TGA7-like [Phoenix dactylifera]
Length=277

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 102/214 (48%), Gaps = 19/214 (9%)
 Frame = -1

Query  1059  SSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNL----------GDDE--LFGVVDRS  916
             +S A +       F  W+ Q   D+  L  A E +L           DDE  L  +V+  
Sbjct  2     ASQAAEQEIFAHFFDCWLGQLDRDLRALLAADEPSLDTRHHPHDDANDDEHQLRSLVEMV  61

Query  915   VKHFEEYQQHRALLAQ-QNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADL  739
             + H+E Y  +RA LA  +       S +W ++ E  F+W GG RPS + +L+YS  G  +
Sbjct  62    LGHYEYY--YRAKLASARRDVLTIFSTAWASSTEKLFLWAGGWRPSAAFQLLYSELGRRI  119

Query  738   DSHL-QGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAM  562
             +  L QG L   R   L  +SA QL Q++ LQ KT++ E K+S   A  QE +A   +  
Sbjct  120   ERCLVQGVL---RVQDLTRLSALQLEQVDRLQRKTIKTERKISEEEAKAQELVAWPQMVE  176

Query  561   IVNKSKKVGESSSDVERALDNHAVAMGRMVVEAD  460
             I ++  + G   + +E  L     AM R++  AD
Sbjct  177   ISHEITESGREVAAMEEGLVGAKEAMKRVLERAD  210



>ref|XP_010449484.1| PREDICTED: uncharacterized protein LOC104731709 isoform X2 [Camelina 
sativa]
Length=153

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = -1

Query  723  GYLQGERKG--SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK  550
            G   GE  G  S+ D++A QL +IN L  KTV+ E+KLS + A+LQED AD P+AM    
Sbjct  4    GETHGEIGGEDSMSDLTAEQLFKINELHLKTVQAENKLSKQSASLQEDTADIPMAMAAFY  63

Query  549  SKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklh  370
             +++GE+   VERALD H   M  ++VEADKLRL T+T++++ILT +QA   LL  KKLH
Sbjct  64   KEEIGETDVVVERALDKHEEDMAGLLVEADKLRLTTMTKIVEILTAVQAVDFLLAGKKLH  123

Query  369  LSIHEWSKKRD  337
            L++HEW + R+
Sbjct  124  LAMHEWGRCRE  134



>emb|CDX78883.1| BnaA01g09500D [Brassica napus]
Length=125

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -1

Query  1071  IEMSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDD-ELFGVVDRSVKHFEEY  895
             +E  SSS ++  +  C + +W++ Q + M +L RA+ +   +D  L  ++   ++ F++Y
Sbjct  1     MENPSSSNIEEVQQEC-YDEWMSLQAKRMTDLKRALANGEKNDGALRELIQSVIEDFKDY  59

Query  894   QQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYL  715
              + R+  +++     F +P+W T  ENA +W+GGCRPS  IRLVY++CG+  +  L  + 
Sbjct  60    ARKRSEHSRRYSSNYF-APTWNTCLENALLWMGGCRPSSFIRLVYAMCGSQTELRLTNFF  118

Query  714   Q  712
             +
Sbjct  119   R  119



>ref|XP_010502248.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Camelina 
sativa]
Length=245

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 94/196 (48%), Gaps = 16/196 (8%)
 Frame = -1

Query  1017  QDWIAQQREDMEELSRAVE----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQ-QNGG  856
             Q WI Q +  +  L  A      S  GD+E L   V+R +KHF E+  HRA  A  +   
Sbjct  15    QSWIEQLQHHLNYLRSAQNHHRNSVTGDEERLREAVERVMKHFREF--HRAKWATTETDV  72

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
                ++  W +  E +  W+GG RP+    LVY+      +S +   L+G R G L D+S 
Sbjct  73    VGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSP  132

Query  675   TQLNQI--------NALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSD  520
             +Q ++I        + LQ +TV+EE+ ++  ++  Q+D ++  +    N  +++   +  
Sbjct  133   SQFSRIKFVKGRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRRLAEI  192

Query  519   VERALDNHAVAMGRMV  472
             V R  D     + R+V
Sbjct  193   VHRTDDLRLRTITRVV  208



>ref|XP_003565204.1| PREDICTED: transcription factor TGA2-like [Brachypodium distachyon]
Length=257

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 103/200 (52%), Gaps = 9/200 (5%)
 Frame = -1

Query  1047  VDHRRLRCVFQDWIAQQREDMEEL-SRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLA  871
             VD       F  WI++Q  D+  L   A  ++    +L  +VDR + H+E Y + ++  A
Sbjct  15    VDGEPFTKFFGCWISEQSRDLAALREAAAAASSSSADLRRLVDRVLGHYEHYYRAKSAAA  74

Query  870   QQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGE---RK  700
               +    F +PSW +T E+ ++W GG RP+ ++ L+YS  GA L++ L  +L G    R 
Sbjct  75    AADVRAMF-APSWISTTESLYLWCGGWRPTAALHLLYSKSGAQLEAQLPAFLDGTGSLRG  133

Query  699   GSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSD  520
               LG +SA QL+  + LQ +T+  E ++    A  QE +A   +  +   + +    ++ 
Sbjct  134   DDLGGLSADQLHAADQLQRRTIGREREIEEAAAAAQESLATGKMVELATGAME----AAG  189

Query  519   VERALDNHAVAMGRMVVEAD  460
             +ER ++  A  M R++  AD
Sbjct  190   LEREMEAKAEGMRRVLEMAD  209



>ref|XP_010317336.1| PREDICTED: uncharacterized protein LOC104646038 [Solanum lycopersicum]
Length=226

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 118/229 (52%), Gaps = 31/229 (14%)
 Frame = -1

Query  1011  WIAQQREDMEELSRAV---ESNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQQNGGPPFL  844
             W + Q E++ EL  AV    +N  D+E L  ++++ +KHF+E+ + R  LA+++      
Sbjct  20    WKSLQHEELTELEHAVGHVNNNEKDEEKLRQLIEKIIKHFQEHSEKRLHLARKDTFFFHS  79

Query  843   SPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLN  664
             +    T FE        C                        L+G     L ++S  QL+
Sbjct  80    THYALTEFEPDANETDPC------------------------LEGIVSRKLRELSGKQLS  115

Query  663   QINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALDNHAVAM  484
              +N LQSKT+ EE ++S++ A+LQED+AD+ L   V K KK G      + ALD H+  M
Sbjct  116   MVNDLQSKTIAEERRISNKFASLQEDIADQRL---VGKMKKEGHGCEKADEALDEHSRHM  172

Query  483   GRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
               ++ E D+LR++TL  ++ +L P+QA   L  AKK+   + +W +KRD
Sbjct  173   ADVIEEGDRLRMKTLKAIVNLLEPVQAVEYLTAAKKMRFCVQQWGEKRD  221



>ref|XP_006348396.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Solanum tuberosum]
Length=226

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 89/174 (51%), Gaps = 5/174 (3%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELS---RAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPP  850
             +  W  Q +E + +LS   R   S    +    +V + V H  EY + ++L A+ +    
Sbjct  7     YDTWFDQLKEIVRQLSQVPRPATSEQHRELHQQLVQKVVSHIYEYYRVKSLAAKNDILSV  66

Query  849   FLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQ  670
             + +P W T+ E +  WI G RP+ +  L+Y+      +SH+   L+G R G LGD+S  Q
Sbjct  67    YSAP-WSTSLERSLHWIAGWRPTTAFHLIYTESSILFESHIIDILRGLRYGDLGDLSPDQ  125

Query  669   LNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERA  508
             L +++ LQ + V+EE+ ++      Q D A E L ++ +   K+ +    +E+A
Sbjct  126   LARVSELQCEAVQEENSITDEFNDWQ-DSASEILGLMGDIEGKMEKLVEILEKA  178



>emb|CDX99444.1| BnaC01g11080D [Brassica napus]
Length=131

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = -1

Query  1071  IEMSSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDD-ELFGVVDRSVKHFEEY  895
             +E  SSS ++  +  C + +W++ Q + M +L RA+ +   +D  L  ++   ++ F++Y
Sbjct  1     MENPSSSNIEEVQQEC-YDEWMSLQAKRMTDLKRALANGEKNDGALRELIQSVIEDFKDY  59

Query  894   QQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHL  727
              + R+  +++     + +P+W T  ENA +W+GGCRPS  IRLVY++CG+   S L
Sbjct  60    ARKRSEHSRRYSSN-YFAPTWNTCLENALLWMGGCRPSSFIRLVYAMCGSQPSSVL  114



>ref|XP_006593493.1| PREDICTED: bZIP transcription factor bZIP132 isoform X1 [Glycine 
max]
Length=266

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 90/173 (52%), Gaps = 7/173 (4%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
             F D+  Q  E+++ L + +      +E   V+++ + H + Y   ++  A+++    FLS
Sbjct  56    FADFYEQWFEELQSLMQQLRGEGRKEE---VMEKVMWHHQNYYVAKSAAAEKDPLNVFLS  112

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQ  661
             P W TT E +  WI G RP+ +  L+Y+      +SH+   LQG R G LGD+S +Q  +
Sbjct  113   P-WATTLERSLHWITGWRPTTAFHLIYTESSLMFESHIIDILQGLRTGDLGDLSPSQFRR  171

Query  660   INALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALD  502
             ++ +Q  T  EE+ ++  ++  Q D   E +    N + K+G     +++A D
Sbjct  172   VSDIQCDT--EENAITEELSEWQ-DSVSEMMGPGANINDKIGRLVCIIKKADD  221



>ref|XP_006449515.1| hypothetical protein CICLE_v10017912mg [Citrus clementina]
 gb|ESR62755.1| hypothetical protein CICLE_v10017912mg [Citrus clementina]
Length=113

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 62/109 (57%), Gaps = 6/109 (6%)
 Frame = -1

Query  1050  AVDHR-RLRCVFQDWIAQQREDMEELSRA----VESNLGDDELFGVVDRSVKHFEEYQQH  886
             A  H+ R RC F +W+  Q +++ EL  A     ++   ++    +  + +K++EEY + 
Sbjct  2     ASSHKLRSRCCFNEWMHVQEQELNELLHAQTLTTKTENSENLCIRLTKKIIKNYEEYMEK  61

Query  885   RALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADL  739
             R+ L  +     F +P WC++ EN+  W+GGCRPS  IRL+Y+  G+ +
Sbjct  62    RSQLFHEEASG-FFAPRWCSSLENSSHWMGGCRPSSFIRLLYAQSGSKV  109



>ref|XP_010104255.1| hypothetical protein L484_016398 [Morus notabilis]
 gb|EXB99422.1| hypothetical protein L484_016398 [Morus notabilis]
Length=226

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 93/188 (49%), Gaps = 24/188 (13%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLS  841
              + W+ +Q   ++EL    +S   DD+L  +V R + H+++Y   ++ +A++N     LS
Sbjct  21    LEGWLVRQEHYLDELLSCRDSP--DDDLRDLVYRILAHYQQYYDEKSKIAERNIFL-VLS  77

Query  840   PSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQ  661
             P+W T+ E+AF+WIGG +P L+ RLV                      S+ D++  Q   
Sbjct  78    PTWFTSLEHAFLWIGGFKPGLAFRLV--------------------NDSIDDLTDDQRRS  117

Query  660   INALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK-SKKVGESSSDVERALDNHAVAM  484
             I  L  +T  EE  L+  +A +QE +A  PL  I  + +++V    +  + A+     A+
Sbjct  118   IGRLVQETKSEERALNDELAKIQESVAAPPLLDISRRCTRQVDGEIAGADVAIATLRTAL  177

Query  483   GRMVVEAD  460
               +V  AD
Sbjct  178   ETVVTAAD  185



>ref|XP_006366944.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum tuberosum]
Length=240

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 80/165 (48%), Gaps = 22/165 (13%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHR  883
             SS + +         Q W  +Q + + EL+   ++ L +  +  ++ R + H++EY + +
Sbjct  5     SSRANISVGSFEAFLQGWFLRQEQFLNELT-ITQTTLDESIMRNLISRILSHYQEYYEEK  63

Query  882   ALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER  703
             + ++  N    F SPSW T  E +F+WI G +P L+  LV +                  
Sbjct  64    SRMSHINVFYMF-SPSWFTPLEKSFLWIAGFKPGLAFPLVMN------------------  104

Query  702   KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPL  568
               S+ D+S  Q+ +IN L+ +T  EE  L  ++A LQE +A  PL
Sbjct  105   --SVNDLSENQIERINRLRIETRIEERNLMDKLAKLQESVAAPPL  147



>ref|XP_004137901.1| PREDICTED: transcription factor TGA7-like [Cucumis sativus]
 ref|XP_004156668.1| PREDICTED: transcription factor TGA7-like [Cucumis sativus]
 gb|KGN58743.1| hypothetical protein Csa_3G731050 [Cucumis sativus]
Length=235

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 76/155 (49%), Gaps = 21/155 (14%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGP  853
              +  F+ W+ +QR  +++L         + +L   + R + H+E+Y + ++ +AQ +   
Sbjct  11    FKAFFEAWLLRQRNYLDDLLSTAHGTPQNRDLQVSISRILSHYEDYYEKKSRIAQTDIFL  70

Query  852   PFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISAT  673
              F +P W TT+E   +WIGG RP L +RLV                      S+ D+S  
Sbjct  71    VF-TPPWFTTYEKTLLWIGGFRPGLIVRLV--------------------NQSIDDLSDE  109

Query  672   QLNQINALQSKTVREEDKLSSRIATLQEDMADEPL  568
             Q+ +I  L+  T  EE  L++ +A +QE +A  PL
Sbjct  110   QVVRIRRLKDDTKVEERLLNNDLAKIQEKVAAPPL  144



>ref|XP_002882899.1| hypothetical protein ARALYDRAFT_341612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59158.1| hypothetical protein ARALYDRAFT_341612 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 96/197 (49%), Gaps = 16/197 (8%)
 Frame = -1

Query  1020  FQD-WIAQQREDMEELSRAVE-----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQQN  862
             FQ+ WI Q R  +  L R+V+     S  GD+E L   V+R ++HF EY + +    +++
Sbjct  13    FQESWIDQLRNHLNHL-RSVQNHHRNSATGDEERLREAVERVMEHFREYHRAKWATTEKD  71

Query  861   GGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDI  682
                   +P W +  E +  W+GG RP+    LVY+      +S +   L+G R G L D+
Sbjct  72    VIGVMATP-WASALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDL  130

Query  681   SATQL-------NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSS  523
             S +Q          ++ LQ +TV EE+ ++  ++  Q+D +D  +    +  +++   + 
Sbjct  131   SPSQFRVKFVKGRTVSELQCETVNEENAITDELSEWQDDASDLVMGTSSDPEQRIRRLAE  190

Query  522   DVERALDNHAVAMGRMV  472
              V R  D     + R+V
Sbjct  191   IVHRTDDLRLRTITRVV  207



>ref|XP_010487301.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Camelina 
sativa]
Length=244

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 92/195 (47%), Gaps = 15/195 (8%)
 Frame = -1

Query  1017  QDWIAQQREDMEELSRAVE----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQ-QNGG  856
             Q WI Q +  +  L  A      S  GD+E L   V+R ++HF EY  HRA  A  +   
Sbjct  15    QSWIEQLQHHLNHLRSAQNHHRNSVTGDEERLREAVERVMEHFREY--HRAKWATTEKDV  72

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
                ++  W +  E +  W+GG RP+    LVY+      +S +   L+G R G L D+S 
Sbjct  73    VGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSP  132

Query  675   TQL-------NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDV  517
             +Q          ++ LQ +TV+EE+ ++  ++  Q+D ++  +    N  +++   +  V
Sbjct  133   SQFRIKFVKGRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRRLAGIV  192

Query  516   ERALDNHAVAMGRMV  472
              R  D     + R+V
Sbjct  193   HRTDDLRLRTITRVV  207



>ref|XP_010502256.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Camelina 
sativa]
Length=244

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 92/195 (47%), Gaps = 15/195 (8%)
 Frame = -1

Query  1017  QDWIAQQREDMEELSRAVE----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQ-QNGG  856
             Q WI Q +  +  L  A      S  GD+E L   V+R +KHF E+  HRA  A  +   
Sbjct  15    QSWIEQLQHHLNYLRSAQNHHRNSVTGDEERLREAVERVMKHFREF--HRAKWATTETDV  72

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
                ++  W +  E +  W+GG RP+    LVY+      +S +   L+G R G L D+S 
Sbjct  73    VGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSP  132

Query  675   TQL-------NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDV  517
             +Q          ++ LQ +TV+EE+ ++  ++  Q+D ++  +    N  +++   +  V
Sbjct  133   SQFRIKFVKGRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRRLAEIV  192

Query  516   ERALDNHAVAMGRMV  472
              R  D     + R+V
Sbjct  193   HRTDDLRLRTITRVV  207



>ref|XP_004961243.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Setaria italica]
Length=230

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 80/170 (47%), Gaps = 12/170 (7%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHRALLAQQNGGPPF-L  844
             F  W    R    +LS A  S+    +L  +V R V H E Y   RA L      P + L
Sbjct  10    FHLWFRGLRSLRRDLSSARWSD-DPAQLEALVGRFVAHLESYCAARAEL-----DPVWTL  63

Query  843   SPSWCTTFE-NAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQL  667
             S  W +  E  A  W+ G RP+  + L+Y+  G   ++ L   L G R G+LGD+S  QL
Sbjct  64    SAPWASPAERGAAYWLAGWRPTTLVHLLYTESGRRFEAQLPDLLLGVRSGNLGDLSPAQL  123

Query  666   NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDV  517
              Q++ LQ + V EED LS  +A +QE        ++       GE+  DV
Sbjct  124   AQVDELQRRMVAEEDALSREMAQVQEGHG----VVVAAAPSPSGETELDV  169



>ref|XP_010465408.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Camelina 
sativa]
Length=244

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 91/195 (47%), Gaps = 15/195 (8%)
 Frame = -1

Query  1017  QDWIAQQREDMEELSRAVE----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQ-QNGG  856
             Q WI Q +  +  L  A      S  GD E L   V+R ++HF EY  HRA  A  +   
Sbjct  15    QSWIEQLQHHLNHLRSAQNHHRNSVTGDVERLREAVERVMEHFREY--HRAKWATTEKDV  72

Query  855   PPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISA  676
                ++  W +  E +  W+GG RP+    LVY+      +S +   L+G R G L D+S 
Sbjct  73    VGVMAAPWSSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSP  132

Query  675   TQL-------NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDV  517
             +Q          ++ LQ +TV+EE+ ++  ++  Q+D ++  +    N  +++   S  V
Sbjct  133   SQFRIKFVKGRTVSELQCETVKEENAITEELSEWQDDASELVMGTSSNPEQRIRRLSEIV  192

Query  516   ERALDNHAVAMGRMV  472
              R  D     + R+V
Sbjct  193   HRTDDLRLRTITRVV  207



>emb|CDX97614.1| BnaA05g24650D [Brassica napus]
Length=237

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 90/177 (51%), Gaps = 10/177 (6%)
 Frame = -1

Query  1011  WIAQQREDMEELSRAVE-----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQ-QNGGP  853
             WI Q +  +  L R+V+     S  GD+E L   V R ++   EY  HRA LA  +    
Sbjct  17    WIGQLQHHLNHL-RSVQNHHRNSATGDEERLREAVQRVMELCREY--HRAKLATTEKDVV  73

Query  852   PFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISAT  673
               ++  W +  E +  W+G  RP+    LVY+      +S +   L+G R G L D+S +
Sbjct  74    GVMAAPWSSALERSLHWVGDWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSPS  133

Query  672   QLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALD  502
             Q  +++ LQ +TV+EE+ ++  ++  Q+D ++  +  + N  +++   +  V RA D
Sbjct  134   QFRKVSELQCETVKEENAITEELSEWQDDASELVMGTVSNLDQRIRRLAEIVHRADD  190



>ref|XP_010552125.1| PREDICTED: transcription factor TGA7 [Tarenaya hassleriana]
Length=238

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 100/201 (50%), Gaps = 20/201 (10%)
 Frame = -1

Query  939  LFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVY  760
            L G V R + H  +Y   R  + + +      SP W +  E A  W+GG RP+ +  LVY
Sbjct  50   LHGAVKRVMVHCSDYYSARRSVTEADVASMVASP-WSSQLERALQWVGGWRPTAAFHLVY  108

Query  759  SLCGADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMA  580
            +    + D H +  + G+R G L D+S  QL +++ LQ KTV+EE+ ++   +  Q+   
Sbjct  109  T----ESDVHFESRIVGDRIGDLSDLSPLQLRRVSVLQCKTVKEENDITEEASDWQD---  161

Query  579  DEPLAMIVNKSKKVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaa  400
                    N S  V  +  +    LD+H + +  +V  AD LRL T+T ++ +L P QAA
Sbjct  162  --------NASLLVPGTVDN----LDDHILGLSDIVQMADNLRLATITGVVAMLNPFQAA  209

Query  399  hlllvakklhLSIHEWSKKRD  337
              L  A KL   +H W   RD
Sbjct  210  EFLTAAAKLLTGVHCWGMIRD  230



>ref|XP_004246934.1| PREDICTED: transcription factor TGA2-like [Solanum lycopersicum]
Length=240

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 99/205 (48%), Gaps = 27/205 (13%)
 Frame = -1

Query  1062  SSSSAVDHRRLRCVFQDWIAQQREDMEELSRAVESNLGDDELFGVVDRSVKHFEEYQQHR  883
             SS + +         Q W+ +Q E + EL+   ++ L +  +  ++ R + H++EY + +
Sbjct  5     SSRANISVGSFEAFLQGWLIRQEELLNELT-TTQNTLDESIIRNLISRILAHYQEYYEEK  63

Query  882   ALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGER  703
             + ++  N    F SPSW +  E +F+WI G +P L+  LV +                  
Sbjct  64    SRMSHINVFYMF-SPSWFSPLEKSFLWIAGFKPGLAFPLVMN------------------  104

Query  702   KGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSK----KVG  535
               S+ D++  Q+  IN L+ +T  +E  L  ++A +QE +A  PL  +  + +    + G
Sbjct  105   --SVNDLTENQIEMINGLKIETRIQERDLMDKLAKIQESVAAPPLMGLAQQYRMEMLQDG  162

Query  534   ESSSDVERALDNHAVAMGRMVVEAD  460
             E  S+V+  ++    AM  +V +AD
Sbjct  163   E-ISEVDEEIEIIRTAMENVVTDAD  186



>gb|KDO56688.1| hypothetical protein CISIN_1g047612mg [Citrus sinensis]
Length=238

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 94/195 (48%), Gaps = 25/195 (13%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEELSRAVESNLG--DDELFGVVDRSVKHFEEYQQHRALLAQQNG  859
                 F+ W+ +Q   ++EL  A E++    D++L  +V R + H+++Y Q ++ +AQ N 
Sbjct  18    FETFFRAWLVRQEHLLDELISAQENHHQSRDEDLKELVKRVLAHYQQYYQEKSKVAQHNV  77

Query  858   GPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDIS  679
                F +P+W T FE  F WI G  P+L+ R+V                      S+ D++
Sbjct  78    FLLF-APTWFTPFEQTFFWIAGFNPTLAFRVV--------------------NESVKDLA  116

Query  678   ATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVG--ESSSDVERAL  505
               Q  ++++L  +T  EE  L+  +A +QE +A   +  +  +  ++G  E +  VE   
Sbjct  117   DEQRQRMDSLSVETRVEEKLLNDELARIQESVAGPTIMELARRRGRLGEWEMTEGVEVTE  176

Query  504   DNHAVAMGRMVVEAD  460
              N   ++  +V  AD
Sbjct  177   SNLRASLESLVANAD  191



>ref|XP_004146086.1| PREDICTED: transcription factor TGA5-like [Cucumis sativus]
 ref|XP_004173947.1| PREDICTED: transcription factor TGA5-like [Cucumis sativus]
 gb|KGN55047.1| hypothetical protein Csa_4G625020 [Cucumis sativus]
Length=232

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 70/118 (59%), Gaps = 1/118 (1%)
 Frame = -1

Query  930  VVDRSVKHFEEYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLC  751
            +V   + H+ +Y + +++ A+++    F +P W T+ E +  WI G RP+ +  L+Y+  
Sbjct  43   LVQTVMSHYSDYYRVKSMAAERDPLSVFSAP-WATSLERSLHWIAGWRPTTTFHLIYTES  101

Query  750  GADLDSHLQGYLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMAD  577
                +S +   L+G   G LGD+S +Q+ +++ LQ +TV EE+ ++  ++  Q+D+++
Sbjct  102  SILFESRIFDILRGLHTGDLGDLSPSQIRRVSELQCETVEEENAITEELSEWQDDVSE  159



>ref|XP_010104546.1| hypothetical protein L484_025521 [Morus notabilis]
 gb|EXC01147.1| hypothetical protein L484_025521 [Morus notabilis]
Length=235

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 129/250 (52%), Gaps = 27/250 (11%)
 Frame = -1

Query  1065  MSSSSAVDHR-RLRCVFQDWIAQQREDMEELSR-AVESNLGDDEL---FGVVDRSVKHFE  901
             M++S+  + R R    +++W+A Q+  + +L   A E+   D++      ++++S+ H++
Sbjct  1     MANSNEPNSRDRFEAFYEEWLAGQQAILNQLLLVAAETAEKDNDCERRRSLIEQSLSHYQ  60

Query  900   EYQQHRALLAQQNGGPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQG  721
              Y + R  +A  +    F SP W ++ E A++WI G RP+L +RLV S            
Sbjct  61    RYFEERNDIASDDVFVVFSSP-WLSSLERAYLWIAGYRPTLILRLVES------------  107

Query  720   YLQGERKGSLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNK-SK  544
                      + D+S  Q  +++ L+++ VR E ++S  +A +QE +A  PL  +V++  +
Sbjct  108   --------GVADLSPEQARRMDRLKAEAVRLEQEVSEAMAAVQESVAARPLVALVSRMGR  159

Query  543   KVGESSSDVERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLS  364
              V    S ++ A+D     M  ++  AD LR  T+   +++L+P QA   L+ A +  L 
Sbjct  160   AVDGEVSAIDVAMDRLRAEMVGVLESADALRGSTMRRAIEVLSPAQAVKFLVAAAEFQLR  219

Query  363   IHEWSKKRDG  334
             I  W ++RD 
Sbjct  220   IRRWGQQRDS  229



>gb|EAY99001.1| hypothetical protein OsI_20960 [Oryza sativa Indica Group]
Length=223

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 74/148 (50%), Gaps = 12/148 (8%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDD--ELFGVVDRSVKHFEEYQQHRALLAQQNGGPPF  847
             F  W+   R    EL  A      DD  +L  +V R V H E Y   RA +      P +
Sbjct  10    FHLWLRGLRGLRRELRAA---RWADDPAQLGSLVGRFVAHVECYTAARAEM-----DPVW  61

Query  846   -LSPSWCTTFE-NAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISAT  673
              LS  W +  E  A  W+ G RP+  + L+Y+  G   ++ L   L G   G+LGD+S +
Sbjct  62    TLSAPWASPVERGAAYWLAGWRPTTLVHLLYTESGRRFEAQLPDLLLGVSSGNLGDLSPS  121

Query  672   QLNQINALQSKTVREEDKLSSRIATLQE  589
             QL QI+ LQ +TV EED LS  +A +QE
Sbjct  122   QLAQIDDLQRRTVAEEDGLSREMALVQE  149



>ref|NP_001056306.1| Os05g0560200 [Oryza sativa Japonica Group]
 dbj|BAF18220.1| Os05g0560200 [Oryza sativa Japonica Group]
Length=223

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 82/175 (47%), Gaps = 12/175 (7%)
 Frame = -1

Query  1020  FQDWIAQQREDMEELSRAVESNLGDD--ELFGVVDRSVKHFEEYQQHRALLAQQNGGPPF  847
             F  W+   R    EL  A      DD  +L  +V R V H E Y   RA +      P +
Sbjct  10    FHLWLRGLRGLRRELRAA---RWADDPAQLGSLVGRFVAHVECYTAARAEM-----DPVW  61

Query  846   -LSPSWCTTFE-NAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISAT  673
              LS  W +  E  A  W+ G RP+  + L+Y+  G   ++ L   L G   G+LGD+S +
Sbjct  62    TLSAPWASPVERGAAYWLAGWRPTTLVHLLYTESGRRFEAQLPDLLLGVSSGNLGDLSPS  121

Query  672   QLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERA  508
             QL QI+ LQ +TV EED LS  +A +QE      +   ++    VG     + RA
Sbjct  122   QLAQIDDLQRRTVAEEDGLSREMALVQEGHGAVAVGGGIDVDGIVGRVRGVLGRA  176



>emb|CDY70896.1| BnaCnng70220D [Brassica napus]
 emb|CDX98510.1| BnaC05g38650D [Brassica napus]
Length=237

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 90/177 (51%), Gaps = 10/177 (6%)
 Frame = -1

Query  1011  WIAQQREDMEELSRAVE-----SNLGDDE-LFGVVDRSVKHFEEYQQHRALLAQ-QNGGP  853
             W+ Q +  +  L R+V+     S  GD+E L   V+R ++   EY  HRA LA  +    
Sbjct  17    WVEQLQHHLNHL-RSVQNHHRNSATGDEERLREAVERVMELCREY--HRAKLATTEKDVV  73

Query  852   PFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISAT  673
               ++  W +  E +  W+G  RP+    LVY+      +S +   L+G R G L D+S +
Sbjct  74    GLMAAPWSSALERSLHWVGDWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSPS  133

Query  672   QLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDVERALD  502
             Q   ++ LQ +TV+EE+ ++  ++  Q+D ++  +  + N  +++   +  V RA D
Sbjct  134   QFRTVSELQCETVKEENAITEDLSEWQDDASELVMGTVSNLDQRIRRLAEIVHRADD  190



>ref|NP_193601.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AAZ52736.1| hypothetical protein At4g18660 [Arabidopsis thaliana]
 gb|AEE84073.1| uncharacterized protein AT4G18660 [Arabidopsis thaliana]
Length=152

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = -1

Query  696  SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDV  517
            S+ D++A QL +IN L  KTV  E+KL+   A+LQED AD P+A+     + +G++   V
Sbjct  15   SMSDLTAEQLFKINELHLKTVEAENKLTKVSASLQEDTADTPIAVAAFYKEVIGQADVVV  74

Query  516  ERALDNHAVAMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRD  337
            ERALD H   MG ++VEADKLR+ TLT+++ ILT +QAA  LL  KKLHL++HEW K R+
Sbjct  75   ERALDKHEEDMGGLLVEADKLRMTTLTKIVDILTAVQAADFLLAGKKLHLAMHEWGKSRE  134



>emb|CDX99442.1| BnaC01g11100D [Brassica napus]
Length=188

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = -1

Query  696  SLGDISATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSSDV  517
            S+ D++A QL +IN L  KTV+EE+ L+ + ATLQED AD P+A+     +++GE+  +V
Sbjct  70   SMSDLTAEQLFKINELHMKTVQEENMLTKQSATLQEDTADMPIAVAAFHKERIGEADVEV  129

Query  516  ERALDNHAVAMGRMVVEAD  460
            E ALD +   M RM+ EAD
Sbjct  130  ELALDKYEDEMARMLAEAD  148



>ref|XP_006429421.1| hypothetical protein CICLE_v10012620mg [Citrus clementina]
 ref|XP_006481058.1| PREDICTED: uncharacterized protein LOC102613676 [Citrus sinensis]
 gb|ESR42661.1| hypothetical protein CICLE_v10012620mg [Citrus clementina]
Length=238

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 84/169 (50%), Gaps = 23/169 (14%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEELSRAVESNLG--DDELFGVVDRSVKHFEEYQQHRALLAQQNG  859
                 F+ W+ +Q   ++EL  A E++    D++L  +V R + H+++Y Q ++ +AQ N 
Sbjct  18    FETFFRAWLVRQEHLLDELISAQENHHQSRDEDLKELVKRVLAHYQQYYQEKSKVAQHNV  77

Query  858   GPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDIS  679
                F +P+W T FE  F WI G  P+L+ R+V                      S+ D++
Sbjct  78    FLLF-APTWFTPFEQTFFWIAGFNPTLAFRVV--------------------NESVKDLA  116

Query  678   ATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGE  532
               Q  ++++L  +T  EE  L+  +A +QE +A   +  +  +  ++GE
Sbjct  117   DEQRQRMDSLSVETRVEEKLLNDELARIQESVAGPTIMELARRRGRLGE  165



>ref|XP_003634664.1| PREDICTED: transcription factor HBP-1b(c38) [Vitis vinifera]
Length=231

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 76/139 (55%), Gaps = 3/139 (2%)
 Frame = -1

Query  1011  WIAQQREDMEELSRAVESNLGDDE--LFGVVDRSVKHFEEYQQHRALLAQQNGGPPFLSP  838
             W     + +++L  A ++   D +  L  +V +   H+ +Y +  +  A+ +    F +P
Sbjct  10    WFDHLHDLLQQLRLAPKATAPDRDRALLDLVHKVRTHYSQYYRAMSYTARHDVVSLFAAP  69

Query  837   SWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQLNQI  658
              W ++ E +  W+ G RP+++  L+Y+      ++H+   L+G   G LGD+S  QL ++
Sbjct  70    -WSSSLERSLHWVAGWRPTIAFHLIYTHSSILFETHIVDILRGAHNGDLGDLSPAQLQRV  128

Query  657   NALQSKTVREEDKLSSRIA  601
             + LQ +TV EE+++++ ++
Sbjct  129   SELQCQTVGEENEITAELS  147



>ref|XP_006433711.1| hypothetical protein CICLE_v10003662mg, partial [Citrus clementina]
 gb|ESR46951.1| hypothetical protein CICLE_v10003662mg, partial [Citrus clementina]
Length=206

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 84/167 (50%), Gaps = 23/167 (14%)
 Frame = -1

Query  1032  LRCVFQDWIAQQREDMEELSRAV-ESNLGDDELFG-VVDRSVKHFEEYQQHRALLAQQNG  859
                 F+DW+ +Q     +L  A+   N+ ++EL   ++D+ + H+++Y   ++L A ++ 
Sbjct  31    FEAFFKDWLIRQENLSYQLLDAIAPENIHNNELHQCLIDQVLSHYQQYYLEKSLAATEDV  90

Query  858   GPPFLSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDIS  679
                 +SP W T  E  F+WIGG RPSL  +L+                      S+ D++
Sbjct  91    FQ-IISPPWLTFPERTFLWIGGFRPSLIFKLI--------------------ANSVQDLT  129

Query  678   ATQLNQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKV  538
             A Q +++  ++++T REE +L   +A +QE +A  P   +  +S  +
Sbjct  130   AEQESEVQQVKAETRREERELGQTMARVQESVASAPFMNLARRSANL  176



>ref|XP_011079057.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
 ref|XP_011079058.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=245

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/232 (28%), Positives = 117/232 (50%), Gaps = 27/232 (12%)
 Frame = -1

Query  1011  WIAQQREDMEELSRAVESNLGDDELFGV-----VDRSVKHFEEYQQHRALLAQQNGGPPF  847
             W+  Q   + +L   +E N  ++E + V     + + + H++ Y + +A + ++N     
Sbjct  18    WLIDQERYLRDLLGLMERNRSEEEEYEVRCKDLIQQVMGHYKHYFEAKARVVEENVFL-V  76

Query  846   LSPSWCTTFENAFMWIGGCRPSLSIRLVYSLCGADLDSHLQGYLQGERKGSLGDISATQL  667
             L P+W ++FE A++WIGG RP L  RLV                    K ++ D++  Q 
Sbjct  77    LMPTWFSSFERAYLWIGGFRPGLLFRLV--------------------KNNVLDLTEEQS  116

Query  666   NQINALQSKTVREEDKLSSRIATLQEDMADEPLAMIVNKSKKVGESSS-DVERALDNHAV  490
              +IN L ++   EE +L+     +QE +A  P+  +V +  ++   +  ++E A+D   +
Sbjct  117   QRINRLMAEIKEEEKELTDEFDRVQEVVASPPMVELVRRLGRLRNGAQHNMESAVDRLKL  176

Query  489   AMGRMVVEADklrlrtltellkilTPlqaahlllvakklhLSIHEWSKKRDG  334
             ++  +V  AD LR++T   L++IL P QA  LL    +L L +  W  +RDG
Sbjct  177   SLETLVECADFLRMKTGIILVEILKPAQAVRLLAAVAQLQLRVRRWGMQRDG  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2555722443024