BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c93411_g1_i1 len=333 path=[311:0-332]

Length=333
                                                                      Score     E

ref|XP_004514602.1|  PREDICTED: diamine acetyltransferase 1-like      78.6    2e-15   
ref|XP_004249522.1|  PREDICTED: probable acetyltransferase NATA1-...  76.6    1e-14   
ref|XP_006294945.1|  hypothetical protein CARUB_v10023999mg           75.1    3e-14   
emb|CDY14413.1|  BnaC03g21820D                                        75.1    4e-14   
ref|XP_002315313.2|  GCN5-related N-acetyltransferase family protein  74.3    7e-14   Populus trichocarpa [western balsam poplar]
gb|ABK93391.1|  unknown                                               74.3    8e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007218286.1|  hypothetical protein PRUPE_ppa010697mg           73.9    1e-13   
ref|XP_009133328.1|  PREDICTED: probable acetyltransferase NATA1-...  73.6    1e-13   
gb|EYU39619.1|  hypothetical protein MIMGU_mgv1a012952mg              73.6    1e-13   
ref|XP_007145441.1|  hypothetical protein PHAVU_007G239400g           73.6    1e-13   
ref|XP_006436451.1|  hypothetical protein CICLE_v10032618mg           73.2    2e-13   
ref|NP_181435.1|  probable acetyltransferase NATA1-like               73.2    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517238.1|  PREDICTED: probable acetyltransferase NATA1-...  73.2    2e-13   
ref|XP_011084320.1|  PREDICTED: probable acetyltransferase NATA1-...  72.4    3e-13   
emb|CDY07680.1|  BnaA03g18310D                                        72.4    3e-13   
ref|XP_004307374.1|  PREDICTED: tyramine N-feruloyltransferase 4/...  72.4    4e-13   
ref|XP_011041030.1|  PREDICTED: probable acetyltransferase NATA1-...  72.4    4e-13   
ref|XP_003535882.1|  PREDICTED: probable acetyltransferase NATA1-...  72.0    5e-13   
ref|XP_002879780.1|  hypothetical protein ARALYDRAFT_482921           71.6    6e-13   
gb|KDO46232.1|  hypothetical protein CISIN_1g026503mg                 71.6    6e-13   
ref|XP_009782835.1|  PREDICTED: probable acetyltransferase NATA1-...  71.6    7e-13   
ref|XP_002530925.1|  Tyramine N-feruloyltransferase 4/11, putative    71.2    9e-13   Ricinus communis
gb|ACJ83848.1|  unknown                                               71.2    1e-12   Medicago truncatula
ref|XP_006294913.1|  hypothetical protein CARUB_v10023984mg           70.9    1e-12   
ref|XP_010509079.1|  PREDICTED: probable acetyltransferase NATA1-...  70.9    1e-12   
ref|XP_004142435.1|  PREDICTED: tyramine N-feruloyltransferase 4/...  70.9    1e-12   
ref|XP_002531687.1|  Tyramine N-feruloyltransferase 4/11, putative    70.5    2e-12   Ricinus communis
ref|XP_007145442.1|  hypothetical protein PHAVU_007G239500g           70.9    2e-12   
ref|XP_010262883.1|  PREDICTED: probable acetyltransferase NATA1-...  70.5    2e-12   
gb|KFK36805.1|  hypothetical protein AALP_AA4G173600                  70.5    2e-12   
gb|KDP44395.1|  hypothetical protein JCGZ_20075                       70.5    2e-12   
ref|XP_008233301.1|  PREDICTED: probable acetyltransferase NATA1-...  70.1    2e-12   
emb|CDO99758.1|  unnamed protein product                              70.1    3e-12   
ref|XP_009595747.1|  PREDICTED: probable acetyltransferase NATA1-...  68.6    7e-12   
ref|XP_002272073.1|  PREDICTED: probable acetyltransferase NATA1-...  68.2    1e-11   Vitis vinifera
ref|XP_011031717.1|  PREDICTED: probable acetyltransferase NATA1-...  68.2    1e-11   
ref|XP_006285254.1|  hypothetical protein CARUB_v10006619mg           68.2    1e-11   
ref|XP_007145448.1|  hypothetical protein PHAVU_007G240100g           67.8    1e-11   
ref|XP_011077267.1|  PREDICTED: probable acetyltransferase NATA1-...  67.4    2e-11   
gb|AFK46864.1|  unknown                                               66.2    5e-11   
ref|XP_010555817.1|  PREDICTED: probable acetyltransferase NATA1-...  66.2    5e-11   
ref|XP_011077268.1|  PREDICTED: probable acetyltransferase NATA1-...  66.2    6e-11   
ref|XP_008446870.1|  PREDICTED: probable acetyltransferase NATA1-...  65.9    7e-11   
ref|NP_565898.1|  L-ornithine N5-acetyltransferase NATA1              65.9    8e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96852.1|  Unknown protein                                       65.5    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879781.1|  hypothetical protein ARALYDRAFT_482922           65.5    9e-11   
ref|XP_010505566.1|  PREDICTED: probable acetyltransferase NATA1-...  65.1    1e-10   
ref|XP_011016733.1|  PREDICTED: probable acetyltransferase NATA1-...  64.7    2e-10   
ref|XP_002312008.2|  GCN5-related N-acetyltransferase family protein  64.7    2e-10   Populus trichocarpa [western balsam poplar]
gb|ABK94515.1|  unknown                                               64.7    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006411125.1|  hypothetical protein EUTSA_v10017189mg           63.9    4e-10   
ref|XP_009368892.1|  PREDICTED: probable acetyltransferase NATA1-...  63.5    4e-10   
ref|XP_010558196.1|  PREDICTED: probable acetyltransferase NATA1-...  63.5    5e-10   
ref|XP_006294941.1|  hypothetical protein CARUB_v10023995mg           62.8    7e-10   
ref|XP_006294942.1|  hypothetical protein CARUB_v10023995mg           63.2    7e-10   
ref|XP_002273620.1|  PREDICTED: probable acetyltransferase NATA1-...  62.0    2e-09   Vitis vinifera
ref|XP_002311082.1|  hypothetical protein POPTR_0008s03740g           62.0    2e-09   Populus trichocarpa [western balsam poplar]
gb|EPS72761.1|  hypothetical protein M569_01998                       61.6    2e-09   
ref|XP_011077269.1|  PREDICTED: probable acetyltransferase NATA1-...  61.2    3e-09   
ref|XP_010509078.1|  PREDICTED: L-ornithine N5-acetyltransferase ...  60.8    5e-09   
ref|XP_010517239.1|  PREDICTED: L-ornithine N5-acetyltransferase ...  60.5    6e-09   
ref|XP_008366562.1|  PREDICTED: probable acetyltransferase NATA1-...  59.7    1e-08   
ref|XP_007009878.1|  Acyl-CoA N-acyltransferases (NAT) superfamil...  58.9    2e-08   
gb|AFK38887.1|  unknown                                               56.6    1e-07   
ref|XP_009382139.1|  PREDICTED: probable acetyltransferase NATA1-...  56.6    1e-07   
ref|XP_008365057.1|  PREDICTED: LOW QUALITY PROTEIN: probable ace...  56.6    2e-07   
emb|CDO99757.1|  unnamed protein product                              55.8    4e-07   
ref|XP_004142434.1|  PREDICTED: tyramine N-feruloyltransferase 4/...  54.7    7e-07   
ref|XP_008446873.1|  PREDICTED: probable acetyltransferase NATA1-...  54.7    9e-07   
ref|XP_008446872.1|  PREDICTED: probable acetyltransferase NATA1-...  54.3    1e-06   
ref|XP_008446871.1|  PREDICTED: probable acetyltransferase NATA1-...  54.3    1e-06   
gb|KGN52261.1|  hypothetical protein Csa_5G622760                     54.3    1e-06   
ref|XP_004164224.1|  PREDICTED: tyramine N-feruloyltransferase 4/...  53.5    2e-06   
ref|XP_004142493.1|  PREDICTED: tyramine N-feruloyltransferase 4/...  51.2    1e-05   
ref|XP_010670040.1|  PREDICTED: probable acetyltransferase NATA1-...  50.8    2e-05   
ref|XP_010693080.1|  PREDICTED: probable acetyltransferase NATA1-...  50.1    2e-05   
ref|XP_010689389.1|  PREDICTED: L-ornithine N5-acetyltransferase ...  49.3    8e-05   
ref|XP_006827452.1|  hypothetical protein AMTR_s00009p00114360        49.3    9e-05   
ref|XP_006836668.1|  hypothetical protein AMTR_s00088p00059900        48.1    2e-04   
ref|XP_010934574.1|  PREDICTED: probable acetyltransferase NATA1-...  48.1    2e-04   
ref|XP_010067321.1|  PREDICTED: probable acetyltransferase NATA1-...  47.8    3e-04   
ref|XP_010693079.1|  PREDICTED: L-ornithine N5-acetyltransferase ...  47.0    5e-04   
ref|XP_009796793.1|  PREDICTED: probable acetyltransferase NATA1-...  46.6    6e-04   
gb|AGJ98237.1|  PIG03 N-acetyltransferase-like protein                45.8    7e-04   



>ref|XP_004514602.1| PREDICTED: diamine acetyltransferase 1-like [Cicer arietinum]
Length=233

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 66/115 (57%), Gaps = 7/115 (6%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTL--ENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F S T+F LEVSP PF  T    NP + P  K+V+LDL ID+P+ + F  Q      VAG
Sbjct  78   FQSITIFILEVSPNPFTDTHFDNNPFYKPSTKVVNLDLPIDDPEKELFRTQHGNEVFVAG  137

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G Y+    + E   RKGF RMLL AVA QA KMGYGRV
Sbjct  138  FV--LFFPNYSTFLGKHGFYVEDLFVRECYRRKGFGRMLLTAVAKQAVKMGYGRV  190



>ref|XP_004249522.1| PREDICTED: probable acetyltransferase NATA1-like [Solanum lycopersicum]
Length=232

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 69/115 (60%), Gaps = 9/115 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLEN--PHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFTVF LEVS  PF P ++   P+FTPI K V+LDL I +P A++F         VAG
Sbjct  80   FTSFTVFLLEVSQTPF-PLIDQNYPNFTPIHKTVNLDLPITDPQAESF-RSCGNDVVVAG  137

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G YI    + E   RKGF +MLL AVAAQA KMGYGRV
Sbjct  138  FV--LFFPNYSTFLAKPGFYIEDIFVRECYRRKGFGKMLLSAVAAQAAKMGYGRV  190



>ref|XP_006294945.1| hypothetical protein CARUB_v10023999mg [Capsella rubella]
 gb|EOA27843.1| hypothetical protein CARUB_v10023999mg [Capsella rubella]
Length=227

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 63/115 (55%), Gaps = 7/115 (6%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTL--ENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F S TVF LEVSP PF  T    +P FTP  K  SLDL I++PD+  F         VAG
Sbjct  73   FKSVTVFLLEVSPSPFPTTFAASSPDFTPFLKTHSLDLPIEDPDSYNFSPDLSNDVVVAG  132

Query  157  YAP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
            +   +F  +  + +   G+     L   P  R+GF RMLL AVA QA KMGYG+V
Sbjct  133  FV--MFFPNYSSYLSKHGFCIEDLLVREPYRRRGFGRMLLTAVAKQAVKMGYGKV  185



>emb|CDY14413.1| BnaC03g21820D [Brassica napus]
Length=233

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 64/114 (56%), Gaps = 6/114 (5%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPH-FTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F SFTVF LEVS  PF  TL +P  FTP+ K  +LDL I++P++  F    L    VAG+
Sbjct  78   FKSFTVFLLEVSRSPFPATLPSPQDFTPLLKTHNLDLPIEDPESHNFTPDMLNDVVVAGF  137

Query  154  AP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
               LF  +  + +   G+         P  RKGF  MLL AVA QA KMGYGRV
Sbjct  138  V--LFFPNYSSFLAKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRV  189



>ref|XP_002315313.2| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
 gb|EEF01484.2| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
Length=236

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 7/115 (6%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFF--PTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFT+F LEVS +PF     L + +FTPI++I++LD  + +P+A+TF       A VAG
Sbjct  81   FQSFTIFLLEVSSRPFEKDSNLHSQNFTPIERIINLDHSLSDPEAETFRNGINGDAVVAG  140

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G Y+    + E   RKG  +MLL AVA+QA KMGYGRV
Sbjct  141  FV--LFFPNYSTFLGKPGFYVEDLFVRECYRRKGLGKMLLSAVASQAVKMGYGRV  193



>gb|ABK93391.1| unknown [Populus trichocarpa]
Length=236

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 7/115 (6%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFF--PTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFT+F LEVS +PF     L + +FTPI++I++LD  + +P+A+TF       A VAG
Sbjct  81   FHSFTIFLLEVSSRPFEKDSNLHSQNFTPIERIINLDHSLSDPEAETFRNGINGDAVVAG  140

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G Y+    + E   RKG  +MLL AVA+QA KMGYGRV
Sbjct  141  FV--LFFPNYSTFLGKPGFYVEDLFVRECYRRKGLGKMLLSAVASQAVKMGYGRV  193



>ref|XP_007218286.1| hypothetical protein PRUPE_ppa010697mg [Prunus persica]
 gb|EMJ19485.1| hypothetical protein PRUPE_ppa010697mg [Prunus persica]
Length=239

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 67/118 (57%), Gaps = 10/118 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLE--NPHFTPIDKIVSLDLLIDNPDAKTF*FQALI---GAT  167
            F SFT+F LEVS  PF   L+  NP + PI K+V+LDL I++PD   F     +    A 
Sbjct  80   FQSFTIFVLEVSHTPFVEHLQYNNPAYPPITKVVNLDLPINDPDRDLFRSNGGVLGGDAC  139

Query  166  VAGYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            VAG+   LF  +  T +   G YI    + E   RKG  +MLL AVA QA KMGYGRV
Sbjct  140  VAGFV--LFFPNYSTFLAKPGFYIEDLFVRECYRRKGLGKMLLSAVAKQAVKMGYGRV  195



>ref|XP_009133328.1| PREDICTED: probable acetyltransferase NATA1-like [Brassica rapa]
Length=234

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 64/114 (56%), Gaps = 6/114 (5%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENP-HFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F SFTVF LEVS  PF  TL +P  FTP+ K  +LDL I++P++  F    L    VAG+
Sbjct  79   FKSFTVFLLEVSRSPFPTTLPSPPDFTPLLKTHNLDLPIEDPESYNFTPDMLNDVVVAGF  138

Query  154  AP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
               LF  +  + +   G+         P  RKGF  MLL AVA QA KMGYGRV
Sbjct  139  V--LFFPNYSSFLAKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRV  190



>gb|EYU39619.1| hypothetical protein MIMGU_mgv1a012952mg [Erythranthe guttata]
Length=235

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 69/117 (59%), Gaps = 11/117 (9%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGAT----V  164
            F SFTVF LE+S  PFFP+ +NPHFTP+ K   LDL I +P+ + F   A  GAT    V
Sbjct  79   FTSFTVFLLELSNSPFFPS-QNPHFTPVLKPHHLDLPIADPEKEIFRSSA-AGATGDVTV  136

Query  163  AGYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
             G+   LF  +  + +   G YI    + E   RKG  +MLL  +AAQA KMGYGRV
Sbjct  137  GGFV--LFFPNYSSFLAKPGFYIEDIFVRECYRRKGLGQMLLSTLAAQAAKMGYGRV  191



>ref|XP_007145441.1| hypothetical protein PHAVU_007G239400g [Phaseolus vulgaris]
 gb|ESW17435.1| hypothetical protein PHAVU_007G239400g [Phaseolus vulgaris]
Length=230

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 9/115 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTL--ENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFT+F LE SP PF  +    NP F P+ K V+L + I++P+ +TF  +++   TV G
Sbjct  77   FHSFTIFLLEASPNPFAASTLDSNPFFKPLTKFVNLRVPIEDPERETF--KSMDDVTVVG  134

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  + +   G Y+    + E   RKGF RMLL AVA QA KMGYGRV
Sbjct  135  FV--LFFPNYSSFLAKPGFYVEDLFVRECYRRKGFGRMLLSAVAKQAVKMGYGRV  187



>ref|XP_006436451.1| hypothetical protein CICLE_v10032618mg [Citrus clementina]
 ref|XP_006485644.1| PREDICTED: probable acetyltransferase NATA1-like [Citrus sinensis]
 gb|ESR49691.1| hypothetical protein CICLE_v10032618mg [Citrus clementina]
Length=237

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 67/117 (57%), Gaps = 9/117 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF----FPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATV  164
            F SFTV  LEVSP PF     P      ++P+D+IV LDL +D+PD +TF        TV
Sbjct  79   FTSFTVLLLEVSPSPFAPLHSPASSPSPYSPVDRIVYLDLPLDDPDRETFASDETHDVTV  138

Query  163  AGYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            AG+   LF  +  T +   G YI    + E   RKGF RMLL AVA QA KMGYGRV
Sbjct  139  AGFV--LFFPNYSTFLAKPGFYIEDIFVRECYRRKGFGRMLLSAVAKQAVKMGYGRV  193



>ref|NP_181435.1| probable acetyltransferase NATA1-like [Arabidopsis thaliana]
 sp|Q9ZV06.1|NATAL_ARATH RecName: Full=Probable acetyltransferase NATA1-like [Arabidopsis 
thaliana]
 gb|AAC79612.1| unknown protein [Arabidopsis thaliana]
 gb|AAO44047.1| At2g39020 [Arabidopsis thaliana]
 gb|AEC09627.1| uncharacterized protein AT2G39020 [Arabidopsis thaliana]
Length=236

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLEN---PHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFTVF LEVS  PF  T+ +   P FTP  K  +LDL ID+P++  F    L    VA
Sbjct  79   FQSFTVFLLEVSRSPFPATITSSPSPDFTPFFKTHNLDLPIDDPESYNFSPDMLNDVVVA  138

Query  160  GYAP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  + +   G+         P  RKGF  MLL AVA QA KMGYGRV
Sbjct  139  GFV--LFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRV  192



>ref|XP_010517238.1| PREDICTED: probable acetyltransferase NATA1-like [Camelina sativa]
Length=236

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLE---NPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFTVF LEVS  PF  T     +P FTP  K  SLDL I++P++  F    L    VA
Sbjct  79   FQSFTVFLLEVSRSPFTATASPSSSPDFTPFLKTHSLDLPIEDPESYNFSPDMLNDVVVA  138

Query  160  GYAP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  T +   G+         P  RKGF  MLL AVA QA KMGYGRV
Sbjct  139  GFV--LFFPNYSTFLSKPGFYIEDIFVREPYRRKGFGSMLLSAVAKQAVKMGYGRV  192



>ref|XP_011084320.1| PREDICTED: probable acetyltransferase NATA1-like [Sesamum indicum]
Length=239

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 67/117 (57%), Gaps = 8/117 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQA----LIGATV  164
            F SFTVF LE+S  PF  T  NPHF P+   V LDL ID+P+ ++F  +A    +IG  V
Sbjct  80   FTSFTVFLLELSSIPFLAT-ANPHFPPLLNSVLLDLPIDDPERESFRSRANDVNIIGNDV  138

Query  163  AGYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
                  LF  +  T +   G YI    + E   RKG  +MLL AVAAQA KMGYGRV
Sbjct  139  IVGGFVLFFPNYSTFLAKPGFYIEDIFVRECYRRKGLGKMLLTAVAAQAAKMGYGRV  195



>emb|CDY07680.1| BnaA03g18310D [Brassica napus]
Length=234

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 64/114 (56%), Gaps = 6/114 (5%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENP-HFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F SFTVF LEVS  PF  +L +P  FTP+ K  +LDL I++P++  F    L    VAG+
Sbjct  79   FKSFTVFLLEVSRSPFPTSLPSPPDFTPLLKTHNLDLPIEDPESYNFTPDMLNDVVVAGF  138

Query  154  AP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
               LF  +  + +   G+         P  RKGF  MLL AVA QA KMGYGRV
Sbjct  139  V--LFFPNYSSFLAKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRV  190



>ref|XP_004307374.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Fragaria 
vesca subsp. vesca]
Length=234

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 67/116 (58%), Gaps = 10/116 (9%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPT---LENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFTVF LE SP PF P      NPH+ P+ K ++LDL +++P+   F +  +  A VA
Sbjct  81   FQSFTVFVLEASPTPF-PNDAHYSNPHYQPVVKTLNLDLPVEDPERLVF-WSGVGDAVVA  138

Query  160  GYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  T +   G Y+    + E   RKG  +MLL AVA QA KMGYGRV
Sbjct  139  GFV--LFFPNYSTFLGKPGFYVEDLFVRECYRRKGMGKMLLSAVAKQAVKMGYGRV  192



>ref|XP_011041030.1| PREDICTED: probable acetyltransferase NATA1-like [Populus euphratica]
Length=236

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 70/115 (61%), Gaps = 7/115 (6%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFF--PTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFT+F LEVS +PF     L + +FTP+++I++LD  + +P+A+TF       A VAG
Sbjct  81   FHSFTIFLLEVSSRPFEKDSNLHSQNFTPVERIINLDHSLIDPEAETFRNGINGDAVVAG  140

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G Y+    + E   RKG  +MLL AVA+QA KMGYGRV
Sbjct  141  FV--LFFPNYSTFLGKPGFYVEDLFVRECYRRKGLGKMLLSAVASQAVKMGYGRV  193



>ref|XP_003535882.1| PREDICTED: probable acetyltransferase NATA1-like [Glycine max]
Length=228

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 67/115 (58%), Gaps = 9/115 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPH--FTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFTV  LE SP PF  +  NP+  + PI K+++L   I++P++ TF  + L G TV G
Sbjct  75   FQSFTVLLLEASPTPFLNSTLNPNPFYKPITKLLNLSNPINDPESDTF--KTLDGVTVVG  132

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G Y+    + E   RKGF RMLL AVA QA KM YGRV
Sbjct  133  FV--LFFPNYSTFLGKPGFYVEDLFVRECYRRKGFGRMLLSAVAKQAVKMEYGRV  185



>ref|XP_002879780.1| hypothetical protein ARALYDRAFT_482921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56039.1| hypothetical protein ARALYDRAFT_482921 [Arabidopsis lyrata subsp. 
lyrata]
Length=235

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 63/115 (55%), Gaps = 7/115 (6%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENP--HFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFTVF LEVS  PF  T+ +P   FTP  K  +LDL I++P++  F    L    VAG
Sbjct  79   FQSFTVFLLEVSRSPFPTTITSPSPDFTPFLKTHNLDLPIEDPESYNFSPDMLNDVVVAG  138

Query  157  YAP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  + +   G+         P  RKGF  MLL AVA QA KMGYGRV
Sbjct  139  FV--LFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRV  191



>gb|KDO46232.1| hypothetical protein CISIN_1g026503mg [Citrus sinensis]
Length=237

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 67/117 (57%), Gaps = 9/117 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF----FPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATV  164
            F SFTV  LEVSP PF     P      ++P+D+IV LDL +D+PD +TF        TV
Sbjct  79   FTSFTVLLLEVSPSPFAPLHSPASSPSPYSPVDRIVYLDLPLDDPDRETFASDETHDVTV  138

Query  163  AGYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            AG+   LF  +  T +   G YI    + E   RKGF R+LL AVA QA KMGYGRV
Sbjct  139  AGFV--LFFPNYSTFLAKPGFYIEDIFVRECYRRKGFGRILLSAVAKQAVKMGYGRV  193



>ref|XP_009782835.1| PREDICTED: probable acetyltransferase NATA1-like [Nicotiana sylvestris]
Length=235

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 69/116 (59%), Gaps = 10/116 (9%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPH---FTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F +FT+F LEVS  PF P ++N +   F+PI K ++LDL I +P+A+ F         VA
Sbjct  80   FTTFTIFLLEVSQNPFLP-IDNQNCTNFSPIHKTINLDLPISDPEAEMF-KSGGNDEVVA  137

Query  160  GYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  + +   G YI    + E   RKGF R+LL AVAAQA KMGYGRV
Sbjct  138  GFV--LFFPNYSSFLAKPGFYIEDIFVMECYRRKGFGRLLLSAVAAQAAKMGYGRV  191



>ref|XP_002530925.1| Tyramine N-feruloyltransferase 4/11, putative [Ricinus communis]
 gb|EEF31440.1| Tyramine N-feruloyltransferase 4/11, putative [Ricinus communis]
Length=222

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 63/122 (52%), Gaps = 24/122 (20%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F SFT F  EVS KP  P +E+PHFTP++++V +D  + +PDA+TF   +   A V G+ 
Sbjct  62   FQSFTTFLAEVSTKPL-PRIESPHFTPVERVVQIDRPVIDPDAETFKSTSGGDAVVVGFT  120

Query  151  ------------P*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYG  8
                        P   L     R  HRG+           G  ++LL AVA+Q  KMGYG
Sbjct  121  LIFPNFSTFMGKPGFHLEDLFIREGHRGF-----------GMGKLLLSAVASQTVKMGYG  169

Query  7    RV  2
            RV
Sbjct  170  RV  171



>gb|ACJ83848.1| unknown [Medicago truncatula]
 gb|AFK47209.1| unknown [Medicago truncatula]
 gb|KEH41364.1| acyl-CoA N-acyltransferase (NAT) family protein [Medicago truncatula]
Length=233

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 64/115 (56%), Gaps = 7/115 (6%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTL--ENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F S T+  LEVS  PF  T    +P + PI K V+LDL ID+P+ + F  Q      VAG
Sbjct  78   FLSTTILILEVSQNPFTDTHFDNDPFYKPITKTVTLDLPIDDPEKENFKTQHGNEVFVAG  137

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G Y+    + E   RKGF +MLL AVA QA KMGYGRV
Sbjct  138  FV--LFFPNYSTFLGKHGFYVEDLFVRECYRRKGFGKMLLTAVAKQAVKMGYGRV  190



>ref|XP_006294913.1| hypothetical protein CARUB_v10023984mg [Capsella rubella]
 gb|EOA27811.1| hypothetical protein CARUB_v10023984mg [Capsella rubella]
Length=232

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 60/113 (53%), Gaps = 5/113 (4%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F SFTVF LEVS  PF     +P FTP  K  +LDL I++ ++  F    L    +AG+ 
Sbjct  78   FQSFTVFLLEVSRSPFTAAAPSPDFTPFHKTHNLDLPIEDRESYNFSPDMLNDVVIAGFV  137

Query  151  P*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
              LF  +  + +   G+         P  RKGF  MLL AVA QA KMGYGRV
Sbjct  138  --LFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRV  188



>ref|XP_010509079.1| PREDICTED: probable acetyltransferase NATA1-like [Camelina sativa]
Length=235

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 61/114 (54%), Gaps = 6/114 (5%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTL-ENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F SFTVF LEVS  PF      +P FTP  K  SLDL I++P++  F    L    VAG+
Sbjct  79   FQSFTVFLLEVSRSPFTEIAPSSPDFTPFLKTHSLDLPIEDPESYNFSPDMLNDVVVAGF  138

Query  154  AP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
               LF  +  + +   G+         P  RKGF  MLL AVA QA KMGYGRV
Sbjct  139  V--LFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLSAVAKQAVKMGYGRV  190



>ref|XP_004142435.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
 ref|XP_004164218.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
 gb|KGN52260.1| hypothetical protein Csa_5G622750 [Cucumis sativus]
Length=235

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 68/116 (59%), Gaps = 9/116 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF---FPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFTVF LEVS KPF    P   NP++TP+ +I++ DL +D+P+ + F  +      VA
Sbjct  80   FQSFTVFILEVSTKPFPENSPHNYNPNYTPVARIINSDLPVDDPEREIFKSEDE-NVVVA  138

Query  160  GYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  T +   G Y+    + E   RKGF ++LL AVA QA KM YGRV
Sbjct  139  GFV--LFFPNFSTFLGKPGLYVEDIFVRECYRRKGFGKLLLSAVAKQAVKMNYGRV  192



>ref|XP_002531687.1| Tyramine N-feruloyltransferase 4/11, putative [Ricinus communis]
 gb|EEF30706.1| Tyramine N-feruloyltransferase 4/11, putative [Ricinus communis]
Length=233

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 6/113 (5%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F SFTVF LEVS  P    + +P+FTPI+++V LD  I +P+++ F         VAG+ 
Sbjct  81   FQSFTVFLLEVSTNPLSKII-SPNFTPIERVVQLDHPIIDPESEMFKNSGSGDVVVAGFV  139

Query  151  P*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
              LF  +  + +   G Y+    + E   RKG  +MLL AVAAQA KMGYGRV
Sbjct  140  --LFFPNYSSFLAKPGFYVEDLFVRECYRRKGMGKMLLSAVAAQAVKMGYGRV  190



>ref|XP_007145442.1| hypothetical protein PHAVU_007G239500g [Phaseolus vulgaris]
 gb|ESW17436.1| hypothetical protein PHAVU_007G239500g [Phaseolus vulgaris]
Length=271

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 9/115 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF-FPTLE-NPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFT+F LE SP PF   TL+ NP FTP+ K+V+L + +++P+ +TF  +++   TV G
Sbjct  117  FHSFTIFLLEASPNPFAVSTLDSNPFFTPLTKLVNLRVPLEDPERETF--KSMDDVTVVG  174

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G Y+    + E   RKGF RMLL AVA  A KMG GRV
Sbjct  175  FV--LFFPNYSTVLGKPGFYVEDLFVRECYRRKGFGRMLLSAVARHAVKMGCGRV  227



>ref|XP_010262883.1| PREDICTED: probable acetyltransferase NATA1-like [Nelumbo nucifera]
Length=232

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 67/115 (58%), Gaps = 9/115 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLE--NPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFTV  LEVS  PF       NP + P+ +I++LD  I++P+A+TF  ++     VAG
Sbjct  81   FQSFTVLILEVSQVPFLQDQHQNNPLYPPVVRIINLDAPINDPEAETF--RSGADVVVAG  138

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G YI    + E   RKG  RMLL AVA+QA KMGYGRV
Sbjct  139  FV--LFFPNYSTFLAKPGFYIEDIFVRECYRRKGMGRMLLSAVASQAVKMGYGRV  191



>gb|KFK36805.1| hypothetical protein AALP_AA4G173600 [Arabis alpina]
Length=234

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F SFTVF LE+S  PF P   +P FTP  K    DL I +P++  F    L    VAG+ 
Sbjct  79   FKSFTVFLLEISRSPF-PATTSPDFTPFLKTHYFDLPIQDPESYNFTPDMLNDVVVAGFV  137

Query  151  P*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
              LF  +  + +   G+         P  RKGF  MLL AVA QA KMGYGRV
Sbjct  138  --LFFPNYSSFLAKPGFYIEDIFVREPYRRKGFGSMLLSAVAKQAVKMGYGRV  188



>gb|KDP44395.1| hypothetical protein JCGZ_20075 [Jatropha curcas]
Length=231

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 65/113 (58%), Gaps = 8/113 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F SFT+F LEVS  P  P + + HF PID+I+ LD  I++P+ +TF         VAG+ 
Sbjct  81   FHSFTIFLLEVSSNPL-PKITS-HFAPIDRIIQLDHPINDPETETF-KNGSDDVVVAGFV  137

Query  151  P*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
              LF  +  T +   G Y+    + E   RKG  RMLL AVA QA KMGYGRV
Sbjct  138  --LFFPNYSTFLGKPGFYVEDLFVRECYRRKGLGRMLLSAVAGQAVKMGYGRV  188



>ref|XP_008233301.1| PREDICTED: probable acetyltransferase NATA1-like [Prunus mume]
Length=239

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 66/118 (56%), Gaps = 10/118 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLE--NPHFTPIDKIVSLDLLIDNPDAKTF*FQALI---GAT  167
            F SFT+F LEVS  PF   L+  N  + P+ K+V+LDL I++PD   F     +    A 
Sbjct  80   FQSFTIFVLEVSHAPFVEHLQYNNAAYPPVTKVVNLDLPINDPDRDLFRSNGGVLGGDAC  139

Query  166  VAGYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            VAG+   LF  +  T +   G YI    + E   RKG  +MLL AVA QA KMGYGRV
Sbjct  140  VAGFV--LFFPNYSTFLAKPGFYIEDLFVRECYRRKGLGKMLLSAVAKQAVKMGYGRV  195



>emb|CDO99758.1| unnamed protein product [Coffea canephora]
Length=238

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 62/109 (57%), Gaps = 6/109 (6%)
 Frame = -3

Query  316  VFALEVSPKPFFPTLENP-HFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYAP*LF  140
            VF LEVSP PF PT ++P +F+PI K   LDL I++ + + F  +      VAG+   LF
Sbjct  88   VFILEVSPDPFPPTPQDPSNFSPILKTFHLDLPIEDSEKEIFRSEIGGDVVVAGFV--LF  145

Query  139  LVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
              +  T +   G+         P  +KGF RML  AVAAQA KMGYGRV
Sbjct  146  FPNYSTFLAKPGFYIEDLFVREPYRKKGFGRMLFTAVAAQAAKMGYGRV  194



>ref|XP_009595747.1| PREDICTED: probable acetyltransferase NATA1-like [Nicotiana tomentosiformis]
Length=235

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 68/116 (59%), Gaps = 10/116 (9%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPH---FTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F +FTVF LEVS  PF P ++N +   F+PI K ++LDL + + +A+ F       A VA
Sbjct  80   FTTFTVFLLEVSQNPFLP-IDNQNCTNFSPIHKTINLDLPVSDAEAEMF-KSGGNDAVVA  137

Query  160  GYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  + +   G YI    + E   RKGF R+LL  VAAQA KMGYGRV
Sbjct  138  GFV--LFFPNYSSFLAKPGFYIEDIFVRECYRRKGFGRLLLSTVAAQAAKMGYGRV  191



>ref|XP_002272073.1| PREDICTED: probable acetyltransferase NATA1-like [Vitis vinifera]
Length=227

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 66/116 (57%), Gaps = 14/116 (12%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F SFTVF LEVSP PF P        PI  +++LDL I +P+++ F   +   A VAG+ 
Sbjct  79   FQSFTVFLLEVSPTPF-PDAPVGAHPPITHVINLDLPIADPESQEF--GSGGDAVVAGFV  135

Query  151  P*LFLVSGKTRVLHRG------YIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
              LF  +  T +   G      Y+R  C    RKGF +MLL AVAAQA KMGYGRV
Sbjct  136  --LFFPNYSTFLGKPGFYIEDLYVRD-CY--RRKGFGKMLLSAVAAQAVKMGYGRV  186



>ref|XP_011031717.1| PREDICTED: probable acetyltransferase NATA1-like [Populus euphratica]
 ref|XP_011031718.1| PREDICTED: probable acetyltransferase NATA1-like [Populus euphratica]
Length=182

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 67/115 (58%), Gaps = 8/115 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFF--PTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFT+F LEVS  PF       +  FTPI++I +LD  + +P+A+TF    + G  VAG
Sbjct  28   FLSFTIFLLEVSSHPFEKDSNFHSQSFTPIERIFNLDHSLIDPEAETF-KNGINGDVVAG  86

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G Y+    + E   RKG  ++LL AVA+QA KMGYGRV
Sbjct  87   FV--LFFPNFSTFLGKPGFYVEDLFVRECYRRKGLGKLLLSAVASQAVKMGYGRV  139



>ref|XP_006285254.1| hypothetical protein CARUB_v10006619mg [Capsella rubella]
 gb|EOA18152.1| hypothetical protein CARUB_v10006619mg [Capsella rubella]
Length=222

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 61/116 (53%), Gaps = 12/116 (10%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F S TVF LE+SP PF P+  +P FTP  K  +LDL I++P+   F         VAG+ 
Sbjct  72   FQSVTVFLLEISPSPF-PSTVSPDFTPFVKTHNLDLPIEDPERDNFTPDISNDVVVAGFV  130

Query  151  P*LFL------VSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
              LF       +S     +   Y+R    P   KGF  MLL AVA QA KMGYGR+
Sbjct  131  --LFFPNYLGFLSTHGLYIEDIYVRE---PYRGKGFGSMLLSAVAKQAVKMGYGRI  181



>ref|XP_007145448.1| hypothetical protein PHAVU_007G240100g [Phaseolus vulgaris]
 gb|ESW17442.1| hypothetical protein PHAVU_007G240100g [Phaseolus vulgaris]
Length=224

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 68/115 (59%), Gaps = 9/115 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF-FPTLE-NPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFT+  LE SP PF F T++ NP F PI K+V+L L  ++P+  T  F+++   TV G
Sbjct  71   FHSFTILLLEASPTPFPFSTVDSNPFFKPITKLVNLSLPFEDPERDT--FKSMDDVTVTG  128

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G Y+ +  + E   R GF +MLL AVA +A KM YGRV
Sbjct  129  FV--LFFPNYSTFLGKPGFYVENLYVRECYRRMGFGKMLLCAVAKEAVKMKYGRV  181



>ref|XP_011077267.1| PREDICTED: probable acetyltransferase NATA1-like [Sesamum indicum]
Length=225

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 65/116 (56%), Gaps = 9/116 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIG---ATVA  161
            F SFTVF LE+S  PF P+ ++PHF P  K + LDL I +P+ + F   A        V 
Sbjct  69   FTSFTVFLLELSTSPFPPS-QSPHFIPRLKSLHLDLPIHDPEKEAFRSNASDANDDVIVG  127

Query  160  GYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  T +   G YI    + E   RKG  +MLL AVAAQA KMGYGRV
Sbjct  128  GFV--LFFPNYSTFLAKPGFYIEDIFVRECYRRKGLGKMLLSAVAAQAAKMGYGRV  181



>gb|AFK46864.1| unknown [Lotus japonicus]
Length=234

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLE---NPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F S TVF LE S  PF        +P + P  K+V+LDL+ID+P+ +TF  Q      + 
Sbjct  78   FHSSTVFILEASQNPFTDDTHFDNDPFYKPTMKVVNLDLIIDDPEKETFRNQHGNDIFIV  137

Query  160  GYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
             +   LF  +  T +   G Y+    + E   RKGF +MLL AVA QA KMGYGRV
Sbjct  138  RFV--LFFPNYSTFMAKAGFYVEDLFVRECYRRKGFGKMLLSAVAKQAVKMGYGRV  191



>ref|XP_010555817.1| PREDICTED: probable acetyltransferase NATA1-like [Tarenaya hassleriana]
Length=214

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F SFTVF LE+S  PF P L +  FTP  K  + DL  ++P+   F         VAG+ 
Sbjct  61   FQSFTVFLLEISRSPF-PHLASSDFTPFLKTHNFDLPTEDPERLVFTSDPGNDVVVAGFV  119

Query  151  P*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
              LF  +  T +   G YI    + +   RKGF RMLL AVA QA KMGYGRV
Sbjct  120  --LFFPNYSTFLAKPGFYIEDIFVRDCYRRKGFGRMLLTAVAKQAVKMGYGRV  170



>ref|XP_011077268.1| PREDICTED: probable acetyltransferase NATA1-like isoform X1 [Sesamum 
indicum]
Length=235

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 65/121 (54%), Gaps = 18/121 (15%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIG-----AT  167
            F S TV  LE+S  PF P+ ENPHFTP  K + LDL ID+ D +   F++  G      T
Sbjct  78   FTSVTVLLLELSTLPFPPS-ENPHFTPWHKSLHLDLPIDD-DPEKEAFRSNAGDVNEDVT  135

Query  166  VAGYAP*LFLVSGKTRVLHRGY------IRSGCLPELRKGFRRMLLLAVAAQATKMGYGR  5
            V G+   LF  +    +   G+      +R  C    RKG  ++LL AVA QA KMGYGR
Sbjct  136  VGGFV--LFFPNYAAFLAKPGFYIDNIFVREYCR---RKGLGKLLLWAVAEQAAKMGYGR  190

Query  4    V  2
            V
Sbjct  191  V  191



>ref|XP_008446870.1| PREDICTED: probable acetyltransferase NATA1-like [Cucumis melo]
Length=235

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 66/116 (57%), Gaps = 9/116 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF---FPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFTVF LEVS KPF    P   NP++ P+ +I++ DL +D+P+ + F  +      VA
Sbjct  80   FQSFTVFILEVSTKPFPENSPHNYNPNYAPVVRIINSDLPVDDPEWEVFKSEDE-NVVVA  138

Query  160  GYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  T +   G Y+    + E   RKG  ++LL AVA QA KM YGRV
Sbjct  139  GFV--LFFPNFSTFLGKPGFYVEDIFVRECYRRKGLGKVLLSAVAKQAVKMDYGRV  192



>ref|NP_565898.1| L-ornithine N5-acetyltransferase NATA1 [Arabidopsis thaliana]
 sp|Q9ZV05.1|NATA1_ARATH RecName: Full=L-ornithine N5-acetyltransferase NATA1; AltName: 
Full=Protein N-ACETYLTRANSFERASE ACTIVITY 1 [Arabidopsis thaliana]
 gb|AAC79613.1| expressed protein [Arabidopsis thaliana]
 gb|AEC09628.1| ornithine N-delta-acetyltransferase [Arabidopsis thaliana]
Length=228

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLEN---PHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F + TVF LE+SP PF PT  +   P FTP  +   +DL I++PD + F    L    VA
Sbjct  72   FQAVTVFLLEISPSPF-PTTHDASSPDFTPFLETHKVDLPIEDPDREKFLPDKLNDVVVA  130

Query  160  GYAP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  + +  +G+         P  RKGF ++LL AVA QA K+G GRV
Sbjct  131  GFV--LFFPNYPSFLAKQGFYIEDIFMREPYRRKGFGKLLLTAVAKQAVKLGVGRV  184



>gb|AAK96852.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL66882.1| unknown protein [Arabidopsis thaliana]
Length=206

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLEN---PHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F + TVF LE+SP PF PT  +   P FTP  +   +DL I++PD + F    L    VA
Sbjct  50   FQAVTVFLLEISPSPF-PTTHDASSPDFTPFLETHKVDLPIEDPDREKFLPDKLNDVVVA  108

Query  160  GYAP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  + +  +G+         P  RKGF ++LL AVA QA K+G GRV
Sbjct  109  GFV--LFFPNYPSFLAKQGFYIEDIFMREPYRRKGFGKLLLTAVAKQAVKLGVGRV  162



>ref|XP_002879781.1| hypothetical protein ARALYDRAFT_482922 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56040.1| hypothetical protein ARALYDRAFT_482922 [Arabidopsis lyrata subsp. 
lyrata]
Length=227

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 61/114 (54%), Gaps = 6/114 (5%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPT-LENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F + TVF LE+SP PF    + +P FTP  +   +DL I++PD   F    L    VAG+
Sbjct  72   FQAVTVFLLEISPSPFSTNDVSSPEFTPFLETHKVDLPIEDPDKDKFLPDKLNDVVVAGF  131

Query  154  AP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
               LF  +  + +  +G+         P  RKGF ++LL AVA QA K+G GRV
Sbjct  132  V--LFFPNYPSFLAKQGFYIEDIFVREPYRRKGFGKLLLTAVAKQAVKLGVGRV  183



>ref|XP_010505566.1| PREDICTED: probable acetyltransferase NATA1-like [Camelina sativa]
Length=238

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 60/118 (51%), Gaps = 10/118 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENP-----HFTPIDKIVSLDLLIDNPDAKTF*FQALIGAT  167
            F SFTVF LEVS  PF  T          FTP  K  SLDL I++P++  F    L    
Sbjct  79   FQSFTVFLLEVSRSPFTATAAASPSSSPDFTPFLKTHSLDLPIEDPESYNFSPDMLNDVV  138

Query  166  VAGYAP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
            VAG+   LF  +  + +   G+         P  RKGF  MLL AVA QA KMGYGRV
Sbjct  139  VAGFV--LFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLSAVAKQAVKMGYGRV  194



>ref|XP_011016733.1| PREDICTED: probable acetyltransferase NATA1-like [Populus euphratica]
Length=232

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALI-------G  173
            F SFTVF LEVS KPF   + +P F PI++ V +D +  +P+A+TF  ++++        
Sbjct  74   FQSFTVFILEVSSKPF-KNIHSPAFLPIERTVLVDHVAADPEAETF--KSVVANEDGDDN  130

Query  172  ATVAGYAP*LFLVSGKTRVLHRGYIRSGCLPEL---RKGFRRMLLLAVAAQATKMGYGRV  2
             TVAG+   LF+ S  T     G+     L      RK F +MLL AVA QA KMG+ RV
Sbjct  131  VTVAGFV--LFVPSYTTFAGKPGFHVEDLLVRECYRRKSFGKMLLSAVAEQAVKMGFKRV  188



>ref|XP_002312008.2| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
 gb|EEE89375.2| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
Length=236

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 65/115 (57%), Gaps = 7/115 (6%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFF--PTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFT+F LEVS  PF       +  FTPI++I +LD  + +P+A+TF         VAG
Sbjct  81   FLSFTIFLLEVSSHPFEKDSNFHSQSFTPIERIFNLDHSLIDPEAETFKNGINGDVVVAG  140

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G Y+    + E   RKG  ++LL AVA+QA KMGYGRV
Sbjct  141  FV--LFFPNFSTFLGKPGFYVEDLFVRECYRRKGLGKLLLSAVASQAVKMGYGRV  193



>gb|ABK94515.1| unknown [Populus trichocarpa]
Length=236

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 65/115 (57%), Gaps = 7/115 (6%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFF--PTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFT+F LEVS  PF       +  FTPI++I +LD  + +P+A+TF         VAG
Sbjct  81   FLSFTIFLLEVSSHPFEKDSNFHSQSFTPIERIFNLDHSLIDPEAETFKNGINGDVVVAG  140

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G Y+    + E   RKG  ++LL AVA+QA KMGYGRV
Sbjct  141  FV--LFFPNFSTFLGKPGFYVEDLFVRECYRRKGLGKLLLSAVASQAVKMGYGRV  193



>ref|XP_006411125.1| hypothetical protein EUTSA_v10017189mg [Eutrema salsugineum]
 gb|ESQ52578.1| hypothetical protein EUTSA_v10017189mg [Eutrema salsugineum]
Length=232

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 62/113 (55%), Gaps = 5/113 (4%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F SFTVF LE+S  PF  +  +P FTP  K  +LDL ID+P++  F    L    VAG+ 
Sbjct  78   FQSFTVFLLEISRSPFPTSSSSPDFTPFLKTHNLDLPIDDPESYNFTPDMLKDVVVAGFV  137

Query  151  P*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
              LF  +  + +   G+         P  RKGF  MLL AVA QA KMGYGRV
Sbjct  138  --LFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRV  188



>ref|XP_009368892.1| PREDICTED: probable acetyltransferase NATA1-like [Pyrus x bretschneideri]
Length=233

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 62/115 (54%), Gaps = 8/115 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLE--NPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFT+F LEVS  PF   L+  N  + P  K  +LDL ID+P+   F       A VAG
Sbjct  80   FQSFTIFVLEVSETPFVEHLQCNNSAYPPTVKTHNLDLPIDDPERDLFRSNGG-DAVVAG  138

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            +   LF  +  T +   G YI    + E   RKG  +MLL AVA QA KMGYGRV
Sbjct  139  FV--LFFPNYSTFLGKPGFYIEDLFVRECYRRKGLGKMLLSAVAKQAVKMGYGRV  191



>ref|XP_010558196.1| PREDICTED: probable acetyltransferase NATA1-like [Tarenaya hassleriana]
Length=231

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F SFTVF LEVS +  FP L +  FTP  K  + DL +D+P+   F         VAG+ 
Sbjct  78   FQSFTVFLLEVS-RSSFPHLPSSDFTPFLKTHNFDLPMDDPERSGFMSDPGNDVVVAGFV  136

Query  151  P*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
              LF  +  + +   G YI    + +    KGF RMLL AVA QA KMGYGRV
Sbjct  137  --LFFPNYSSFLAKPGFYIEDIFVRDCYRSKGFGRMLLTAVAKQAVKMGYGRV  187


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -1

Query  153  LPNYSSFLAKPEFYIEDIFVQDAYQS*G  70
             PNYSSFLAKP FYIEDIFV+D Y+S G
Sbjct  139  FPNYSSFLAKPGFYIEDIFVRDCYRSKG  166



>ref|XP_006294941.1| hypothetical protein CARUB_v10023995mg [Capsella rubella]
 gb|EOA27839.1| hypothetical protein CARUB_v10023995mg [Capsella rubella]
Length=183

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 63/114 (55%), Gaps = 6/114 (5%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPT-LENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F + TVF LE+S  PF  T   +P FTP  +  ++DL I++P+++ F    L    VAG+
Sbjct  28   FQAVTVFLLEISRSPFSTTDATSPDFTPFFETHNVDLPIEDPESQDFSPDKLNDVIVAGF  87

Query  154  AP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
               LF  +  + +  +G+         P  RKGF +MLL AVA QA K+G GRV
Sbjct  88   V--LFFPNYPSFLAKQGFYIEDIFVREPYRRKGFGKMLLTAVAKQAVKLGVGRV  139



>ref|XP_006294942.1| hypothetical protein CARUB_v10023995mg [Capsella rubella]
 gb|EOA27840.1| hypothetical protein CARUB_v10023995mg [Capsella rubella]
Length=229

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 63/114 (55%), Gaps = 6/114 (5%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPT-LENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F + TVF LE+S  PF  T   +P FTP  +  ++DL I++P+++ F    L    VAG+
Sbjct  74   FQAVTVFLLEISRSPFSTTDATSPDFTPFFETHNVDLPIEDPESQDFSPDKLNDVIVAGF  133

Query  154  AP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
               LF  +  + +  +G+         P  RKGF +MLL AVA QA K+G GRV
Sbjct  134  V--LFFPNYPSFLAKQGFYIEDIFVREPYRRKGFGKMLLTAVAKQAVKLGVGRV  185



>ref|XP_002273620.1| PREDICTED: probable acetyltransferase NATA1-like [Vitis vinifera]
Length=229

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 63/122 (52%), Gaps = 26/122 (21%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F SFTV  LEVSP PF       H  PI +IV+LDL I +P++K F   +   A V G+ 
Sbjct  79   FQSFTVLLLEVSPTPFPDGPVGCH-PPITRIVNLDLPIVDPESKEF--GSGGEAVVVGFV  135

Query  151  ------------P*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYG  8
                        P  ++ S  TR  +R           +KGF +MLL AVAAQA KMGYG
Sbjct  136  LFFPNYGVFLGKPGFYIESLYTRECYR-----------KKGFGKMLLSAVAAQAVKMGYG  184

Query  7    RV  2
            ++
Sbjct  185  KL  186



>ref|XP_002311082.1| hypothetical protein POPTR_0008s03740g [Populus trichocarpa]
 gb|EEE88449.1| hypothetical protein POPTR_0008s03740g [Populus trichocarpa]
Length=236

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 64/117 (55%), Gaps = 10/117 (9%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*F----QALIGATV  164
            F SFTVF LEVS  PF   + +P F PI++ V +D +  +P+A+TF      +     TV
Sbjct  79   FQSFTVFILEVSSNPF-KNIHSPAFLPIERTVLVDHVAADPEAETFKSGVANEDDDDVTV  137

Query  163  AGYAP*LFLVSGKTRVLHRGYIRSGCLPEL---RKGFRRMLLLAVAAQATKMGYGRV  2
            AG+   LF+ S  T     G+     L      RKGF ++LL AVA QA KMG+ RV
Sbjct  138  AGFV--LFVPSYTTFAGKPGFHVEDLLVRECYRRKGFGKVLLSAVAEQAVKMGFKRV  192



>gb|EPS72761.1| hypothetical protein M569_01998, partial [Genlisea aurea]
Length=205

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 64/113 (57%), Gaps = 8/113 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F S +V  LEVS  PF PT     FTPI++ + +DL I++PD ++F  +     TV G+ 
Sbjct  59   FTSVSVLVLEVSSVPFPPTTCPQIFTPIERSLHVDLPIEDPDRESFRSE---DGTVCGFV  115

Query  151  P*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
              LF  +  + +   G YI    + +   RKG  +MLL AVA QA +MG+GRV
Sbjct  116  --LFFPNYASFLAKAGFYIEDLFVRDCYRRKGLGKMLLCAVARQAAEMGHGRV  166



>ref|XP_011077269.1| PREDICTED: probable acetyltransferase NATA1-like isoform X2 [Sesamum 
indicum]
Length=206

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 53/111 (48%), Gaps = 27/111 (24%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLI-DNPDAKTF*FQALIGATVAGY  155
            F S TV  LE+S  PF P+ ENPHFTP  K + LDL I D+P+ + F   A         
Sbjct  78   FTSVTVLLLELSTLPFPPS-ENPHFTPWHKSLHLDLPIDDDPEKEAFRSNA---------  127

Query  154  AP*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
                            G +        RKG  ++LL AVA QA KMGYGRV
Sbjct  128  ----------------GDVNEDVTVGGRKGLGKLLLWAVAEQAAKMGYGRV  162



>ref|XP_010509078.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1 [Camelina sativa]
Length=231

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 63/117 (54%), Gaps = 12/117 (10%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPT-LENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F + TVF LE+S  PF  T   +P FTP  +  + DL I++PD++ F    L    VAG+
Sbjct  76   FQAVTVFLLEISRSPFSTTDATSPDFTPFLETHNGDLPIEDPDSQDFSPDKLKDVVVAGF  135

Query  154  AP*LFL------VSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
               LF       ++ +   +   ++R    P  RKGF +MLL AVA QA K+G GRV
Sbjct  136  V--LFFPNYPSFLAKQCFYIEDIFVRE---PYRRKGFGKMLLTAVAKQAVKLGMGRV  187



>ref|XP_010517239.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1-like [Camelina 
sativa]
Length=228

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 63/117 (54%), Gaps = 12/117 (10%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPT-LENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F + TVF LE+S  PF  T   +P FTP  +  + DL I++PD++ F    L    VAG+
Sbjct  76   FQAVTVFLLEISRSPFSTTDATSPDFTPFLESHNGDLPIEDPDSQDFSPDKLKDVVVAGF  135

Query  154  AP*LFL------VSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
               LF       ++ +   +   ++R    P  RKGF +MLL AVA QA K+G GRV
Sbjct  136  V--LFFPNYPSFLAKQCFYIENIFVRE---PYRRKGFGKMLLTAVAKQAVKLGMGRV  187



>ref|XP_008366562.1| PREDICTED: probable acetyltransferase NATA1-like [Malus domestica]
Length=233

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 64/116 (55%), Gaps = 10/116 (9%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLE--NPHFTPIDKIVSLDLLIDNPDAKTF*FQALIG-ATVA  161
            F SFT+  LEVS  PF   L+  N  + P  K  +LDL ID  DA+   F++  G A VA
Sbjct  80   FQSFTILVLEVSETPFVEHLQCNNSAYPPTIKTHNLDLPID--DAERDLFRSNGGDAVVA  137

Query  160  GYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  T +   G YI    + E   RKG  +MLL AVA QA KMGYGRV
Sbjct  138  GFV--LFFPNYSTFLGKPGFYIEDLFVRECYRRKGLGKMLLSAVAKQAVKMGYGRV  191



>ref|XP_007009878.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Theobroma 
cacao]
 gb|EOY18688.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Theobroma 
cacao]
Length=235

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = -3

Query  331  FASFTVFALEVS--PKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQ-ALIGATVA  161
            F SFT+F LEVS  P P  P++  P FT I+K  + D+ I++P+   F          +A
Sbjct  79   FDSFTIFILEVSSTPIPPLPSI-YPSFTSIEKTFNFDIPINDPEEDAFTVNFGKDQIIIA  137

Query  160  GYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +  T +   G Y+    + +   RKGF +MLL AVA QA KMGYGRV
Sbjct  138  GFV--LFFPNYSTFLGKPGFYVEDLFVRQCYRRKGFGKMLLSAVAKQAVKMGYGRV  191



>gb|AFK38887.1| unknown [Lotus japonicus]
Length=182

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 58/106 (55%), Gaps = 7/106 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTL--ENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFTVF LEVS  PF  T    +P + P+ K V L+L +D+P+ +TF  Q      VAG
Sbjct  78   FHSFTVFILEVSSNPFTDTHFDNDPFYKPVTKTVHLELPLDDPEKETFRNQLGNEVFVAG  137

Query  157  YAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQ  29
            +   LF  +  T +   G Y+    + E   RKGF RMLL AVA Q
Sbjct  138  FV--LFSPNYSTFLAKPGFYVEDLFVRECYRRKGFGRMLLSAVAKQ  181



>ref|XP_009382139.1| PREDICTED: probable acetyltransferase NATA1-like [Musa acuminata 
subsp. malaccensis]
Length=214

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 56/122 (46%), Gaps = 23/122 (19%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGYA  152
            F SFTV  LE+S  PF    + P F PI + + L+  +++P+A  F      G  VAG+ 
Sbjct  61   FLSFTVLILELSHSPFSEDSDAPLFAPIVRRIDLESAVEDPEAAEFASPRGEGIVVAGFV  120

Query  151  ------------P*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYG  8
                        P L++     R   R           R+G  RMLL AVA QA +MG G
Sbjct  121  LCFPNYSTFLAKPGLYIEDIFVRATWR-----------RRGLGRMLLAAVAGQAAQMGMG  169

Query  7    RV  2
            RV
Sbjct  170  RV  171



>ref|XP_008365057.1| PREDICTED: LOW QUALITY PROTEIN: probable acetyltransferase NATA1-like, 
partial [Malus domestica]
Length=232

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 62/118 (53%), Gaps = 12/118 (10%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLE----NPHFTPIDKIVSLDLLIDNPDAKTF*FQALIG-AT  167
            F SFT+F LEVS  PF   L     N  +    K ++LDL ID+P+   F  ++  G A 
Sbjct  77   FQSFTIFVLEVSQTPFVEHLHLECNNSAYPXXIKTLNLDLPIDDPERNLF--RSNXGDAV  134

Query  166  VAGYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            VAG+   LF  +  T +  RG Y+    + E   RKG  +MLL  V  QA +MGYG V
Sbjct  135  VAGFV--LFFPNYSTLLGKRGFYVEDLFVRECYRRKGLGKMLLSTVVKQAVRMGYGIV  190



>emb|CDO99757.1| unnamed protein product [Coffea canephora]
Length=238

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 58/116 (50%), Gaps = 8/116 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF---FPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SF VF LEVSP  F    P  +  + +P+ K + LDL I++ + + F  +      VA
Sbjct  82   FTSFNVFILEVSPDHFPPPAPQEDTTNSSPLLKTLHLDLPIEDSEKEIFRSEIGGDVVVA  141

Query  160  GYAP*LFLVSGKTRVLHRGYIRSGCL---PELRKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF     T +   G+         P  + GF +ML+ AVA QA KMGYG V
Sbjct  142  GFV--LFFPKYSTYLAKPGFHIEDLFVREPYRKHGFGKMLITAVAGQAVKMGYGMV  195



>ref|XP_004142434.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
 ref|XP_004164217.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
Length=226

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 61/125 (49%), Gaps = 27/125 (22%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF---FPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFT+F LEVS +PF    P   N +++P+ +IV  ++ +D+P+ + F  +      VA
Sbjct  63   FQSFTIFILEVSHEPFPENSPHNSNANYSPVVRIVYSEVPVDDPEREIFKSEDE-NVVVA  121

Query  160  GYA------------P*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKM  17
            G+             P  F+ S   R  +R           RKG  +MLL AV  QA +M
Sbjct  122  GFVLFFPNFSALLGKPGFFVESVAVRKCYR-----------RKGLGKMLLSAVVNQAVEM  170

Query  16   GYGRV  2
             YG+V
Sbjct  171  DYGQV  175



>ref|XP_008446873.1| PREDICTED: probable acetyltransferase NATA1-like [Cucumis melo]
Length=230

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 59/118 (50%), Gaps = 12/118 (10%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF---FPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFTVF LEVSP PF    P   NP++TP+ + +  +L +D+P+ + F  +      VA
Sbjct  72   FRSFTVFILEVSPIPFSENSPHNSNPNYTPVVRTLDSELPVDDPERENFKAEDE-NVVVA  130

Query  160  GYAP*LFLVS-----GKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
            G+   LF  +     GK            C    ++   R+LLLAV  QA KM Y +V
Sbjct  131  GFV--LFFPNFPSLLGKPGFFVEAIAVRDCY-RRKEDLGRILLLAVVNQAVKMDYCQV  185



>ref|XP_008446872.1| PREDICTED: probable acetyltransferase NATA1-like isoform X2 [Cucumis 
melo]
Length=227

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 59/116 (51%), Gaps = 9/116 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF---FPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFT+F LEVS +PF    P   N H++P+ +IV  ++ +D+P+ + +  +      VA
Sbjct  62   FQSFTMFILEVSHEPFPENSPHNSNSHYSPVVRIVDSEVPVDDPERELYKSEDE-NVVVA  120

Query  160  GYA---P*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
            G+    P    + GK        +   C    RKG  +MLL AV  QA +M Y +V
Sbjct  121  GFVLFFPKFSALLGKPGFFVEAIVVRKCY--RRKGLGKMLLSAVVNQAVEMDYCQV  174



>ref|XP_008446871.1| PREDICTED: probable acetyltransferase NATA1-like isoform X1 [Cucumis 
melo]
Length=240

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 59/116 (51%), Gaps = 9/116 (8%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF---FPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFT+F LEVS +PF    P   N H++P+ +IV  ++ +D+P+ + +  +      VA
Sbjct  75   FQSFTMFILEVSHEPFPENSPHNSNSHYSPVVRIVDSEVPVDDPERELYKSEDE-NVVVA  133

Query  160  GYA---P*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
            G+    P    + GK        +   C    RKG  +MLL AV  QA +M Y +V
Sbjct  134  GFVLFFPKFSALLGKPGFFVEAIVVRKCY--RRKGLGKMLLSAVVNQAVEMDYCQV  187



>gb|KGN52261.1| hypothetical protein Csa_5G622760 [Cucumis sativus]
Length=262

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 61/125 (49%), Gaps = 27/125 (22%)
 Frame = -3

Query  331  FASFTVFALEVSPKPF---FPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFT+F LEVS +PF    P   N +++P+ +IV  ++ +D+P+ + F  +      VA
Sbjct  99   FQSFTIFILEVSHEPFPENSPHNSNANYSPVVRIVYSEVPVDDPEREIFKSEDE-NVVVA  157

Query  160  GYA------------P*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKM  17
            G+             P  F+ S   R  +R           RKG  +MLL AV  QA +M
Sbjct  158  GFVLFFPNFSALLGKPGFFVESVAVRKCYR-----------RKGLGKMLLSAVVNQAVEM  206

Query  16   GYGRV  2
             YG+V
Sbjct  207  DYGQV  211



>ref|XP_004164224.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
Length=230

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 57/116 (49%), Gaps = 8/116 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTL---ENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFTVF LEVS  PF        NP++TP+  I+  +  +D+P+++ F  +      VA
Sbjct  72   FQSFTVFILEVSSTPFPENSLHNSNPNYTPVVGILDSEPPVDDPESEDFKAEDE-NVVVA  130

Query  160  GYA---P*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
            G+    P    + GK        +   C    RK   R+LLLAV  QA KM Y +V
Sbjct  131  GFVMFFPNFPSLLGKPGFFVEAIVVRDCY-HRRKDLERILLLAVVNQAVKMDYCQV  185



>ref|XP_004142493.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
 gb|KGN52262.1| hypothetical protein Csa_5G622770 [Cucumis sativus]
Length=230

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 56/116 (48%), Gaps = 8/116 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTL---ENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVA  161
            F SFTVF LEVS  PF        NP++TP+  I+  +  +D+P ++ F  +      VA
Sbjct  72   FQSFTVFILEVSSIPFPQNSLHNSNPNYTPVVGILDSEPPVDDPGSEDFKAEDE-NVVVA  130

Query  160  GYA---P*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
            G+    P    + GK        +   C    RK   R+LLLAV  QA KM Y +V
Sbjct  131  GFVLFFPNFPSLLGKPGFFVEAIVVRDCY-HRRKDLERILLLAVVNQAVKMDYCQV  185



>ref|XP_010670040.1| PREDICTED: probable acetyltransferase NATA1-like [Beta vulgaris 
subsp. vulgaris]
Length=234

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 60/117 (51%), Gaps = 13/117 (11%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPH----FTPIDKIVSLDLLIDNPDAKTF*FQALIGATV  164
            F SFTVF LE S  P   +L +P     F PI K   L   +D+P+   F      G+T+
Sbjct  80   FQSFTVFLLEASSTPL--SLHHPPTISLFQPIHKTFHLSQPMDDPEFARF--CTSEGSTI  135

Query  163  AGYAP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
            AG+   LF  +  + +   G Y+    + E   RKG   +L+ AVA QA K+GYGRV
Sbjct  136  AGFV--LFFPNYSSFLAKPGFYVEDVFVRECYRRKGLGGLLMKAVANQAVKLGYGRV  190



>ref|XP_010693080.1| PREDICTED: probable acetyltransferase NATA1-like [Beta vulgaris 
subsp. vulgaris]
Length=184

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (50%), Gaps = 14/117 (12%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTL-ENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F + TVF +EVS  PF P      HF  I+  + L   I++P+ + F  +   G  +AG+
Sbjct  32   FKTVTVFLVEVSSTPFAPNHPSTQHFNHIETTLHLPHPINDPEMELF--RTKEGTIIAGF  89

Query  154  AP*LFLVSGKTRVLHRGY------IRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
               +F  S  T +    +      +R G      KGF  ML+ AVA+QA KMGY R+
Sbjct  90   V--IFFPSYSTFLSKHAFHVEDLFVREGYR---GKGFGGMLMKAVASQAVKMGYARM  141



>ref|XP_010689389.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1-like [Beta 
vulgaris subsp. vulgaris]
Length=238

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 59/117 (50%), Gaps = 14/117 (12%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTL-ENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F + TVF +EVS  PF P      HF  I+  + L   I++P+ + F  +   G  +AG+
Sbjct  86   FKTVTVFLVEVSSTPFAPNHPSTQHFNHIETTLHLPHPINDPEMELF--RTEEGTIIAGF  143

Query  154  AP*LFLVSGKTRV------LHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
               +F  S  T +      +   ++R G      KGF  ML+ AVA+QA KMGY R+
Sbjct  144  V--IFFPSYSTFLSKPAFHVEDLFVREGYR---GKGFGGMLMKAVASQAVKMGYARM  195



>ref|XP_006827452.1| hypothetical protein AMTR_s00009p00114360 [Amborella trichopoda]
 gb|ERM94868.1| hypothetical protein AMTR_s00009p00114360 [Amborella trichopoda]
Length=234

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 57/114 (50%), Gaps = 6/114 (5%)
 Frame = -3

Query  331  FASFTVFALEV-SPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F   TVF LE+ +  P  P  +   F PI K +  D  +++ +AKTF         VAG+
Sbjct  71   FQGTTVFILEILTDFPRNPCDDKQSFKPIFKQLIFDPPVEDTEAKTFASSRNGDGVVAGF  130

Query  154  AP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYGRV  2
               LF  +  T +   G YI    + E   R+G  RML+ +VA QA KMG GRV
Sbjct  131  V--LFFQNYSTFMAKSGFYIEDLFVRECYRRRGLGRMLMESVAGQAVKMGLGRV  182



>ref|XP_006836668.1| hypothetical protein AMTR_s00088p00059900 [Amborella trichopoda]
 gb|ERM99521.1| hypothetical protein AMTR_s00088p00059900 [Amborella trichopoda]
Length=234

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 58/112 (52%), Gaps = 6/112 (5%)
 Frame = -3

Query  331  FASFTVFALEV-SPKPFFPTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F   TVF LE+ S  P  P  +N  F PI K +  D  +++ +AKTF         VAG+
Sbjct  71   FQGTTVFILEIFSDFPQNPCDKNQFFKPIFKKLVFDPPVEDVEAKTFASSQNGDGVVAGF  130

Query  154  AP*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYG  8
               LF+ +  T +   G Y+    + E   R+G  RML+ +VA QA KMG+G
Sbjct  131  V--LFVQNYSTFLAKPGFYMEDLFVRECYRRRGLGRMLMESVAGQAVKMGFG  180



>ref|XP_010934574.1| PREDICTED: probable acetyltransferase NATA1-like [Elaeis guineensis]
Length=233

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 63/123 (51%), Gaps = 18/123 (15%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLE------NPH-FTPIDKIVSLDLLIDNPDAKTF*FQALIG  173
            F SFTV  LE+SP PF  + E      NP  F PI + V L   +++P+A  F      G
Sbjct  69   FLSFTVLILELSPNPFSQSDEEHKDTANPSLFRPIVRRVELKSPLEDPEAVEFASPRGGG  128

Query  172  ATVAGYAP*LFLVSGKTRVLHRG------YIRSGCLPELRKGFRRMLLLAVAAQATKMGY  11
            A V G+   L   +  T +   G      ++R+      R+GF RMLL AVAAQA KMG 
Sbjct  129  AVVVGFV--LCFPNYSTFLAKPGLYVEDIFVRAAWR---RRGFGRMLLSAVAAQAAKMGM  183

Query  10   GRV  2
            GRV
Sbjct  184  GRV  186



>ref|XP_010067321.1| PREDICTED: probable acetyltransferase NATA1-like [Eucalyptus 
grandis]
Length=242

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 61/122 (50%), Gaps = 12/122 (10%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLEN-------PHFTPIDKIVSLDLLIDNPDAKTF*FQALIG  173
            F SFTV  LEVS  PF P           P F P+   ++LDL I++P+A+ F   A  G
Sbjct  77   FQSFTVLLLEVSHLPFAPLPPPPQNPTGVPAFAPVVHAINLDLPIEDPEAEIFASGAEGG  136

Query  172  ATVAGYAP--*LFLVSGKTRVLHRG-YIRSGCLPEL--RKGFRRMLLLAVAAQATKMGYG  8
            A          LF  +  T +   G YI    + E   RKG  RMLL AVA QA +MGYG
Sbjct  137  AGAGAVVAGFVLFFPNYSTFLAKPGFYIEDLFVRECYRRKGLGRMLLTAVAGQAARMGYG  196

Query  7    RV  2
            RV
Sbjct  197  RV  198



>ref|XP_010693079.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1-like [Beta 
vulgaris subsp. vulgaris]
Length=233

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 58/117 (50%), Gaps = 14/117 (12%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTL-ENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAGY  155
            F + TVF +EVS  PF P      HF  I+  +     I++P+ + F  +   G  +AG+
Sbjct  81   FKTVTVFLVEVSSTPFAPYHPSTQHFNHIETTLHFPHPINDPEMELF--RTEEGTIIAGF  138

Query  154  AP*LFLVSGKTRV------LHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGYGRV  2
               +F  S  T +      +   ++R G      KGF  ML+ AVA+QA KMGY R+
Sbjct  139  V--IFFPSYSTFLAKPAFHVEDLFVREGYR---GKGFGGMLMKAVASQAVKMGYARM  190



>ref|XP_009796793.1| PREDICTED: probable acetyltransferase NATA1-like [Nicotiana sylvestris]
Length=222

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 56/123 (46%), Gaps = 25/123 (20%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFFPTLENPH--FTPIDKIVSLDLLIDNPDAKTF*FQA--------  182
            F S T F LEVSP  F P     H  F PI K ++LD  I +P+++ F            
Sbjct  63   FYSVTAFILEVSPNNF-PKKTTKHSIFDPIQKTINLDSPIVDPESELFRTNEDDIFIAGY  121

Query  181  -LIGATVAGY--AP*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLLLAVAAQATKMGY  11
             L   + +GY   P  F+ +   R  +R Y           GF ++L  AVA+QA KMG+
Sbjct  122  ILFFPSYSGYFEKPGFFIENMYVRECYRKY-----------GFGKILFSAVASQAAKMGF  170

Query  10   GRV  2
              V
Sbjct  171  STV  173



>gb|AGJ98237.1| PIG03 N-acetyltransferase-like protein, partial [Petunia x hybrida]
Length=169

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 7/97 (7%)
 Frame = -3

Query  331  FASFTVFALEVSPKPFF--PTLENPHFTPIDKIVSLDLLIDNPDAKTF*FQALIGATVAG  158
            F SFT+F LEVSP PF   P L  P+F+PI K V LD+ I +P+A  F        TVAG
Sbjct  76   FTSFTIFLLEVSPNPFLPIPQLTYPNFSPIHKSVILDVPITDPEADKFRSDGE-DVTVAG  134

Query  157  YAP*LFLVSGKTRVLHRGYIRSGCLPELRKGFRRMLL  47
            +   LF  +  + +  +G+        +R+ +R+  L
Sbjct  135  FV--LFFPNYSSFLAKQGFYIEDIF--VRECYRKEGL  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517432785088