BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c931_g1_i1 len=1273 path=[1294:0-1272]

Length=1273
                                                                      Score     E

ref|XP_009788733.1|  PREDICTED: uncharacterized protein LOC104236...    324   3e-104   
ref|XP_009595949.1|  PREDICTED: uncharacterized protein LOC104092133    320   7e-103   
ref|XP_006342198.1|  PREDICTED: uncharacterized protein LOC102590...    315   1e-100   
ref|XP_004238473.1|  PREDICTED: uncharacterized protein LOC101246922    309   2e-98    
ref|XP_011099848.1|  PREDICTED: uncharacterized protein LOC105178156    303   9e-97    
ref|XP_003530319.1|  PREDICTED: uncharacterized protein LOC100815805    294   7e-93    
gb|KHN23500.1|  hypothetical protein glysoja_043761                     292   1e-92    
ref|XP_003556619.1|  PREDICTED: uncharacterized protein LOC100797641    288   9e-91    
ref|XP_008237886.1|  PREDICTED: uncharacterized protein LOC103336604    288   1e-90    
ref|XP_006435484.1|  hypothetical protein CICLE_v10001981mg             288   2e-90    
ref|XP_007211272.1|  hypothetical protein PRUPE_ppa017191mg             285   8e-90    
gb|EYU41215.1|  hypothetical protein MIMGU_mgv1a018037mg                280   3e-88    
ref|XP_003589678.1|  hypothetical protein MTR_1g034960                  282   4e-88    
ref|XP_007153122.1|  hypothetical protein PHAVU_003G008600g             281   1e-87    
ref|XP_004300081.1|  PREDICTED: uncharacterized protein LOC101308578    279   4e-87    
ref|XP_008364325.1|  PREDICTED: uncharacterized protein LOC103427985    276   5e-86    
ref|XP_002307829.2|  hypothetical protein POPTR_0005s28020g             275   2e-85    Populus trichocarpa [western balsam poplar]
ref|XP_004498200.1|  PREDICTED: uncharacterized protein LOC101495335    273   8e-85    
ref|XP_009347083.1|  PREDICTED: uncharacterized protein LOC103938763    273   1e-84    
ref|XP_008346427.1|  PREDICTED: uncharacterized protein LOC103409391    271   4e-84    
ref|XP_009362918.1|  PREDICTED: uncharacterized protein LOC103952935    271   5e-84    
ref|XP_008453038.1|  PREDICTED: uncharacterized protein LOC103493863    270   2e-83    
ref|XP_009372668.1|  PREDICTED: histone-lysine N-methyltransferas...    269   3e-83    
ref|XP_007028813.1|  Cysteine/Histidine-rich C1 domain family pro...    265   6e-82    
ref|XP_011041124.1|  PREDICTED: diacylglycerol kinase theta             265   7e-82    
emb|CDP07241.1|  unnamed protein product                                266   9e-82    
ref|XP_009372669.1|  PREDICTED: uncharacterized protein LOC103961...    264   1e-81    
ref|XP_002510748.1|  protein binding protein, putative                  263   3e-81    Ricinus communis
ref|XP_004145611.1|  PREDICTED: uncharacterized protein LOC101220216    263   5e-81    
ref|XP_007028814.1|  Cysteine/Histidine-rich C1 domain family pro...    262   6e-81    
gb|KGN55555.1|  hypothetical protein Csa_4G665110                       263   7e-81    
ref|XP_004157110.1|  PREDICTED: uncharacterized protein LOC101223621    262   1e-80    
ref|XP_010534419.1|  PREDICTED: uncharacterized protein LOC104809...    262   2e-80    
ref|XP_010534428.1|  PREDICTED: uncharacterized protein LOC104809...    259   2e-79    
gb|KDP36722.1|  hypothetical protein JCGZ_08013                         255   4e-78    
ref|XP_010061339.1|  PREDICTED: uncharacterized protein LOC104449040    255   6e-78    
ref|XP_010684748.1|  PREDICTED: uncharacterized protein LOC104899283    255   2e-77    
ref|XP_008798635.1|  PREDICTED: diacylglycerol kinase theta-like        255   2e-77    
ref|XP_002273882.2|  PREDICTED: uncharacterized protein LOC100252968    251   1e-75    Vitis vinifera
emb|CAN76803.1|  hypothetical protein VITISV_000633                     252   2e-75    Vitis vinifera
gb|KCW68282.1|  hypothetical protein EUGRSUZ_F01949                     242   8e-74    
ref|XP_010270609.1|  PREDICTED: uncharacterized protein LOC104606892    243   9e-74    
ref|XP_002273846.1|  PREDICTED: uncharacterized protein LOC100258...    242   3e-73    Vitis vinifera
ref|XP_010664041.1|  PREDICTED: uncharacterized protein LOC100258...    238   1e-71    
ref|XP_002893147.1|  predicted protein                                  238   9e-71    
emb|CBI40789.3|  unnamed protein product                                243   2e-70    
ref|XP_010477357.1|  PREDICTED: uncharacterized protein LOC104756457    236   4e-70    
ref|XP_009418236.1|  PREDICTED: uncharacterized protein LOC103998480    233   4e-70    
ref|XP_006305380.1|  hypothetical protein CARUB_v10009771mg             235   7e-70    
gb|KFK44213.1|  hypothetical protein AALP_AA1G229300                    234   1e-69    
emb|CDY01341.1|  BnaA07g11140D                                          234   1e-69    
ref|XP_009103313.1|  PREDICTED: diacylglycerol kinase theta-like        234   2e-69    
ref|XP_010266305.1|  PREDICTED: uncharacterized protein LOC104603842    232   2e-69    
ref|NP_173523.1|  Cysteine/Histidine-rich C1 domain family protein      233   3e-69    Arabidopsis thaliana [mouse-ear cress]
gb|AAD30592.1|AC007369_2  Hypothetical protein                          233   4e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459793.1|  PREDICTED: uncharacterized protein LOC104740797    232   1e-68    
ref|XP_010063182.1|  PREDICTED: uncharacterized protein LOC104450...    230   1e-68    
ref|XP_010063183.1|  PREDICTED: uncharacterized protein LOC104450...    230   1e-68    
ref|XP_010498554.1|  PREDICTED: uncharacterized protein LOC104776223    231   1e-68    
emb|CDY04590.1|  BnaC05g16280D                                          231   4e-68    
ref|XP_006416341.1|  hypothetical protein EUTSA_v10008443mg             229   4e-68    
ref|XP_009149580.1|  PREDICTED: uncharacterized protein LOC103872892    230   5e-68    
ref|XP_006849839.1|  hypothetical protein AMTR_s00022p00036270          225   9e-67    
gb|EMT18965.1|  hypothetical protein F775_00785                         216   5e-63    
ref|XP_010239409.1|  PREDICTED: uncharacterized protein LOC104585122    210   6e-61    
ref|XP_010094492.1|  hypothetical protein L484_024783                   209   9e-61    
ref|XP_002462590.1|  hypothetical protein SORBIDRAFT_02g028650          198   2e-56    Sorghum bicolor [broomcorn]
ref|XP_008670289.1|  PREDICTED: uncharacterized protein LOC103647547    194   1e-54    
ref|XP_004959574.1|  PREDICTED: uncharacterized protein LOC101775078    192   4e-54    
ref|XP_008652876.1|  PREDICTED: uncharacterized protein LOC103632945    192   9e-54    
ref|XP_006342199.1|  PREDICTED: uncharacterized protein LOC102590...    186   1e-51    
gb|KHM99033.1|  hypothetical protein glysoja_024333                     176   2e-48    
gb|EEC84807.1|  hypothetical protein OsI_31875                          162   1e-42    Oryza sativa Indica Group [Indian rice]
ref|XP_009788734.1|  PREDICTED: uncharacterized protein LOC104236...    148   1e-37    
gb|EEE69969.1|  hypothetical protein OsJ_29861                          141   2e-34    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661383.1|  PREDICTED: uncharacterized protein LOC102707900    126   2e-30    
ref|XP_006849838.1|  hypothetical protein AMTR_s00022p00034890          110   1e-24    
gb|EYU35257.1|  hypothetical protein MIMGU_mgv1a024781mg                106   9e-23    
ref|XP_008382519.1|  PREDICTED: uncharacterized protein LOC103445306    104   2e-22    
ref|XP_008787842.1|  PREDICTED: uncharacterized protein LOC103705770    102   3e-22    
ref|XP_003530334.1|  PREDICTED: uncharacterized protein LOC100795400    103   5e-22    
gb|EYU35259.1|  hypothetical protein MIMGU_mgv11b024130mg               103   2e-21    
ref|XP_004290094.1|  PREDICTED: uncharacterized protein LOC101310179    101   4e-21    
ref|XP_008796308.1|  PREDICTED: uncharacterized protein LOC103711798    100   4e-21    
ref|XP_009121236.1|  PREDICTED: uncharacterized protein LOC103846067    100   9e-21    
emb|CDX71256.1|  BnaC07g05350D                                          100   1e-20    
ref|XP_010927292.1|  PREDICTED: uncharacterized protein LOC105049369  99.4    2e-20    
ref|XP_007043120.1|  Cysteine/Histidine-rich C1 domain family pro...  99.0    2e-20    
ref|XP_010687681.1|  PREDICTED: diacylglycerol kinase theta-like      97.4    3e-20    
ref|XP_007153143.1|  hypothetical protein PHAVU_003G010500g           98.6    4e-20    
ref|XP_009143447.1|  PREDICTED: uncharacterized protein LOC103867159  99.4    4e-20    
ref|XP_011095209.1|  PREDICTED: uncharacterized protein LOC105174719  99.0    4e-20    
ref|NP_181318.1|  cysteine/histidine-rich C1 domain-containing pr...  99.0    5e-20    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009358911.1|  PREDICTED: uncharacterized protein LOC103949521  97.8    6e-20    
ref|XP_008776507.1|  PREDICTED: uncharacterized protein LOC103696605  96.7    1e-19    
emb|CDX91385.1|  BnaC04g07650D                                        97.8    1e-19    
ref|XP_006410975.1|  hypothetical protein EUTSA_v10017859mg           97.1    2e-19    
ref|XP_006295890.1|  hypothetical protein CARUB_v10025020mg           97.1    2e-19    
ref|XP_010940196.1|  PREDICTED: uncharacterized protein LOC105058837  95.5    3e-19    
emb|CAN76522.1|  hypothetical protein VITISV_034514                   97.4    3e-19    Vitis vinifera
emb|CDY27676.1|  BnaUnng00260D                                        94.0    4e-19    
gb|KDO48122.1|  hypothetical protein CISIN_1g042732mg                 96.3    4e-19    
gb|ACJ86267.1|  unknown                                               95.9    5e-19    Medicago truncatula
ref|XP_006493588.1|  PREDICTED: uncharacterized protein LOC102620333  95.9    6e-19    
gb|KCW55308.1|  hypothetical protein EUGRSUZ_I01234                   95.1    7e-19    
gb|EYU35258.1|  hypothetical protein MIMGU_mgv1a025608mg              95.9    7e-19    
ref|XP_004161619.1|  PREDICTED: uncharacterized LOC101214603          94.7    9e-19    
ref|XP_006856165.1|  hypothetical protein AMTR_s00059p00175720        94.4    9e-19    
ref|XP_004145337.1|  PREDICTED: uncharacterized protein LOC101210122  94.4    9e-19    
gb|EYU35252.1|  hypothetical protein MIMGU_mgv1a020442mg              95.9    1e-18    
gb|KEH40771.1|  cysteine/histidine-rich C1 domain protein             94.7    1e-18    
ref|XP_010509273.1|  PREDICTED: LOW QUALITY PROTEIN: diacylglycer...  95.1    1e-18    
ref|XP_006493596.1|  PREDICTED: uncharacterized protein LOC102622534  96.3    2e-18    
gb|KDP46202.1|  hypothetical protein JCGZ_10042                       94.0    2e-18    
ref|XP_010658575.1|  PREDICTED: uncharacterized protein LOC104881138  94.0    2e-18    
ref|XP_006409477.1|  hypothetical protein EUTSA_v10023200mg           93.6    2e-18    
ref|XP_006423152.1|  hypothetical protein CICLE_v10029187mg           93.2    2e-18    
emb|CAN78576.1|  hypothetical protein VITISV_020584                   92.8    3e-18    Vitis vinifera
ref|XP_010517057.1|  PREDICTED: diacylglycerol kinase theta           93.6    3e-18    
ref|XP_002283292.1|  PREDICTED: uncharacterized protein LOC100257225  92.8    4e-18    Vitis vinifera
ref|XP_007200406.1|  hypothetical protein PRUPE_ppa010933mg           92.4    4e-18    
ref|XP_004230849.1|  PREDICTED: uncharacterized protein LOC101260772  92.8    4e-18    
ref|XP_008448154.1|  PREDICTED: uncharacterized protein LOC103490439  92.8    4e-18    
ref|XP_007200363.1|  hypothetical protein PRUPE_ppa010622mg           92.8    4e-18    
ref|XP_002284701.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  95.5    4e-18    Vitis vinifera
ref|XP_010028546.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  95.5    4e-18    
ref|XP_006365493.1|  PREDICTED: uncharacterized protein LOC102590985  92.8    4e-18    
ref|XP_008236736.1|  PREDICTED: uncharacterized protein LOC103335502  92.4    5e-18    
ref|XP_009375313.1|  PREDICTED: uncharacterized protein LOC103964141  92.4    5e-18    
ref|XP_010910408.1|  PREDICTED: uncharacterized protein LOC105036333  92.4    6e-18    
emb|CDY67825.1|  BnaCnng56590D                                        90.9    6e-18    
ref|XP_008235838.1|  PREDICTED: uncharacterized protein LOC103334641  92.4    6e-18    
ref|XP_004139981.1|  PREDICTED: uncharacterized protein LOC101214474  92.4    6e-18    
emb|CDO97102.1|  unnamed protein product                              92.0    6e-18    
ref|XP_006846382.1|  hypothetical protein AMTR_s00012p00263580        92.4    7e-18    
ref|XP_008459265.1|  PREDICTED: uncharacterized protein LOC103498438  92.0    7e-18    
ref|XP_010489188.1|  PREDICTED: uncharacterized protein LOC104766915  91.7    9e-18    
ref|XP_006410974.1|  hypothetical protein EUTSA_v10017138mg           91.7    1e-17    
emb|CDX71255.1|  BnaC07g05340D                                        90.1    1e-17    
ref|XP_010690962.1|  PREDICTED: uncharacterized protein LOC104904417  91.7    1e-17    
ref|XP_010274284.1|  PREDICTED: uncharacterized protein LOC104609609  91.3    1e-17    
ref|XP_010270608.1|  PREDICTED: uncharacterized protein LOC104606891  91.7    1e-17    
ref|XP_002519112.1|  protein binding protein, putative                91.7    1e-17    Ricinus communis
gb|KEH30369.1|  cysteine/histidine-rich C1 domain protein             91.3    1e-17    
ref|XP_006410973.1|  hypothetical protein EUTSA_v10017531mg           91.3    1e-17    
gb|KHN25342.1|  hypothetical protein glysoja_010259                   91.3    1e-17    
ref|XP_004144568.1|  PREDICTED: uncharacterized protein LOC101218937  91.3    1e-17    
ref|XP_010999501.1|  PREDICTED: uncharacterized protein LOC105107312  90.9    1e-17    
ref|XP_004498185.1|  PREDICTED: uncharacterized protein LOC101491038  91.3    2e-17    
ref|XP_009798303.1|  PREDICTED: uncharacterized protein LOC104244556  90.9    2e-17    
ref|XP_010505377.1|  PREDICTED: diacylglycerol kinase theta-like      91.3    2e-17    
ref|XP_003541098.2|  PREDICTED: uncharacterized protein LOC100790779  90.9    2e-17    
ref|XP_006341197.1|  PREDICTED: uncharacterized protein LOC102604803  90.9    3e-17    
ref|XP_008451176.1|  PREDICTED: uncharacterized protein LOC103492553  90.5    3e-17    
gb|KFK36673.1|  hypothetical protein AALP_AA4G154900                  89.7    3e-17    
ref|XP_007131878.1|  hypothetical protein PHAVU_011G048900g           90.5    3e-17    
ref|XP_002313820.1|  DC1 domain-containing family protein             90.1    3e-17    Populus trichocarpa [western balsam poplar]
ref|XP_010255009.1|  PREDICTED: uncharacterized protein LOC104595803  90.1    3e-17    
ref|XP_010096236.1|  hypothetical protein L484_026973                 90.1    3e-17    
ref|XP_004289630.1|  PREDICTED: uncharacterized protein LOC101309404  90.1    3e-17    
ref|NP_179203.2|  Cysteine/Histidine-rich C1 domain family protein    90.1    4e-17    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010243310.1|  PREDICTED: uncharacterized protein LOC104587404  90.1    4e-17    
ref|XP_010517022.1|  PREDICTED: uncharacterized protein LOC104792535  89.7    5e-17    
ref|XP_009618628.1|  PREDICTED: uncharacterized protein LOC104110783  89.7    5e-17    
ref|XP_006590914.1|  PREDICTED: uncharacterized protein LOC100805046  89.4    6e-17    
ref|XP_008387338.1|  PREDICTED: uncharacterized protein LOC103449799  89.0    8e-17    
ref|XP_006410972.1|  hypothetical protein EUTSA_v10017725mg           88.2    9e-17    
ref|XP_010090730.1|  hypothetical protein L484_013752                 89.0    9e-17    
ref|XP_011040845.1|  PREDICTED: uncharacterized protein LOC105137000  89.0    9e-17    
ref|XP_010467342.1|  PREDICTED: uncharacterized protein LOC104747414  89.0    1e-16    
ref|XP_006660116.1|  PREDICTED: uncharacterized protein LOC102712928  90.5    1e-16    
ref|XP_011092762.1|  PREDICTED: uncharacterized protein LOC105172865  88.6    1e-16    
ref|XP_002271768.1|  PREDICTED: diacylglycerol kinase theta-like      89.0    1e-16    Vitis vinifera
ref|XP_009609507.1|  PREDICTED: uncharacterized protein LOC104103...  88.6    1e-16    
ref|XP_002305409.1|  DC1 domain-containing family protein             88.2    2e-16    Populus trichocarpa [western balsam poplar]
ref|XP_010658576.1|  PREDICTED: uncharacterized protein LOC104881139  88.6    2e-16    
ref|XP_004142194.1|  PREDICTED: uncharacterized protein LOC101203482  88.6    2e-16    
ref|XP_008382114.1|  PREDICTED: uncharacterized protein LOC103444922  87.8    2e-16    
ref|XP_009350358.1|  PREDICTED: uncharacterized protein LOC103941884  87.8    2e-16    
ref|XP_004142190.1|  PREDICTED: uncharacterized protein LOC101223041  88.6    2e-16    
ref|XP_009602754.1|  PREDICTED: uncharacterized protein LOC104097843  88.2    2e-16    
ref|XP_004987115.1|  PREDICTED: uncharacterized protein LOC101755021  86.7    2e-16    
ref|NP_181316.1|  cysteine/histidine-rich C1 domain-containing pr...  90.1    2e-16    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011037594.1|  PREDICTED: uncharacterized protein LOC105134753  87.8    2e-16    
ref|XP_004171720.1|  PREDICTED: uncharacterized LOC101223041          88.2    3e-16    
gb|KFK36674.1|  hypothetical protein AALP_AA4G155000                  87.8    3e-16    
ref|XP_006384879.1|  hypothetical protein POPTR_0004s21900g           87.4    3e-16    
gb|EPS58960.1|  hypothetical protein M569_15854                       87.0    4e-16    
emb|CAN78510.1|  hypothetical protein VITISV_031643                   89.4    4e-16    Vitis vinifera
ref|XP_010654237.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    4e-16    
ref|XP_008448294.1|  PREDICTED: uncharacterized protein LOC103490529  87.4    5e-16    
ref|XP_006298412.1|  hypothetical protein CARUB_v10014481mg           87.0    5e-16    
emb|CAN76804.1|  hypothetical protein VITISV_000634                   84.0    5e-16    Vitis vinifera
emb|CBI32534.3|  unnamed protein product                              86.3    5e-16    
ref|XP_009779824.1|  PREDICTED: uncharacterized protein LOC104228964  87.0    8e-16    
gb|EPS68374.1|  hypothetical protein M569_06392                       86.7    8e-16    
ref|XP_008813825.1|  PREDICTED: uncharacterized protein LOC103724371  86.3    9e-16    
ref|XP_009388938.1|  PREDICTED: uncharacterized protein LOC103975643  86.3    1e-15    
gb|AIN76234.1|  cysteine-histidine-rich C1 domain family protein      85.9    1e-15    
ref|XP_007041387.1|  Cysteine/Histidine-rich C1 domain family pro...  88.6    1e-15    
ref|XP_010526929.1|  PREDICTED: uncharacterized protein LOC104804360  85.9    1e-15    
emb|CAN63103.1|  hypothetical protein VITISV_029578                   88.6    1e-15    Vitis vinifera
ref|XP_010253825.1|  PREDICTED: uncharacterized protein LOC104594968  85.5    2e-15    
ref|XP_009773541.1|  PREDICTED: diacylglycerol kinase theta-like      85.5    2e-15    
ref|XP_009133207.1|  PREDICTED: uncharacterized protein LOC103857736  85.9    2e-15    
ref|XP_010675468.1|  PREDICTED: uncharacterized protein LOC104891469  84.7    2e-15    
tpg|DAA55038.1|  TPA: hypothetical protein ZEAMMB73_497831            86.3    2e-15    
gb|EYU41772.1|  hypothetical protein MIMGU_mgv11b018922mg             85.1    3e-15    
ref|XP_004507389.1|  PREDICTED: uncharacterized protein LOC101513960  84.3    4e-15    
ref|XP_009801635.1|  PREDICTED: uncharacterized protein LOC104247346  84.3    5e-15    
gb|EYU42639.1|  hypothetical protein MIMGU_mgv1a023213mg              84.0    6e-15    
ref|XP_007026910.1|  Cysteine/Histidine-rich C1 domain family pro...  84.7    6e-15    
ref|XP_011036079.1|  PREDICTED: uncharacterized protein LOC105133695  83.6    8e-15    
emb|CDY07768.1|  BnaA03g17430D                                        85.5    1e-14    
ref|XP_006493589.1|  PREDICTED: uncharacterized protein LOC102620618  84.3    1e-14    
ref|XP_010922353.1|  PREDICTED: uncharacterized protein LOC105045685  83.2    1e-14    
ref|XP_009406820.1|  PREDICTED: uncharacterized protein LOC103989633  81.3    1e-14    
emb|CDY59486.1|  BnaC03g72080D                                        82.8    1e-14    
emb|CDY59485.1|  BnaC03g72070D                                        82.8    1e-14    
emb|CAN64093.1|  hypothetical protein VITISV_016055                   82.8    1e-14    Vitis vinifera
ref|XP_010658564.1|  PREDICTED: uncharacterized protein LOC104881134  82.8    1e-14    
ref|XP_008448327.1|  PREDICTED: uncharacterized protein LOC103490554  83.2    2e-14    
emb|CDY07769.1|  BnaA03g17420D                                        82.4    2e-14    
gb|AAD26948.1|  hypothetical protein                                  80.9    2e-14    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001144613.1|  uncharacterized protein LOC100277629             82.4    2e-14    Zea mays [maize]
ref|XP_010690591.1|  PREDICTED: uncharacterized protein LOC104904101  82.4    2e-14    
gb|EYU41773.1|  hypothetical protein MIMGU_mgv1a024136mg              82.4    2e-14    
ref|XP_002271800.1|  PREDICTED: uncharacterized protein LOC100252758  82.4    2e-14    Vitis vinifera
ref|XP_010509275.1|  PREDICTED: uncharacterized protein LOC104785709  80.9    3e-14    
gb|KDO48121.1|  hypothetical protein CISIN_1g042921mg                 82.8    3e-14    
ref|XP_007200840.1|  hypothetical protein PRUPE_ppa026298mg           81.6    3e-14    
ref|XP_004246862.2|  PREDICTED: uncharacterized protein LOC101250920  84.3    4e-14    
gb|EYU37744.1|  hypothetical protein MIMGU_mgv1a012062mg              81.6    4e-14    
ref|XP_010478691.1|  PREDICTED: uncharacterized protein LOC104757632  80.9    5e-14    
ref|XP_008775784.1|  PREDICTED: uncharacterized protein LOC103696057  80.9    6e-14    
ref|XP_010910318.1|  PREDICTED: uncharacterized protein LOC105036256  80.9    6e-14    
gb|EYU27121.1|  hypothetical protein MIMGU_mgv1a025457mg              82.4    6e-14    
ref|XP_010653882.1|  PREDICTED: uncharacterized protein LOC104880120  81.3    6e-14    
ref|XP_009133208.1|  PREDICTED: uncharacterized protein LOC103857738  80.9    6e-14    
gb|AFK36976.1|  unknown                                               80.9    8e-14    
ref|XP_009135902.1|  PREDICTED: uncharacterized protein LOC103860043  80.1    9e-14    
gb|KCW66146.1|  hypothetical protein EUGRSUZ_G03410                   82.0    9e-14    
ref|XP_009609510.1|  PREDICTED: uncharacterized protein LOC104103312  80.1    1e-13    
gb|EYU35251.1|  hypothetical protein MIMGU_mgv1a019158mg              79.0    1e-13    
ref|XP_002323327.2|  DC1 domain-containing family protein             83.2    1e-13    Populus trichocarpa [western balsam poplar]
ref|XP_010068899.1|  PREDICTED: uncharacterized protein LOC104455890  79.7    1e-13    
ref|XP_008458931.1|  PREDICTED: uncharacterized protein LOC103498191  79.7    2e-13    
ref|XP_010456774.1|  PREDICTED: uncharacterized protein LOC104738272  80.5    2e-13    
ref|XP_011039456.1|  PREDICTED: uncharacterized protein LOC105136...  82.4    2e-13    
ref|XP_011039457.1|  PREDICTED: uncharacterized protein LOC105136...  82.0    2e-13    
ref|XP_002316259.2|  DC1 domain-containing family protein             79.7    2e-13    Populus trichocarpa [western balsam poplar]
ref|NP_181317.1|  Cysteine/Histidine-rich C1 domain family protein    79.0    2e-13    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036066.1|  PREDICTED: uncharacterized protein LOC105133676  79.3    2e-13    
dbj|BAJ86714.1|  predicted protein                                    79.3    3e-13    
ref|XP_010941914.1|  PREDICTED: uncharacterized protein LOC105060033  79.0    3e-13    
emb|CBI30490.3|  unnamed protein product                              79.0    3e-13    
ref|XP_011088326.1|  PREDICTED: uncharacterized protein LOC105169599  79.0    3e-13    
ref|XP_010067903.1|  PREDICTED: uncharacterized protein LOC104454684  80.5    3e-13    
gb|AFK45997.1|  unknown                                               77.4    4e-13    
ref|XP_007031380.1|  Cysteine/Histidine-rich C1 domain family pro...  79.0    5e-13    
ref|XP_008802756.1|  PREDICTED: uncharacterized protein LOC103716509  77.8    6e-13    
ref|XP_004165099.1|  PREDICTED: uncharacterized protein LOC101228868  78.2    7e-13    
ref|XP_004142836.1|  PREDICTED: uncharacterized protein LOC101213594  78.2    8e-13    
ref|XP_008458932.1|  PREDICTED: uncharacterized protein LOC103498192  77.4    1e-12    
ref|XP_010062762.1|  PREDICTED: uncharacterized protein LOC104450055  77.0    1e-12    
ref|XP_010507601.1|  PREDICTED: uncharacterized protein LOC104784245  77.0    1e-12    
ref|XP_006435993.1|  hypothetical protein CICLE_v10032506mg           77.4    1e-12    
ref|XP_010055458.1|  PREDICTED: uncharacterized protein LOC104443655  80.1    1e-12    
gb|EMS52363.1|  hypothetical protein TRIUR3_01647                     78.6    1e-12    
emb|CDP10062.1|  unnamed protein product                              79.7    1e-12    
dbj|BAK06969.1|  predicted protein                                    77.4    1e-12    
ref|XP_008448356.1|  PREDICTED: uncharacterized protein LOC103490570  77.0    1e-12    
ref|XP_004959826.1|  PREDICTED: uncharacterized protein LOC101780629  79.0    2e-12    
ref|XP_004151553.1|  PREDICTED: probable nucleoredoxin 1-1-like       75.5    2e-12    
ref|XP_009587921.1|  PREDICTED: uncharacterized protein LOC104085562  78.6    2e-12    
ref|XP_004136731.1|  PREDICTED: uncharacterized protein LOC101202742  76.6    2e-12    
ref|XP_010053581.1|  PREDICTED: uncharacterized protein LOC104441996  78.6    2e-12    
gb|EYU27108.1|  hypothetical protein MIMGU_mgv1a022256mg              76.3    2e-12    
ref|XP_009410586.1|  PREDICTED: atherin-like                          78.6    2e-12    
ref|XP_009401012.1|  PREDICTED: uncharacterized protein LOC103985121  77.0    2e-12    
gb|KGN51304.1|  hypothetical protein Csa_5G516560                     75.9    2e-12    
ref|XP_007029374.1|  Cysteine/Histidine-rich C1 domain family pro...  79.0    2e-12    
gb|EMT28386.1|  hypothetical protein F775_15359                       76.3    3e-12    
gb|KFK36671.1|  hypothetical protein AALP_AA4G154700                  75.9    3e-12    
ref|XP_003579199.1|  PREDICTED: uncharacterized protein LOC100837524  76.3    3e-12    
ref|XP_002322661.1|  hypothetical protein POPTR_0016s04640g           78.6    3e-12    
gb|KDO46400.1|  hypothetical protein CISIN_1g035521mg                 76.6    3e-12    
ref|XP_009792330.1|  PREDICTED: X-linked retinitis pigmentosa GTP...  77.8    3e-12    
ref|XP_009398501.1|  PREDICTED: uncharacterized protein LOC103983073  75.9    3e-12    
ref|XP_006478123.1|  PREDICTED: uncharacterized protein LOC102618330  76.3    4e-12    
ref|XP_008461757.1|  PREDICTED: probable nucleoredoxin 1-1            74.3    4e-12    
ref|XP_006373756.1|  hypothetical protein POPTR_0016s04770g           78.2    4e-12    
ref|XP_006441352.1|  hypothetical protein CICLE_v10024031mg           76.6    4e-12    
ref|XP_008236740.1|  PREDICTED: uncharacterized protein LOC103335505  75.1    5e-12    
ref|XP_006373755.1|  hypothetical protein POPTR_0016s047601g          74.7    6e-12    
gb|EAZ06937.1|  hypothetical protein OsI_29177                        75.1    6e-12    
ref|XP_006846383.1|  hypothetical protein AMTR_s00012p00263620        74.7    6e-12    
ref|XP_004142834.1|  PREDICTED: uncharacterized protein LOC101213112  75.1    7e-12    
ref|XP_002862969.1|  predicted protein                                72.8    8e-12    
gb|KDO37043.1|  hypothetical protein CISIN_1g036211mg                 74.3    1e-11    
ref|NP_001061767.1|  Os08g0404500                                     74.7    1e-11    
gb|EAZ42675.1|  hypothetical protein OsJ_27241                        73.6    1e-11    
ref|XP_006410970.1|  hypothetical protein EUTSA_v10017974mg           74.3    1e-11    
ref|XP_008443040.1|  PREDICTED: uncharacterized protein LOC103486755  74.3    1e-11    
ref|XP_006369462.1|  hypothetical protein POPTR_0001s23660g           75.1    1e-11    
ref|XP_011000767.1|  PREDICTED: uncharacterized protein LOC105108...  75.1    1e-11    
ref|XP_011000773.1|  PREDICTED: uncharacterized protein LOC105108...  75.1    1e-11    
ref|XP_011000772.1|  PREDICTED: uncharacterized protein LOC105108...  75.1    1e-11    
ref|XP_011000768.1|  PREDICTED: uncharacterized protein LOC105108...  75.1    1e-11    
ref|XP_011000771.1|  PREDICTED: uncharacterized protein LOC105108...  75.1    1e-11    
gb|EYU35255.1|  hypothetical protein MIMGU_mgv1a024928mg              73.2    1e-11    
ref|XP_008458884.1|  PREDICTED: uncharacterized protein LOC103498155  73.9    2e-11    
ref|XP_006486507.1|  PREDICTED: uncharacterized protein LOC102608837  73.9    2e-11    
ref|XP_008458928.1|  PREDICTED: uncharacterized protein LOC103498189  73.6    2e-11    
ref|XP_010528985.1|  PREDICTED: uncharacterized protein LOC104805963  76.3    2e-11    
ref|XP_009793294.1|  PREDICTED: uncharacterized protein LOC104240207  72.8    2e-11    
ref|XP_002530545.1|  protein binding protein, putative                74.7    2e-11    
ref|XP_006296296.1|  hypothetical protein CARUB_v10025466mg           72.4    3e-11    
ref|XP_007028907.1|  Uncharacterized protein TCM_024834               76.3    3e-11    
ref|XP_004156738.1|  PREDICTED: uncharacterized protein LOC101227411  73.2    3e-11    
ref|XP_010922354.1|  PREDICTED: uncharacterized protein LOC105045687  73.2    3e-11    
ref|XP_006486097.1|  PREDICTED: uncharacterized protein LOC102618645  73.2    3e-11    
gb|EYU27146.1|  hypothetical protein MIMGU_mgv1a011839mg              73.2    3e-11    
gb|KCW71933.1|  hypothetical protein EUGRSUZ_E00393                   75.9    3e-11    
ref|XP_011002292.1|  PREDICTED: uncharacterized protein LOC105109324  72.4    3e-11    
gb|KGN51307.1|  hypothetical protein Csa_5G517070                     72.8    3e-11    
ref|XP_006373751.1|  hypothetical protein POPTR_0016s04730g           72.4    3e-11    
ref|XP_004974683.1|  PREDICTED: uncharacterized protein LOC101777915  72.8    3e-11    
ref|XP_010055461.1|  PREDICTED: uncharacterized protein LOC104443657  75.5    3e-11    
ref|XP_009765121.1|  PREDICTED: uncharacterized protein LOC104216701  73.9    3e-11    
gb|EYU38382.1|  hypothetical protein MIMGU_mgv1a022712mg              72.8    4e-11    
gb|EYU27149.1|  hypothetical protein MIMGU_mgv1a012140mg              72.8    4e-11    
ref|XP_010691825.1|  PREDICTED: uncharacterized protein LOC104905082  75.1    4e-11    
ref|XP_007026909.1|  Cysteine/Histidine-rich C1 domain family pro...  73.2    4e-11    
gb|EAZ06895.1|  hypothetical protein OsI_29134                        74.7    4e-11    
ref|XP_002268131.1|  PREDICTED: uncharacterized protein LOC100261320  73.9    4e-11    
gb|KDO37048.1|  hypothetical protein CISIN_1g036737mg                 72.4    5e-11    
ref|XP_006435994.1|  hypothetical protein CICLE_v10033328mg           72.0    6e-11    
ref|XP_011002310.1|  PREDICTED: uncharacterized protein LOC105109329  73.2    6e-11    
emb|CDY57142.1|  BnaC04g53490D                                        71.6    6e-11    
dbj|BAF80453.1|  DC1 domain containing protein                        71.6    6e-11    
ref|XP_011033198.1|  PREDICTED: uncharacterized protein LOC105131...  74.7    6e-11    
gb|ABK24844.1|  unknown                                               71.6    6e-11    
gb|EYU27109.1|  hypothetical protein MIMGU_mgv1a024965mg              73.2    6e-11    
ref|XP_006373734.1|  hypothetical protein POPTR_0016s04400g           74.3    7e-11    
ref|XP_011033196.1|  PREDICTED: uncharacterized protein LOC105131...  74.3    7e-11    
ref|XP_011033194.1|  PREDICTED: uncharacterized protein LOC105131...  74.3    7e-11    
emb|CDP14956.1|  unnamed protein product                              74.3    8e-11    
ref|XP_002317723.2|  DC1 domain-containing family protein             72.4    1e-10    
ref|NP_001130492.1|  hypothetical protein                             71.2    1e-10    
ref|XP_006359160.1|  PREDICTED: uncharacterized protein LOC102598...  72.8    1e-10    
ref|XP_006359159.1|  PREDICTED: uncharacterized protein LOC102598...  72.8    1e-10    
ref|XP_002512181.1|  protein binding protein, putative                70.5    1e-10    
ref|XP_010246187.1|  PREDICTED: uncharacterized protein LOC104589539  72.4    1e-10    
emb|CDP07680.1|  unnamed protein product                              72.8    1e-10    
gb|KDP20386.1|  hypothetical protein JCGZ_05269                       70.1    1e-10    
ref|XP_010265934.1|  PREDICTED: uncharacterized protein LOC104603561  70.5    2e-10    
emb|CDP14976.1|  unnamed protein product                              73.2    2e-10    
ref|XP_009144109.1|  PREDICTED: uncharacterized protein LOC103867773  70.5    2e-10    
ref|XP_004142835.1|  PREDICTED: uncharacterized protein LOC101213357  70.9    2e-10    
ref|XP_004229346.1|  PREDICTED: uncharacterized protein LOC101250152  72.4    2e-10    
emb|CAN66246.1|  hypothetical protein VITISV_033016                   72.4    2e-10    
ref|XP_011087030.1|  PREDICTED: uncharacterized protein LOC105168590  72.4    2e-10    
ref|XP_004241463.2|  PREDICTED: uncharacterized protein LOC101268692  72.4    2e-10    
gb|EAY83759.1|  hypothetical protein OsI_38976                        70.9    2e-10    
ref|XP_009587118.1|  PREDICTED: uncharacterized protein LOC104084868  71.6    2e-10    
ref|XP_009619361.1|  PREDICTED: uncharacterized protein LOC104111386  71.6    2e-10    
ref|XP_007039749.1|  Cysteine/Histidine-rich C1 domain family pro...  72.4    3e-10    
ref|XP_008802757.1|  PREDICTED: uncharacterized protein LOC103716510  70.1    3e-10    
gb|AAB61029.1|  A_IG002N01.27 gene product                            72.4    3e-10    
ref|XP_002322659.2|  hypothetical protein POPTR_0016s04390g           72.0    3e-10    
ref|XP_009591760.1|  PREDICTED: uncharacterized protein LOC104088...  71.6    3e-10    
emb|CDP14966.1|  unnamed protein product                              72.0    3e-10    
ref|XP_011073977.1|  PREDICTED: uncharacterized protein LOC105158800  70.9    3e-10    
emb|CAB80944.1|  putative CHP-rich zinc finger protein                72.0    3e-10    
ref|XP_006359155.1|  PREDICTED: uncharacterized protein LOC102596695  69.7    4e-10    
ref|XP_009591759.1|  PREDICTED: uncharacterized protein LOC104088...  71.2    4e-10    
ref|NP_192044.2|  cysteine/histidine-rich C1 domain-containing pr...  72.0    4e-10    
ref|NP_181314.1|  cysteine/histidine-rich C1 domain-containing pr...  70.1    4e-10    
ref|XP_004963060.1|  PREDICTED: uncharacterized protein LOC101786433  69.7    5e-10    
gb|ABA99195.2|  DC1 domain-containing protein, putative, expressed    69.3    5e-10    
ref|XP_006347358.1|  PREDICTED: uncharacterized protein LOC102591548  70.9    5e-10    
ref|XP_010111365.1|  hypothetical protein L484_028022                 71.2    5e-10    
ref|XP_011088918.1|  PREDICTED: diacylglycerol kinase theta-like      69.7    5e-10    
ref|XP_004978942.1|  PREDICTED: uncharacterized protein LOC101753353  69.3    5e-10    
ref|XP_010519713.1|  PREDICTED: uncharacterized protein LOC104799...  71.2    5e-10    
ref|XP_011073147.1|  PREDICTED: uncharacterized protein LOC105158187  70.1    6e-10    
ref|XP_006369466.1|  DC1 domain-containing family protein             68.2    6e-10    
ref|XP_011033197.1|  PREDICTED: uncharacterized protein LOC105131...  71.6    6e-10    
gb|EYU27124.1|  hypothetical protein MIMGU_mgv1a018864mg              68.9    6e-10    
ref|XP_006373733.1|  hypothetical protein POPTR_0016s04390g           71.2    6e-10    
ref|XP_010235104.1|  PREDICTED: uncharacterized protein LOC104583707  69.3    6e-10    
emb|CDY46706.1|  BnaC07g42110D                                        71.2    6e-10    
ref|XP_002442444.1|  hypothetical protein SORBIDRAFT_08g020133        68.6    6e-10    
ref|XP_010524602.1|  PREDICTED: uncharacterized protein LOC104802616  69.3    7e-10    
ref|XP_010691826.1|  PREDICTED: uncharacterized protein LOC104905083  70.1    7e-10    
ref|XP_010544532.1|  PREDICTED: diacylglycerol kinase theta-like      68.9    7e-10    
ref|XP_004142189.1|  PREDICTED: uncharacterized protein LOC101222803  68.9    9e-10    
ref|XP_007023018.1|  Cysteine/Histidine-rich C1 domain family pro...  71.2    9e-10    
ref|XP_010519712.1|  PREDICTED: uncharacterized protein LOC104799...  70.9    9e-10    
gb|EAZ21099.1|  hypothetical protein OsJ_36740                        68.6    9e-10    
ref|NP_180394.1|  cysteine/histidine-rich C1-like domain-containi...  68.6    1e-09    
ref|XP_010506364.1|  PREDICTED: uncharacterized protein LOC104782986  68.2    1e-09    
ref|XP_003621910.1|  hypothetical protein MTR_7g024930                67.8    1e-09    
ref|XP_007203407.1|  hypothetical protein PRUPE_ppa021376mg           70.1    1e-09    
ref|XP_010318329.1|  PREDICTED: uncharacterized protein LOC101264193  69.7    1e-09    
ref|XP_002450602.1|  hypothetical protein SORBIDRAFT_05g008052        68.2    1e-09    
ref|XP_006392123.1|  hypothetical protein EUTSA_v10023939mg           70.5    1e-09    
ref|XP_008240917.1|  PREDICTED: uncharacterized protein LOC103339407  70.1    1e-09    
gb|KDP44966.1|  hypothetical protein JCGZ_01466                       68.2    1e-09    
gb|EMS49075.1|  putative nucleoredoxin 1                              67.8    1e-09    
gb|EMT10892.1|  hypothetical protein F775_23316                       67.0    1e-09    
ref|NP_198848.1|  cysteine/histidine-rich C1 domain-containing pr...  70.1    1e-09    
gb|KFK29943.1|  hypothetical protein AALP_AA7G198300                  70.1    1e-09    
gb|EYU27150.1|  hypothetical protein MIMGU_mgv1a018784mg              67.4    1e-09    
gb|ABK26475.1|  unknown                                               67.8    1e-09    
ref|XP_002323288.2|  hypothetical protein POPTR_0016s04350g           70.1    2e-09    
ref|NP_181966.1|  cysteine/histidine-rich C1 domain-containing pr...  67.8    2e-09    
emb|CDY63460.1|  BnaCnng42150D                                        69.3    2e-09    
ref|XP_010529595.1|  PREDICTED: uncharacterized protein LOC104806404  70.1    2e-09    
ref|XP_008458930.1|  PREDICTED: uncharacterized protein LOC103498190  67.8    2e-09    
ref|XP_010058185.1|  PREDICTED: uncharacterized protein LOC104445959  70.1    2e-09    
ref|XP_004173756.1|  PREDICTED: uncharacterized protein LOC101223378  67.8    2e-09    
emb|CDO98652.1|  unnamed protein product                              69.3    2e-09    
ref|XP_010506361.1|  PREDICTED: uncharacterized protein LOC104782983  67.4    2e-09    
ref|XP_006295388.1|  hypothetical protein CARUB_v10024483mg           67.4    2e-09    
emb|CDY22552.1|  BnaC03g23620D                                        67.8    2e-09    
ref|XP_006492914.1|  PREDICTED: uncharacterized protein LOC102618400  67.0    2e-09    
gb|KDO59888.1|  hypothetical protein CISIN_1g001175mg                 69.3    3e-09    
ref|XP_006494731.1|  PREDICTED: uncharacterized protein LOC102619...  69.3    3e-09    
ref|XP_006373753.1|  hypothetical protein POPTR_0016s04750g           66.6    3e-09    
ref|XP_006494733.1|  PREDICTED: uncharacterized protein LOC102619...  69.3    3e-09    
ref|XP_006494732.1|  PREDICTED: uncharacterized protein LOC102619...  69.3    3e-09    
gb|ABK23690.1|  unknown                                               66.6    3e-09    
ref|XP_002445472.1|  hypothetical protein SORBIDRAFT_07g020030        67.0    3e-09    
ref|XP_003621917.1|  hypothetical protein MTR_7g025000                66.2    3e-09    
emb|CDX88733.1|  BnaA03g09160D                                        68.9    4e-09    
emb|CDP07682.1|  unnamed protein product                              66.6    4e-09    
ref|XP_009596227.1|  PREDICTED: uncharacterized protein LOC104092341  66.6    4e-09    
ref|XP_010257481.1|  PREDICTED: uncharacterized protein LOC104597562  66.2    4e-09    
ref|XP_006429888.1|  hypothetical protein CICLE_v10013549mg           66.6    4e-09    
ref|XP_007023019.1|  Cysteine/Histidine-rich C1 domain family pro...  68.9    4e-09    
ref|XP_007023017.1|  Cysteine/Histidine-rich C1 domain family pro...  68.6    5e-09    
gb|KCW71929.1|  hypothetical protein EUGRSUZ_E00386                   68.6    5e-09    
ref|NP_001177044.1|  Os12g0596300                                     67.4    5e-09    
ref|XP_003520000.1|  PREDICTED: uncharacterized protein LOC100816065  66.2    5e-09    
ref|XP_010559202.1|  PREDICTED: uncharacterized protein LOC104827679  66.6    5e-09    
ref|XP_003621912.1|  hypothetical protein MTR_7g024950                66.2    5e-09    
ref|XP_007030357.1|  Cysteine/Histidine-rich C1 domain family pro...  68.6    5e-09    
ref|XP_006373752.1|  hypothetical protein POPTR_0016s04740g           68.6    5e-09    
gb|KDO70910.1|  hypothetical protein CISIN_1g040047mg                 66.2    5e-09    
emb|CDY35387.1|  BnaA03g19730D                                        66.6    5e-09    
ref|XP_009771792.1|  PREDICTED: uncharacterized protein LOC104222273  67.4    5e-09    
gb|KDP24637.1|  hypothetical protein JCGZ_25553                       67.4    5e-09    
gb|KCW71924.1|  hypothetical protein EUGRSUZ_E00381                   68.2    6e-09    
ref|XP_010322098.1|  PREDICTED: uncharacterized protein LOC104647934  65.5    6e-09    
ref|XP_009388619.1|  PREDICTED: uncharacterized protein LOC103975389  66.2    6e-09    
ref|XP_009131959.1|  PREDICTED: uncharacterized protein LOC103856592  68.2    7e-09    
ref|XP_002275658.1|  PREDICTED: uncharacterized protein LOC100258837  65.9    7e-09    
ref|NP_001168541.1|  hypothetical protein                             65.9    7e-09    
ref|XP_006428003.1|  hypothetical protein CICLE_v10027267mg           68.2    7e-09    
ref|XP_008448343.1|  PREDICTED: uncharacterized protein LOC103490565  65.1    7e-09    
ref|XP_009133532.1|  PREDICTED: uncharacterized protein LOC103858009  66.2    8e-09    
ref|XP_010058184.1|  PREDICTED: uncharacterized protein LOC104445957  68.2    8e-09    
gb|EYU27122.1|  hypothetical protein MIMGU_mgv1a017892mg              66.2    8e-09    
ref|XP_009142259.1|  PREDICTED: uncharacterized protein LOC103866135  65.5    9e-09    
ref|XP_009790389.1|  PREDICTED: diacylglycerol kinase theta-like      65.5    9e-09    
gb|EMS55283.1|  hypothetical protein TRIUR3_33991                     65.1    9e-09    
ref|XP_006583724.1|  PREDICTED: uncharacterized protein LOC102667953  65.5    9e-09    
ref|XP_006295416.1|  hypothetical protein CARUB_v10024514mg           65.1    1e-08    
ref|XP_002530849.1|  protein binding protein, putative                65.1    1e-08    
ref|XP_010514676.1|  PREDICTED: uncharacterized protein LOC104790594  65.5    1e-08    
ref|XP_010489404.1|  PREDICTED: uncharacterized protein LOC104767077  65.5    1e-08    
ref|XP_006397615.1|  hypothetical protein EUTSA_v10001796mg           65.1    1e-08    
gb|KHN23793.1|  hypothetical protein glysoja_044965                   65.1    1e-08    
ref|XP_010094816.1|  hypothetical protein L484_011389                 67.4    1e-08    
gb|EYU27144.1|  hypothetical protein MIMGU_mgv1a019454mg              67.0    1e-08    
ref|XP_006493876.1|  PREDICTED: uncharacterized protein LOC102615121  67.4    1e-08    
ref|XP_010691827.1|  PREDICTED: uncharacterized protein LOC104905084  65.5    2e-08    
ref|XP_010094819.1|  hypothetical protein L484_011392                 67.0    2e-08    
ref|XP_006418664.1|  hypothetical protein EUTSA_v10002650mg           64.7    2e-08    
gb|EYU27129.1|  hypothetical protein MIMGU_mgv1a020238mg              63.9    2e-08    
ref|XP_009596208.1|  PREDICTED: uncharacterized protein LOC104092...  64.7    2e-08    
gb|KHN07436.1|  hypothetical protein glysoja_012734                   66.2    2e-08    
gb|KDO59944.1|  hypothetical protein CISIN_1g045770mg                 67.0    2e-08    
emb|CDP21193.1|  unnamed protein product                              66.2    2e-08    
gb|EYU27152.1|  hypothetical protein MIMGU_mgv1a026602mg              63.9    2e-08    
ref|XP_006577684.1|  PREDICTED: uncharacterized protein LOC102661606  66.2    2e-08    
ref|XP_010518036.1|  PREDICTED: uncharacterized protein LOC104793382  64.7    2e-08    
ref|XP_011088907.1|  PREDICTED: uncharacterized protein LOC105170022  66.2    2e-08    
ref|XP_007139220.1|  hypothetical protein PHAVU_008G011500g           64.3    2e-08    
ref|XP_009596198.1|  PREDICTED: uncharacterized protein LOC104092...  64.7    2e-08    
ref|XP_009142260.1|  PREDICTED: uncharacterized protein LOC103866137  64.7    2e-08    
ref|XP_010506363.1|  PREDICTED: uncharacterized protein LOC104782985  63.9    2e-08    
ref|XP_007048688.1|  Binding protein, putative                        63.5    2e-08    
dbj|BAD82440.1|  hypothetical protein                                 64.7    2e-08    
ref|XP_010053575.1|  PREDICTED: uncharacterized protein LOC104441990  63.9    3e-08    
ref|XP_006855605.1|  hypothetical protein AMTR_s00044p00070150        65.1    3e-08    
ref|XP_007023025.1|  Cysteine/Histidine-rich C1 domain family pro...  66.2    3e-08    
emb|CDP07683.1|  unnamed protein product                              65.5    3e-08    



>ref|XP_009788733.1| PREDICTED: uncharacterized protein LOC104236505 isoform X1 [Nicotiana 
sylvestris]
Length=328

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 175/258 (68%), Positives = 203/258 (79%), Gaps = 14/258 (5%)
 Frame = +2

Query  350   VEFPTSPQP--------NNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQ  505
             +EFPTSPQP         N    +VH +H+KHPL E+TL ELFTCSGCKE+GAG+RYACQ
Sbjct  61    IEFPTSPQPPDDHDGVHANHNGTIVHHTHSKHPLAEITLSELFTCSGCKEFGAGRRYACQ  120

Query  506   QCNFQLHDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRC  685
              C+FQLH FCALSPPSL  HP HGQHQL+FH KPKQVK+GIT  +CDVCGKSTKGFTFRC
Sbjct  121   DCDFQLHHFCALSPPSLKAHPFHGQHQLVFHAKPKQVKAGITWPRCDVCGKSTKGFTFRC  180

Query  686   R--ACSFQMHPCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCG  859
             R  +C+FQMHPCCAMLSTE+K P H H LK+LPP + L G    G+     + + CG C 
Sbjct  181   RVNSCNFQMHPCCAMLSTEVKLPIHPHSLKVLPPGNALSGGAGGGNDQ---SGMVCGACK  237

Query  860   KKR-AGRVYGCTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefig  1036
             KKR +GRVY CT CDYHLHA+CAK M+NGLQE GI PPEKP+VLGTA ++A QVV EFIG
Sbjct  238   KKRSSGRVYSCTVCDYHLHAMCAKSMINGLQEYGIKPPEKPNVLGTAARLASQVVIEFIG  297

Query  1037  glidgigegvgeAIVQNI  1090
             GLI+G+GEGVGEA+VQNI
Sbjct  298   GLIEGLGEGVGEALVQNI  315



>ref|XP_009595949.1| PREDICTED: uncharacterized protein LOC104092133 [Nicotiana tomentosiformis]
Length=328

 Score =   320 bits (821),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 173/258 (67%), Positives = 204/258 (79%), Gaps = 14/258 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGE--------EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQ  505
             +EFPTSPQP +  +         +VH +H+KHPL E+TL ELFTCSGCKE+GAG+RYACQ
Sbjct  61    IEFPTSPQPPDDHDGVHAHHNGTIVHHTHSKHPLAEITLSELFTCSGCKEFGAGRRYACQ  120

Query  506   QCNFQLHDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRC  685
              C+FQLH FCALSPPSL  HP HGQHQL+FH KPKQVK+GIT  +CDVCGKSTKGFTFRC
Sbjct  121   DCDFQLHHFCALSPPSLKAHPFHGQHQLVFHAKPKQVKAGITWPRCDVCGKSTKGFTFRC  180

Query  686   R--ACSFQMHPCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCG  859
             R  +C+FQMHPCCAMLSTE+K P H H LK++PP + L G    G+     + + CG C 
Sbjct  181   RINSCNFQMHPCCAMLSTEVKLPIHPHPLKVVPPGNALSGGAGGGNVQ---SGMVCGACK  237

Query  860   KKR-AGRVYGCTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefig  1036
             KKR +GRVY CT CDYHLHA+CAK M+NGLQE GI PPEKP+VLGTA ++A QVV EFIG
Sbjct  238   KKRSSGRVYSCTVCDYHLHALCAKSMINGLQEYGIKPPEKPNVLGTAARLASQVVIEFIG  297

Query  1037  glidgigegvgeAIVQNI  1090
             GLI+G+GEGVGEA+VQNI
Sbjct  298   GLIEGLGEGVGEALVQNI  315



>ref|XP_006342198.1| PREDICTED: uncharacterized protein LOC102590059 isoform X1 [Solanum 
tuberosum]
Length=328

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 174/268 (65%), Positives = 201/268 (75%), Gaps = 14/268 (5%)
 Frame = +2

Query  350   VEFPTSPQP--------NNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQ  505
             +EFPTSPQP         N    +VH +H+KHPL E+TL ELFTCSGCKE+G G+RYACQ
Sbjct  61    IEFPTSPQPPDDHTGYHANHNGTIVHHTHSKHPLAEITLSELFTCSGCKEFGTGRRYACQ  120

Query  506   QCNFQLHDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRC  685
              C FQLH FCALSPPSL  HP HGQHQL+FH KPKQVK+GI   +CDVC KSTKGFTFRC
Sbjct  121   DCGFQLHHFCALSPPSLKAHPFHGQHQLVFHAKPKQVKAGIAWPRCDVCCKSTKGFTFRC  180

Query  686   R--ACSFQMHPCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCG  859
             R  +C+FQMHPCCAMLSTEIK+P H H LK+LPP + L G    G+       + C +C 
Sbjct  181   RVNSCNFQMHPCCAMLSTEIKFPNHPHLLKVLPPGNTLPGGAGGGNDQ---PGMVCSECK  237

Query  860   KKR-AGRVYGCTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefig  1036
             KKR +GRVY CT C YHLHA+CAK M+NGLQE GI PPEKP++LGTA ++A QVV EFIG
Sbjct  238   KKRSSGRVYSCTVCGYHLHALCAKSMINGLQEYGIKPPEKPNMLGTAARLASQVVIEFIG  297

Query  1037  glidgigegvgeAIVQNISGGRGSARIR  1120
             GLI+G GEGVGE +VQNI  GRGS   R
Sbjct  298   GLIEGFGEGVGEVLVQNIGRGRGSTNRR  325



>ref|XP_004238473.1| PREDICTED: uncharacterized protein LOC101246922 [Solanum lycopersicum]
Length=328

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 172/259 (66%), Positives = 199/259 (77%), Gaps = 16/259 (6%)
 Frame = +2

Query  350   VEFPTSPQP--------NNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQ  505
             +EFPTSPQP         N    +VH +H+KHPL E+TL ELFTCSGCKE+G G+RYACQ
Sbjct  61    IEFPTSPQPPDDHTGYHANHNGTIVHHTHSKHPLAEITLSELFTCSGCKEFGTGRRYACQ  120

Query  506   QCNFQLHDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRC  685
              C+FQLH FCALSPPSL  HP HGQHQL+FH KPKQVK+GI   +CDVC KSTKGFTFRC
Sbjct  121   DCDFQLHHFCALSPPSLKAHPFHGQHQLVFHAKPKQVKAGIAWPRCDVCCKSTKGFTFRC  180

Query  686   R--ACSFQMHPCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAG-DQHGHAAAVSCGKC  856
             R  +C+FQMHPCCAMLSTEIK+P H H LK+LP  + L G    G DQ G    + C +C
Sbjct  181   RVKSCNFQMHPCCAMLSTEIKFPNHPHLLKVLPQGNTLTGGAGGGNDQPG----MVCSEC  236

Query  857   GKKR-AGRVYGCTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefi  1033
              KKR +GRVY CT CDYHLHA+CAK M+NGLQE GI PPEKP++LGTA ++A QVV EFI
Sbjct  237   KKKRSSGRVYSCTVCDYHLHALCAKSMINGLQEYGIKPPEKPTMLGTAARLASQVVIEFI  296

Query  1034  gglidgigegvgeAIVQNI  1090
             GGLI+G GEGVGE +VQNI
Sbjct  297   GGLIEGFGEGVGEVLVQNI  315



>ref|XP_011099848.1| PREDICTED: uncharacterized protein LOC105178156 [Sesamum indicum]
Length=295

 Score =   303 bits (777),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 168/281 (60%), Positives = 200/281 (71%), Gaps = 34/281 (12%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFPTSPQP  G E++ H +H++HPL E+ LPELFTCSGCKE+GAGKR+ACQQC+FQLH+
Sbjct  22    VEFPTSPQPTVG-EQITHYAHSQHPLTELILPELFTCSGCKEFGAGKRFACQQCDFQLHE  80

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPK------------------------QVKSGITRA  637
             FCA+SPP L  HPLHGQHQL+FH KP+                          K GI+  
Sbjct  81    FCAVSPPLLKNHPLHGQHQLVFHSKPRPGIHICIQNHATSFTKNYTMTMYISSKGGISWP  140

Query  638   KCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGD  817
             +CDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI +P H H LKLL         PA   
Sbjct  141   RCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEINFPIHPHPLKLL---------PAFST  191

Query  818   QHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTA  997
               G     +CG+C K+R+GR+Y CT C+YHLHA+CAK ++NGL  NGI  PEKPS LGTA
Sbjct  192   SSGANMGANCGECNKRRSGRMYRCTVCEYHLHALCAKPLINGLGPNGIPTPEKPSALGTA  251

Query  998   VKIAGQVVFefigglidgigegvgeAIVQNISGGRGSARIR  1120
              ++A QVV EFIGGLI+G GEG+GE IVQ+I+ GR  +R R
Sbjct  252   ARLASQVVIEFIGGLIEGFGEGMGEVIVQSIARGRCISRRR  292



>ref|XP_003530319.1| PREDICTED: uncharacterized protein LOC100815805 [Glycine max]
Length=300

 Score =   294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 155/252 (62%), Positives = 188/252 (75%), Gaps = 12/252 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFPTSPQ    GEE++H SH +HPL  + LP+LF C GCKEYG+GKR+ CQQC+FQLHD
Sbjct  49    VEFPTSPQ-LIFGEEILHFSHPQHPLSMVDLPDLFNCVGCKEYGSGKRFVCQQCDFQLHD  107

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP H QH +LFH KP   K+G+ ++KCDVCGK TKGF F C AC+FQMH
Sbjct  108   FCALAPPALKAHPFHSQHSVLFHSKP--AKTGMAKSKCDVCGKPTKGFAFLCTACAFQMH  165

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAML+TEI+YPPH H LK+LP +S     P         A+  CG+C K+R+G+VY C
Sbjct  166   PCCAMLNTEIEYPPHPHTLKMLPTTSSTAPDP---------ASFVCGECKKRRSGKVYRC  216

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T C YHLHAVCAK  +NGLQ NGI  PEKPSVL  A ++A QVV EFIGGL++GIGE VG
Sbjct  217   TVCKYHLHAVCAKTKINGLQANGIRTPEKPSVLAAAARVASQVVIEFIGGLVEGIGESVG  276

Query  1070  eAIVQNISGGRG  1105
             + +VQNI+ G  
Sbjct  277   DVLVQNIAKGNN  288



>gb|KHN23500.1| hypothetical protein glysoja_043761 [Glycine soja]
Length=278

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/252 (62%), Positives = 188/252 (75%), Gaps = 12/252 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFPTSPQ    GEE++H SH +HPL  + LP+LF C GCKEYG+GKR+ CQQC+FQLHD
Sbjct  27    VEFPTSPQ-LIFGEEILHFSHPQHPLSMVDLPDLFNCVGCKEYGSGKRFVCQQCDFQLHD  85

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP H QH +LFH KP   K+G+ ++KCDVCGK TKGF F C AC+FQMH
Sbjct  86    FCALAPPALKAHPFHSQHSVLFHSKP--AKTGMAKSKCDVCGKPTKGFAFLCTACAFQMH  143

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAML+TEI+YPPH H LK+LP +S     P         A+  CG+C K+R+G+VY C
Sbjct  144   PCCAMLNTEIEYPPHPHTLKMLPTTSSTAPDP---------ASFVCGECKKRRSGKVYRC  194

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T C YHLHAVCAK  +NGLQ NGI  PEKPSVL  A ++A QVV EFIGGL++GIGE VG
Sbjct  195   TVCKYHLHAVCAKTKINGLQANGIRTPEKPSVLAAAARVASQVVIEFIGGLVEGIGESVG  254

Query  1070  eAIVQNISGGRG  1105
             + +VQNI+ G  
Sbjct  255   DVLVQNIAKGNN  266



>ref|XP_003556619.1| PREDICTED: uncharacterized protein LOC100797641 [Glycine max]
Length=299

 Score =   288 bits (738),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 153/253 (60%), Positives = 188/253 (74%), Gaps = 15/253 (6%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFPTSPQ    GEE++H SH +HPL  + LP+LF C GCKEYG+GKR+ CQQC+FQLHD
Sbjct  51    VEFPTSPQ-LIFGEEILHFSHPQHPLSMVDLPDLFNCVGCKEYGSGKRFVCQQCDFQLHD  109

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP H QH +LFH KP  VKSG+ ++KCDVCGK TKGF F C AC+FQMH
Sbjct  110   FCALAPPALKAHPFHSQHSVLFHSKP--VKSGMAKSKCDVCGKPTKGFGFLCTACAFQMH  167

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAML+ EI+YP H H L++LP +                A+  CG+C K+R+G+VY C
Sbjct  168   PCCAMLNNEIEYPAHPHTLRMLPTTV------------PDPASFVCGECKKQRSGKVYRC  215

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T C+YHLHAVCAK  +NGLQ NGI PPEKPSVL  A ++A QVV EFIGGL++GIGE VG
Sbjct  216   TVCEYHLHAVCAKTKINGLQANGIRPPEKPSVLAAAARVASQVVIEFIGGLVEGIGESVG  275

Query  1070  eAIVQNISGGRGS  1108
             + +VQNI+ G  +
Sbjct  276   DVLVQNIAKGNNA  288



>ref|XP_008237886.1| PREDICTED: uncharacterized protein LOC103336604 [Prunus mume]
Length=290

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/256 (60%), Positives = 192/256 (75%), Gaps = 10/256 (4%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFPTSPQ    GEEM+H  H +HPL ++ LP+LFTC+GCKEYGAGKR+ CQQCNFQLHD
Sbjct  40    VEFPTSPQLI-FGEEMLHFGHPQHPLSQVNLPDLFTCAGCKEYGAGKRFVCQQCNFQLHD  98

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+LN+HP H QHQL+ +   K VK GI ++KCDVC K  KG+ FRC  CSFQMH
Sbjct  99    FCALAPPALNSHPFHFQHQLVLYS--KSVKGGIAQSKCDVCHKPAKGYAFRCSTCSFQMH  156

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLS+EI    H H L+LLP +S   G P +      +++  CG+C +KR+GRVY C
Sbjct  157   PCCAMLSSEINLQTHPHTLRLLPATSSSNGDPNS------SSSFVCGECRRKRSGRVYHC  210

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T C+YH+HAVCAK+M+NGL +NG    EKPSV G A ++A QVV EFIGGL++G+GEGV 
Sbjct  211   TVCNYHVHAVCAKDMINGLHDNGHKGREKPSVFGAAARLASQVVIEFIGGLMEGLGEGVA  270

Query  1070  eAIVQNIS-GGRGSAR  1114
             EA V+NI+  GR + R
Sbjct  271   EAFVENIARSGRANGR  286



>ref|XP_006435484.1| hypothetical protein CICLE_v10001981mg [Citrus clementina]
 ref|XP_006494442.1| PREDICTED: uncharacterized protein LOC102616666 [Citrus sinensis]
 gb|ESR48724.1| hypothetical protein CICLE_v10001981mg [Citrus clementina]
 gb|KDO85290.1| hypothetical protein CISIN_1g022100mg [Citrus sinensis]
Length=302

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/253 (62%), Positives = 189/253 (75%), Gaps = 13/253 (5%)
 Frame = +2

Query  353   EFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDF  532
             EFPTSP+    GEE+ H  H +HPL E+ LP+LFTC+GCKEYGAGKR+ CQQC+FQLH+F
Sbjct  53    EFPTSPR-LILGEEITHFGHPQHPLAEIDLPDLFTCAGCKEYGAGKRFTCQQCDFQLHEF  111

Query  533   CALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHP  712
             CA +P +L  HPLH QHQL+F  KP  VK GI +++CDVCGK TKG+TFRC ACSFQMHP
Sbjct  112   CAFAPQTLKNHPLHCQHQLVFFSKP--VKGGIMKSRCDVCGKPTKGYTFRCSACSFQMHP  169

Query  713   CCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCT  892
             CCA LSTEI YP HAH LKLL  +    G P             CG+C +KR+GRVY CT
Sbjct  170   CCAKLSTEINYPVHAHTLKLLAVTPLTNGDP----------GFVCGECKRKRSGRVYRCT  219

Query  893   ACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvge  1072
              C+YHLHAVCAK M+NGLQ N I  P+KPS+LGTA ++A QVV +FIGGLI+G+GEGVGE
Sbjct  220   ICNYHLHAVCAKGMVNGLQANDIKGPDKPSMLGTAARLASQVVIDFIGGLIEGLGEGVGE  279

Query  1073  AIVQNISGGRGSA  1111
             A+  N++ GR + 
Sbjct  280   AVASNVTRGRSTT  292



>ref|XP_007211272.1| hypothetical protein PRUPE_ppa017191mg [Prunus persica]
 gb|EMJ12471.1| hypothetical protein PRUPE_ppa017191mg [Prunus persica]
Length=285

 Score =   285 bits (730),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 191/256 (75%), Gaps = 10/256 (4%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFPTSPQ    GEEM+H  H +HPL ++ LP+LFTC+GCKEYGAGKR+ CQQC+FQLHD
Sbjct  35    VEFPTSPQLI-FGEEMLHFGHPQHPLSQVNLPDLFTCAGCKEYGAGKRFVCQQCDFQLHD  93

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+LN+HP H QHQL+ +   K VK GI ++KCD+C K  KG+ FRC  CSFQMH
Sbjct  94    FCALAPPALNSHPFHFQHQLVLYS--KSVKGGIAQSKCDICHKPAKGYAFRCSTCSFQMH  151

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLS+EI    H H L+LLP +S   G P +      +++  CG+C +KR+GRVY C
Sbjct  152   PCCAMLSSEINLQTHPHTLRLLPATSSSNGDPNS------SSSFVCGECRRKRSGRVYHC  205

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T C+YH+HAVCAK+M+NGL +NG    EKPSV GTA ++A QVV EFIGGLI+G+GEGV 
Sbjct  206   TVCNYHVHAVCAKDMINGLHDNGHKGREKPSVFGTAARLASQVVIEFIGGLIEGLGEGVA  265

Query  1070  eAIVQNIS-GGRGSAR  1114
             E  V NI+  GR + R
Sbjct  266   EVFVDNIARSGRANGR  281



>gb|EYU41215.1| hypothetical protein MIMGU_mgv1a018037mg, partial [Erythranthe 
guttata]
Length=260

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 196/263 (75%), Gaps = 24/263 (9%)
 Frame = +2

Query  350   VEFPTS---PQPN-NGGE-EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCN  514
             ++FPTS   P  N NGGE E+ H +H+ HPL ++ L +LFTC GCKEYGAG R++CQ C+
Sbjct  8     IQFPTSAAQPSTNGNGGENEITHYTHSNHPLTQLNLSQLFTCDGCKEYGAGTRFSCQHCD  67

Query  515   FQLHDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRAC  694
             FQLHDFCA +PP LN HPLHGQHQL+FH KPK    G++   CDVCGKSTKGFTFRCRAC
Sbjct  68    FQLHDFCAAAPPLLNNHPLHGQHQLVFHSKPK--SGGMSWPTCDVCGKSTKGFTFRCRAC  125

Query  695   SFQMHPCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRA-  871
             +FQMHPCCAMLSTE+ +P H H L++LPP +G              AA+ CG+C K+R+ 
Sbjct  126   NFQMHPCCAMLSTEVNFPIHPHPLRVLPPLNG--------------AAMDCGECKKRRSK  171

Query  872   GRVYGCTAC-DYHLHAVCAKEMMNGLQENGINPPEKP-SVLGTAVKIAGQVVFefiggli  1045
             GR+Y CT C DYHLHA+CAK  +NGLQ NGI  P KP S LGTA ++A QVV EFIGGLI
Sbjct  172   GRIYRCTVCSDYHLHALCAKPFVNGLQANGIPTPGKPTSALGTAARLASQVVIEFIGGLI  231

Query  1046  dgigegvgeAIVQNISGGRGSAR  1114
             +GIGEG+GEA+VQN+  GR  +R
Sbjct  232   EGIGEGMGEALVQNMVRGRCISR  254



>ref|XP_003589678.1| hypothetical protein MTR_1g034960 [Medicago truncatula]
 gb|AES59929.1| cysteine/histidine-rich C1 domain protein [Medicago truncatula]
Length=313

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 150/254 (59%), Positives = 188/254 (74%), Gaps = 8/254 (3%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EFPTSPQ    GEE++H SH +HPL  + LP+LF C GCKEYG+GKR+ CQQCN+QLHD
Sbjct  53    IEFPTSPQLI-FGEEIIHFSHPQHPLSMVDLPDLFICVGCKEYGSGKRFVCQQCNYQLHD  111

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP H QH +LFH KP  VKSG+T++KCDVCGK TKG+TF C AC+FQMH
Sbjct  112   FCALAPPALKAHPFHSQHAMLFHSKP--VKSGMTKSKCDVCGKPTKGYTFLCTACAFQMH  169

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAML+TEI++P H H LKL    +    +         +  + C +C K+R+G+VY C
Sbjct  170   PCCAMLNTEIEFPNHPHTLKL----THSSTTTGTATNTDLSNTIVCNECKKRRSGKVYRC  225

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T C+Y+LHA CAK  +NGLQ NGI  PEKPSVL  A K+A QVV EFIGG ++GIGE +G
Sbjct  226   TVCNYNLHAFCAKNKVNGLQANGIRLPEKPSVLSAAAKVASQVVIEFIGGFVEGIGESMG  285

Query  1070  eAIVQNIS-GGRGS  1108
             E +VQNI+ GG G+
Sbjct  286   EVLVQNITKGGNGT  299



>ref|XP_007153122.1| hypothetical protein PHAVU_003G008600g [Phaseolus vulgaris]
 gb|ESW25116.1| hypothetical protein PHAVU_003G008600g [Phaseolus vulgaris]
Length=304

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 188/265 (71%), Gaps = 13/265 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFPTSPQ    GEE+VH SH +HPL  + LP+LF C GCKEYG+GKR+ CQQC+FQ+HD
Sbjct  51    VEFPTSPQ-LIFGEEIVHFSHPQHPLSVVDLPDLFNCVGCKEYGSGKRFVCQQCDFQMHD  109

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGI-TRAKCDVCGKSTKGFTFRCRACSFQM  706
             FCAL+P +L  HP H QH LLFH KP  VKSG+  + KCDVC K TKGF F C AC+FQM
Sbjct  110   FCALAPTALKAHPFHSQHSLLFHSKP--VKSGMGGKVKCDVCVKPTKGFAFLCTACAFQM  167

Query  707   HPCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYG  886
             HPCCAML+TEI +P H H LK+LP +S     P         A+  C +C K+++G+VY 
Sbjct  168   HPCCAMLNTEIDFPSHPHTLKILPTTSSAAVDP---------ASFVCAECKKRKSGKVYR  218

Query  887   CTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegv  1066
             CT CDYHLHA CAK  +NGL  NGI PP+KPSVL  A ++A QVV EFIGGL++GIGE V
Sbjct  219   CTVCDYHLHAACAKTKINGLLANGIKPPQKPSVLAAAARVASQVVIEFIGGLVEGIGESV  278

Query  1067  geAIVQNISGGRGSARIRAT*RLNY  1141
             G+ +VQNI+ G   +   A+ +  Y
Sbjct  279   GDVLVQNITKGNAVSPANASPKPRY  303



>ref|XP_004300081.1| PREDICTED: uncharacterized protein LOC101308578 [Fragaria vesca 
subsp. vesca]
Length=290

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 154/250 (62%), Positives = 187/250 (75%), Gaps = 13/250 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             + FPTSPQ    GEEM+H SH +HPL  + LP+LFTC+GCKEYGAGKR+ CQQC++QLHD
Sbjct  42    LRFPTSPQLV-LGEEMLHFSHPQHPLSHVNLPDLFTCAGCKEYGAGKRFTCQQCDYQLHD  100

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L +HP H QHQL+F+ KP  VK GI ++KCDVC K  KG+ FRC ACSFQMH
Sbjct  101   FCALAPPALKSHPFHCQHQLVFYSKP--VKGGIAQSKCDVCNKPIKGYAFRCGACSFQMH  158

Query  710   PCCAMLSTEIKYP-PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAG-RVY  883
             PCCAMLS+EI     H H L+LLP S+ L          G   +  CG+C +KR+G RVY
Sbjct  159   PCCAMLSSEISLLYVHPHTLRLLPASTTLSS--------GSDPSFVCGECRRKRSGTRVY  210

Query  884   GCTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigeg  1063
              CT CDYHLHAVCAK M+NGL ENGI   EKPS+LGTA ++A QVV EFIGGL++G+GEG
Sbjct  211   HCTVCDYHLHAVCAKNMINGLHENGIKNREKPSMLGTAARLASQVVIEFIGGLMEGLGEG  270

Query  1064  vgeAIVQNIS  1093
             V E  VQN++
Sbjct  271   VAEVFVQNVT  280



>ref|XP_008364325.1| PREDICTED: uncharacterized protein LOC103427985 [Malus domestica]
Length=301

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/255 (59%), Positives = 190/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EFPTSPQ    GEE++H  H +HPL ++ LP+LFTC+GCKEYGAGKR+ CQQC+FQLHD
Sbjct  53    LEFPTSPQLV-FGEEILHFGHPQHPLSQVILPDLFTCAGCKEYGAGKRFICQQCDFQLHD  111

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP H QHQL+F+   K VK GI ++KCDVC + +KG+ FRC ACSFQMH
Sbjct  112   FCALAPPALKNHPFHFQHQLVFYS--KAVKGGIAQSKCDVCHRPSKGYAFRCSACSFQMH  169

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLS+EI    H H L+LLP ++       +       ++  C +C +K++GRVY C
Sbjct  170   PCCAMLSSEINLQTHPHTLRLLPAAASGSIGGDSS-----GSSFVCAECRRKKSGRVYHC  224

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
               CDYH+HAVCAK M+NGLQENG+   EKPSVLGTA ++A QVV EFIGGLI+G+GEGV 
Sbjct  225   KVCDYHIHAVCAKNMINGLQENGLKGREKPSVLGTAARLASQVVIEFIGGLIEGLGEGVA  284

Query  1070  eAIVQNIS-GGRGSA  1111
             E  VQNI+  GR +A
Sbjct  285   EVFVQNIARSGRPNA  299



>ref|XP_002307829.2| hypothetical protein POPTR_0005s28020g [Populus trichocarpa]
 gb|EEE94825.2| hypothetical protein POPTR_0005s28020g [Populus trichocarpa]
Length=299

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 152/254 (60%), Positives = 186/254 (73%), Gaps = 8/254 (3%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +E+P SPQ   G E + H+SH +HPL ++ + +LFTCSGCKEYG+G R+ CQQC FQLH 
Sbjct  48    IEYPASPQIILGEETLRHTSHPQHPLSQVEVSDLFTCSGCKEYGSGFRFTCQQCEFQLHV  107

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L  HP H QHQL  H KP  VK GI ++KCDVC K TKG+TFRC ACS+QMH
Sbjct  108   FCALAPPLLKEHPFHRQHQLSLHSKP--VKGGILKSKCDVCWKPTKGYTFRCNACSYQMH  165

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLS +I    H H LKLLP  + +  SP  GD    A+   CG+C +KR+GRVY C
Sbjct  166   PCCAMLSAQINITVHPHPLKLLP--ANVTNSP-NGDS---ASGFVCGECKRKRSGRVYRC  219

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T C+YHLHAVCAK M+NGL+ NGI  PEKPS+LGTA ++A QV  EFIGG+I+G+GEGVG
Sbjct  220   TVCEYHLHAVCAKNMVNGLEANGIKGPEKPSMLGTAARLASQVFSEFIGGIIEGLGEGVG  279

Query  1070  eAIVQNISGGRGSA  1111
             E  +Q I+ GR  A
Sbjct  280   EMFIQTITRGRRPA  293



>ref|XP_004498200.1| PREDICTED: uncharacterized protein LOC101495335 [Cicer arietinum]
Length=306

 Score =   273 bits (699),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 147/254 (58%), Positives = 187/254 (74%), Gaps = 8/254 (3%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EFP SPQ    GEE++H SH +H L  + LP+LFTC GCKEYG+GKR+ CQQC++QLHD
Sbjct  51    LEFPKSPQLI-FGEEIIHFSHPQHALSMVDLPDLFTCVGCKEYGSGKRFVCQQCDYQLHD  109

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HPLH QH +LFH KP  VK G+T++KCDVCGK TKG+TF C AC+FQMH
Sbjct  110   FCALAPPALMAHPLHSQHAILFHSKP--VKIGMTKSKCDVCGKPTKGYTFVCTACAFQMH  167

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAML+T+I +P H H LKL    +    S    +   ++  + C +C K+R+G+VY C
Sbjct  168   PCCAMLNTQIDFPKHPHTLKL----TSSSSSTTTTNIDNNSNNIVCNECKKRRSGKVYRC  223

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T CDY+LHA CAK  +NGLQ NGI   EKPSVL  A K+A QVV EFIGG ++G+GE +G
Sbjct  224   TVCDYNLHAFCAKSKVNGLQANGIRVLEKPSVLAAAAKVASQVVIEFIGGFVEGLGESMG  283

Query  1070  eAIVQNIS-GGRGS  1108
             E +VQNI+ GG G+
Sbjct  284   EVLVQNIAKGGSGN  297



>ref|XP_009347083.1| PREDICTED: uncharacterized protein LOC103938763 [Pyrus x bretschneideri]
Length=308

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/255 (59%), Positives = 189/255 (74%), Gaps = 9/255 (4%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EFPTSPQ    GEE++   H +HPL ++ LP+LFTC+GCKEYGAGKR+ CQQC+FQLHD
Sbjct  60    LEFPTSPQLI-FGEEILQFGHPQHPLSQVILPDLFTCAGCKEYGAGKRFICQQCDFQLHD  118

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP H QHQL+F+   K VK GI ++KCDVC + +KG+ FRC ACSFQMH
Sbjct  119   FCALAPPALKNHPFHFQHQLVFYY--KAVKGGIAQSKCDVCHRPSKGYAFRCSACSFQMH  176

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLS+EI    H H L+LLP ++       +       ++  C +C +KR+GRVY C
Sbjct  177   PCCAMLSSEINLQTHPHTLRLLPAAASGGSGGDSS-----GSSFVCAECRRKRSGRVYHC  231

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
               CDYH+HAVCAK M+NGLQENG+   EKPSVLGTA ++A QVV EFIGGLI+G+GEGV 
Sbjct  232   KVCDYHIHAVCAKNMINGLQENGLKGREKPSVLGTAARLASQVVIEFIGGLIEGLGEGVA  291

Query  1070  eAIVQNIS-GGRGSA  1111
             E  VQNI+  GR +A
Sbjct  292   EVFVQNIARSGRPNA  306



>ref|XP_008346427.1| PREDICTED: uncharacterized protein LOC103409391 [Malus domestica]
Length=289

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 187/256 (73%), Gaps = 17/256 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFPTS      GEE +H  H +HPL ++ LP+LFTC+GCKE GAGKR+ CQ C+FQLHD
Sbjct  43    VEFPTSQLI--FGEERLHFXHPQHPLSQVILPDLFTCAGCKEXGAGKRFICQLCDFQLHD  100

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP H QHQL+F+   K VK GI ++KCD+C K +KG+ FRC ACSFQMH
Sbjct  101   FCALAPPALKNHPFHIQHQLVFYS--KAVKGGIAQSKCDICHKPSKGYAFRCSACSFQMH  158

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLS+EI    H H L+LL          +A D    + +  CG+C ++R+GRVY C
Sbjct  159   PCCAMLSSEINLQTHPHTLRLL----------SAAD--SSSRSFVCGECRRRRSGRVYHC  206

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T CDYHLHAVCAK M+NGLQENG+   EKPSVLGTA ++A QVV EFIGGLI+G+GEGV 
Sbjct  207   TVCDYHLHAVCAKNMINGLQENGLKGREKPSVLGTAARLASQVVTEFIGGLIEGLGEGVA  266

Query  1070  eAIVQNIS-GGRGSAR  1114
               +VQ+I+  GR +AR
Sbjct  267   XVLVQDIARSGRPNAR  282



>ref|XP_009362918.1| PREDICTED: uncharacterized protein LOC103952935 [Pyrus x bretschneideri]
Length=304

 Score =   271 bits (693),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 188/255 (74%), Gaps = 9/255 (4%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EF TSPQ    GEE++   H +HPL ++ LP+LFTC+GCKEYGAGKR+ CQQC+FQLHD
Sbjct  56    LEFSTSPQLI-FGEEILQFGHPQHPLSQVILPDLFTCAGCKEYGAGKRFICQQCDFQLHD  114

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP H QHQL+F+   K VK GI ++KCDVC + +KG+ FRC ACSFQMH
Sbjct  115   FCALAPPALKNHPFHFQHQLVFYS--KAVKGGIAQSKCDVCHRPSKGYAFRCSACSFQMH  172

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLS+EI    H H L+LLP ++       +       ++  C +C +KR+GRVY C
Sbjct  173   PCCAMLSSEINLQTHPHTLRLLPAAASGGSGGDSS-----GSSFVCAECRRKRSGRVYHC  227

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
               CDYH+HAVCAK M+NGLQENG+   EKPSVLGTA ++A QVV EFIGGL++G+GEGV 
Sbjct  228   KVCDYHIHAVCAKNMINGLQENGLKGREKPSVLGTAARLASQVVIEFIGGLVEGLGEGVA  287

Query  1070  eAIVQNIS-GGRGSA  1111
             E  VQNI+  GR +A
Sbjct  288   EVFVQNIARSGRPNA  302



>ref|XP_008453038.1| PREDICTED: uncharacterized protein LOC103493863 [Cucumis melo]
Length=308

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 187/256 (73%), Gaps = 5/256 (2%)
 Frame = +2

Query  356   FPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFC  535
              P SPQ   G EEMVH SH +H L  M LP+LFTCSGCKEYGAG R++CQQC+FQLHDFC
Sbjct  55    LPVSPQLMYG-EEMVHFSHPRHRLSRMCLPDLFTCSGCKEYGAGNRFSCQQCDFQLHDFC  113

Query  536   ALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPC  715
             A SPP+L  HP H  HQLLF+ KP  VK GI ++KC++C K  KGF+FRC  CSFQMHPC
Sbjct  114   AFSPPALKAHPFHSYHQLLFYSKP--VKGGIMQSKCEICAKPIKGFSFRCGVCSFQMHPC  171

Query  716   CAMLSTEIKYPP-HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCT  892
             CAMLS E+K P  H H LK++  ++    S +      H  A SCG+C K+R+GRVY CT
Sbjct  172   CAMLSWEMKIPSMHPHTLKMVGATTISSTSSSTVQLVDHHQA-SCGECKKRRSGRVYRCT  230

Query  893   ACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvge  1072
              C+Y +HAVCAK + NGL++NG N  EKPSVLGTA ++A QVV EF+GG+I+G+GEGVGE
Sbjct  231   VCEYQVHAVCAKSVKNGLRDNGHNGAEKPSVLGTAARLASQVVVEFLGGIIEGLGEGVGE  290

Query  1073  AIVQNISGGRGSARIR  1120
             A VQNI+G    + +R
Sbjct  291   AFVQNINGKAAPSPLR  306



>ref|XP_009372668.1| PREDICTED: histone-lysine N-methyltransferase ATX3-like isoform 
X1 [Pyrus x bretschneideri]
Length=289

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 186/256 (73%), Gaps = 17/256 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EFPTS      GEE +H  H +HPL ++  P+LFTC+GCKEYGAGKR+ CQ C F+LHD
Sbjct  43    LEFPTSQL--IFGEERLHFGHPQHPLSQVIRPDLFTCAGCKEYGAGKRFICQPCEFRLHD  100

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP H QHQL+F+   K VK GI ++KCD+C K +KG+ FRC ACSFQMH
Sbjct  101   FCALAPPALKNHPFHIQHQLVFYS--KAVKGGIAQSKCDICHKPSKGYAFRCSACSFQMH  158

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLS+EI    H H L+LLP          A D    A +  CG+C ++R+GRVY C
Sbjct  159   PCCAMLSSEINLQTHPHTLRLLP----------AAD--FSARSFVCGECRRRRSGRVYHC  206

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T CDYHLHAVCAK M+NGLQENG+   EKPSVLGTA ++A QVV EF+GG+I+G+GE V 
Sbjct  207   TVCDYHLHAVCAKNMINGLQENGLKGREKPSVLGTAARLASQVVTEFVGGIIEGLGESVA  266

Query  1070  eAIVQNIS-GGRGSAR  1114
             E +VQ+I+  GR +AR
Sbjct  267   EVLVQDIARSGRPNAR  282



>ref|XP_007028813.1| Cysteine/Histidine-rich C1 domain family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY09315.1| Cysteine/Histidine-rich C1 domain family protein, putative isoform 
1 [Theobroma cacao]
Length=279

 Score =   265 bits (677),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 183/260 (70%), Gaps = 13/260 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             V FPTSPQ    GEE+ + +H +HP+ +  LP+LFTC+ CKEYGAG+R+ C  C++QLHD
Sbjct  31    VAFPTSPQAPQLGEEIFYFAHPQHPISQTNLPDLFTCAACKEYGAGERFTCSDCDYQLHD  90

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP+H  H+++F  KP  VKSGI +++CDVC K+TKG  F+C  CSFQMH
Sbjct  91    FCALAPPALKRHPIHPVHKIIFFPKP--VKSGILKSRCDVCAKTTKGCVFKCTVCSFQMH  148

Query  710   PCCAMLSTEIKYPPHAHRLKLLP-PSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYG  886
             PCCAMLSTEI  P H H L+LLP P     G P             CG+C K+R+GRVY 
Sbjct  149   PCCAMLSTEINIPVHPHTLRLLPVPQYTSNGDP----------GFVCGECNKRRSGRVYH  198

Query  887   CTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegv  1066
             CT CDYHLHAVCAK M+NGLQ NG    EK S+LG A K+A +V+ +FIGGLI+GIGEGV
Sbjct  199   CTVCDYHLHAVCAKNMVNGLQANGFKGMEKSSMLGAAAKVASRVMIDFIGGLIEGIGEGV  258

Query  1067  geAIVQNISGGRGSARIRAT  1126
             G+ ++Q+ + GR   R   T
Sbjct  259   GQVLIQSAARGRCHTRSDRT  278



>ref|XP_011041124.1| PREDICTED: diacylglycerol kinase theta [Populus euphratica]
Length=293

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 149/254 (59%), Positives = 184/254 (72%), Gaps = 8/254 (3%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +E+  SP    G E   H+SH +HPL ++ + +LFTCSGCKEYG+G R+ACQQC FQLH+
Sbjct  42    IEYTASPHIILGEETPRHTSHPQHPLSQIEVSDLFTCSGCKEYGSGFRFACQQCEFQLHE  101

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP LN H  H QHQL  H KP   K GI ++KCDVC K TKG+TFRC ACS+QMH
Sbjct  102   FCALAPPLLNEHHFHRQHQLSLHSKPD--KGGILKSKCDVCWKPTKGYTFRCNACSYQMH  159

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCA LS +I    H H LK+LP  + +  SP  GD    A+   CG+C +KR+GRVY C
Sbjct  160   PCCATLSDQINITVHPHPLKILP--ANVTNSP-NGDS---ASGFVCGECKRKRSGRVYRC  213

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             TAC+YHLHAVCAK M+NGL+ NGI  PEKPS+LGTA ++A QV  EFIGG+I+G+GEGVG
Sbjct  214   TACEYHLHAVCAKNMVNGLEANGIKGPEKPSMLGTAARLASQVFSEFIGGIIEGLGEGVG  273

Query  1070  eAIVQNISGGRGSA  1111
             E  +Q I+ GR  A
Sbjct  274   EMFIQTITRGRRPA  287



>emb|CDP07241.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   266 bits (679),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 158/261 (61%), Positives = 192/261 (74%), Gaps = 22/261 (8%)
 Frame = +2

Query  350   VEFPTSPQP-----NNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCN  514
             +EFPTSPQ      ++    + H SH KHPL ++TLPELF C+GCKEYGAGKR+ACQ+C+
Sbjct  40    IEFPTSPQGCTSIGSDAAVLVTHYSHPKHPLAQLTLPELFACAGCKEYGAGKRFACQECD  99

Query  515   FQLHDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRAC  694
             +QLH+FCALSPP L +HPLH QHQL+FH +PKQ   GI   +CD+CGKS +GFTFRCRAC
Sbjct  100   YQLHEFCALSPPLLRSHPLHPQHQLVFHSRPKQ--GGIKWPRCDICGKSCRGFTFRCRAC  157

Query  695   SFQMHPCCAMLSTEIKYPP-HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRA  871
             SFQMHPCCAMLST+I  P  H H LKLLPP   LQ S A        + VSC +C K+R+
Sbjct  158   SFQMHPCCAMLSTDITLPELHPHPLKLLPPRQ-LQLSNAG------ESLVSCDRCKKRRS  210

Query  872   -GRVYGCTAC-DYHLHAVCAKEMMNGLQENGINPP---EKPS--VLGTAVKIAGQVVFef  1030
              GRVY C  C +YHLHA+CAK  +NGLQENG       +KPS  VLGTA ++A QVV EF
Sbjct  211   GGRVYRCAVCNNYHLHALCAKPFINGLQENGFQTAPDHDKPSNTVLGTAARLASQVVIEF  270

Query  1031  igglidgigegvgeAIVQNIS  1093
             IGGLI+G GEG G+A+VQ+I+
Sbjct  271   IGGLIEGFGEGFGQALVQSIN  291



>ref|XP_009372669.1| PREDICTED: uncharacterized protein LOC103961787 isoform X2 [Pyrus 
x bretschneideri]
Length=287

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 184/256 (72%), Gaps = 19/256 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EFPTS      GEE +H  H +HPL ++  P+LFTC+GCKEYGAGKR+ CQ C F+LHD
Sbjct  43    LEFPTSQL--IFGEERLHFGHPQHPLSQVIRPDLFTCAGCKEYGAGKRFICQPCEFRLHD  100

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP H QHQL+F+ K      GI ++KCD+C K +KG+ FRC ACSFQMH
Sbjct  101   FCALAPPALKNHPFHIQHQLVFYSK----AGGIAQSKCDICHKPSKGYAFRCSACSFQMH  156

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLS+EI    H H L+LLP          A D    A +  CG+C ++R+GRVY C
Sbjct  157   PCCAMLSSEINLQTHPHTLRLLP----------AAD--FSARSFVCGECRRRRSGRVYHC  204

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T CDYHLHAVCAK M+NGLQENG+   EKPSVLGTA ++A QVV EF+GG+I+G+GE V 
Sbjct  205   TVCDYHLHAVCAKNMINGLQENGLKGREKPSVLGTAARLASQVVTEFVGGIIEGLGESVA  264

Query  1070  eAIVQNIS-GGRGSAR  1114
             E +VQ+I+  GR +AR
Sbjct  265   EVLVQDIARSGRPNAR  280



>ref|XP_002510748.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52935.1| protein binding protein, putative [Ricinus communis]
Length=267

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 180/249 (72%), Gaps = 14/249 (6%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFPTSPQ    GE+++H  H +HPL ++ L +LFTCSGCKEYG+GKR  CQQCNFQLH+
Sbjct  21    VEFPTSPQ-LILGEQILHFGHPQHPLYQVELSDLFTCSGCKEYGSGKRLICQQCNFQLHE  79

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FC  +   LNTHPLH  HQLLF  KP  VK GI ++KCDVCGKS KG+ FRC ACS+QMH
Sbjct  80    FCGFASQQLNTHPLHIHHQLLFASKP--VKGGILKSKCDVCGKSAKGYMFRCNACSYQMH  137

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             PCCAMLS EI    H H LK+LP  S   G P             CG+C + KR+GRV+ 
Sbjct  138   PCCAMLSNEINISVHPHPLKILPAMSSPNGDP----------GFVCGECNRAKRSGRVFR  187

Query  887   CTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegv  1066
             CT C+YHLHAVCAK M+NGL  NG    EKPS+LGTA ++A QV+ EFIGGLI+GIGEGV
Sbjct  188   CTVCEYHLHAVCAKNMVNGLLANGFKGVEKPSMLGTAARLASQVIIEFIGGLIEGIGEGV  247

Query  1067  geAIVQNIS  1093
             GEA +Q+I+
Sbjct  248   GEAFIQSIA  256



>ref|XP_004145611.1| PREDICTED: uncharacterized protein LOC101220216 [Cucumis sativus]
Length=298

 Score =   263 bits (673),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 151/253 (60%), Positives = 185/253 (73%), Gaps = 13/253 (5%)
 Frame = +2

Query  356   FPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFC  535
              P SPQ   G EEMVH SH +H L  M LP+LFTCSGCKEYGAG R++CQQC+FQLHDFC
Sbjct  43    LPVSPQLMYG-EEMVHFSHPRHRLSRMCLPDLFTCSGCKEYGAGNRFSCQQCDFQLHDFC  101

Query  536   ALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPC  715
             A SPP+L  HP H  HQLLF+ KP  VK GI ++KC++C K  KGF+FRC  CSFQMHPC
Sbjct  102   AFSPPALKAHPFHSYHQLLFYSKP--VKGGIMQSKCEICAKPIKGFSFRCGVCSFQMHPC  159

Query  716   CAMLSTEIKYPP-HAHRLKLLPPSSGLQGSPAAG-----DQHGHAAAVSCGKCGKKRAGR  877
             CAMLS E+K P  H H LK++  ++    S ++      D H     VSCG+C K+R+GR
Sbjct  160   CAMLSWEMKMPSMHPHPLKMVGATTTSSSSSSSSTVQLVDHH----QVSCGECNKRRSGR  215

Query  878   VYGCTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgig  1057
             VY CT C+Y +HAVCAK + NGL++NG    EKPSVLGTA ++A QVV EF+GG+I+G+G
Sbjct  216   VYRCTVCEYQVHAVCAKSVKNGLRDNGHKGAEKPSVLGTAARLASQVVVEFLGGIIEGLG  275

Query  1058  egvgeAIVQNISG  1096
             EGVGEA VQNI+G
Sbjct  276   EGVGEAFVQNING  288



>ref|XP_007028814.1| Cysteine/Histidine-rich C1 domain family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY09316.1| Cysteine/Histidine-rich C1 domain family protein, putative isoform 
2 [Theobroma cacao]
Length=270

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 181/254 (71%), Gaps = 15/254 (6%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             V FPTSPQ    GEE+ + +H +HP+ +  LP+LFTC+ CKEYGAG+R+ C  C++QLHD
Sbjct  31    VAFPTSPQAPQLGEEIFYFAHPQHPISQTNLPDLFTCAACKEYGAGERFTCSDCDYQLHD  90

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L  HP+H  H+++F  KP  VKSGI +++CDVC K+TKG  F+C  CSFQMH
Sbjct  91    FCALAPPALKRHPIHPVHKIIFFPKP--VKSGILKSRCDVCAKTTKGCVFKCTVCSFQMH  148

Query  710   PCCAMLSTEIKYPPHAHRLKLLP-PSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYG  886
             PCCAMLSTEI  P H H L+LLP P     G P             CG+C K+R+GRVY 
Sbjct  149   PCCAMLSTEINIPVHPHTLRLLPVPQYTSNGDP----------GFVCGECNKRRSGRVYH  198

Query  887   CTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegv  1066
             CT CDYHLHAVCAK M+NGLQ NG    EK S+LG A K+A +V+ +FIGGLI+GIGEGV
Sbjct  199   CTVCDYHLHAVCAKNMVNGLQANGFKGMEKSSMLGAAAKVASRVMIDFIGGLIEGIGEGV  258

Query  1067  geAIVQNISGGRGS  1108
             G+ ++Q  S  RGS
Sbjct  259   GQVLIQ--SAARGS  270



>gb|KGN55555.1| hypothetical protein Csa_4G665110 [Cucumis sativus]
Length=299

 Score =   263 bits (672),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 151/254 (59%), Positives = 185/254 (73%), Gaps = 14/254 (6%)
 Frame = +2

Query  356   FPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFC  535
              P SPQ   G EEMVH SH +H L  M LP+LFTCSGCKEYGAG R++CQQC+FQLHDFC
Sbjct  43    LPVSPQLMYG-EEMVHFSHPRHRLSRMCLPDLFTCSGCKEYGAGNRFSCQQCDFQLHDFC  101

Query  536   ALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPC  715
             A SPP+L  HP H  HQLLF+ KP  VK GI ++KC++C K  KGF+FRC  CSFQMHPC
Sbjct  102   AFSPPALKAHPFHSYHQLLFYSKP--VKGGIMQSKCEICAKPIKGFSFRCGVCSFQMHPC  159

Query  716   CAMLSTEIKYPP-HAHRLKLLPPSSGLQGSPAAG------DQHGHAAAVSCGKCGKKRAG  874
             CAMLS E+K P  H H LK++  ++    S ++       D H     VSCG+C K+R+G
Sbjct  160   CAMLSWEMKMPSMHPHPLKMVGATTTSSSSSSSSSTVQLVDHH----QVSCGECNKRRSG  215

Query  875   RVYGCTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgi  1054
             RVY CT C+Y +HAVCAK + NGL++NG    EKPSVLGTA ++A QVV EF+GG+I+G+
Sbjct  216   RVYRCTVCEYQVHAVCAKSVKNGLRDNGHKGAEKPSVLGTAARLASQVVVEFLGGIIEGL  275

Query  1055  gegvgeAIVQNISG  1096
             GEGVGEA VQNI+G
Sbjct  276   GEGVGEAFVQNING  289



>ref|XP_004157110.1| PREDICTED: uncharacterized protein LOC101223621 [Cucumis sativus]
Length=297

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/253 (59%), Positives = 184/253 (73%), Gaps = 14/253 (6%)
 Frame = +2

Query  356   FPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFC  535
              P SPQ   G EEMVH SH +H L  M LP+LFTCSGCKEYGAG R++CQQC+FQLHDFC
Sbjct  43    LPVSPQLMYG-EEMVHFSHPRHRLSRMCLPDLFTCSGCKEYGAGNRFSCQQCDFQLHDFC  101

Query  536   ALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPC  715
             A SPP+L  HP H  HQLLF+ KP  VK GI ++KC++C K  KGF+FRC  CSFQMHPC
Sbjct  102   AFSPPALKAHPFHSYHQLLFYSKP--VKGGIMQSKCEICAKPIKGFSFRCGVCSFQMHPC  159

Query  716   CAMLSTEIKYPP-HAHRLKLLPPSSGLQGSPAAG------DQHGHAAAVSCGKCGKKRAG  874
             CAMLS E+K P  H H LK++  ++    S ++       D H     VSCG+C K+R+G
Sbjct  160   CAMLSWEMKMPSMHPHPLKMVGATTTSSSSSSSSSTVQLVDHH----QVSCGECNKRRSG  215

Query  875   RVYGCTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgi  1054
             RVY CT C+Y +HAVCAK + NGL++NG    EKPSVLGTA ++A QVV EF+GG+I+G+
Sbjct  216   RVYRCTVCEYQVHAVCAKSVKNGLRDNGHKGAEKPSVLGTAARLASQVVVEFLGGIIEGL  275

Query  1055  gegvgeAIVQNIS  1093
             GEGVGEA VQNI+
Sbjct  276   GEGVGEAFVQNIN  288



>ref|XP_010534419.1| PREDICTED: uncharacterized protein LOC104809973 isoform X1 [Tarenaya 
hassleriana]
Length=306

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/260 (59%), Positives = 189/260 (73%), Gaps = 19/260 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EFP SPQ   G EEMVH  H +H   ++ LP+L+TCSGCKE GAGKRY CQQC++QLH+
Sbjct  55    MEFPVSPQLILG-EEMVHFGHPQHVAAKVELPDLYTCSGCKEDGAGKRYVCQQCDYQLHE  113

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L  HP H QH LLF+ KP   K GI ++KCDVCG++ KG+TFRC+AC FQMH
Sbjct  114   FCALAPPLLKAHPFHYQHHLLFYAKPS--KGGIVKSKCDVCGRTPKGYTFRCKACGFQMH  171

Query  710   PCCAMLSTEIKYPPH-AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVY  883
             PCCAMLS  I +  H  H LKLL         PA GD  G+     CG+C + KR+GRVY
Sbjct  172   PCCAMLSPTISFSGHPNHALKLL---------PAGGDGGGNYV---CGECKRGKRSGRVY  219

Query  884   GCTACDYHLHAVCAKEMMNGLQENGINPPEK-PSVLGTAVKIAGQVVFefigglidgige  1060
              CT C+YHLHAVCAKEM+NGL+ NG+   EK P+VLGTA K+A QVV +F+GG+++GIGE
Sbjct  220   RCTVCEYHLHAVCAKEMVNGLRANGLKSKEKSPAVLGTAAKLASQVVIDFLGGIMEGIGE  279

Query  1061  gvgeAIVQNIS-GGRGSARI  1117
             GVGEA +  ++ GG G ARI
Sbjct  280   GVGEAFLDGVTRGGNGPARI  299



>ref|XP_010534428.1| PREDICTED: uncharacterized protein LOC104809973 isoform X2 [Tarenaya 
hassleriana]
Length=304

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 188/259 (73%), Gaps = 19/259 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EFP SPQ   G EEMVH  H +H   ++ LP+L+TCSGCKE GAGKRY CQQC++QLH+
Sbjct  55    MEFPVSPQLILG-EEMVHFGHPQHVAAKVELPDLYTCSGCKEDGAGKRYVCQQCDYQLHE  113

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L  HP H QH LLF+ KP   K GI ++KCDVCG++ KG+TFRC+AC FQMH
Sbjct  114   FCALAPPLLKAHPFHYQHHLLFYAKPS--KGGIVKSKCDVCGRTPKGYTFRCKACGFQMH  171

Query  710   PCCAMLSTEIKYPPH-AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVY  883
             PCCAMLS  I +  H  H LKLL         PA GD  G+     CG+C + KR+GRVY
Sbjct  172   PCCAMLSPTISFSGHPNHALKLL---------PAGGDGGGNYV---CGECKRGKRSGRVY  219

Query  884   GCTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigeg  1063
              CT C+YHLHAVCAKEM+NGL+ NG+   + P+VLGTA K+A QVV +F+GG+++GIGEG
Sbjct  220   RCTVCEYHLHAVCAKEMVNGLRANGLK-SKSPAVLGTAAKLASQVVIDFLGGIMEGIGEG  278

Query  1064  vgeAIVQNIS-GGRGSARI  1117
             VGEA +  ++ GG G ARI
Sbjct  279   VGEAFLDGVTRGGNGPARI  297



>gb|KDP36722.1| hypothetical protein JCGZ_08013 [Jatropha curcas]
Length=282

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 181/249 (73%), Gaps = 10/249 (4%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EFPTSP     GEE++HS H +H L ++ LPELFTC+GCKEYG+GKR+ CQQC+FQLH+
Sbjct  31    IEFPTSPH-LLLGEELIHSGHPQHRLFQVDLPELFTCAGCKEYGSGKRFTCQQCDFQLHE  89

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FC L+PP L  HPLH  HQL F  KP   K GI ++KCDVCGK  KG++FRC AC++QMH
Sbjct  90    FCGLAPPLLKAHPLHMHHQLYFSSKPG--KGGILKSKCDVCGKPAKGYSFRCNACNYQMH  147

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             PCCAMLS EI    H H LKLLP  + +  +   GD  G      CG+C + KR+GRVY 
Sbjct  148   PCCAMLSNEINISVHPHPLKLLP--AAVMSTLPNGDSSG---GFVCGECNRFKRSGRVYR  202

Query  887   CTACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegv  1066
             CT C+YHLHAVCAK M+NGL  NGI   E  S+ GTA K+A QV+ +FIGG+I+GIGEGV
Sbjct  203   CTVCEYHLHAVCAKNMVNGLHSNGIK-VENSSMFGTAAKLASQVIIQFIGGIIEGIGEGV  261

Query  1067  geAIVQNIS  1093
             GEA +Q+I+
Sbjct  262   GEAFIQSIA  270



>ref|XP_010061339.1| PREDICTED: uncharacterized protein LOC104449040 [Eucalyptus grandis]
Length=290

 Score =   255 bits (651),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 177/258 (69%), Gaps = 19/258 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EFPTSP+    G EM+H SH  H L  M LPELFTCSGC+E GAGKRYACQ CN+QLH+
Sbjct  43    IEFPTSPE-RIVGAEMLHFSHPHHHLFHMNLPELFTCSGCQELGAGKRYACQHCNYQLHE  101

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+P +L +HPLH QH+L+F+ KP + KS     KCDVCGKS KGF+FRC  C+FQ+H
Sbjct  102   FCALAPQALRSHPLHYQHELVFYSKPGKAKS-----KCDVCGKSIKGFSFRCNPCNFQIH  156

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAML  EI + PH H LK       L  SP  G+      +  CG+C +KR GR+Y C
Sbjct  157   PCCAMLPLEIVFAPHPHTLKF------LMASPNGGE-----TSFQCGECKRKRTGRIYRC  205

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPS--VLGTAVKIAGQVVFefigglidgigeg  1063
               CDYHLHA+CAK + NGL+++GI  P   S  VL  A +IA QVV  F GGLI+GIG+ 
Sbjct  206   AVCDYHLHAICAKIIFNGLKDSGITEPTSKSGPVLEAATRIATQVVTGFFGGLIEGIGQT  265

Query  1064  vgeAIVQNISGGRGSARI  1117
             VGE I Q + GG G+A +
Sbjct  266   VGEDIFQTVLGGAGNAFV  283



>ref|XP_010684748.1| PREDICTED: uncharacterized protein LOC104899283 [Beta vulgaris 
subsp. vulgaris]
Length=334

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 145/261 (56%), Positives = 181/261 (69%), Gaps = 16/261 (6%)
 Frame = +2

Query  350   VEFPTSPQPNNG--GEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQL  523
             +EFP SP  +    GE + +S+H +H +V + LP  FTC GCKEYGAG R+ CQQCNF+L
Sbjct  80    IEFPVSPDADVLLLGEGITNSNHPQHKMVHVNLPNPFTCMGCKEYGAGSRFTCQQCNFEL  139

Query  524   HDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQ  703
             HDFCAL+P  L  HPLH QHQL+F  KP   K G+ R+KCDVCGKS KG+ F C ACSFQ
Sbjct  140   HDFCALAPLVLKAHPLHSQHQLVFIPKPG--KGGLMRSKCDVCGKSAKGYMFHCSACSFQ  197

Query  704   MHPCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVY  883
             +HPCCAMLS ++ +P H H L +LP ++ L  SP  GD       + C +C K+RAG++Y
Sbjct  198   LHPCCAMLSAKMSFPTHPHSLVILPATANL-ASP--GDH------MLCSECKKRRAGKLY  248

Query  884   GCTACDYHLHAVCAKEMMNGLQENGINPPE--KPSVLGTAVKIAGQVVFefigglidgig  1057
              CT CDY+LHAVCAK M+NGL  NGI   E  KPS+LG A KIA  VV   +GG+++GIG
Sbjct  249   QCTVCDYYLHAVCAKSMVNGLHANGIKGLENGKPSMLGVAAKIASHVVVGLMGGIVEGIG  308

Query  1058  egvgeAIVQNISGGR-GSARI  1117
             EG+GEA+ QN   GR  S RI
Sbjct  309   EGLGEALTQNFLKGRCNSTRI  329



>ref|XP_008798635.1| PREDICTED: diacylglycerol kinase theta-like [Phoenix dactylifera]
Length=324

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 161/225 (72%), Gaps = 15/225 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             ++ P +P+  N GE+++H SH +HPLV+++ P LFTC GCKEYGAGKR+ CQ C F LHD
Sbjct  82    MDLPATPK-TNPGEQILHFSHPQHPLVQVSYPYLFTCMGCKEYGAGKRFRCQICGFDLHD  140

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PPSL+ HPLH +HQL+F  KP     G  R+KCDVCGK  KGF FRC +CSF+MH
Sbjct  141   FCALAPPSLHNHPLHHKHQLVFFPKP----GGFLRSKCDVCGKPAKGFAFRCSSCSFEMH  196

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAM+S E+K+  H H L L PP++ + G           ++ +C  C +KR+G+VY C
Sbjct  197   PCCAMMSREMKFSTHQHPLTLSPPTAIMGGD----------SSFACEVCQRKRSGQVYCC  246

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVF  1024
              AC Y+LHAVCAK+M+NGL  +GI PPEK ++LG A K+A Q +F
Sbjct  247   MACGYYLHAVCAKDMINGLHVHGIRPPEKSNMLGAAAKLATQAIF  291



>ref|XP_002273882.2| PREDICTED: uncharacterized protein LOC100252968 [Vitis vinifera]
Length=336

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 181/259 (70%), Gaps = 16/259 (6%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VE+P+S  P  G E M+ S H  HPL ++T PE F C GCKEYGAG R+ CQQCN QLH+
Sbjct  90    VEYPSSVNPTQG-EPMLLSCHP-HPLAQVTSPEPFICMGCKEYGAGTRFTCQQCNNQLHE  147

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+P +L +HPLH  H L F  KP  VK GI   KCD+C K T G+TFRC ACSFQ+H
Sbjct  148   FCALAPTTLKSHPLHRLHPLEFCSKP--VKGGILGTKCDICSKPTAGYTFRCSACSFQIH  205

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLSTE+ +  H H L L+P  +   G P            SCG+C +KR+GRV+ C
Sbjct  206   PCCAMLSTEMTFVVHPHPLTLMPAMALSSGDP----------GFSCGECKRKRSGRVFHC  255

Query  890   TA--CDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigeg  1063
             TA  CDYHLHAVCAK M+NGL+ +GI   EKPS+LGTA KIA QVV EFIGGLI+G+G+G
Sbjct  256   TAPSCDYHLHAVCAKNMVNGLRASGIMSLEKPSMLGTAAKIASQVVIEFIGGLIEGLGQG  315

Query  1064  vgeAIVQNISGGRGSARIR  1120
             VG+ +VQ I+ GR + R R
Sbjct  316   VGDVLVQTIARGRCTTRRR  334



>emb|CAN76803.1| hypothetical protein VITISV_000633 [Vitis vinifera]
Length=389

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 152/273 (56%), Positives = 187/273 (68%), Gaps = 19/273 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VE+P+S  P  G E M+ S H  HPL ++T PE F C GCKEYGAG R+ CQQCN QLH+
Sbjct  121   VEYPSSVNPTQG-EPMLLSCHP-HPLAQVTSPEPFICMGCKEYGAGTRFTCQQCNNQLHE  178

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+P +L +HPLH  H L F  KP  VK GI   KCD+C K T G+TFRC ACSFQ+H
Sbjct  179   FCALAPKTLKSHPLHRLHPLEFCSKP--VKGGILGTKCDICSKPTAGYTFRCSACSFQIH  236

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLSTE+ +  H H L L+P  +   G P            SCG+C +KR+GRV+ C
Sbjct  237   PCCAMLSTEMTFVVHPHPLTLMPAMALSSGDP----------GFSCGECKRKRSGRVFHC  286

Query  890   TA--CDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigeg  1063
             TA  CDYHLHAVCAK M+NGL+ +GI   EKPS+LGTA KIA QVV EFIGGLI+G+G+G
Sbjct  287   TAPSCDYHLHAVCAKNMVNGLRASGIMSLEKPSMLGTAAKIASQVVIEFIGGLIEGLGQG  346

Query  1064  vgeAIVQNISGGRGSARIRAT*RLNYIIYIYPT  1162
             VG+ +VQ I+ GR  A +    RL+ +I +  T
Sbjct  347   VGDVLVQTIARGRSVAILT---RLSEVIGLLWT  376



>gb|KCW68282.1| hypothetical protein EUGRSUZ_F01949 [Eucalyptus grandis]
Length=234

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 167/243 (69%), Gaps = 18/243 (7%)
 Frame = +2

Query  395   MVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLH  574
             M+H SH  H L  M LPELFTCSGC+E GAGKRYACQ CN+QLH+FCAL+P +L +HPLH
Sbjct  1     MLHFSHPHHHLFHMNLPELFTCSGCQELGAGKRYACQHCNYQLHEFCALAPQALRSHPLH  60

Query  575   GQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
              QH+L+F+ KP + KS     KCDVCGKS KGF+FRC  C+FQ+HPCCAML  EI + PH
Sbjct  61    YQHELVFYSKPGKAKS-----KCDVCGKSIKGFSFRCNPCNFQIHPCCAMLPLEIVFAPH  115

Query  755   AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEM  934
              H LK       L  SP  G+      +  CG+C +KR GR+Y C  CDYHLHA+CAK +
Sbjct  116   PHTLKF------LMASPNGGE-----TSFQCGECKRKRTGRIYRCAVCDYHLHAICAKII  164

Query  935   MNGLQENGINPPEKPS--VLGTAVKIAGQVVFefigglidgigegvgeAIVQNISGGRGS  1108
              NGL+++GI  P   S  VL  A +IA QVV  F GGLI+GIG+ VGE I Q + GG G+
Sbjct  165   FNGLKDSGITEPTSKSGPVLEAATRIATQVVTGFFGGLIEGIGQTVGEDIFQTVLGGAGN  224

Query  1109  ARI  1117
             A +
Sbjct  225   AFV  227



>ref|XP_010270609.1| PREDICTED: uncharacterized protein LOC104606892 [Nelumbo nucifera]
Length=247

 Score =   243 bits (619),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 144/212 (68%), Gaps = 15/212 (7%)
 Frame = +2

Query  389   EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E++ H SH +HPLV++ LP LFTC GCKEYGAGKR  CQ C+F LHD CA +PPSL+ H 
Sbjct  9     EKITHFSHPQHPLVQINLPYLFTCMGCKEYGAGKRLTCQHCDFFLHDLCAFAPPSLSNHS  68

Query  569   LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             LH QH L+F+ KP     GI R+ CD+CGKST+G+ FRC  C+F+MHPCCA L  E+ +P
Sbjct  69    LHSQHHLVFYIKP----GGILRSTCDICGKSTRGYAFRCSTCNFEMHPCCAKLCREMDFP  124

Query  749   PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
              H H LKL+  ++   G P            +C +C  KR GR+YGCT CDYHLHAVCAK
Sbjct  125   VHPHTLKLVTTATLTSGDP----------DFTCNECNTKRGGRIYGCTVCDYHLHAVCAK  174

Query  929   EMMNGLQENG-INPPEKPSVLGTAVKIAGQVV  1021
              M+NGL  +G I  PEKPS LG AV++   VV
Sbjct  175   NMINGLHASGIIKVPEKPSRLGAAVRLVSNVV  206



>ref|XP_002273846.1| PREDICTED: uncharacterized protein LOC100258099 isoform X1 [Vitis 
vinifera]
Length=265

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 178/260 (68%), Gaps = 16/260 (6%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
              ++PTS      GE+++ S H +HPL  +T P+ FTC GCKEYGAG R+ CQQCN QLH+
Sbjct  17    FQYPTS-HNQTRGEQILLSCHPQHPLALLTSPDPFTCMGCKEYGAGTRFTCQQCNHQLHE  75

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+P +L +HPLH QH L F  KP  VK GI   +CD+C K T G+TFRC ACSFQMH
Sbjct  76    FCALAPTTLKSHPLHCQHPLGFCSKP--VKGGILGKRCDICNKPTAGYTFRCSACSFQMH  133

Query  710   PCCAMLSTEIKYP-PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYG  886
             PCCAMLSTE+ +P  H H L L+P  +   G P            SCG+C +KR GRVY 
Sbjct  134   PCCAMLSTEMTFPLAHPHPLTLMPAMTLSSGEP----------GFSCGECKRKRPGRVYR  183

Query  887   C--TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgige  1060
             C  TACDYHLHAVCAK M+NGL+ NG+   EKPS+ GT +KIA  VV EFIGGLI G+G+
Sbjct  184   CTATACDYHLHAVCAKNMVNGLRANGVTCLEKPSMRGTFIKIASVVVMEFIGGLIGGLGQ  243

Query  1061  gvgeAIVQNISGGRGSARIR  1120
             GVG+ + Q ++ G+ ++  R
Sbjct  244   GVGDVLGQTMAAGKSASARR  263



>ref|XP_010664041.1| PREDICTED: uncharacterized protein LOC100258099 isoform X2 [Vitis 
vinifera]
Length=263

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 176/260 (68%), Gaps = 18/260 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
              ++PTS      GE+++ S H +HPL  +T P+ FTC GCKEYGAG R+ CQQCN QLH+
Sbjct  17    FQYPTS-HNQTRGEQILLSCHPQHPLALLTSPDPFTCMGCKEYGAGTRFTCQQCNHQLHE  75

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+P +L +HPLH QH L F  KP     GI   +CD+C K T G+TFRC ACSFQMH
Sbjct  76    FCALAPTTLKSHPLHCQHPLGFCSKP----GGILGKRCDICNKPTAGYTFRCSACSFQMH  131

Query  710   PCCAMLSTEIKYP-PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYG  886
             PCCAMLSTE+ +P  H H L L+P  +   G P            SCG+C +KR GRVY 
Sbjct  132   PCCAMLSTEMTFPLAHPHPLTLMPAMTLSSGEP----------GFSCGECKRKRPGRVYR  181

Query  887   C--TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgige  1060
             C  TACDYHLHAVCAK M+NGL+ NG+   EKPS+ GT +KIA  VV EFIGGLI G+G+
Sbjct  182   CTATACDYHLHAVCAKNMVNGLRANGVTCLEKPSMRGTFIKIASVVVMEFIGGLIGGLGQ  241

Query  1061  gvgeAIVQNISGGRGSARIR  1120
             GVG+ + Q ++ G+ ++  R
Sbjct  242   GVGDVLGQTMAAGKSASARR  261



>ref|XP_002893147.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69406.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   238 bits (606),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 159/228 (70%), Gaps = 11/228 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFP SPQ   G EEMVH  H +H LV++ LP+++TC+GCKE GAG RY CQ+C++QLH+
Sbjct  54    VEFPVSPQLIQG-EEMVHFGHPQHVLVKVELPDIYTCAGCKEEGAGVRYVCQECDYQLHE  112

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L +HP H QHQLLF  KP   K GI ++KCDVCG+S KG+TFRC+ACSFQMH
Sbjct  113   FCALAPPQLKSHPFHYQHQLLFFAKP--AKGGIVKSKCDVCGRSPKGYTFRCKACSFQMH  170

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             P CAMLS  +      H    L PSS   G+   GD  G      CG+C + KR GRVY 
Sbjct  171   PGCAMLSPSLSSSSLHHHPLRLLPSSS-PGNITGGDSGGFL----CGECKRGKRTGRVYR  225

Query  887   CTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
             CT CDYHLHAVCAK+  +NGL+ NG    +K P+VLGTA ++A QVV 
Sbjct  226   CTVCDYHLHAVCAKDAAVNGLRANGHKGRDKSPAVLGTAARLASQVVI  273



>emb|CBI40789.3| unnamed protein product [Vitis vinifera]
Length=547

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 155/227 (68%), Gaps = 16/227 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VE+P+S  P  G E M+ S H  HPL ++T PE F C GCKEYGAG R+ CQQCN QLH+
Sbjct  34    VEYPSSVNPTQG-EPMLLSCHP-HPLAQVTSPEPFICMGCKEYGAGTRFTCQQCNNQLHE  91

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+P +L +HPLH  H L F  KP  VK GI   KCD+C K T G+TFRC ACSFQ+H
Sbjct  92    FCALAPTTLKSHPLHRLHPLEFCSKP--VKGGILGTKCDICSKPTAGYTFRCSACSFQIH  149

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCAMLSTE+ +  H H L L+P  +   G P            SCG+C +KR+GRV+ C
Sbjct  150   PCCAMLSTEMTFVVHPHPLTLMPAMALSSGDP----------GFSCGECKRKRSGRVFHC  199

Query  890   TA--CDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVF  1024
             TA  CDYHLHAVCAK M+NGL+ +GI   EKPS+LGTA KIA QVV 
Sbjct  200   TAPSCDYHLHAVCAKNMVNGLRASGIMSLEKPSMLGTAAKIASQVVI  246


 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 178/259 (69%), Gaps = 16/259 (6%)
 Frame = +2

Query  353   EFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDF  532
             ++PTS      GE+++ S H +HPL  +T P+ FTC GCKEYGAG R+ CQQCN QLH+F
Sbjct  300   QYPTS-HNQTRGEQILLSCHPQHPLALLTSPDPFTCMGCKEYGAGTRFTCQQCNHQLHEF  358

Query  533   CALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHP  712
             CAL+P +L +HPLH QH L F  KP  VK GI   +CD+C K T G+TFRC ACSFQMHP
Sbjct  359   CALAPTTLKSHPLHCQHPLGFCSKP--VKGGILGKRCDICNKPTAGYTFRCSACSFQMHP  416

Query  713   CCAMLSTEIKYP-PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             CCAMLSTE+ +P  H H L L+P  +   G P            SCG+C +KR GRVY C
Sbjct  417   CCAMLSTEMTFPLAHPHPLTLMPAMTLSSGEP----------GFSCGECKRKRPGRVYRC  466

Query  890   --TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigeg  1063
               TACDYHLHAVCAK M+NGL+ NG+   EKPS+ GT +KIA  VV EFIGGLI G+G+G
Sbjct  467   TATACDYHLHAVCAKNMVNGLRANGVTCLEKPSMRGTFIKIASVVVMEFIGGLIGGLGQG  526

Query  1064  vgeAIVQNISGGRGSARIR  1120
             VG+ + Q ++ G+ ++  R
Sbjct  527   VGDVLGQTMAAGKSASARR  545



>ref|XP_010477357.1| PREDICTED: uncharacterized protein LOC104756457 [Camelina sativa]
Length=321

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 158/228 (69%), Gaps = 11/228 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFP SPQ   G EEMVH  H +H LV++ LP+++TC+GCKE GAG RY CQ+C++QLH+
Sbjct  54    VEFPASPQLIQG-EEMVHFGHPQHVLVKVELPDIYTCAGCKEEGAGVRYVCQECDYQLHE  112

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L +HP H QHQLLF  KP   K GI ++KCDVCG+S +G+TFRC+ACSFQMH
Sbjct  113   FCALAPPLLKSHPFHYQHQLLFFAKP--AKGGIVKSKCDVCGRSPRGYTFRCKACSFQMH  170

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             P CAMLS  +      H    L PSS      A+    G +    CG+C + KR GRVY 
Sbjct  171   PGCAMLSPSLSSSSLHHHPLRLVPSSS-----ASNTTGGDSGGFLCGECKRGKRTGRVYH  225

Query  887   CTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
             CT CDY LHAVCAK+  +NGL+ NG    +K P+VLGTA ++A QVVF
Sbjct  226   CTVCDYQLHAVCAKDAAVNGLRANGHKGRDKSPAVLGTAARLASQVVF  273



>ref|XP_009418236.1| PREDICTED: uncharacterized protein LOC103998480 [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 175/257 (68%), Gaps = 18/257 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             ++ P +P PN  G++++H SH +HPL++++LP LFTC GCKEYGAG+R+ CQ C F LHD
Sbjct  1     MDLPATPNPNLQGDQLLHFSHPQHPLLQISLPYLFTCMGCKEYGAGRRFRCQTCGFDLHD  60

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP+L+ HP H +HQL+F  KP     G  R KCDVCGK+ KGF FRC  CSF MH
Sbjct  61    FCALAPPALHNHPFHHKHQLVFFTKP----GGFLRWKCDVCGKAAKGFGFRCTTCSFGMH  116

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCCA +   + +P H H L L         SP+A    G A+ V C  C +KR+G+VY C
Sbjct  117   PCCAAMRVVMNFPTHQHPLVL---------SPSAAVATGDASTV-CNVCQRKRSGQVYRC  166

Query  890   -TACDYHLHAVCAKEMMNGLQENGINPPEKP-SVLGTAVKIAGQVVFefigglidgigeg  1063
               AC Y LHA CAK+M+NGL  +G+  P+KP ++LGTA K+  Q +   IGGLI+GIGEG
Sbjct  167   AAACGYCLHAACAKDMVNGLYVHGLRSPDKPNNMLGTAAKLTTQALVGIIGGLIEGIGEG  226

Query  1064  vgeAIVQNISGGRGSAR  1114
             +GE ++ NI  GRGS R
Sbjct  227   IGEFLMDNI--GRGSCR  241



>ref|XP_006305380.1| hypothetical protein CARUB_v10009771mg [Capsella rubella]
 gb|EOA38278.1| hypothetical protein CARUB_v10009771mg [Capsella rubella]
Length=319

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 157/228 (69%), Gaps = 11/228 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFP SPQ   G EEMVH  H +H LV++ LP+++TC+GCKE GAG RY CQ+C++QLH+
Sbjct  54    VEFPASPQLIQG-EEMVHFGHPQHVLVKVDLPDIYTCAGCKEEGAGIRYVCQECDYQLHE  112

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L +HP H QHQLLF  KP +V  GI ++KCDVCG+S KG+TFRC+ACSFQMH
Sbjct  113   FCALAPPLLKSHPFHYQHQLLFFAKPAKV--GIVKSKCDVCGRSPKGYTFRCKACSFQMH  170

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             P CAMLS  +      H    L PSS      AA           CG+C + KR GRVY 
Sbjct  171   PGCAMLSPSLSSSSLHHHPLRLIPSSS-----AANTTGRDPGGYLCGECKRGKRTGRVYR  225

Query  887   CTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
             CT CDYHLHAVCAK+  +NGL+ NG    +K P+VLGTA ++A QVV 
Sbjct  226   CTVCDYHLHAVCAKDAAVNGLRSNGHKGRDKSPAVLGTAARLASQVVI  273



>gb|KFK44213.1| hypothetical protein AALP_AA1G229300 [Arabis alpina]
Length=298

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 155/228 (68%), Gaps = 12/228 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             +EFPTSPQ   G EEM+H  H +H LV++ LP+++TC GCKE GAG +Y CQ+C++QLH+
Sbjct  36    IEFPTSPQLIQG-EEMIHFGHPQHVLVKVDLPDIYTCVGCKEEGAGIKYVCQECDYQLHE  94

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L +HP H QHQLLF  KP   K GI ++KCDVCG S KG+TFRC++CSFQMH
Sbjct  95    FCALAPPLLKSHPFHYQHQLLFFAKP--AKGGIVKSKCDVCGISPKGYTFRCKSCSFQMH  152

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             P CAML      PP      L      L  S AA    G  +   CG+C K KRAGRVY 
Sbjct  153   PGCAML------PPTLSSSSLHHHPLHLLSSSAANTAGGDYSGFLCGECKKGKRAGRVYR  206

Query  887   CTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
             CT CDYHLHAVCAK   +NGL+ NG    +K P+VLGTA + A QVVF
Sbjct  207   CTVCDYHLHAVCAKNAAVNGLRANGHKGRDKSPAVLGTAARFASQVVF  254



>emb|CDY01341.1| BnaA07g11140D [Brassica napus]
Length=316

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 159/229 (69%), Gaps = 17/229 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             V+FP SPQ   G EEMVH  H +H LV++ LP+++TC+GCKE GAG RY CQ+C++QLH+
Sbjct  53    VKFPVSPQLIQG-EEMVHFGHPQHVLVKVDLPDIYTCAGCKEEGAGIRYVCQECDYQLHE  111

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L +HP H QHQLLF  KP   K GI ++KCDVCG+S KG+T+RC+ACSFQMH
Sbjct  112   FCALAPPLLKSHPFHYQHQLLFFAKP--AKGGIMKSKCDVCGRSPKGYTYRCKACSFQMH  169

Query  710   PCCAM-LSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVY  883
             P CAM   +      H H L+LLP S     SPA            CG+C + KR GRVY
Sbjct  170   PGCAMLSPSLSSSSLHRHPLQLLPSS-----SPA-----NTTGGFLCGECKRGKRVGRVY  219

Query  884   GCTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
              CT CDYHLHAVCAK+  +NGL+ENG    ++ P+VLGTA ++A QVV 
Sbjct  220   RCTVCDYHLHAVCAKDAAVNGLRENGHKGRDRSPAVLGTAARLASQVVI  268



>ref|XP_009103313.1| PREDICTED: diacylglycerol kinase theta-like [Brassica rapa]
Length=316

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 161/229 (70%), Gaps = 17/229 (7%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             V+FP SPQ   G EEMVH  H +H LV++ LP+++TC+GCKE GAG RY CQ+C++QLH+
Sbjct  53    VKFPVSPQLIQG-EEMVHFGHPQHVLVKVDLPDIYTCAGCKEEGAGIRYVCQECDYQLHE  111

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L +HP H QHQLLF  KP   K GI ++KCDVCG+S KG+T+RC+ACSFQMH
Sbjct  112   FCALAPPLLKSHPFHYQHQLLFFAKP--AKGGIMKSKCDVCGRSPKGYTYRCKACSFQMH  169

Query  710   PCCAMLSTEIKYPP-HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVY  883
             P CAMLS  +     H H L+LLP +     SPA            CG+C + KR GRVY
Sbjct  170   PGCAMLSPSLSSSSIHRHPLQLLPST-----SPA-----NTTGGFLCGECKRGKRVGRVY  219

Query  884   GCTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
              CT CDYHLHAVCAK+  +NGL+ENG    ++ P+VLGTA ++A QVV 
Sbjct  220   RCTVCDYHLHAVCAKDAAVNGLRENGHKGRDRSPAVLGTAARLASQVVI  268



>ref|XP_010266305.1| PREDICTED: uncharacterized protein LOC104603842 [Nelumbo nucifera]
Length=278

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 147/211 (70%), Gaps = 14/211 (7%)
 Frame = +2

Query  392   EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
             E+ H SH +HPLV++ +P LFTC+GCKEYGAG RY CQQC+  LH+FCAL+PPSL TH L
Sbjct  39    EITHFSHPQHPLVQVRVPYLFTCTGCKEYGAGSRYKCQQCDVHLHEFCALAPPSLTTHSL  98

Query  572   HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
             H QH L+F+ KP     G  R++CD+CGK+TKG+ +RC  C+F+MHPCCA L  ++ +P 
Sbjct  99    HHQHHLVFYTKP---GGGFIRSRCDICGKTTKGYAYRCSTCNFEMHPCCAKLCRQMDFPV  155

Query  752   HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKR-AGRVYGCTACDYHLHAVCAK  928
             H H L LLP ++   G P            +C +C +K   GRVYGCT CDY+LHAVCAK
Sbjct  156   HPHTLILLPTTTLTSGDP----------NFNCNECNRKGPGGRVYGCTVCDYYLHAVCAK  205

Query  929   EMMNGLQENGINPPEKPSVLGTAVKIAGQVV  1021
              M+NGL  NGI  PEKPS LG AV++A  VV
Sbjct  206   NMVNGLYANGIKAPEKPSRLGAAVRLASHVV  236



>ref|NP_173523.1| Cysteine/Histidine-rich C1 domain family protein [Arabidopsis 
thaliana]
 gb|AEE30051.1| Cysteine/Histidine-rich C1 domain family protein [Arabidopsis 
thaliana]
Length=319

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 157/228 (69%), Gaps = 11/228 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFP SPQ   G EEMVH  H +H LV++ LP+++TC+GCKE GAG RY CQ+C++QLH+
Sbjct  54    VEFPASPQLVQG-EEMVHFGHPQHVLVKVELPDIYTCAGCKEEGAGVRYVCQECDYQLHE  112

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L +HP H QHQLLF  KP   K GI ++KCDVCG+S KG+TFRC+ACSFQMH
Sbjct  113   FCALAPPQLKSHPFHYQHQLLFFAKP--AKGGIVKSKCDVCGRSPKGYTFRCKACSFQMH  170

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             P CAMLS  +      H    L PSS      A     G +    CG+C + KR GRVY 
Sbjct  171   PGCAMLSPSLSSSSLHHHPLRLLPSSS-----AGSTTGGDSGGFLCGECKRGKRTGRVYR  225

Query  887   CTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
             CT CDYHLHAVCAK+  +NGL+ NG    +K P+VLGTA ++A QVV 
Sbjct  226   CTVCDYHLHAVCAKDAAVNGLRANGHKGRDKSPAVLGTAARLASQVVI  273



>gb|AAD30592.1|AC007369_2 Hypothetical protein [Arabidopsis thaliana]
Length=318

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 157/228 (69%), Gaps = 11/228 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFP SPQ   G EEMVH  H +H LV++ LP+++TC+GCKE GAG RY CQ+C++QLH+
Sbjct  53    VEFPASPQLVQG-EEMVHFGHPQHVLVKVELPDIYTCAGCKEEGAGVRYVCQECDYQLHE  111

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L +HP H QHQLLF  KP   K GI ++KCDVCG+S KG+TFRC+ACSFQMH
Sbjct  112   FCALAPPQLKSHPFHYQHQLLFFAKP--AKGGIVKSKCDVCGRSPKGYTFRCKACSFQMH  169

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             P CAMLS  +      H    L PSS      A     G +    CG+C + KR GRVY 
Sbjct  170   PGCAMLSPSLSSSSLHHHPLRLLPSSS-----AGSTTGGDSGGFLCGECKRGKRTGRVYR  224

Query  887   CTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
             CT CDYHLHAVCAK+  +NGL+ NG    +K P+VLGTA ++A QVV 
Sbjct  225   CTVCDYHLHAVCAKDAAVNGLRANGHKGRDKSPAVLGTAARLASQVVI  272



>ref|XP_010459793.1| PREDICTED: uncharacterized protein LOC104740797 [Camelina sativa]
Length=315

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 156/228 (68%), Gaps = 11/228 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFP SPQ   G EEMVH  H +H LV++ LP+++TC+GCKE GAG RY CQ+C++QLH+
Sbjct  54    VEFPASPQLIQG-EEMVHFGHPQHVLVKVELPDIYTCAGCKEEGAGVRYVCQECDYQLHE  112

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L +HP H QHQLLF  KP   K GI ++KCDVCG+S +G+TFRC+ACSFQMH
Sbjct  113   FCALAPPLLKSHPFHYQHQLLFFAKP--AKGGIVKSKCDVCGRSPRGYTFRCKACSFQMH  170

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             P CAMLS  +      H    L  S     S A+    G      CG+C + KR GRVY 
Sbjct  171   PGCAMLSPSLSSSSLHHHPLRLVLS-----SSASNTNGGDYGGFLCGECKRGKRTGRVYH  225

Query  887   CTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
             CT CDYHLHAVCAK+  +NGL+ NG    +K P+VLGTA ++A QVV 
Sbjct  226   CTVCDYHLHAVCAKDAAVNGLRANGHKGRDKSPAVLGTAARLASQVVI  273



>ref|XP_010063182.1| PREDICTED: uncharacterized protein LOC104450360 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70382.1| hypothetical protein EUGRSUZ_F03617 [Eucalyptus grandis]
Length=274

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/252 (52%), Positives = 172/252 (68%), Gaps = 15/252 (6%)
 Frame = +2

Query  356   FPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFC  535
             +P SPQ   G EE++H SH +H L  + LP+LF C+GC E GAGKRY CQQC+F LH+FC
Sbjct  18    YPMSPQLIFG-EEIIHYSHQQHALSMINLPDLFRCAGCLEDGAGKRYTCQQCDFHLHEFC  76

Query  536   ALSPPS--LNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             AL  P+  L  HP H QH   FH KP   K GI +++CD+CG+  KG+ FRC ACSF MH
Sbjct  77    ALPYPNQVLKNHPFHYQHNFYFHSKPA-AKGGIAKSRCDICGEPMKGYAFRCGACSFSMH  135

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCC ML  +I    H H+L+LLPP++      ++ D         CG+C K+R+GRVYGC
Sbjct  136   PCCEMLPVDIVISNHPHKLQLLPPAAS-----SSAD-----LGFVCGECKKRRSGRVYGC  185

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEK-PSVLGTAVKIAGQVVFefigglidgigegv  1066
             T C Y+LHAVCAK ++NGL ++GI   EK  S LG A ++A +VV  FIGGL++ IGEG+
Sbjct  186   TVCGYYLHAVCAKSIVNGLYDSGIKGTEKHTSKLGAAARLASRVVSNFIGGLMESIGEGL  245

Query  1067  geAIVQNISGGR  1102
             G+A+VQN++ G+
Sbjct  246   GQALVQNVTKGK  257



>ref|XP_010063183.1| PREDICTED: uncharacterized protein LOC104450360 isoform X2 [Eucalyptus 
grandis]
 gb|KCW70381.1| hypothetical protein EUGRSUZ_F03617 [Eucalyptus grandis]
Length=273

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/252 (52%), Positives = 172/252 (68%), Gaps = 16/252 (6%)
 Frame = +2

Query  356   FPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFC  535
             +P SPQ   G EE++H SH +H L  + LP+LF C+GC E GAGKRY CQQC+F LH+FC
Sbjct  18    YPMSPQLIFG-EEIIHYSHQQHALSMINLPDLFRCAGCLEDGAGKRYTCQQCDFHLHEFC  76

Query  536   ALSPPS--LNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             AL  P+  L  HP H QH   FH KP   K GI +++CD+CG+  KG+ FRC ACSF MH
Sbjct  77    ALPYPNQVLKNHPFHYQHNFYFHSKP--AKGGIAKSRCDICGEPMKGYAFRCGACSFSMH  134

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCC ML  +I    H H+L+LLPP++      ++ D         CG+C K+R+GRVYGC
Sbjct  135   PCCEMLPVDIVISNHPHKLQLLPPAAS-----SSAD-----LGFVCGECKKRRSGRVYGC  184

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEK-PSVLGTAVKIAGQVVFefigglidgigegv  1066
             T C Y+LHAVCAK ++NGL ++GI   EK  S LG A ++A +VV  FIGGL++ IGEG+
Sbjct  185   TVCGYYLHAVCAKSIVNGLYDSGIKGTEKHTSKLGAAARLASRVVSNFIGGLMESIGEGL  244

Query  1067  geAIVQNISGGR  1102
             G+A+VQN++ G+
Sbjct  245   GQALVQNVTKGK  256



>ref|XP_010498554.1| PREDICTED: uncharacterized protein LOC104776223 [Camelina sativa]
Length=317

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 156/228 (68%), Gaps = 11/228 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFP SPQ   G EEMVH  H +H LV++ LP+++TC+GCKE GAG RY CQ+C++QLH+
Sbjct  54    VEFPASPQLIQG-EEMVHFGHPQHVLVKVELPDIYTCAGCKEDGAGVRYVCQECDYQLHE  112

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L +HP H QHQLLF  KP   K GI ++KCDVCG+S +G+TFRC+ACSFQMH
Sbjct  113   FCALAPPLLKSHPFHYQHQLLFFAKP--AKGGIVKSKCDVCGRSPRGYTFRCKACSFQMH  170

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             P CAMLS  +      H    L  SS      A+    G      CG+C + KR GRVY 
Sbjct  171   PGCAMLSPSLSSSSLHHHPLRLVLSSS-----ASNTNGGDYGGFLCGECKRGKRTGRVYH  225

Query  887   CTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
             CT CDYHLHAVCAK+  +NGL+ NG    +K P+VLGTA ++A QVV 
Sbjct  226   CTVCDYHLHAVCAKDAAVNGLRANGHKGRDKSPAVLGTAARLASQVVI  273



>emb|CDY04590.1| BnaC05g16280D [Brassica napus]
Length=321

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 159/228 (70%), Gaps = 12/228 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFP SPQ   G EE+VH  H +H LV++ LP+++TC+GCKE GAG RY CQ+C++QLH+
Sbjct  55    VEFPVSPQLMRG-EEIVHFGHPRHVLVKVDLPDIYTCAGCKEEGAGVRYVCQECDYQLHE  113

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCA +PP L +HPLH QHQLLF  KP   K GI ++KCDVCG+S KG+TFRC+ACSFQMH
Sbjct  114   FCASAPPVLKSHPLHYQHQLLFFAKP--AKGGIKKSKCDVCGRSPKGYTFRCKACSFQMH  171

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             P CAMLS  +      H    L  S+    + A GD   H+    CG+C + KR GRVY 
Sbjct  172   PGCAMLSPSLSSSSLHHHPLQLLSSA---TNNAGGD---HSGGFLCGECKRGKRVGRVYR  225

Query  887   CTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
             CT CDYHLHAVCAK+  +NGL+ NG    ++ P+VLGTA ++A QVV 
Sbjct  226   CTVCDYHLHAVCAKDAAVNGLRANGHKGRDRSPAVLGTAARVASQVVI  273



>ref|XP_006416341.1| hypothetical protein EUTSA_v10008443mg [Eutrema salsugineum]
 gb|ESQ34694.1| hypothetical protein EUTSA_v10008443mg [Eutrema salsugineum]
Length=276

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 177/253 (70%), Gaps = 10/253 (4%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             V FP SPQ   G EEMVH  H +H LV++ LP+++ C+GCKE GAG RY CQ+C++QLH+
Sbjct  27    VHFPVSPQLKQG-EEMVHFGHPQHVLVKVDLPDMYNCAGCKEEGAGIRYVCQECDYQLHE  85

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+PP L +HP H QHQLLF  KP   K GI ++KCDVCG+S KG+ FRC+ACSFQMH
Sbjct  86    FCALAPPILKSHPFHYQHQLLFFAKP--AKGGIMKSKCDVCGRSPKGYNFRCKACSFQMH  143

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             P CAMLS  +      H    L PSS    S A      ++    CG+C + KR GRVY 
Sbjct  144   PGCAMLSPSLSSSSLHHHPLQLLPSS----SSANNTGGDYSGGFLCGQCKRGKRVGRVYR  199

Query  887   CTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVFefigglidgige  1060
             CT CDYHLHAVCAK+  +NGL+ NG    ++ P+VLGTA ++A QVV +F+GG+IDG+GE
Sbjct  200   CTVCDYHLHAVCAKDAAVNGLRANGHKGRDRSPAVLGTAARVASQVVIDFLGGIIDGLGE  259

Query  1061  gvgeAIVQNISGG  1099
             GVGEAI+  ++ G
Sbjct  260   GVGEAILDGVTRG  272



>ref|XP_009149580.1| PREDICTED: uncharacterized protein LOC103872892 [Brassica rapa]
 emb|CDY29488.1| BnaA06g14820D [Brassica napus]
Length=321

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 157/228 (69%), Gaps = 12/228 (5%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             VEFP SPQ   G EEMVH  H +H LV++ LP+++TC+GCKE GAG RY CQ+C++QLH+
Sbjct  55    VEFPVSPQLMRG-EEMVHFGHPRHVLVKVDLPDIYTCAGCKEEGAGIRYVCQECDYQLHE  113

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCA +PP L +HP H QHQLLF  KP   K GI ++KCDVCG+S KG+TFRC+ACSFQMH
Sbjct  114   FCASAPPVLKSHPFHYQHQLLFFTKP--AKGGIMKSKCDVCGRSPKGYTFRCKACSFQMH  171

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYG  886
             P CAMLS  +      H    L  S+    +   GD   H+    CG+C + KR GRVY 
Sbjct  172   PGCAMLSPSLSSSSLHHHPLQLLSSA---ANNTGGD---HSGGFLCGECKRGKRVGRVYR  225

Query  887   CTACDYHLHAVCAKE-MMNGLQENGINPPEK-PSVLGTAVKIAGQVVF  1024
             CT CDYHLHAVCAK+  +NGL+ NG    ++ P+VLGTA ++A QVV 
Sbjct  226   CTVCDYHLHAVCAKDAAVNGLRANGHKGRDRSPAVLGTAARVASQVVI  273



>ref|XP_006849839.1| hypothetical protein AMTR_s00022p00036270 [Amborella trichopoda]
 gb|ERN11420.1| hypothetical protein AMTR_s00022p00036270 [Amborella trichopoda]
Length=272

 Score =   225 bits (574),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 164/257 (64%), Gaps = 15/257 (6%)
 Frame = +2

Query  350   VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
             ++   SPQ      E++H SH  HPL  +++P LFTC GCKEYGAG+RY C  CNF LH+
Sbjct  24    IQMDVSPQTQIKQGEILHFSHPNHPLSLISIPYLFTCMGCKEYGAGQRYRCNLCNFDLHE  83

Query  530   FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             FCAL+P  L  HPLH +H L+F  KP    +   + KC++C K+TKGF +RC AC F+MH
Sbjct  84    FCALAPSHLQNHPLHPKHPLVFSTKP---STRFLKPKCEICSKTTKGFAYRCTACYFEMH  140

Query  710   PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
             PCC+ LS ++KYP H H LKL P +    GS              C  CG+KR+G +Y C
Sbjct  141   PCCSKLSIDMKYPTHEHTLKLSPATLMGDGS------------FWCQVCGRKRSGWLYNC  188

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
             T C Y +HAVCAK+ +NGL + G+  P KPSVLG A + A Q V  FIGGLI+G+GEGVG
Sbjct  189   TNCRYGVHAVCAKDAINGLHKEGLIAPIKPSVLGVAARFASQSVLGFIGGLIEGLGEGVG  248

Query  1070  eAIVQNISGGRGSARIR  1120
             EAI+++   G G    R
Sbjct  249   EAIIESAGRGLGDGNTR  265



>gb|EMT18965.1| hypothetical protein F775_00785 [Aegilops tauschii]
Length=273

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 156/241 (65%), Gaps = 16/241 (7%)
 Frame = +2

Query  392   EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
             EMVH SH +H L     P LF C GCKEYGAGKR+ CQ C FQLH+FCA++PPSL+ HP 
Sbjct  46    EMVHFSHPEHRLARFDFPYLFLCMGCKEYGAGKRFMCQICGFQLHEFCAMAPPSLHDHPF  105

Query  572   HGQHQ-LLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             H +HQ LLF +KP     G  R KCD+CGK  KGF+FRC  CSF +HPCCA ++  ++ P
Sbjct  106   HPKHQHLLFFEKP----GGFLRCKCDICGKPVKGFSFRCACCSFDVHPCCAAMTRRMELP  161

Query  749   PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
              H H L LL P +G           G A +  C  C ++R+GRVY C  C Y+LHA CAK
Sbjct  162   AHGHPL-LLAPDAGA----------GVATSFVCQVCRRRRSGRVYQCMPCGYYLHAKCAK  210

Query  929   EMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvgeAIVQNISGGRGS  1108
             +M+NGL E+G+ PPEK + L    K+    +F  IGGLI+GIGEG+GE  V+NI   RG 
Sbjct  211   DMVNGLYEHGVVPPEKSNPLVAVAKVTINALFSVIGGLIEGIGEGIGEGFVENIGRSRGR  270

Query  1109  A  1111
             +
Sbjct  271   S  271



>ref|XP_010239409.1| PREDICTED: uncharacterized protein LOC104585122 [Brachypodium 
distachyon]
Length=267

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 156/242 (64%), Gaps = 15/242 (6%)
 Frame = +2

Query  392   EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
             EMVH SH +H L     P LF C GCKEYGAG+R+ CQ C FQLHDFCAL+PPSL+ HP 
Sbjct  37    EMVHLSHPEHRLARFDFPYLFMCMGCKEYGAGRRFMCQICGFQLHDFCALAPPSLHDHPF  96

Query  572   HGQHQ-LLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             H +H+ LLF DKP     G+ R KCD+CGKS KGF FRC  C F MHPCCA ++  ++ P
Sbjct  97    HPRHRHLLFFDKP----GGLLRFKCDICGKSVKGFCFRCACCGFGMHPCCAAMTRRMELP  152

Query  749   -PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
               H H L L       QGS A       AA+  C  C ++R+GRVY C  C Y LHA CA
Sbjct  153   AAHGHPLLL------AQGSDAGSII---AASFVCQVCRRRRSGRVYQCMPCGYCLHAKCA  203

Query  926   KEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvgeAIVQNISGGRG  1105
             K+M+NGL  +G+ PPE+ + L  A K+    +F  IGGL++GIGEG+GEA V+NI   RG
Sbjct  204   KDMVNGLYVHGVVPPERSNPLVAAAKVTINAIFGVIGGLVEGIGEGIGEAFVENIGRSRG  263

Query  1106  SA  1111
              +
Sbjct  264   RS  265



>ref|XP_010094492.1| hypothetical protein L484_024783 [Morus notabilis]
 gb|EXB56246.1| hypothetical protein L484_024783 [Morus notabilis]
Length=258

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 137/203 (67%), Gaps = 22/203 (11%)
 Frame = +2

Query  350  VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
            VEFPTSPQ    GEEM+H  H +HPL  + LP+LFTC+GCKEYG+GKR+ CQQC+FQLHD
Sbjct  49   VEFPTSPQLI-FGEEMLHFGHPRHPLSLVKLPDLFTCAGCKEYGSGKRFVCQQCDFQLHD  107

Query  530  FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
            FCA +PP+L  HPLH QHQL+   KP + +S     KCDVC K  KG+ +RC ACSFQMH
Sbjct  108  FCASAPPTLKAHPLHYQHQLILFSKPVKGQS-----KCDVCNKPCKGYAYRCSACSFQMH  162

Query  710  PCCAMLSTEIK-YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKR-AGRVY  883
            PCCAML TE+     HAH L+L P            DQH +   V CG+C +KR +GRVY
Sbjct  163  PCCAMLKTEMSLLLAHAHTLRLQP-----------ADQHNN--DVHCGECNRKRSSGRVY  209

Query  884  GCTACDYHLHAVCAKEMMNGLQE  952
             CT C YH+HAV   + + GL E
Sbjct  210  HCTYCGYHIHAVMI-DFIGGLIE  231



>ref|XP_002462590.1| hypothetical protein SORBIDRAFT_02g028650 [Sorghum bicolor]
 gb|EER99111.1| hypothetical protein SORBIDRAFT_02g028650 [Sorghum bicolor]
Length=276

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 157/251 (63%), Gaps = 18/251 (7%)
 Frame = +2

Query  380   NGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLN  559
             +GGE MVH SH +H L     P LF C GCKEYGAGKR+ CQ C FQLH+FCAL+PP+L+
Sbjct  36    DGGETMVHFSHPEHRLARFDFPYLFMCMGCKEYGAGKRFMCQACGFQLHEFCALAPPALH  95

Query  560   THPLHGQH-QLLFHDKPK----QVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAM  724
              HP H +H  LLF  KP         G  R KCD+CGKS +GF+FRC +CSF MHPCCA 
Sbjct  96    DHPFHRKHPHLLFFVKPSPGGGGGGGGFLRRKCDLCGKSVRGFSFRCASCSFDMHPCCAS  155

Query  725   LSTEIKYPP-HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGR-VYGCTA  895
             ++  ++ P  H H L L     G  G P          +  C  C + KR+G+ VY C  
Sbjct  156   MARRLELPAVHEHPLLLAQDDGG--GEP--------ETSFVCQVCRRTKRSGQHVYQCLP  205

Query  896   CDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvgeA  1075
             C Y+LHA CAK+M+NGL  +G+ PPEK + L TA ++    +F  IGGLI+GIGEG+GEA
Sbjct  206   CGYYLHARCAKDMVNGLYVHGVVPPEKKNALATAARVTVNALFGVIGGLIEGIGEGIGEA  265

Query  1076  IVQNISGGRGS  1108
              V++I   R S
Sbjct  266   FVESIGRSRRS  276



>ref|XP_008670289.1| PREDICTED: uncharacterized protein LOC103647547 [Zea mays]
 tpg|DAA40417.1| TPA: hypothetical protein ZEAMMB73_290328 [Zea mays]
Length=264

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 148/241 (61%), Gaps = 18/241 (7%)
 Frame = +2

Query  392   EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
             EMVH SH +H L     P LF C GCKEYGAGKR+ CQ C FQLH+ CAL+PPSL+ HP 
Sbjct  36    EMVHFSHPEHRLARFDFPHLFMCMGCKEYGAGKRFMCQACGFQLHESCALAPPSLHEHPF  95

Query  572   HGQH-QLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             H +H  LLF  KP     G  R +CDVCGK  +GF+FRC +CSF MHPCCA ++  ++ P
Sbjct  96    HPKHPHLLFFVKP--ASGGFLRCRCDVCGKPVRGFSFRCASCSFDMHPCCAAMARRMELP  153

Query  749   P-HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGR-VYGCTACDYHLHAV  919
               H H L LL      Q S              C  C + +RAG+  Y C  C Y+LHA 
Sbjct  154   AVHEHPLLLLARDGAEQTS------------FVCQACRRTRRAGQHAYQCLPCGYYLHAR  201

Query  920   CAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvgeAIVQNISGG  1099
             CAK+++NGL  +G+ PPEK S L TA ++    +F  IGGLI+ IGEG+GEA V+NI   
Sbjct  202   CAKDVVNGLYVHGVVPPEKRSALATAARVTVNALFGVIGGLIEAIGEGIGEAFVENIGRS  261

Query  1100  R  1102
             R
Sbjct  262   R  262



>ref|XP_004959574.1| PREDICTED: uncharacterized protein LOC101775078 [Setaria italica]
Length=268

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 124/255 (49%), Positives = 154/255 (60%), Gaps = 19/255 (7%)
 Frame = +2

Query  362   TSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCAL  541
             + P+  + GE +VH SH +H L     P LF C GCKEYGAGKR+ CQ C FQLH+FCAL
Sbjct  29    SEPEAEDDGE-IVHFSHPEHRLARFDFPYLFMCMGCKEYGAGKRFMCQTCGFQLHEFCAL  87

Query  542   SPPSLNTHPLHGQH-QLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCC  718
             +PP L+ HP H +H  LLF  KP     G  R KCD+CGK+ KGF+FRC +C F MHPCC
Sbjct  88    APPLLHDHPFHPKHPHLLFFAKP---AGGFLRCKCDICGKAVKGFSFRCASCGFDMHPCC  144

Query  719   AMLSTEIKYP-PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGR--VYGC  889
             A +S  ++ P  H H L L P + G           G   +  C  C + R G   VY C
Sbjct  145   AAMSARMELPAAHEHPLVLAPAAGG-----------GEETSFVCQVCRRARRGHHLVYQC  193

Query  890   TACDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvg  1069
               C Y LHA CAK+M+NGL  +GI PPE+ S L  A ++    +F  IGGLI+GIGEG+G
Sbjct  194   LPCGYCLHARCAKDMVNGLYAHGIVPPERRSALAAAARVTVNALFGVIGGLIEGIGEGIG  253

Query  1070  eAIVQNISGGRGSAR  1114
             EA V+NI   R S R
Sbjct  254   EAFVENIGRSRRSFR  268



>ref|XP_008652876.1| PREDICTED: uncharacterized protein LOC103632945 [Zea mays]
 tpg|DAA62082.1| TPA: hypothetical protein ZEAMMB73_680738 [Zea mays]
Length=278

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 150/242 (62%), Gaps = 18/242 (7%)
 Frame = +2

Query  392   EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
             EMVH SH +H L     P LF C GC+EYGAGKR+ CQ C FQLH+FCAL+PPSL+ HPL
Sbjct  48    EMVHFSHPEHRLARFDFPYLFMCMGCREYGAGKRFMCQTCGFQLHEFCALAPPSLHDHPL  107

Query  572   HGQH-QLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             H +H  LLF  KP     G  R KCDVCGK  +GF+FRC +CSF MHPCCA ++  ++ P
Sbjct  108   HPKHPHLLFFAKP--ASGGFLRCKCDVCGKPVRGFSFRCASCSFDMHPCCAAMARRMELP  165

Query  749   P-HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAG---RVYGCTACDYHLHA  916
               H H L L         +PAA D  G   +  C  C + +     RVY C  C Y+LHA
Sbjct  166   AVHEHPLLL---------APAAQD--GAETSFVCQVCRRTKRSSGQRVYQCLPCGYYLHA  214

Query  917   VCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvgeAIVQNISG  1096
              CAK+M+NGL  +G+ PPEK + L  A +     +F  IGGLI+GIGEG+GEA V NI  
Sbjct  215   RCAKDMVNGLYVHGVVPPEKRNALAAAARATVNALFGVIGGLIEGIGEGIGEAFVDNIGR  274

Query  1097  GR  1102
              R
Sbjct  275   SR  276



>ref|XP_006342199.1| PREDICTED: uncharacterized protein LOC102590059 isoform X2 [Solanum 
tuberosum]
Length=270

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 130/173 (75%), Gaps = 8/173 (5%)
 Frame = +2

Query  614   VKSGITRAKCDVCGKSTKGFTFRCR--ACSFQMHPCCAMLSTEIKYPPHAHRLKLLPPSS  787
             VK+GI   +CDVC KSTKGFTFRCR  +C+FQMHPCCAMLSTEIK+P H H LK+LPP +
Sbjct  99    VKAGIAWPRCDVCCKSTKGFTFRCRVNSCNFQMHPCCAMLSTEIKFPNHPHLLKVLPPGN  158

Query  788   GLQGSPAAG-DQHGHAAAVSCGKCGKKRA-GRVYGCTACDYHLHAVCAKEMMNGLQENGI  961
              L G    G DQ G      C +C KKR+ GRVY CT C YHLHA+CAK M+NGLQE GI
Sbjct  159   TLPGGAGGGNDQPGMV----CSECKKKRSSGRVYSCTVCGYHLHALCAKSMINGLQEYGI  214

Query  962   NPPEKPSVLGTAVKIAGQVVFefigglidgigegvgeAIVQNISGGRGSARIR  1120
              PPEKP++LGTA ++A QVV EFIGGLI+G GEGVGE +VQNI  GRGS   R
Sbjct  215   KPPEKPNMLGTAARLASQVVIEFIGGLIEGFGEGVGEVLVQNIGRGRGSTNRR  267



>gb|KHM99033.1| hypothetical protein glysoja_024333 [Glycine soja]
Length=231

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 141/227 (62%), Gaps = 10/227 (4%)
 Frame = +2

Query  434   MTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFHDKPKQ  613
             + LP+LF C GCKEYG+GKR+ CQQC+FQLHDFCAL+PP+L  HP H QH +LFH KP  
Sbjct  2     VDLPDLFNCVGCKEYGSGKRFVCQQCDFQLHDFCALAPPALKAHPFHSQHSVLFHSKPG-  60

Query  614   VKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH--AHRLKLLPPSS  787
               S I R        S   + +     +++       L++  ++ P    H        S
Sbjct  61    -FSTIIRFCMAGLSSSHDYYVYLASPAAYK------ALASYARHVPFRCTHAAPCSTTKS  113

Query  788   GLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEMMNGLQENGINP  967
               Q +P   +     ++  CG+C K+R+G+VY CT C+YHLHAVCAK  +NGLQ NGI P
Sbjct  114   STQPTPTLSECSQQPSSFVCGECKKRRSGKVYRCTVCEYHLHAVCAKTKINGLQANGIRP  173

Query  968   PEKPSVLGTAVKIAGQVVFefigglidgigegvgeAIVQNISGGRGS  1108
             PEK SVL  A ++A QVV EFIGGL++GIGE VG+ +VQNI+ G  +
Sbjct  174   PEKSSVLAAAARVASQVVIEFIGGLVEGIGESVGDVLVQNIAKGNNA  220



>gb|EEC84807.1| hypothetical protein OsI_31875 [Oryza sativa Indica Group]
Length=287

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 136/252 (54%), Gaps = 21/252 (8%)
 Frame = +2

Query  395   MVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCA-LSPPSLNTHPL  571
             MVH SH +H L     P LF C GCKEYGAGKR+ CQ C FQLH+FCA L  PS+ T  +
Sbjct  47    MVHFSHPEHRLARFDFPYLFMCMGCKEYGAGKRFMCQLCGFQLHEFCAWLLRPSMTTLSI  106

Query  572   HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP-  748
                        P       +  +CD+CGKS KGF+FRC +CSF MHPCCA +S  +  P 
Sbjct  107   -----------PSTNTFSSSSNQCDICGKSVKGFSFRCTSCSFAMHPCCAAMSRRMDLPV  155

Query  749   PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVS--------CGKCGKKRAGRVYGCTACDY  904
              H H L L P       +    D  G              C +C +     VY C  C Y
Sbjct  156   AHEHPLMLAPSPPTPPMATPTSDVVGVGDGGVGTSFVCQMCRRCRRPAGQYVYQCMPCGY  215

Query  905   HLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvgeAIVQ  1084
             +LHA CAK+++NGL  +G+ PPEK S L    ++    +F  IGGLI+GIGEG+GEA V 
Sbjct  216   YLHARCAKDVVNGLYVHGVAPPEKGSALAAVARVTINALFSVIGGLIEGIGEGIGEAFVD  275

Query  1085  NISGGRGSARIR  1120
             NI   RG +  R
Sbjct  276   NIGRSRGRSSFR  287



>ref|XP_009788734.1| PREDICTED: uncharacterized protein LOC104236505 isoform X2 [Nicotiana 
sylvestris]
Length=270

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 90/142 (63%), Gaps = 18/142 (13%)
 Frame = +2

Query  350  VEFPTSPQP--------NNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQ  505
            +EFPTSPQP         N    +VH +H+KHPL E+TL ELFTCSGCKE+GAG+RYACQ
Sbjct  61   IEFPTSPQPPDDHDGVHANHNGTIVHHTHSKHPLAEITLSELFTCSGCKEFGAGRRYACQ  120

Query  506  QCNFQLHDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKS------GITRAKCDVCG----  655
             C+FQLH FCALSPPSL  HP HGQHQL+FH KPKQ  +      G       VCG    
Sbjct  121  DCDFQLHHFCALSPPSLKAHPFHGQHQLVFHAKPKQGNALSGGAGGGNDQSGMVCGACKK  180

Query  656  KSTKGFTFRCRACSFQMHPCCA  721
            K + G  + C  C + +H  CA
Sbjct  181  KRSSGRVYSCTVCDYHLHAMCA  202


 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 115/182 (63%), Gaps = 8/182 (4%)
 Frame = +2

Query  569   LHGQHQ--LLFHDKPKQVKSGITRAK---CDVCGKSTKGFTFRCRACSFQMHPCCAMLST  733
             +H  H   ++ H   K   + IT ++   C  C +   G  + C+ C FQ+H  CA+   
Sbjct  76    VHANHNGTIVHHTHSKHPLAEITLSELFTCSGCKEFGAGRRYACQDCDFQLHHFCALSPP  135

Query  734   EIKYPPHAHRLKLLPPSSGLQGSPAAGDQHG--HAAAVSCGKCGKKRA-GRVYGCTACDY  904
              +K  P   + +L+  +   QG+  +G   G    + + CG C KKR+ GRVY CT CDY
Sbjct  136   SLKAHPFHGQHQLVFHAKPKQGNALSGGAGGGNDQSGMVCGACKKKRSSGRVYSCTVCDY  195

Query  905   HLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvgeAIVQ  1084
             HLHA+CAK M+NGLQE GI PPEKP+VLGTA ++A QVV EFIGGLI+G+GEGVGEA+VQ
Sbjct  196   HLHAMCAKSMINGLQEYGIKPPEKPNVLGTAARLASQVVIEFIGGLIEGLGEGVGEALVQ  255

Query  1085  NI  1090
             NI
Sbjct  256   NI  257



>gb|EEE69969.1| hypothetical protein OsJ_29861 [Oryza sativa Japonica Group]
Length=340

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 81/123 (66%), Gaps = 14/123 (11%)
 Frame = +2

Query  395  MVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLH  574
            MVH SH +H L     P LF C GCKEYGAGKR+ CQ C FQLH+FCAL+PPSL+ HP H
Sbjct  47   MVHFSHPEHRLARFDFPYLFMCMGCKEYGAGKRFMCQLCGFQLHEFCALAPPSLHDHPFH  106

Query  575  GQHQ-LLFHDKPKQVKS-------------GITRAKCDVCGKSTKGFTFRCRACSFQMHP  712
             +HQ LLF  KP+   S              + R KCD+CGKS KGF+FRC +CSF MHP
Sbjct  107  PKHQHLLFFVKPEWRCSDRIVYRIIFFYPMWVLRCKCDICGKSVKGFSFRCTSCSFAMHP  166

Query  713  CCA  721
            CCA
Sbjct  167  CCA  169



>ref|XP_006661383.1| PREDICTED: uncharacterized protein LOC102707900 [Oryza brachyantha]
Length=203

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 74/106 (70%), Gaps = 5/106 (5%)
 Frame = +2

Query  371  QPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPP  550
            + ++G  E+VH SH +H L     P LF C GCKEYGAG+R+ C+ C FQLH+FCAL+PP
Sbjct  37   RADDGDGEIVHFSHPEHRLGRFDFPYLFMCMGCKEYGAGRRFMCRLCGFQLHEFCALAPP  96

Query  551  SLNTHPLHGQHQ-LLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRC  685
            SL+ HP H +HQ LLF  KP     G  R KCD+CGKS KGF+FRC
Sbjct  97   SLHDHPFHPKHQHLLFFVKP----GGFLRCKCDICGKSVKGFSFRC  138


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 85/188 (45%), Gaps = 36/188 (19%)
 Frame = +2

Query  560   THPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAM----L  727
              H  H +H+L   D P           C  C +   G  F CR C FQ+H  CA+    L
Sbjct  46    VHFSHPEHRLGRFDFPYLFM-------CMGCKEYGAGRRFMCRLCGFQLHEFCALAPPSL  98

Query  728   STEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYH  907
                  +P H H L  + P   L+                C  CGK   G  +        
Sbjct  99    HDHPFHPKHQHLLFFVKPGGFLR--------------CKCDICGKSVKGFSF--------  136

Query  908   LHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQVVFefigglidgigegvgeAIVQN  1087
                 CAK+++NGL E+G+ PPEK S L  A K+    +F  IGGL++GIGEG+GEA V+N
Sbjct  137   ---RCAKDVVNGLYEHGVVPPEKGSALVAAAKVTINALFGVIGGLVEGIGEGIGEAFVEN  193

Query  1088  ISGGRGSA  1111
             I   RG +
Sbjct  194   IGRSRGRS  201



>ref|XP_006849838.1| hypothetical protein AMTR_s00022p00034890 [Amborella trichopoda]
 gb|ERN11419.1| hypothetical protein AMTR_s00022p00034890 [Amborella trichopoda]
Length=243

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 98/212 (46%), Gaps = 26/212 (12%)
 Frame = +2

Query  389   EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             +E++H SH++H L       LF C GCKE G G RY C  C+F LH  CA   P+LN HP
Sbjct  7     KEIIHYSHSQHRLKFECSDALFNCDGCKEAGIGARYKCDICDFDLHKNCATPSPTLN-HP  65

Query  569   LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
              + +    F+ +P     G     CD CG+   GF + C +C F +HPCCA L   +   
Sbjct  66    FYRKCNFQFYSRP----PGDKMRYCDACGQDVLGFVYHCNSCGFDLHPCCACLPPVLNDG  121

Query  749   PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                  L L                     + +C +CG+K  G  Y      Y+LH  C K
Sbjct  122   ERNLYLSL-------------------KVSAACHRCGRKGIGWSYRSECKKYNLHVSCVK  162

Query  929   EM-MNGLQENGINPPEKPSVLGTAV-KIAGQV  1018
             +M M   QE   +  +K + L T + K+ GQV
Sbjct  163   DMLMESWQEIYDSGAKKINELQTRIPKLKGQV  194



>gb|EYU35257.1| hypothetical protein MIMGU_mgv1a024781mg, partial [Erythranthe 
guttata]
Length=269

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 82/177 (46%), Gaps = 24/177 (14%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H +H +H L    +P  F C GC + G+G  Y+C+ CNF LH+ CA  P ++ +   H +
Sbjct  22   HRTHPEHLLKPFYIPNEFLCDGCDQLGSGPTYSCEACNFDLHEICATCPSTIQSG-FHPK  80

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPHAH  760
            H L   +KP      +    CD+CG    G  + CR C+F +HP C  L  ++K P H H
Sbjct  81   HPLTLVNKP------VANRVCDLCGDFVCGLFYTCRTCAFDVHPLCTQLPVQVKLPMHRH  134

Query  761  RLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
            RL L P               G  A   C  C +  A   Y C  CD  +H  CA +
Sbjct  135  RLTLKP---------------GRIAP--CDLCDEVCASWRYTCRTCDVDIHLECALQ  174



>ref|XP_008382519.1| PREDICTED: uncharacterized protein LOC103445306 [Malus domestica]
Length=241

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 83/183 (45%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            +E+ H  H KH L        F C GCKE G G +Y CQQC F LH  CA++PP++ THP
Sbjct  5    KEISHPIHLKHRLKIEYTEVPFYCDGCKEAGIGLKYKCQQCEFDLHKACAVAPPTI-THP  63

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + + +  F  +P     G  R  CD C K   GF + CR C F +HPCCA L   +   
Sbjct  64   FYDKCEFQFLYRP----PGAVRRVCDACRKDVVGFVYHCRKCGFDLHPCCANLPQVLDDG  119

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                 L L   S                   +C +CG K  G  Y      Y+LH  C K
Sbjct  120  ERNFYLYLKLSS-------------------ACHRCGGKGRGWCYRSECKTYNLHVSCVK  160

Query  929  EMM  937
            E++
Sbjct  161  ELL  163



>ref|XP_008787842.1| PREDICTED: uncharacterized protein LOC103705770 [Phoenix dactylifera]
Length=185

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 89/181 (49%), Gaps = 27/181 (15%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLN--T  562
            +++ H +H KHPLV   + E FTC GC+  G+G RY C +C+F LH  CA SPP+L    
Sbjct  3    KKITHFTHPKHPLVRTIIDERFTCDGCRYPGSGLRYHCDRCDFVLHVHCATSPPALQFFA  62

Query  563  HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
            HPLH   Q+   D P   +       CD+C +  +G ++RC AC+F +HP CA L   ++
Sbjct  63   HPLHKLTQVARAD-PADPRV------CDLCREPVRGMSYRCVACAFDVHPLCAQLPPTVE  115

Query  743  YPPHA-HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
               HA H L L+P                 A    C  CG+      Y C  C  +LH  
Sbjct  116  SDVHAGHALSLVP-----------------AIPQPCSACGRVCQVWRYRCGPCMVNLHPQ  158

Query  920  C  922
            C
Sbjct  159  C  159



>ref|XP_003530334.1| PREDICTED: uncharacterized protein LOC100795400 [Glycine max]
Length=259

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 85/182 (47%), Gaps = 22/182 (12%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L        F C GCKE G G RY C  C+F LH  C++  PSL  HP 
Sbjct  32   EISHFSHKQHKLAFDYSESPFKCDGCKELGIGSRYKCSICDFDLHTHCSIPSPSL-FHPF  90

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  +P     G T   C+ C K  KGF + C +C F +HPCCA L T +    
Sbjct  91   YPKCSFHFLSQPP----GDTSRYCNACEKPVKGFLYHCFSCGFDLHPCCAKLPTVLGSDE  146

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
            H  RL L    S                  +C +CG+K +G  Y  +   Y+LH  C +E
Sbjct  147  HGVRLFLYRKVSS-----------------ACHRCGRKGSGWSYRSSCKRYNLHVACVRE  189

Query  932  MM  937
            M+
Sbjct  190  MV  191



>gb|EYU35259.1| hypothetical protein MIMGU_mgv11b024130mg, partial [Erythranthe 
guttata]
Length=296

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 86/191 (45%), Gaps = 24/191 (13%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H +H +H L    +P  F C GC + G+G  Y+C+ CNF LH+ CA  P ++ +   H +
Sbjct  49   HRTHPEHLLKPFYIPNEFLCDGCDQLGSGPTYSCEACNFDLHEICATCPSTIQSG-FHPK  107

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPHAH  760
            H L   +     K G  R  CD+CG    G  + CR C+F +HP C  L  ++K P H H
Sbjct  108  HPLTLVN-----KLGANRV-CDLCGDFVCGLFYTCRTCAFDVHPLCTQLPIQVKLPMHRH  161

Query  761  RLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEMMN  940
            RL L P               G  A   C  C +      Y C  CD  +H  CA +  +
Sbjct  162  RLTLKP---------------GRIAP--CDLCDEVCTSWRYTCRTCDVDIHLECALQDDD  204

Query  941  GLQENGINPPE  973
               +  I  PE
Sbjct  205  DDDDEEIVIPE  215



>ref|XP_004290094.1| PREDICTED: uncharacterized protein LOC101310179 [Fragaria vesca 
subsp. vesca]
Length=240

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 87/185 (47%), Gaps = 28/185 (15%)
 Frame = +2

Query  389  EEMVHSSHAKHPL-VEMT-LPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT  562
            +E+ H  H +H L +E T +P  F C GCKE G G +Y CQQC F LH  CA++P  +N 
Sbjct  5    KEITHPIHPRHKLKIEYTEIP--FYCDGCKEAGIGLKYKCQQCEFDLHKSCAVAPLYIN-  61

Query  563  HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
            HP + + +  F  +P     G  R  CD C K   GF + CR C F +HPCCA L   + 
Sbjct  62   HPFYNKCEFQFLYRP----PGALRRVCDACRKDVSGFVYHCRRCGFDLHPCCANLPQVLD  117

Query  743  YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
               H   L L   S                   +C +CG K  G  Y      Y+LH  C
Sbjct  118  DGKHNLYLCLKLTS-------------------ACHRCGGKGPGWSYRSDCKTYNLHVSC  158

Query  923  AKEMM  937
             KE++
Sbjct  159  VKELL  163



>ref|XP_008796308.1| PREDICTED: uncharacterized protein LOC103711798 [Phoenix dactylifera]
Length=240

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 93/212 (44%), Gaps = 34/212 (16%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            +E+ H  H +H L        F C GCKE G G +Y C  C+F LH  CAL+P ++  H 
Sbjct  5    KEICHPIHPQHKLKIEYTEVPFRCDGCKEAGIGLKYKCDMCDFDLHKACALAPATIK-HA  63

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + + +  F+ KP     G+    CD CGK   GF + C  C F +HPCCA L  ++   
Sbjct  64   FYKRCEFRFYSKP----PGLGMRICDACGKDVPGFVYHCSRCGFDLHPCCANLPQQLDDG  119

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
             H   L L   S                    C +CG+K  G  Y     +Y+LH  C K
Sbjct  120  EHNFYLCLKLSS-------------------PCHRCGRKGLGWSYRSECKNYNLHVSCVK  160

Query  929  EMMN--------GLQENGINP--PEKPSVLGT  994
            E++          L +N +    P  PS+ GT
Sbjct  161  ELLAESWQAIYLNLDKNKVREIQPRIPSLRGT  192



>ref|XP_009121236.1| PREDICTED: uncharacterized protein LOC103846067 [Brassica rapa]
 emb|CDY49555.1| BnaA07g03770D [Brassica napus]
Length=242

 Score =   100 bits (248),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 84/186 (45%), Gaps = 28/186 (15%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYAC----QQCNFQLHDFCALSPPSLN  559
            E+ H SH KH L      + F C GC E G G RY C    Q C+F LH  CAL P +  
Sbjct  5    EISHFSHPKHNLKYDYTEKPFKCDGCNEVGIGSRYRCSSDHQSCDFDLHAHCAL-PSATI  63

Query  560  THPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
            THP + + +  F  KP     G  R  C+ C K   GF + CRAC F +HPCCAML   +
Sbjct  64   THPFYKKCKFQFLAKP----PGNERRYCNACQKDVSGFVYHCRACGFDLHPCCAMLPMVL  119

Query  740  KYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
                   +L L    S                  SC +CGKK     Y  +   Y+LH  
Sbjct  120  --DDGETKLFLYRKVSS-----------------SCHRCGKKGRSWSYRSSCKKYNLHVA  160

Query  920  CAKEMM  937
            C +EM+
Sbjct  161  CVREML  166



>emb|CDX71256.1| BnaC07g05350D [Brassica napus]
Length=242

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 84/186 (45%), Gaps = 28/186 (15%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYAC----QQCNFQLHDFCALSPPSLN  559
            E+ H SH KH L      + F C GC E G G RY C    Q C+F LH  CAL P +  
Sbjct  5    EISHFSHPKHNLKYDYTEKPFKCDGCNEVGIGSRYRCSSDHQSCDFDLHAHCAL-PSATI  63

Query  560  THPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
            THP + + +  F  KP     G  R  C+ C K   GF + CRAC F +HPCCAML   +
Sbjct  64   THPFYKKCKFQFLAKP----PGNERRYCNACQKDVSGFVYHCRACGFDLHPCCAMLPMVL  119

Query  740  KYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
                   +L L    S                  SC +CGKK     Y  +   Y+LH  
Sbjct  120  --DDGETKLFLYRNVSS-----------------SCHRCGKKGRSWSYRSSCKKYNLHVA  160

Query  920  CAKEMM  937
            C +EM+
Sbjct  161  CVREML  166



>ref|XP_010927292.1| PREDICTED: uncharacterized protein LOC105049369 [Elaeis guineensis]
Length=240

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 84/183 (46%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            +E+ H SH  H L        F C+GCKE G G +Y C  C+F LH  CAL+P ++  H 
Sbjct  5    KEICHPSHPHHKLKVEYTEVPFRCNGCKEAGIGLKYKCDMCDFDLHKACALAPATIK-HA  63

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + + +  F+  P     G+    CD CGK   GF + C  C F +HPCCA L  ++   
Sbjct  64   FYKKCEFRFYTTP----PGLGMRICDACGKDVPGFVYHCSRCGFDLHPCCANLPQQLDDG  119

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
             H   L L   S                    C +CG+K +G  Y     +Y+LH  C K
Sbjct  120  DHNFYLCLKLSS-------------------PCHRCGRKGSGWSYRSECKNYNLHVSCVK  160

Query  929  EMM  937
            E++
Sbjct  161  ELL  163



>ref|XP_007043120.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao]
 gb|EOX98951.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao]
Length=240

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 83/183 (45%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            +E+ H  H KH L        F C GCKE G G +Y+CQQC F LH  CA+  P++ THP
Sbjct  5    KEIPHPIHPKHKLKLEYTEIPFNCDGCKEAGIGLKYSCQQCEFDLHKACAMPSPTI-THP  63

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + + +  F+ KP   +  I    CD C     GF + C+ C F +HPCCA L   +   
Sbjct  64   FYKKCEFQFYYKPPGEQMRI----CDACRNDVLGFVYHCKGCDFDLHPCCANLPQVLDDG  119

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
             H   L L                     + SC +CG K  G  Y      Y+LH  C K
Sbjct  120  EHNLYLCL-------------------KLSRSCHRCGGKGPGWSYRSQCKSYNLHVSCVK  160

Query  929  EMM  937
            E++
Sbjct  161  ELL  163



>ref|XP_010687681.1| PREDICTED: diacylglycerol kinase theta-like [Beta vulgaris subsp. 
vulgaris]
Length=198

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/217 (32%), Positives = 95/217 (44%), Gaps = 37/217 (17%)
 Frame = +2

Query  395   MVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLN--THP  568
             + H+ H KHPL E+     F C  CK  G G R+ C QC+F +H  CA  P SL+  THP
Sbjct  7     ITHNKHTKHPLKEVYKNSKFECKICKCNGKGMRFRCDQCDFNIHSACATCPVSLSSFTHP  66

Query  569   LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA----MLSTE  736
                +H +   ++P          KC +C K   G  +RC+ C F MHP C+     L   
Sbjct  67    ---EHAVELMERPNLAH------KCHLCQKPITGMVYRCKLCKFFMHPVCSEFPEFLFKH  117

Query  737   IKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
             + +PPH  +L+L+  S                    C  C K      Y C  CD HLH 
Sbjct  118   VMHPPHTLKLQLMESS-------------------KCDVCDKSCKHWRYFCGICDVHLHV  158

Query  917   VC--AKEMMNGLQENGINPPEKPSVLG-TAVKIAGQV  1018
              C  +K  ++   E G       ++LG  A  IAG +
Sbjct  159   GCLSSKNNISDDDEGGFGEVLGVTILGEIASVIAGSI  195



>ref|XP_007153143.1| hypothetical protein PHAVU_003G010500g [Phaseolus vulgaris]
 gb|ESW25137.1| hypothetical protein PHAVU_003G010500g [Phaseolus vulgaris]
Length=255

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 83/182 (46%), Gaps = 22/182 (12%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L        F C GCKE G G RY+C  C+F LH  C++  PSL  HP 
Sbjct  30   EISHFSHKQHKLTFDYSESPFQCDGCKELGIGSRYSCSLCDFDLHTHCSIPSPSL-FHPF  88

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F   P     G T   C+ C K  KGF + C +C F +HPCCA L T I    
Sbjct  89   YPKCSFHFLSHP----PGDTPRYCNACQKPLKGFLYHCFSCGFDLHPCCAKLPTVIAGDN  144

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
            +  RL L                       +C +CG+K  G  Y  +   Y+LH  C +E
Sbjct  145  NEVRLLLY-----------------RTVRSACHRCGQKGRGWSYRSSCKRYNLHVACVRE  187

Query  932  MM  937
            M+
Sbjct  188  MV  189



>ref|XP_009143447.1| PREDICTED: uncharacterized protein LOC103867159 [Brassica rapa]
 emb|CDX74931.1| BnaA05g06770D [Brassica napus]
Length=301

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 90/202 (45%), Gaps = 27/202 (13%)
 Frame = +2

Query  401   HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
             H +H  HPL E      F C GCK YG+GK Y C+ CN+ LHD+CA  P +L T  +H Q
Sbjct  13    HFTHI-HPLTEFNSAGDFICDGCKTYGSGKTYRCEPCNYDLHDYCATCPLTLPTF-IHPQ  70

Query  581   HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-A  757
             H+L    + +Q      RA CD+C +S +G  +RC+ C F +HP C  L   +++  H A
Sbjct  71    HELSLVVRKQQSTRQNERA-CDICNESVEGLFYRCKLCEFDVHPLCTQLPQHVRHVLHPA  129

Query  758   HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEMM  937
             H L+                      A  C  C        Y C  C + +H  C   + 
Sbjct  130   HHLEFR-----------------LGGASPCMVCYNPCQSWRYRCELCRFDIHMECILAVC  172

Query  938   NGLQENGINPPEKPSVLGTAVK  1003
             N       +PP+     GT  K
Sbjct  173   N------TSPPDNTEASGTKSK  188



>ref|XP_011095209.1| PREDICTED: uncharacterized protein LOC105174719 [Sesamum indicum]
Length=283

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 94/204 (46%), Gaps = 20/204 (10%)
 Frame = +2

Query  365  SPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALS  544
            +P P N    ++H +H  HPL      + + C+GCK  G GKRY CQ+C+F LHD+C   
Sbjct  2    APLPKN---PILHFTHPAHPLTAFDSQQDYLCNGCKTLGNGKRYRCQRCDFDLHDYCGTC  58

Query  545  PPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAM  724
            P  L++  +H  H L    +  Q    + R  CDVC    +G  +RC+ C F +HP C  
Sbjct  59   PRVLSSF-MHKNHSLSLVTRKPQGTRQVHRI-CDVCRDPVEGLFYRCKDCQFDVHPLCTQ  116

Query  725  LSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDY  904
            L  ++++  H   L +      LQ S   G       AV  G C   R    Y C  C++
Sbjct  117  LPEKLQHALHKIHLLI------LQSSTVPG-----FCAVCRGSCSSWR----YRCGLCNF  161

Query  905  HLHAVCAKEMMNGLQENGINPPEK  976
             +H  C    +    +NG    E+
Sbjct  162  DIHLECVLVPVVPCTQNGRGSKER  185



>ref|NP_181318.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
 gb|AAR92255.1| At2g37820 [Arabidopsis thaliana]
 gb|AAS76245.1| At2g37820 [Arabidopsis thaliana]
 gb|AAY57581.1| PHD domain protein [Arabidopsis thaliana]
 gb|AEC09454.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
Length=290

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 83/175 (47%), Gaps = 20/175 (11%)
 Frame = +2

Query  419  HPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFH  598
            HPL E      F C GCK YG+GK Y C+ CN+ LH++CA  P +L T  +H QH+L   
Sbjct  18   HPLTEFNSIGDFICDGCKTYGSGKTYRCEPCNYDLHEYCATCPLTLPTF-IHPQHELSLV  76

Query  599  DKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-AHRLKLL  775
             + +Q      RA CD+C +S +G  +RC+ C F +HP C  L   +++  H AH L+  
Sbjct  77   VRKQQSTRQNDRA-CDICDESVEGLFYRCKICEFDVHPLCTQLPQHVRHVLHPAHHLEFR  135

Query  776  PPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEMMN  940
            P                 + A +C  C        Y C  C + +H  C   + N
Sbjct  136  P-----------------SGASTCMVCHGPCQSWRYRCELCRFDIHMECILAVCN  173



>ref|XP_009358911.1| PREDICTED: uncharacterized protein LOC103949521 [Pyrus x bretschneideri]
Length=241

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 85/185 (46%), Gaps = 28/185 (15%)
 Frame = +2

Query  389  EEMVHSSHAKHPL-VEMT-LPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT  562
            +E+ H  H KH L +E T +P  F C GCKE G G +Y CQQC F LH  CA++ P++  
Sbjct  5    KEISHPIHLKHKLKIEYTEIP--FYCDGCKEAGIGLKYKCQQCEFDLHKACAVASPTI-I  61

Query  563  HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
            HP + + +  F   P     G  R  CD C K   GF + CR C F +HPCCA L   + 
Sbjct  62   HPFYNKCEFQFLYSP----PGAARRVCDACRKDVVGFVYHCRRCGFDLHPCCANLPQVLD  117

Query  743  YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
                   L L   S                   +C +CG K  G  Y      Y+LH  C
Sbjct  118  DGERNFYLYLKLSS-------------------ACHQCGGKGHGWCYRSECKTYNLHVSC  158

Query  923  AKEMM  937
             KE++
Sbjct  159  VKELL  163



>ref|XP_008776507.1| PREDICTED: uncharacterized protein LOC103696605 [Phoenix dactylifera]
Length=240

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 86/185 (46%), Gaps = 28/185 (15%)
 Frame = +2

Query  389  EEMVHSSHAKHPL-VEMT-LPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT  562
            +E+ H SH +H L +E T +P  F C GCKE G G +Y C  C+F LH  CAL+ PS+ T
Sbjct  5    KELFHPSHPQHKLKIEYTEIP--FRCDGCKEAGIGLKYKCHACDFDLHKACALA-PSMIT  61

Query  563  HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
            HP + + +  F+ KP     G     CD C K   GF + C  C F +HPCCA L   + 
Sbjct  62   HPFYKKCEFRFYGKP----PGPVMRICDACRKDVLGFVYHCTRCGFDLHPCCANLPQCLD  117

Query  743  YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
                   L L                     + +C +CG K  G  Y     +Y LH  C
Sbjct  118  DGERNFYLSL-------------------RVSGTCLRCGGKGLGWSYKSDCKNYTLHVSC  158

Query  923  AKEMM  937
             KE++
Sbjct  159  VKELL  163



>emb|CDX91385.1| BnaC04g07650D [Brassica napus]
Length=301

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 90/202 (45%), Gaps = 27/202 (13%)
 Frame = +2

Query  401   HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
             H +H  HPL E      F C GCK YG+GK Y C+ CN+ LHD+CA  P +L T  +H Q
Sbjct  13    HFTHI-HPLTEFNSAGDFICDGCKTYGSGKTYRCEPCNYDLHDYCATCPLTLPTF-IHPQ  70

Query  581   HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-A  757
             H+L    + +Q      RA CD+C +S +G  +RC+ C F +HP C  L   +++  H A
Sbjct  71    HELSLVVRKQQSTRQNERA-CDICNESVEGLFYRCKLCEFDVHPLCTQLPQHVRHVLHPA  129

Query  758   HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEMM  937
             H L+                      A  C  C        Y C  C + +H  C   + 
Sbjct  130   HHLEFR-----------------LGGASPCMVCYNPCQSWRYRCELCRFDIHMECILTVC  172

Query  938   NGLQENGINPPEKPSVLGTAVK  1003
             N       +P +K    GT  K
Sbjct  173   N------TSPSDKTEASGTKSK  188



>ref|XP_006410975.1| hypothetical protein EUTSA_v10017859mg, partial [Eutrema salsugineum]
 gb|ESQ52428.1| hypothetical protein EUTSA_v10017859mg, partial [Eutrema salsugineum]
Length=265

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 90/187 (48%), Gaps = 25/187 (13%)
 Frame = +2

Query  419  HPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFH  598
            HPL E      F C GCK YG+GK Y C+ CN+ LH++CA  P +L T  +H QH+L   
Sbjct  18   HPLTEFNSVGDFNCDGCKTYGSGKTYRCEPCNYDLHEYCATCPLTLPTF-IHPQHELSLV  76

Query  599  DKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-AHRLKLL  775
             + +Q      RA CD+C +S +G  +RC+ C F +HP C  L   +++  H AH L+  
Sbjct  77   VRKQQSTRQNERA-CDICNESVEGLFYRCKLCEFDVHPLCTQLPQHVRHVLHPAHHLEFR  135

Query  776  PPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLH-----AVCAKEMMN  940
                 L G+         A  V  G C   R    Y C  C + +H     AVC     +
Sbjct  136  -----LGGAS--------ACMVCRGPCQSWR----YRCELCRFDIHMECILAVCNTSPSD  178

Query  941  GLQENGI  961
               E+GI
Sbjct  179  PTDESGI  185



>ref|XP_006295890.1| hypothetical protein CARUB_v10025020mg [Capsella rubella]
 gb|EOA28788.1| hypothetical protein CARUB_v10025020mg [Capsella rubella]
Length=286

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 91/200 (46%), Gaps = 26/200 (13%)
 Frame = +2

Query  419   HPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFH  598
             HPL+E      F C GCK YG+GK Y C+ CN+ LH++CA  P +L T  +H QH L   
Sbjct  18    HPLLEFNSIGDFICDGCKTYGSGKTYRCEPCNYDLHEYCATCPLTLPTF-IHPQHTLNLV  76

Query  599   DKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-AHRLKLL  775
              + +Q      RA CD+C +S +G  +RC+ C F +HP C  L   +++  H AH L+  
Sbjct  77    VRKQQSTRQNDRA-CDICDESVEGLFYRCKICEFDVHPLCTQLPQHVRHVLHPAHHLEFR  135

Query  776   PPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEMMNGLQEN  955
                               A A  C  C        Y C  C + +H  C   + N     
Sbjct  136   L-----------------AGASPCMVCHVPCQSWRYRCELCRFDIHMECILAVCN-----  173

Query  956   GINPPEKPSVLGTAVKIAGQ  1015
               +P ++ +  GT  +  GQ
Sbjct  174   -TSPSDQTNASGTKSRGIGQ  192



>ref|XP_010940196.1| PREDICTED: uncharacterized protein LOC105058837 [Elaeis guineensis]
Length=219

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 86/181 (48%), Gaps = 27/181 (15%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT--  562
            +++ H +H KHPLV+  +   F C GCK  G+G RY C   +F LHD CA  PP+L+   
Sbjct  3    KKITHFTHPKHPLVQTLIDRRFKCDGCKYPGSGLRYYCDIFDFVLHDRCATCPPALHIFA  62

Query  563  HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
            HPLH   Q+   D P   +       CD+C +  +  ++RC AC F +HP CAML   ++
Sbjct  63   HPLHPLTQVARTD-PADPRV------CDLCREPVRRTSYRCVACGFDLHPLCAMLPPTVE  115

Query  743  YPPHA-HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
               H+ H L L+P                 A    C  CG+      Y C  C  +LH  
Sbjct  116  AELHSGHALSLVP-----------------AIPQPCSACGEVCLVWRYRCIPCKVNLHPQ  158

Query  920  C  922
            C
Sbjct  159  C  159



>emb|CAN76522.1| hypothetical protein VITISV_034514 [Vitis vinifera]
Length=351

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 81/198 (41%), Gaps = 27/198 (14%)
 Frame = +2

Query  383  GGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT  562
            G  +  H SH +HPL      + +TC GCKE G G R+ C+ C+F LH+ C   P    T
Sbjct  2    GATDRXHVSHPEHPLXLKNYKKPYTCDGCKEPGFGSRHRCEACDFDLHEDCMF-PTETTT  60

Query  563  HPLHGQHQLLFHDKPKQVK------SGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAM  724
            H   G     FH +P   K          R  CD  GK+ KGF + C A    +HPCC  
Sbjct  61   HDFFGNAAFKFHLRPPNSKCKEKHCRNHGRTYCDAXGKAVKGFVYHCAARDLDLHPCCRN  120

Query  725  LSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYGCTACD  901
            L T++       RL+                      +  C  C +  R G  Y  +  D
Sbjct  121  LKTKMDINGEGFRLQ-------------------DKVSRRCNWCKEGSRVGWAYASSNDD  161

Query  902  YHLHAVCAKEMMNGLQEN  955
            Y+ H  C  EMM    +N
Sbjct  162  YYFHVGCVPEMMLEAWQN  179



>emb|CDY27676.1| BnaUnng00260D [Brassica napus]
Length=166

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 69/126 (55%), Gaps = 12/126 (10%)
 Frame = +2

Query  365  SPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALS  544
            SP P N  + + H +H  HPL ++     + C GCK YG+G+ Y C  CN+ LH+FCA+ 
Sbjct  2    SPLPLNAEQVLQHFTHI-HPLTKVDGVGTYICDGCKTYGSGRTYRCAACNYDLHEFCAIC  60

Query  545  PPSLNTHPLHGQHQL-LFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA  721
            PP+L +  LH  H+L L H           R  CD+C +S  G  ++C+ C F +HP C 
Sbjct  61   PPTLLS-TLHPHHELRLVHQD---------RRACDICKESINGLFYQCKTCGFDVHPLCT  110

Query  722  MLSTEI  739
             L  E+
Sbjct  111  QLPKEV  116



>gb|KDO48122.1| hypothetical protein CISIN_1g042732mg [Citrus sinensis]
Length=275

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 3/141 (2%)
 Frame = +2

Query  374  PNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPS  553
            P +G + + H +H  H L+E+     + C GCK  G+ KR+ C  C+F LH++C + P +
Sbjct  3    PLHGQKTIHHFTHPNHKLLEINDDNEYLCGGCKTPGSSKRFRCHGCDFDLHEYCGICPMT  62

Query  554  LNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLST  733
            L++  +H QHQL   ++  Q      R+ CDVCG S +G  +RC+ C F +HP C  L  
Sbjct  63   LSSF-MHPQHQLNLVNRIPQATRQNARS-CDVCGDSIEGLFYRCKLCEFDVHPVCTQLPQ  120

Query  734  EIKYP-PHAHRLKLLPPSSGL  793
            ++++    AH L L P SS  
Sbjct  121  QVRHVLDAAHPLTLQPFSSAW  141



>gb|ACJ86267.1| unknown [Medicago truncatula]
 gb|AFK39239.1| unknown [Medicago truncatula]
Length=267

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 82/190 (43%), Gaps = 37/190 (19%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            +E+ H SH KH L        F C GCKE G G RY+C  C++ LH  C++  PSL  HP
Sbjct  22   DEISHFSHQKHKLTFQHSEFPFKCDGCKEIGIGSRYSCNICDYDLHMHCSIPSPSL-FHP  80

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  KP     G     C+ C KS  GF + C +C F +HPCCA L       
Sbjct  81   FYPKCCFQFLSKP----PGDIPRYCNACEKSVTGFVYHCFSCGFDLHPCCAKL-------  129

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHA-------AAVSCGKCGKKRAGRVYGCTACDYH  907
                              P   D HG          + SC +CG+K     Y  +   Y+
Sbjct  130  ------------------PMILDDHGEVKLYLYRKVSSSCQRCGQKGRSWSYRSSCKKYN  171

Query  908  LHAVCAKEMM  937
            LH  C +EM+
Sbjct  172  LHVACVREMI  181



>ref|XP_006493588.1| PREDICTED: uncharacterized protein LOC102620333 [Citrus sinensis]
Length=291

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 3/141 (2%)
 Frame = +2

Query  374  PNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPS  553
            P +G + + H +H  H L+E+     + C GCK  G+ KR+ C  C+F LH++C + P +
Sbjct  3    PLHGQKTIHHFTHPNHKLLEINDDNEYLCGGCKTPGSSKRFRCHGCDFDLHEYCGICPMT  62

Query  554  LNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLST  733
            L++  +H QHQL   ++  Q      R+ CDVCG S +G  +RC+ C F +HP C  L  
Sbjct  63   LSSF-MHPQHQLNLVNRIPQATRQNARS-CDVCGDSIEGLFYRCKLCEFDVHPVCTQLPP  120

Query  734  EIKYP-PHAHRLKLLPPSSGL  793
            ++++    AH L L P SS  
Sbjct  121  QVRHVLDAAHPLTLQPFSSAW  141



>gb|KCW55308.1| hypothetical protein EUGRSUZ_I01234 [Eucalyptus grandis]
Length=248

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 80/183 (44%), Gaps = 23/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY+C  CNF LH  CA+ P +  +HP
Sbjct  4    NEISHFSHPQHILKFEYTEFPFKCDGCKEIGIGSRYSCAACNFDLHSHCAI-PSATISHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P           C+ C K   GF + CRAC F +HPCCA L   +   
Sbjct  63   FYPKCSFQFMSRPPTEDGP---RYCNACEKDVTGFVYHCRACGFDLHPCCAKLPMVLD--  117

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                +L L                     + SC KCGKK     Y  +   Y+LH  C +
Sbjct  118  DGEVKLYLY-----------------RKVSASCHKCGKKGRSWCYRSSCKRYNLHVACVR  160

Query  929  EMM  937
            EM+
Sbjct  161  EML  163



>gb|EYU35258.1| hypothetical protein MIMGU_mgv1a025608mg, partial [Erythranthe 
guttata]
Length=300

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 73/175 (42%), Gaps = 23/175 (13%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H++H  H L  +  P+ F C GC   G+G  Y+C  C F LH+FCA  P S      H +
Sbjct  29   HTTHPGHLLKLVYDPDEFVCDGCDGLGSGSSYSCYPCGFNLHEFCATCP-STTESVFHPR  87

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPHAH  760
            H L   + P      +    CD+CG    G  + CR C F +HP C  L   +K P H H
Sbjct  88   HPLTLVNLPM-----VNNRVCDLCGDYVCGLFYTCRPCGFDVHPLCTQLPVHVKLPMHRH  142

Query  761  RLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
             LKL P                  A  +C  C +      Y C  C   +H  CA
Sbjct  143  SLKLKP-----------------GAVTACDLCDEDCTSWRYSCGNCQVDIHLECA  180



>ref|XP_004161619.1| PREDICTED: uncharacterized LOC101214603 [Cucumis sativus]
Length=238

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 81/184 (44%), Gaps = 24/184 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH KH L        F C GCKE G G RY C  C+F LH  CA+ P S  +HP
Sbjct  4    NEISHFSHPKHKLKFEYSESPFKCDGCKEVGIGSRYKCTICDFDLHMHCAI-PSSSISHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +    + G T   C+ C K   GF + C+AC F +HPCCA L   +   
Sbjct  63   FYTRCSFQFMSR----QPGNTPRYCNACEKDVNGFLYHCKACGFDLHPCCAKLPMAL--S  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                +L L    S                  SC KCG+K     Y  +   Y+LH  C K
Sbjct  117  DGEIKLYLYKKVSS-----------------SCHKCGRKGRSWSYRSSCKKYNLHVACVK  159

Query  929  EMMN  940
            EM+ 
Sbjct  160  EMLE  163



>ref|XP_006856165.1| hypothetical protein AMTR_s00059p00175720 [Amborella trichopoda]
 gb|ERN17632.1| hypothetical protein AMTR_s00059p00175720 [Amborella trichopoda]
Length=235

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 83/192 (43%), Gaps = 34/192 (18%)
 Frame = +2

Query  395  MVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLH  574
            MVH SH +H L        F C GCKE G G +Y C  C+F LH  CAL+   +  HP +
Sbjct  1    MVHPSHPQHKLKFEHTDIPFKCDGCKEAGIGSKYKCDICDFDLHLHCALASQDI-YHPFY  59

Query  575  GQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
             +    FH KP     G     C+ CGK   GF + C+ C + +HPCCA L       PH
Sbjct  60   RKCTFQFHQKP----PGELMRYCNACGKDVLGFVYHCKRCGYDLHPCCAKL-------PH  108

Query  755  AH-----RLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
            A      RL L    S                  SC KCG+K     Y      Y+LH  
Sbjct  109  ALDDGEIRLFLYRKVSS-----------------SCHKCGRKGPSWSYRSPCKKYNLHVS  151

Query  920  CAKEMMNGLQEN  955
            C KEM+  + + 
Sbjct  152  CVKEMLVEIWQE  163



>ref|XP_004145337.1| PREDICTED: uncharacterized protein LOC101210122 [Cucumis sativus]
 ref|XP_004153636.1| PREDICTED: uncharacterized protein LOC101214603 [Cucumis sativus]
 gb|KGN61774.1| hypothetical protein Csa_2G239390 [Cucumis sativus]
Length=238

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 81/184 (44%), Gaps = 24/184 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH KH L        F C GCKE G G RY C  C+F LH  CA+ P S  +HP
Sbjct  4    NEISHFSHPKHKLKFEYSESPFKCDGCKEVGIGSRYKCTICDFDLHMHCAI-PSSSISHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +    + G T   C+ C K   GF + C+AC F +HPCCA L   +   
Sbjct  63   FYTRCSFQFMSR----QPGNTPRYCNACEKDVNGFLYHCKACGFDLHPCCAKLPMAL--S  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                +L L    S                  SC KCG+K     Y  +   Y+LH  C K
Sbjct  117  DGEIKLYLYKKVSS-----------------SCHKCGRKGRSWSYRSSCKKYNLHVACVK  159

Query  929  EMMN  940
            EM+ 
Sbjct  160  EMLE  163



>gb|EYU35252.1| hypothetical protein MIMGU_mgv1a020442mg, partial [Erythranthe 
guttata]
Length=326

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 87/197 (44%), Gaps = 29/197 (15%)
 Frame = +2

Query  362  TSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCAL  541
            +SP+P      + H +  KHPL  + +P  F C+GC   G G RY C  C+  LH+FCA 
Sbjct  3    SSPKPT----IIRHFTDPKHPLYLVDIPSEFLCNGCSALGFGARYRCHACDVDLHEFCA-  57

Query  542  SPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA  721
            + PS+    LH +H L   + P      +    CD+CG    G  + C AC F +HP C 
Sbjct  58   TCPSVAQSALHPKHPLTLVNLP------VNDRFCDLCGDLVNGLFYACEACEFDVHPLCT  111

Query  722  MLSTEIKYPPH-AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTAC  898
             L   ++   H  H LKL P      G+PAA           C  C +      Y C AC
Sbjct  112  QLPLHVRLTQHPQHLLKLQP------GNPAA-----------CALCRQSCTAWRYRCDAC  154

Query  899  DYHLHAVCAKEMMNGLQ  949
               +H  C     +G Q
Sbjct  155  SLDIHLECVLAGDDGDQ  171



>gb|KEH40771.1| cysteine/histidine-rich C1 domain protein [Medicago truncatula]
Length=267

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 81/190 (43%), Gaps = 37/190 (19%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH KH L        F C GCKE G G RY+C  C++ LH  C++  PSL  HP
Sbjct  22   NEISHFSHQKHKLTFQHSEFPFKCDGCKEIGIGSRYSCNICDYDLHMHCSIPSPSL-FHP  80

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  KP     G     C+ C KS  GF + C +C F +HPCCA L       
Sbjct  81   FYPKCCFQFLSKP----PGDIPRYCNACEKSVTGFVYHCFSCGFDLHPCCAKL-------  129

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHA-------AAVSCGKCGKKRAGRVYGCTACDYH  907
                              P   D HG          + SC +CG+K     Y  +   Y+
Sbjct  130  ------------------PMILDDHGEVKLYLYRKVSSSCQRCGQKGRSWSYRSSCKKYN  171

Query  908  LHAVCAKEMM  937
            LH  C +EM+
Sbjct  172  LHVACVREMI  181



>ref|XP_010509273.1| PREDICTED: LOW QUALITY PROTEIN: diacylglycerol kinase theta-like 
[Camelina sativa]
Length=292

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 82/183 (45%), Gaps = 25/183 (14%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H +H  HPL E T    F C GCK YG+G  Y C+ CN+ LH++CA  P +L T  +H Q
Sbjct  13   HFTHV-HPLTEXTSIGDFICDGCKTYGSGTTYRCEPCNYDLHEYCATCPLTLPTF-IHPQ  70

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK---YPP  751
            H L    + +Q      R  CD+C +S +G  +RC+ C F +HP C  L   ++   +PP
Sbjct  71   HALNLVVRKQQSTRQNDRV-CDICDESVEGLFYRCKICEFDVHPLCTQLPQHVRHVLHPP  129

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
            H    +L                   A A  C  C        Y C  C + +H  C   
Sbjct  130  HHLEFRL-------------------AGASQCMVCHGPCQSWRYRCELCRFDIHMECILA  170

Query  932  MMN  940
            + N
Sbjct  171  VCN  173



>ref|XP_006493596.1| PREDICTED: uncharacterized protein LOC102622534 [Citrus sinensis]
Length=396

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 88/184 (48%), Gaps = 20/184 (11%)
 Frame = +2

Query  374  PNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPS  553
            P +G + + H +H  H L+E+     + C GCK  G+ KR+ C  C+F LH++C + P +
Sbjct  108  PLHGQKTIHHFTHPNHKLLEINDDNEYLCGGCKTPGSSKRFRCHGCDFDLHEYCGICPMT  167

Query  554  LNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLST  733
            L++  +H QHQL   ++  Q      R+ CDVCG S +G  +RC+ C F +HP C  L  
Sbjct  168  LSSF-MHPQHQLNLVNRIPQATRQNARS-CDVCGDSIEGLFYRCKLCEFDVHPVCTQLPP  225

Query  734  EIKYP-PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHL  910
            ++++    AH L L P SS                   C  C  +     Y C  C   +
Sbjct  226  QVRHVLDAAHPLTLQPFSSAW-----------------CMVCRNECTSWRYRCGICGVDI  268

Query  911  HAVC  922
            H  C
Sbjct  269  HLEC  272



>gb|KDP46202.1| hypothetical protein JCGZ_10042 [Jatropha curcas]
Length=246

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 82/182 (45%), Gaps = 24/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH++H L        F C GCKE G G RY C +C+F LH  CA+  PS+  HP 
Sbjct  5    EISHFSHSQHTLRFEYSEFPFKCDGCKEVGIGSRYKCSKCDFDLHMHCAIPSPSI-FHPF  63

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  +P     G     C+ C +   GF + C+ C F +HPCCA L T +    
Sbjct  64   YTKCSFQFLSRP----PGDKPRYCNACERDISGFLYHCKDCGFDLHPCCAKLPTVLD--D  117

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
               +L L                     + +C KCG+K     Y  +   Y+LH  C K+
Sbjct  118  GETKLYLY-----------------RKVSATCHKCGRKGRSWSYRSSCKKYNLHVACVKD  160

Query  932  MM  937
            M+
Sbjct  161  ML  162



>ref|XP_010658575.1| PREDICTED: uncharacterized protein LOC104881138 [Vitis vinifera]
Length=254

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 80/198 (40%), Gaps = 27/198 (14%)
 Frame = +2

Query  383  GGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT  562
            G  +  H SH +H L      + +TC GCKE G G R+ C+ C+F LH+ C   P    T
Sbjct  2    GATDRTHVSHPEHSLELKNYKKPYTCDGCKEPGFGSRHRCEACDFDLHEDCMF-PTETTT  60

Query  563  HPLHGQHQLLFHDKPKQVK------SGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAM  724
            H   G     F  +P   K          R  CD CGK+ KGF + C A    +HPCC  
Sbjct  61   HDFFGNAAFKFLLRPPNSKCKEKHCRNHGRTYCDACGKAVKGFVYHCAARDLDLHPCCRN  120

Query  725  LSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGK-KRAGRVYGCTACD  901
            L T++       RL+                      +  C  C +  R G  Y  +  D
Sbjct  121  LKTKMDINGEGFRLQ-------------------DKVSRRCNWCKEGSRVGWAYASSNED  161

Query  902  YHLHAVCAKEMMNGLQEN  955
            Y+ H  C  EMM    +N
Sbjct  162  YYFHVGCVPEMMLEAWQN  179



>ref|XP_006409477.1| hypothetical protein EUTSA_v10023200mg [Eutrema salsugineum]
 gb|ESQ50930.1| hypothetical protein EUTSA_v10023200mg [Eutrema salsugineum]
Length=242

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 92/209 (44%), Gaps = 31/209 (15%)
 Frame = +2

Query  392   EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYAC----QQCNFQLHDFCALSPPSLN  559
             E+ H SH +H L      + F C GC E G G RY C    Q C+F LH  CAL   S+ 
Sbjct  5     EISHFSHPQHNLKFDYTEKPFKCDGCNEVGIGSRYRCSKDHQGCDFDLHAHCALPSASI-  63

Query  560   THPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
             THP + +    F  +P     G  R  C+ C K   GF + C+AC F +HPCCAML   +
Sbjct  64    THPFYKKCSFQFLAQP----PGKERRYCNACEKDVSGFVYHCKACGFDLHPCCAMLPMVL  119

Query  740   KYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
                    +L L    S                  SC +CG+K     Y  +   Y+LH  
Sbjct  120   --DDGETKLFLYRKVSS-----------------SCHRCGRKGRSWSYRSSCKKYNLHVA  160

Query  920   CAKEMMNGLQENGINPPEKPSVLGTAVKI  1006
             C +EM   L +N     ++ ++  T  KI
Sbjct  161   CVREM---LVDNWRELYKEQNIKRTERKI  186



>ref|XP_006423152.1| hypothetical protein CICLE_v10029187mg [Citrus clementina]
 ref|XP_006479359.1| PREDICTED: uncharacterized protein LOC102616499 [Citrus sinensis]
 gb|ESR36392.1| hypothetical protein CICLE_v10029187mg [Citrus clementina]
 gb|KDO51403.1| hypothetical protein CISIN_1g026471mg [Citrus sinensis]
Length=238

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 81/183 (44%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+  PS+  HP
Sbjct  4    NEISHFSHPQHKLKFEYSEFPFKCDGCKEVGIGSRYKCSICDFDLHMHCAIPSPSI-CHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P     G     C+ C K   GF + C++C + +HPCCA L   +   
Sbjct  63   FYTKCSFQFFSRP----PGDKPRYCNACEKDVTGFVYHCKSCGYDLHPCCAKLPMVLD--  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                +L L    S                  SC KCG+K     Y  T  +Y+LH  C K
Sbjct  117  DGEVKLYLYRKVSS-----------------SCHKCGRKGRSWSYRSTCKNYNLHVACVK  159

Query  929  EMM  937
            EM+
Sbjct  160  EML  162



>emb|CAN78576.1| hypothetical protein VITISV_020584 [Vitis vinifera]
Length=240

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 81/182 (45%), Gaps = 24/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H  H +H L        F C GCKE G G ++ CQQC F LH  CA++PP++ THP 
Sbjct  4    EVSHPIHPQHKLKPEYTEIPFNCDGCKEAGIGLKHRCQQCEFDLHKSCAVAPPTI-THPF  62

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + + +  F  +P     G     CD CGK   GF + C+ C F +HPCCA L   +    
Sbjct  63   YKKCEFQFLHQP----PGAALRICDACGKDVLGFVYHCKRCGFDLHPCCANLPQVLNDGE  118

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
                L L                     + SC  CG K  G  Y      Y+LH  C K+
Sbjct  119  RNLYLCL-------------------KLSNSCYCCGGKGPGWSYRSKCKTYNLHVSCVKK  159

Query  932  MM  937
            ++
Sbjct  160  LL  161


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 60/137 (44%), Gaps = 27/137 (20%)
 Frame = +2

Query  560  THPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
            +HP+H QH+L    KP+  +       CD C ++  G   RC+ C F +H  CA+    I
Sbjct  6    SHPIHPQHKL----KPEYTEIPFN---CDGCKEAGIGLKHRCQQCEFDLHKSCAVAPPTI  58

Query  740  KYPPHAH-RLKLL--PPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHL  910
             +P +     + L  PP + L+                C  CGK   G VY C  C + L
Sbjct  59   THPFYKKCEFQFLHQPPGAALR---------------ICDACGKDVLGFVYHCKRCGFDL  103

Query  911  HAVCAK--EMMNGLQEN  955
            H  CA   +++N  + N
Sbjct  104  HPCCANLPQVLNDGERN  120



>ref|XP_010517057.1| PREDICTED: diacylglycerol kinase theta [Camelina sativa]
Length=293

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 78/177 (44%), Gaps = 24/177 (14%)
 Frame = +2

Query  419  HPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFH  598
            HPL E      F C GCK YG+G  Y C+ CN+ LH++CA  P +L T  +H QH L   
Sbjct  18   HPLTEFNSIGDFICDGCKTYGSGTTYRCEPCNYDLHEYCATCPLTLPTF-IHPQHALSLV  76

Query  599  DKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK---YPPHAHRLK  769
             + +Q      R  CD+C +S +G  +RC+ C F +HP C  L   ++   +PPH    +
Sbjct  77   VRKQQSTRQNDRV-CDICDESVEGLFYRCKICEFDVHPLCTQLPQHVRHVLHPPHHLEFR  135

Query  770  LLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEMMN  940
            L                   A A  C  C        Y C  C + +H  C   + N
Sbjct  136  L-------------------AGASQCMVCHGPCQSWRYRCELCRFDIHMECILAVCN  173



>ref|XP_002283292.1| PREDICTED: uncharacterized protein LOC100257225 [Vitis vinifera]
Length=240

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 81/182 (45%), Gaps = 24/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H  H +H L        F C GCKE G G ++ CQQC F LH  CA++PP++ THP 
Sbjct  4    EVSHPIHPQHKLKPEYTEIPFNCDGCKEAGIGLKHRCQQCEFDLHKSCAVAPPTI-THPF  62

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + + +  F  +P     G     CD CGK   GF + C+ C F +HPCCA L   +    
Sbjct  63   YKKCEFQFLHQP----PGAALRICDACGKDVLGFVYHCKRCGFDLHPCCANLPQVLNDGE  118

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
                L L                     + SC  CG K  G  Y      Y+LH  C K+
Sbjct  119  RNLYLCL-------------------KLSNSCYCCGGKGPGWSYRSKCKTYNLHVSCVKK  159

Query  932  MM  937
            ++
Sbjct  160  LL  161


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 60/137 (44%), Gaps = 27/137 (20%)
 Frame = +2

Query  560  THPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
            +HP+H QH+L    KP+  +       CD C ++  G   RC+ C F +H  CA+    I
Sbjct  6    SHPIHPQHKL----KPEYTEIPFN---CDGCKEAGIGLKHRCQQCEFDLHKSCAVAPPTI  58

Query  740  KYPPHAH-RLKLL--PPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHL  910
             +P +     + L  PP + L+                C  CGK   G VY C  C + L
Sbjct  59   THPFYKKCEFQFLHQPPGAALR---------------ICDACGKDVLGFVYHCKRCGFDL  103

Query  911  HAVCAK--EMMNGLQEN  955
            H  CA   +++N  + N
Sbjct  104  HPCCANLPQVLNDGERN  120



>ref|XP_007200406.1| hypothetical protein PRUPE_ppa010933mg [Prunus persica]
 gb|EMJ01605.1| hypothetical protein PRUPE_ppa010933mg [Prunus persica]
Length=229

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 80/183 (44%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+  PS+  HP
Sbjct  4    NEISHFSHPQHKLKFEYTEIPFKCDGCKEVGIGSRYKCAMCDFDLHMHCAMPSPSI-FHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P     G     C+ C K   GFT+ C +C F +HPCCA L   +   
Sbjct  63   FYTKCSFQFFSRP----PGNNPRFCNACEKDITGFTYHCTSCGFDLHPCCAKLPMVL---  115

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
             +   +KL                     + SC KCG+K     Y      Y+LH  C K
Sbjct  116  -NDGEVKLYLYRK---------------VSSSCHKCGRKGRSWSYRSKCKKYNLHVACVK  159

Query  929  EMM  937
            EM+
Sbjct  160  EML  162



>ref|XP_004230849.1| PREDICTED: uncharacterized protein LOC101260772 [Solanum lycopersicum]
Length=248

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 82/188 (44%), Gaps = 32/188 (17%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY C  C++ LH  CA+  PS+ THP
Sbjct  4    NEIAHFSHPQHKLRYEYSEFPFKCDGCKEVGIGSRYKCTICDYDLHMHCAIPSPSI-THP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P     G     C+ C K   GF + CR+C F +HPCCA L   +   
Sbjct  63   FYTKCSFQFLSRP----PGNVPRYCNACEKDINGFMYHCRSCGFDLHPCCAKLPMVLD--  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGH---AAAVSCGKCGKKRAGR--VYGCTACDYHLH  913
                                 GD   +     + +C +CG+K   R   Y  T   Y+LH
Sbjct  117  --------------------DGDVKLYLYRKISATCHRCGRKGRNRSWSYRSTCKKYNLH  156

Query  914  AVCAKEMM  937
              C KEM+
Sbjct  157  VACVKEML  164



>ref|XP_008448154.1| PREDICTED: uncharacterized protein LOC103490439 [Cucumis melo]
Length=239

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 77/183 (42%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H  H +H L        + C GCKE G G +Y CQQC F LH  CA+  P + THP
Sbjct  5    REITHPMHPRHKLRLEYTEIPYNCDGCKEAGIGYKYKCQQCGFNLHKVCAVGAPRI-THP  63

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + + +   +  P     G  +  CD C     GF + C +C F +HPCCA L   +   
Sbjct  64   FYEKCEFKLYYYP----PGKGKRVCDACRTYVHGFVYHCNSCDFDLHPCCANLPQVLD--  117

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
               H L L    S L                 C  CG K  G  Y      Y+LH  C K
Sbjct  118  DGKHNLYLCNKLSSL-----------------CHSCGGKGLGWSYRSQCKTYNLHLSCVK  160

Query  929  EMM  937
            EM+
Sbjct  161  EML  163



>ref|XP_007200363.1| hypothetical protein PRUPE_ppa010622mg [Prunus persica]
 gb|EMJ01562.1| hypothetical protein PRUPE_ppa010622mg [Prunus persica]
Length=242

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 85/185 (46%), Gaps = 28/185 (15%)
 Frame = +2

Query  389  EEMVHSSHAKHPL-VEMT-LPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT  562
            +E+ H  H +H L +E T +P  F C GCKE G G +Y CQ+C F LH  CA++ P+++ 
Sbjct  5    KEISHPIHLQHKLKIEYTEIP--FYCDGCKEPGIGLKYKCQKCEFDLHKACAVAAPNIH-  61

Query  563  HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
            HP + + +  F   P     G  R  CD C K   GF + C  C F +HPCCA L   + 
Sbjct  62   HPFYNKCEFHFLHNP----PGAARRVCDACRKDVLGFVYHCWKCDFDLHPCCANLPQVLD  117

Query  743  YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
               H   L L   S                    C +CG K  G  Y      Y+LH  C
Sbjct  118  DGEHNLYLCLKLSS-------------------PCHRCGGKGPGWSYRSDCKTYNLHVSC  158

Query  923  AKEMM  937
             KE++
Sbjct  159  VKELL  163



>ref|XP_002284701.2| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100264105 
[Vitis vinifera]
Length=427

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 80/182 (44%), Gaps = 24/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L    +   F C GCKE G G RY C  C++ LH  CAL  PS+ THP 
Sbjct  5    EIPHFSHPQHKLKFEYIELPFKCDGCKEAGIGSRYKCSICDYDLHTHCALPSPSI-THPF  63

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  +P     G     C+ C K   GF + C +C F +HPCCA L   +    
Sbjct  64   YTKCSFQFLPRP----PGDAARFCNACEKDINGFLYHCNSCGFDLHPCCARLPMVLD--D  117

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
               +L L                     + SC +CG+K     Y      Y+LH  C KE
Sbjct  118  GEMKLYLY-----------------RKVSASCDRCGRKGRSWSYRSKCKKYNLHVACVKE  160

Query  932  MM  937
            M+
Sbjct  161  ML  162



>ref|XP_010028546.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104418804 
[Eucalyptus grandis]
Length=443

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 80/182 (44%), Gaps = 23/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L        F C GCKE G G RY+C  CNF LH  CA+ P +  +HP 
Sbjct  5    EISHFSHPQHILKFEYTEFPFKCDGCKEIGIGSRYSCAACNFDLHSHCAI-PSATISHPF  63

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  +P           C+ C K   GF + CRAC F +HPCCA L   +    
Sbjct  64   YPKCSFQFMSRPPTEDGP---RYCNACEKDVTGFVYHCRACGFDLHPCCAKLPMVLD--D  118

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
               +L L                     + SC KCGKK     Y  +   Y+LH  C +E
Sbjct  119  GEVKLYLY-----------------RKVSASCHKCGKKGRSWCYRSSCKRYNLHVACVRE  161

Query  932  MM  937
            M+
Sbjct  162  ML  163



>ref|XP_006365493.1| PREDICTED: uncharacterized protein LOC102590985 [Solanum tuberosum]
Length=251

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 82/185 (44%), Gaps = 26/185 (14%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY C  C++ LH  CA+  PS+ THP
Sbjct  4    NEIAHFSHPQHKLRYEYSEFPFKCDGCKEVGIGSRYKCTICDYDLHMHCAIPSPSI-THP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P     G     C+ C K   GF + CR+C F +HPCCA L   +   
Sbjct  63   FYTKCSFQFLSRP----PGNVPRYCNACEKDITGFMYHCRSCGFDLHPCCAKLPMVLD--  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGR--VYGCTACDYHLHAVC  922
                +L L    S                  +C +CG+K   R   Y  T   Y+LH  C
Sbjct  117  DGDVKLYLFRKVSA-----------------TCHRCGRKGRNRSWSYRSTCKKYNLHVAC  159

Query  923  AKEMM  937
             KEM+
Sbjct  160  VKEML  164



>ref|XP_008236736.1| PREDICTED: uncharacterized protein LOC103335502 [Prunus mume]
Length=242

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 79/183 (43%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+  PS+  HP
Sbjct  4    NEISHFSHPQHKLKFEYTEIPFKCDGCKEVGIGSRYKCAMCDFDLHMHCAIPSPSI-FHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P     G     C+ C K   GFT+ C +C F +HPCCA L   +   
Sbjct  63   FYTKCSFQFFSRP----PGNNPRYCNACEKDITGFTYHCTSCGFDLHPCCAKLPMVLD--  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                +L L    S                  SC +CG+K     Y      Y+LH  C K
Sbjct  117  DGEVKLYLYRKVSS-----------------SCHRCGRKGRSWSYRSKCKKYNLHVACVK  159

Query  929  EMM  937
            EM+
Sbjct  160  EML  162



>ref|XP_009375313.1| PREDICTED: uncharacterized protein LOC103964141 [Pyrus x bretschneideri]
 ref|XP_009345789.1| PREDICTED: uncharacterized protein LOC103937568 [Pyrus x bretschneideri]
Length=243

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 84/184 (46%), Gaps = 26/184 (14%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPEL-FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTH  565
             E+ H SH +H L +    E+ F C GCKE G G RY C  C+F LH  CA+  PS+  H
Sbjct  4    NEISHFSHPQHKL-KFEYSEIPFNCDGCKEVGIGSRYKCATCDFDLHMHCAIPTPSI-FH  61

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P + +    F  +P     G +   C+ C K   GF + C++C F +HPCCA L   +  
Sbjct  62   PFYTKCSFQFLSRP----PGDSPRFCNACEKDITGFVYHCKSCGFDLHPCCAKLPMVLD-  116

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
                 +L L    S                  SC +CG+K     Y     +Y+LH  C 
Sbjct  117  -DGEVKLYLYRKVSS-----------------SCHRCGRKGRSWSYRSKCKEYNLHVACV  158

Query  926  KEMM  937
            KEM+
Sbjct  159  KEML  162



>ref|XP_010910408.1| PREDICTED: uncharacterized protein LOC105036333 [Elaeis guineensis]
Length=240

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 79/183 (43%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            +E+ H SH +H L        F C GCKE G G +Y C  C+F LH  CAL+ PS+ +H 
Sbjct  5    KELFHPSHPQHKLKSEYTEIPFRCDGCKEAGIGLKYKCDACDFDLHKACALA-PSMISHH  63

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + + +  F+ KP     G     CD C K   GF + C  C F +HPCCA L   +   
Sbjct  64   FYKKCEFRFYSKP----PGPVMRVCDACRKDVLGFVYHCMRCDFDLHPCCANLPHCLDDG  119

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                 L L   S                    C +CG K  G  Y     +Y LH  C K
Sbjct  120  ERNFYLSLRVSS-------------------ICLRCGGKGLGWSYRSDCKNYTLHVSCVK  160

Query  929  EMM  937
            E++
Sbjct  161  ELL  163



>emb|CDY67825.1| BnaCnng56590D [Brassica napus]
Length=166

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 68/126 (54%), Gaps = 12/126 (10%)
 Frame = +2

Query  365  SPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALS  544
            SP P N  + + H +H  HPL ++     + C GCK YG+G+ Y C  CN+ LH+FCA  
Sbjct  2    SPLPLNAEQVLQHFTHI-HPLTKVDGVGTYICDGCKTYGSGRTYRCAACNYDLHEFCAKC  60

Query  545  PPSLNTHPLHGQHQL-LFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA  721
            PP++ +  LH  H+L L H           R  CD+C +S  G  ++C+ C F +HP C 
Sbjct  61   PPTVLS-TLHPHHELRLVHQD---------RRACDICKESINGLFYQCKICGFDVHPLCT  110

Query  722  MLSTEI  739
             L  E+
Sbjct  111  QLPKEV  116



>ref|XP_008235838.1| PREDICTED: uncharacterized protein LOC103334641 [Prunus mume]
Length=243

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 85/185 (46%), Gaps = 28/185 (15%)
 Frame = +2

Query  389  EEMVHSSHAKHPL-VEMT-LPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT  562
            +E+ H  H +H L +E T +P  F C GCKE G G +Y CQ+C F LH  CA++ P+++ 
Sbjct  5    KEISHPIHLQHKLKIEYTEIP--FYCDGCKEPGIGLKYKCQKCEFDLHKACAVAAPNIH-  61

Query  563  HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
            HP + + +  F   P     G  R  CD C K   GF + C  C F +HPCCA L   + 
Sbjct  62   HPYYNKCEFQFLYNP----PGAARRVCDACRKDVLGFVYHCWKCDFDLHPCCANLPKVLD  117

Query  743  YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
               H   L L   S                    C +CG K  G  Y      Y+LH  C
Sbjct  118  DGEHNLYLCLKLSS-------------------PCHRCGGKGPGWSYRSDCKTYNLHVSC  158

Query  923  AKEMM  937
             KE++
Sbjct  159  VKELL  163



>ref|XP_004139981.1| PREDICTED: uncharacterized protein LOC101214474 [Cucumis sativus]
 gb|KGN46638.1| hypothetical protein Csa_6G117200 [Cucumis sativus]
Length=239

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 80/184 (43%), Gaps = 26/184 (14%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPEL-FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTH  565
             E+ H  H +H L  +   E+ + C GCKE G G +Y CQQC F LH  CA+  P + TH
Sbjct  5    REITHLMHPRHKL-RLEYTEIPYNCDGCKEAGIGYKYKCQQCGFNLHKVCAVGAPRI-TH  62

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P + + +   +  P     G  +  CD C     GF + C +C F +HPCCA L   +  
Sbjct  63   PFYEKCEFKLYYYP----PGKGKRVCDACRTYVHGFVYHCNSCDFDLHPCCANLPQVLD-  117

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
                H L L    S                  SC  CG K  G  Y      Y+LH  C 
Sbjct  118  -DGKHNLYLCNKLSS-----------------SCHSCGGKGLGWSYRSQCKTYNLHLSCV  159

Query  926  KEMM  937
            KEM+
Sbjct  160  KEML  163



>emb|CDO97102.1| unnamed protein product [Coffea canephora]
Length=238

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 79/183 (43%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY C  C++ LH  CAL P S  THP
Sbjct  4    NEIPHFSHPQHKLKFEYTEVPFKCDGCKEVGIGSRYKCSICDYDLHMHCAL-PSSSITHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P     G     C+ C K   GF + C++C F +HPCCA L   +   
Sbjct  63   FYTKCSFQFLPRP----PGNIPRYCNACEKDVTGFVYHCKSCGFDLHPCCAKLPMALD--  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                +L L                       SC +CG+K     Y  T   Y+LH  C K
Sbjct  117  DGEVKLYLY-----------------RKVGASCHRCGRKGRSWNYRSTCKKYNLHVACVK  159

Query  929  EMM  937
            EM+
Sbjct  160  EML  162



>ref|XP_006846382.1| hypothetical protein AMTR_s00012p00263580 [Amborella trichopoda]
 gb|ERN08057.1| hypothetical protein AMTR_s00012p00263580 [Amborella trichopoda]
Length=263

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 88/196 (45%), Gaps = 16/196 (8%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            + ++H SH  H + E+ +   F C+GCK  G G RY C  C+F LH  C   P +L    
Sbjct  6    KSILHLSHPSHYVHEVYMASEFLCNGCKTLGFGTRYRCGSCDFDLHPHCTTCPRTLPPSY  65

Query  569  LHGQHQL-LFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            +H  H + L   K   ++      +CDVCG    G  +RC  C F  HP C+ L   +++
Sbjct  66   IHPNHSMELVMRKAAGIRQ--NHRQCDVCGDQVLGLFYRCALCDFDSHPICSKLPCNVQH  123

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVS-CGKCGKKRAGRVYGCTACDYHLHAVC  922
              H H LKLLP        P      G+A   S C  CG   +   Y C  C  +LH  C
Sbjct  124  NGHPHVLKLLP-------KPVVN---GYAQNSSFCFVCGGVCSLWCYQCLPCGANLHLTC  173

Query  923  AKEMMNGLQENGINPP  970
                +    E+ + PP
Sbjct  174  VLTPVE--DESQVFPP  187



>ref|XP_008459265.1| PREDICTED: uncharacterized protein LOC103498438 [Cucumis melo]
Length=238

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 81/183 (44%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+ P S  +HP
Sbjct  4    NEISHFSHPQHKLKFEYSESPFKCDGCKEVGIGCRYKCTICDFDLHMHCAI-PSSSISHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +    + G T   C+ C K   GF + C+AC F +HPCCA L   +   
Sbjct  63   FYTRCSFQFMSR----QPGNTPRYCNACEKDVNGFLYHCKACGFDLHPCCAKLPMALN--  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                +L L    S                  SC KCG+K     Y  +   Y+LH  C K
Sbjct  117  DGEIKLYLYKKVSS-----------------SCHKCGRKGRSWSYRSSCKKYNLHVACVK  159

Query  929  EMM  937
            EM+
Sbjct  160  EML  162



>ref|XP_010489188.1| PREDICTED: uncharacterized protein LOC104766915 [Camelina sativa]
Length=243

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 83/187 (44%), Gaps = 29/187 (16%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ-----CNFQLHDFCALSPPSL  556
            E+ H SH +H L      + F C GC E G G RY C +     C+F LH  CAL   S+
Sbjct  5    EISHFSHPQHNLKFDYTEKPFKCDGCNEVGIGSRYRCSRDDHGSCDFDLHAHCALPSASI  64

Query  557  NTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTE  736
             THP + +    F  +P     G  R  C+ C K   GF + C+AC F +HPCCAML   
Sbjct  65   -THPFYKKCTFQFLAQP----PGNERRYCNACEKDVSGFVYHCKACGFDLHPCCAMLPMV  119

Query  737  IKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
            +       +L L    S                  SC +CG+K     Y  +   Y+LH 
Sbjct  120  L--DDGETKLFLYRKVSS-----------------SCHRCGRKGRSWSYRSSCKKYNLHV  160

Query  917  VCAKEMM  937
             C +EM+
Sbjct  161  ACVREML  167



>ref|XP_006410974.1| hypothetical protein EUTSA_v10017138mg [Eutrema salsugineum]
 gb|ESQ52427.1| hypothetical protein EUTSA_v10017138mg [Eutrema salsugineum]
Length=250

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 68/120 (57%), Gaps = 5/120 (4%)
 Frame = +2

Query  419  HPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQL-LF  595
            HPL +      FTC+GCK YG GK Y C  C++ LHD CA  PP+L +  +H QH+L L 
Sbjct  15   HPLTKFDGYGEFTCNGCKTYGFGKTYRCSWCDYNLHDHCATCPPTLLSF-MHPQHELRLV  73

Query  596  HDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-AHRLKL  772
               P+Q      +  CD+C +S +G  ++C  C F +HP C  L   +++ PH AH L L
Sbjct  74   FRGPEQTHH--DKRMCDICDESAEGLFYQCEPCGFDVHPLCTWLPQHVRHVPHQAHLLDL  131



>emb|CDX71255.1| BnaC07g05340D [Brassica napus]
Length=175

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 63/117 (54%), Gaps = 11/117 (9%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYAC----QQCNFQLHDFCALSPPSLN  559
            E+ H SH KH L    + + F C GC E G G RY C    Q C+F LH  CAL  PS N
Sbjct  5    EISHFSHPKHNLKYDYIEKPFKCDGCNEVGIGSRYRCSSDHQSCDFDLHAHCAL--PSAN  62

Query  560  -THPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAML  727
             THP + + +  F  KP     G  R  C+ C K   GF + CRAC F +HPCCAML
Sbjct  63   ITHPFYKKCKFQFLAKP----PGNERRYCNACQKDVSGFVYHCRACGFDLHPCCAML  115



>ref|XP_010690962.1| PREDICTED: uncharacterized protein LOC104904417 [Beta vulgaris 
subsp. vulgaris]
Length=255

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 85/187 (45%), Gaps = 32/187 (17%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPEL-FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTH  565
             E+ H SH KH L ++ L E+ F C GCKE G G  Y C  C++ LH  CA+  P +  H
Sbjct  4    NEISHYSHPKHNL-KIDLTEVPFKCDGCKEIGIGSCYKCNLCDYDLHMHCAIPTPVI-YH  61

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P + +   +F  KP     G     C+ C +   GF++ C +C F +HPCCA L T +  
Sbjct  62   PFYPKCTFVFVSKP----PGNVPRYCNACERGVSGFSYHCNSCGFDLHPCCAKLPTALD-  116

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGH---AAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
                                  GD   +     + SC +CG+K     Y  +   Y+LH 
Sbjct  117  ---------------------DGDIKMYLYRKVSASCDRCGRKGRSWSYRSSDKKYNLHV  155

Query  917  VCAKEMM  937
             C K+M+
Sbjct  156  ACVKDML  162



>ref|XP_010274284.1| PREDICTED: uncharacterized protein LOC104609609 [Nelumbo nucifera]
Length=230

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 78/176 (44%), Gaps = 17/176 (10%)
 Frame = +2

Query  398  VHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHG  577
            +H     H LVE+ LP+ F C+GC+  G G RY C  C+F LH +C+  P +L  H +H 
Sbjct  11   LHHVLHDHVLVEVFLPQEFRCNGCRTLGIGLRYRCHGCDFDLHLYCSTCPMTLPCH-MHS  69

Query  578  QHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPHA  757
             H L    +P+ +        C+VC  S +G  + C  C F  HP C  L + +K+  H 
Sbjct  70   DHPLSLLRQPQGLMMQGNGRLCNVCRDSLQGIFYACPLCDFDAHPICTQLPSTVKHAVHP  129

Query  758  HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
              +  L P     G P            +C  CG       YGC  C  HLH  C 
Sbjct  130  QHILSLQP-----GGPN-----------NCSICGFACNYWRYGCAYCHVHLHFECV  169



>ref|XP_010270608.1| PREDICTED: uncharacterized protein LOC104606891 [Nelumbo nucifera]
Length=241

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 83/184 (45%), Gaps = 26/184 (14%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPEL-FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTH  565
            +EM H SH +H L ++   E+ F C GCKE G G +Y CQQC F LH  CA + P L  H
Sbjct  5    KEMPHPSHPQHKL-QLEYTEIPFNCDGCKEAGIGLKYRCQQCEFDLHKACAQA-PQLMVH  62

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P + + +   + +P     G     CD C     GF + C  C F +HPCCA L   +  
Sbjct  63   PFYKKCEFRLYHRP----PGTLARICDACRNDVVGFVYHCEGCGFDLHPCCANLPQVL--  116

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
                          G +    +        + SC +CG K  G  Y     +Y+LH  C 
Sbjct  117  ------------DDGERNLYLSL-----KLSSSCHRCGGKGPGWSYRSECKNYNLHVSCV  159

Query  926  KEMM  937
            KE++
Sbjct  160  KELL  163



>ref|XP_002519112.1| protein binding protein, putative [Ricinus communis]
 gb|EEF43323.1| protein binding protein, putative [Ricinus communis]
Length=262

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 80/182 (44%), Gaps = 24/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +HPL        F C GCKE G G RY C +C+F LH  CA+ P +   HP 
Sbjct  5    EISHFSHPQHPLKFEYSESPFKCDGCKEVGIGSRYKCTKCDFDLHMHCAI-PSATIYHPF  63

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  +P     G     C+ C +   GF + C+ C F +HPCCA L   +    
Sbjct  64   YTKCSFQFLSRP----PGDKPRYCNACERDVSGFVYHCKDCGFDLHPCCAKLPMVLD---  116

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
                +KL                     + +C KCG+K     Y  +   Y+LH  C K+
Sbjct  117  -DGEVKLYLYRK---------------VSATCHKCGRKGRSWSYRSSCKKYNLHVACVKD  160

Query  932  MM  937
            M+
Sbjct  161  ML  162



>gb|KEH30369.1| cysteine/histidine-rich C1 domain protein [Medicago truncatula]
Length=246

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 85/194 (44%), Gaps = 33/194 (17%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH KH L        F C GCKE G G RY C  C++ LH  CA+ P +   HP 
Sbjct  5    EISHFSHPKHKLRFEHNEFPFKCDGCKEIGIGSRYKCSICDYDLHTHCAI-PSTTLFHPF  63

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA---MLSTEIK  742
            + +    F     Q+  G T   C+ C K   GF + C++C F +HPCCA   M+  + +
Sbjct  64   YTKCTFQF----MQIPPGNTLRYCNACEKDVNGFVYHCKSCGFDLHPCCAKLPMVLNDGE  119

Query  743  YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
               + HR K+  P                     C +CG+K     Y      Y+LH  C
Sbjct  120  MKLYLHR-KVSSP---------------------CHRCGRKGRSWSYRSNCKSYNLHVAC  157

Query  923  AKEMMNGLQENGIN  964
             +EM   L EN  N
Sbjct  158  VREM---LVENWYN  168



>ref|XP_006410973.1| hypothetical protein EUTSA_v10017531mg [Eutrema salsugineum]
 gb|ESQ52426.1| hypothetical protein EUTSA_v10017531mg [Eutrema salsugineum]
Length=235

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 90/195 (46%), Gaps = 33/195 (17%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLN--THPLH  574
            H +H  HPL E+ +   F C GCK YG+ K Y C+ CN+ LH++CA  P +L   THP  
Sbjct  13   HFTH-NHPLTELNIACDFICDGCKTYGSDKTYRCEPCNYDLHEYCATCPFTLQNFTHP--  69

Query  575  GQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
             QH++    + +  +       CD+C +S +G  +RC+ C F +HP C  L   +++  H
Sbjct  70   -QHEISLFRQKQSTRQN--ERVCDICNESVEGLFYRCKLCEFDVHPLCTQLPQHVRHVLH  126

Query  755  -AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSC-GKCGKKRAGRVYGCTACDYHLH-----  913
             AH L+                  G +  + C G C   R    Y C  C + +H     
Sbjct  127  PAHHLEF--------------RLGGESTCMVCQGSCQSWR----YRCELCKFDIHIECIL  168

Query  914  AVCAKEMMNGLQENG  958
            AVC     N   E+G
Sbjct  169  AVCNTSPSNQTDESG  183



>gb|KHN25342.1| hypothetical protein glysoja_010259 [Glycine soja]
Length=238

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 80/182 (44%), Gaps = 23/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+       HP 
Sbjct  5    EISHFSHPQHKLRFEYSEFPFKCDGCKEVGIGSRYKCSICDFDLHMHCAMITSPTLLHPF  64

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  KP     G T   C+ C K  +GF + C+AC F +HPCCA L   +    
Sbjct  65   YTKCNFQFMSKP----PGDTPRYCNACEKDVRGFLYHCKACGFDLHPCCAKLPMVLD--D  118

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
               +L L    S    SP             C +CG+K     Y     +Y+LH  C ++
Sbjct  119  GEVKLYLYRKVS----SP-------------CHRCGRKGRSWSYRSKCKNYNLHVACVRD  161

Query  932  MM  937
            M+
Sbjct  162  ML  163



>ref|XP_004144568.1| PREDICTED: uncharacterized protein LOC101218937 [Cucumis sativus]
 ref|XP_004162883.1| PREDICTED: uncharacterized LOC101218937 [Cucumis sativus]
 gb|KGN43378.1| hypothetical protein Csa_7G029430 [Cucumis sativus]
Length=239

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 84/206 (41%), Gaps = 24/206 (12%)
 Frame = +2

Query  389   EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             +EM H  H  H L        F CSGC E G G  Y C QC+F LH  CA++ P + THP
Sbjct  5     KEMFHPIHPWHKLKLNHTDTPFNCSGCHEAGIGFNYQCLQCDFTLHKLCAMAHPKI-THP  63

Query  569   LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
              + +    F+  P     G     CD C     GF + C+ C F +HPCCA L   +   
Sbjct  64    FYPKCTFEFYSSP----PGACARYCDACRNDVSGFVYHCKRCGFDLHPCCANLPQVLDDG  119

Query  749   PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                  L L      L G               C +CG K  G  Y     +Y+LH  C K
Sbjct  120   ERNLYLSL-----KLSG--------------PCHRCGGKGPGWSYKSKCRNYNLHLSCVK  160

Query  929   EMMNGLQENGINPPEKPSVLGTAVKI  1006
             E++    +      +K  V+    +I
Sbjct  161   ELLVESWQAMYLKVDKNKVIEVQTRI  186



>ref|XP_010999501.1| PREDICTED: uncharacterized protein LOC105107312 [Populus euphratica]
Length=236

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 82/187 (44%), Gaps = 34/187 (18%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+S P+  +H  
Sbjct  5    EITHDSHPQHRLRSEHSEFPFKCDGCKEVGIGSRYKCTMCDFDLHMQCAISSPAF-SHSF  63

Query  572  HGQ--HQLLFH---DKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTE  736
            + +   Q LF    DKP+          C+ C +   GF + C+ C F +HPCCA L   
Sbjct  64   YTKCSFQFLFRPPGDKPRL---------CNACEREVTGFLYHCKDCGFDLHPCCAKLPMV  114

Query  737  IKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
            +       +L L    S                  SC KCG+K     Y  +   Y+LH 
Sbjct  115  L--DDGEIKLYLYKKVSA-----------------SCQKCGRKGRSWSYRSSCKKYNLHV  155

Query  917  VCAKEMM  937
             C K+M+
Sbjct  156  ACVKDML  162



>ref|XP_004498185.1| PREDICTED: uncharacterized protein LOC101491038 [Cicer arietinum]
Length=263

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 80/199 (40%), Gaps = 37/199 (19%)
 Frame = +2

Query  362  TSPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCAL  541
            T+        E+ H SH KH L        F C GCKE G G RY C  C++ LH  C++
Sbjct  13   TTVNTTKRYNEISHFSHPKHKLTFQYSEFPFKCDGCKEIGIGSRYNCTICDYDLHMHCSI  72

Query  542  SPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA  721
              PSL  HP + +    F  KP     G     C+ C K   GF + C +C F +HPCCA
Sbjct  73   PSPSL-FHPFYPKCTFQFLSKP----PGDIPRYCNACEKGVTGFVYHCFSCGFDLHPCCA  127

Query  722  MLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHA-------AAVSCGKCGKKRAGRV  880
             L                         P   D H           + SC +CG+K     
Sbjct  128  KL-------------------------PMILDDHSEVKLYLYRKVSSSCQRCGQKGRSWS  162

Query  881  YGCTACDYHLHAVCAKEMM  937
            Y  +   Y+LH  C +EM+
Sbjct  163  YRSSCKKYNLHVACVREMI  181



>ref|XP_009798303.1| PREDICTED: uncharacterized protein LOC104244556 [Nicotiana sylvestris]
Length=250

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 80/183 (44%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY C  C++ LH  CA+   S+ THP
Sbjct  4    NEIYHFSHPQHKLRFEYSEFPFKCDGCKEVGIGSRYKCTTCDYDLHMHCAIPSASI-THP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P     G     C+ C K   GF + C++C F +HPCCA L   +   
Sbjct  63   FYKKCSFQFLSRP----PGNVPRYCNACEKDITGFLYHCKSCGFDLHPCCAKLPMVLD--  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                +L L    S                  SC +CG+K     Y  T   Y+LH  C K
Sbjct  117  DGEVKLYLYRKVSA-----------------SCHRCGRKGRSWSYRSTCKKYNLHVACVK  159

Query  929  EMM  937
            EM+
Sbjct  160  EML  162



>ref|XP_010505377.1| PREDICTED: diacylglycerol kinase theta-like [Camelina sativa]
Length=293

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 77/177 (44%), Gaps = 24/177 (14%)
 Frame = +2

Query  419  HPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFH  598
            HPL E      F C GCK YG+G  Y C+ CN+ LH++CA  P +  T  +H QH L   
Sbjct  18   HPLTEFNSIGDFICDGCKTYGSGTTYRCEPCNYDLHEYCATCPLTFPTF-IHPQHALNLV  76

Query  599  DKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK---YPPHAHRLK  769
             + +Q      R  CD+C +S +G  +RC+ C F +HP C  L   ++   +PPH    +
Sbjct  77   VRKQQSTRQNDRV-CDICDESVEGLFYRCKLCEFDVHPLCTQLPQHVRHVLHPPHHVEFR  135

Query  770  LLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEMMN  940
                                A A  C  C  +     Y C  C + +H  C   + N
Sbjct  136  -------------------QAGASQCMVCHGRCQSWRYRCELCRFDIHMECILAVCN  173



>ref|XP_003541098.2| PREDICTED: uncharacterized protein LOC100790779 [Glycine max]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 80/182 (44%), Gaps = 23/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+       HP 
Sbjct  29   EISHFSHPQHKLRFEYSEFPFKCDGCKEVGIGSRYKCSICDFDLHMHCAMITSPTLLHPF  88

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  KP     G T   C+ C K  +GF + C+AC F +HPCCA L   +    
Sbjct  89   YTKCNFQFMSKP----PGDTPRYCNACEKDVRGFLYHCKACGFDLHPCCAKLPMVLD--D  142

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
               +L L    S    SP             C +CG+K     Y     +Y+LH  C ++
Sbjct  143  GEVKLYLYRKVS----SP-------------CHRCGRKGRSWSYRSKCKNYNLHVACVRD  185

Query  932  MM  937
            M+
Sbjct  186  ML  187



>ref|XP_006341197.1| PREDICTED: uncharacterized protein LOC102604803 [Solanum tuberosum]
Length=266

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 87/188 (46%), Gaps = 20/188 (11%)
 Frame = +2

Query  365  SPQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALS  544
            SP P N    + H +H KH L        ++C GCK  G GKRY C +C+F LH++C   
Sbjct  2    SPLPRN---TIQHFTHPKHSLTLFDSNTKYSCDGCKILGIGKRYHCSKCDFDLHEYCGTC  58

Query  545  PPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAM  724
            P  L++  LH  H L   ++  Q +  + R  C+VC  S +G  +RC  C F +HP C  
Sbjct  59   PMKLSSF-LHPYHSLKLVNRKPQGERRLDRF-CNVCCDSIEGLFYRCEVCEFDVHPLCTQ  116

Query  725  LSTEIKYPPH-AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACD  901
            L   +++  H  H LKLL       GS  +G        +  G C    +   Y C  C 
Sbjct  117  LPETLRHALHQVHPLKLL-------GSTESG-----TCVICRGACNA--SSWRYRCIPCG  162

Query  902  YHLHAVCA  925
            + +H  C 
Sbjct  163  FDIHIDCV  170



>ref|XP_008451176.1| PREDICTED: uncharacterized protein LOC103492553 [Cucumis melo]
Length=239

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 85/206 (41%), Gaps = 24/206 (12%)
 Frame = +2

Query  389   EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             +EM H  H  H L        F C GC E G G  Y C QC+F LH  CA++ P + THP
Sbjct  5     KEMFHPIHPWHKLKLNHSDNPFNCGGCHEAGIGFNYQCLQCDFTLHKLCAVAHPKI-THP  63

Query  569   LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
              + +    F+  P     G     CD C     GF + C+ C F +HPCCA L   +   
Sbjct  64    FYPKCAFEFYSSP----PGACARYCDACRNDVSGFVYHCKRCGFDLHPCCASLPQVLDDG  119

Query  749   PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
               +  L L    SGL                 C +CG K  G  Y     +Y+LH  C K
Sbjct  120   ERS--LYLSMKLSGL-----------------CHRCGGKGPGWSYKSKCRNYNLHLSCVK  160

Query  929   EMMNGLQENGINPPEKPSVLGTAVKI  1006
             E++    +      +K  V+    +I
Sbjct  161   ELLVESWQAMYLKVDKNKVIEVQTRI  186



>gb|KFK36673.1| hypothetical protein AALP_AA4G154900 [Arabis alpina]
Length=204

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 84/183 (46%), Gaps = 22/183 (12%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H +H  HPL ++     F C GC  YG G+ Y C  CN+ LH+ CA  PP+ +   +H Q
Sbjct  9    HFTHV-HPLTKVDGDIEFICDGCNTYGFGETYRCVSCNYDLHEHCATCPPT-HLSFMHPQ  66

Query  581  HQL--LFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
            H+L  +F +  + +K    R  CD+C +S +G  + C  C F +HP C  L   ++Y PH
Sbjct  67   HELRRVFREPDEGLKD---RRLCDICYESVEGLYYHCVPCGFDVHPLCTQLPQYVRYVPH  123

Query  755  AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEM  934
                    P+  L+ SP+        A+ +C  C        Y C  C   +H  C    
Sbjct  124  --------PAHALELSPS-------GASNTCQVCRNTIQSWRYKCGQCRLDVHIECVTSA  168

Query  935  MNG  943
              G
Sbjct  169  SAG  171



>ref|XP_007131878.1| hypothetical protein PHAVU_011G048900g [Phaseolus vulgaris]
 gb|ESW03872.1| hypothetical protein PHAVU_011G048900g [Phaseolus vulgaris]
Length=260

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 80/189 (42%), Gaps = 23/189 (12%)
 Frame = +2

Query  371  QPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPP  550
            +P+    E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+   
Sbjct  17   EPSMKYSEISHFSHPQHKLRFEYSEFPFKCDGCKEVGIGSRYKCSICDFDLHMHCAMITS  76

Query  551  SLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLS  730
                HP + +    F  KP     G T   C+ C K   GF + C+AC F +HPCCA L 
Sbjct  77   PTLFHPFYTKCTFQFMSKP----PGDTPRYCNACEKDVSGFVYHCKACGFDLHPCCAKLP  132

Query  731  TEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHL  910
              +       +L L    S                   C +CG+K     Y     +Y+L
Sbjct  133  MVLD--DGEVKLYLYRKVSS-----------------CCHRCGRKGRSWSYRSKCKNYNL  173

Query  911  HAVCAKEMM  937
            H  C ++M+
Sbjct  174  HVACVRDML  182



>ref|XP_002313820.1| DC1 domain-containing family protein [Populus trichocarpa]
 gb|EEE87775.1| DC1 domain-containing family protein [Populus trichocarpa]
Length=236

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 79/182 (43%), Gaps = 24/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+VH SH +H L        F C GCKE G G RY C  C+F LH  CA+  P+  +H  
Sbjct  5    EIVHYSHPQHKLRFEYSEFPFKCDGCKEVGIGSRYKCTVCDFDLHMQCAIPSPAF-SHSF  63

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  +P     G     C+ C +   GF + C+ C F +HPCCA L   +    
Sbjct  64   YTKCSFQFFSRP----PGDKPRNCNACEREVTGFLYHCKDCGFDLHPCCAKLPMVLD---  116

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
                +KL                     + SC KCG+K     Y  +   Y+LH  C K+
Sbjct  117  -DGEIKLYLY---------------RKVSASCQKCGRKGRSWSYRSSCKKYNLHVACVKD  160

Query  932  MM  937
            M+
Sbjct  161  ML  162



>ref|XP_010255009.1| PREDICTED: uncharacterized protein LOC104595803 [Nelumbo nucifera]
Length=239

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 82/182 (45%), Gaps = 24/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L        F C GCKE G G RY C  C+F LH  CAL  PS+ +HP 
Sbjct  5    EISHLSHPQHKLRFEYAEAPFKCDGCKEAGIGSRYKCNVCDFDLHMHCALPSPSI-SHPF  63

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  +P     G     C+ C K   GF + C++C F +HP CA L   I+   
Sbjct  64   YTKCSFQFLPRP----PGDMPRFCNACEKDVNGFVYHCKSCGFDLHPTCANLPRVIE--D  117

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
               +L L    S                  +C KCG+K     Y  +   Y+LH  CAKE
Sbjct  118  GEVKLYLYRKLSS-----------------ACHKCGRKGRSWSYRSSCKKYNLHVACAKE  160

Query  932  MM  937
            ++
Sbjct  161  IL  162



>ref|XP_010096236.1| hypothetical protein L484_026973 [Morus notabilis]
 gb|EXB63631.1| hypothetical protein L484_026973 [Morus notabilis]
Length=242

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 80/183 (44%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+  P++ +HP
Sbjct  4    NEISHFSHPQHKLKFEYSEFPFKCDGCKEAGIGSRYKCAYCDFDLHTHCAIPSPTI-SHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P     G     C+ C K   GF + C +C F +HPCCA L   +   
Sbjct  63   FYTKCSFRFLSRP----PGDAPRYCNACEKDVTGFVYHCTSCGFDLHPCCAKLPMVLD--  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                +L L    S                  SC +CG+K     Y  +   Y+LH  C +
Sbjct  117  DGETKLYLYRKVSS-----------------SCHRCGRKGRSWSYRSSCKKYNLHVACVR  159

Query  929  EMM  937
            EM+
Sbjct  160  EML  162



>ref|XP_004289630.1| PREDICTED: uncharacterized protein LOC101309404 [Fragaria vesca 
subsp. vesca]
Length=244

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 81/186 (44%), Gaps = 30/186 (16%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+  PS+  HP
Sbjct  4    NEISHFSHPQHKLKFEYTEIPFKCDGCKEVGIGSRYKCATCDFDLHMHCAIPTPSI-FHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA---MLSTEI  739
             + +    F  +      G +   C+ C K   GF + CR+C F +HPCCA   M+  + 
Sbjct  63   FYTKCSFQFLSRA----PGDSPRYCNACEKDITGFVYHCRSCGFDLHPCCAKLPMVLDDG  118

Query  740  KYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
            +   + +R                        + SC KCG+K     Y      Y+LH  
Sbjct  119  EVNLYLYR----------------------KVSSSCHKCGRKGRSWSYRSKCKKYNLHVA  156

Query  920  CAKEMM  937
            C KEM+
Sbjct  157  CVKEML  162



>ref|NP_179203.2| Cysteine/Histidine-rich C1 domain family protein [Arabidopsis 
thaliana]
 gb|AEC06462.1| Cysteine/Histidine-rich C1 domain family protein [Arabidopsis 
thaliana]
Length=243

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 81/187 (43%), Gaps = 29/187 (16%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQ-----QCNFQLHDFCALSPPSL  556
            ++ H SH +H L      + F C GC E G G RY C       C+F LH  CAL   S+
Sbjct  5    DISHFSHPQHNLKFDYTEKPFKCDGCNEVGIGSRYRCSGDNHGSCDFDLHAHCALPSASI  64

Query  557  NTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTE  736
             THP + +    F  +P     G  R  C+ C K   GF + C+AC F +HPCCAML   
Sbjct  65   -THPFYKKCTFQFVARP----PGNERRYCNACEKDVSGFLYHCKACGFDLHPCCAMLPMV  119

Query  737  IKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
            +        L L    S                  SC +CGKK     Y  +   Y+LH 
Sbjct  120  L--DDGETNLFLYRKVSS-----------------SCHRCGKKGRSWSYRSSCKKYNLHV  160

Query  917  VCAKEMM  937
             C +EM+
Sbjct  161  ACVREML  167



>ref|XP_010243310.1| PREDICTED: uncharacterized protein LOC104587404 [Nelumbo nucifera]
Length=240

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 80/182 (44%), Gaps = 24/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L    +   F C GCKE G G RY C  C+F LH  CAL  PS+  HP 
Sbjct  5    EITHFSHPQHKLRFEYIEVPFKCDGCKEVGIGSRYKCSICDFDLHIHCALPSPSI-YHPF  63

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  +P     G     C+ C K   GF + C++C F +HP CA L   +    
Sbjct  64   YKKCSFQFFARP----PGNVPRFCNACEKDVNGFVYHCKSCGFDLHPTCANLPRVLD--D  117

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
               +L L    S                  +C KCG+K     Y  +   Y+LH  C +E
Sbjct  118  GEVKLYLYRKVSS-----------------ACHKCGRKGRSWSYRSSCKKYNLHVACVRE  160

Query  932  MM  937
            ++
Sbjct  161  IL  162



>ref|XP_010517022.1| PREDICTED: uncharacterized protein LOC104792535 [Camelina sativa]
Length=244

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 82/188 (44%), Gaps = 30/188 (16%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ------CNFQLHDFCALSPPS  553
            E+ H SH +H        + F C GC E G G RY C +      C+F LH  CAL   S
Sbjct  5    EISHFSHPQHNFKFDYTEKPFKCDGCNEVGIGSRYRCSRDDHHGSCDFDLHAHCALPSAS  64

Query  554  LNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLST  733
            + THP + +    F  +P     G  R  C+ C K   GF + C+AC F +HPCCAML  
Sbjct  65   I-THPFYKKCTFQFLVQP----PGNERRYCNACEKDVSGFVYHCKACGFDLHPCCAMLPM  119

Query  734  EIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLH  913
             +       +L L    S                  SC +CG+K     Y  +   Y+LH
Sbjct  120  VL--DDGETKLFLYRKVSS-----------------SCHRCGRKGRSWSYRSSCKKYNLH  160

Query  914  AVCAKEMM  937
              C +EM+
Sbjct  161  VACVREML  168



>ref|XP_009618628.1| PREDICTED: uncharacterized protein LOC104110783 [Nicotiana tomentosiformis]
Length=245

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 80/183 (44%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G RY C  C++ LH  CA+   S+ THP
Sbjct  4    NEIYHFSHPQHKLRFEYSEFPFKCDGCKEVGIGSRYKCTTCDYDLHMHCAIPCASI-THP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P     G     C+ C K   GF + C++C F +HPCCA L   +   
Sbjct  63   FYKKCSFQFLSRP----PGNVPRYCNACEKDITGFLYHCKSCGFDLHPCCAKLPMVLD--  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                +L L    S                  SC +CG+K     Y  T   Y+LH  C K
Sbjct  117  DGEVKLYLYRKVSA-----------------SCHRCGRKGRSWSYRSTCKKYNLHVACVK  159

Query  929  EMM  937
            EM+
Sbjct  160  EML  162



>ref|XP_006590914.1| PREDICTED: uncharacterized protein LOC100805046 [Glycine max]
 gb|KHN06156.1| hypothetical protein glysoja_031598 [Glycine soja]
Length=239

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 84/184 (46%), Gaps = 25/184 (14%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCA-LSPPSLNTH  565
             E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA ++ P+L+ H
Sbjct  4    NEISHFSHTEHKLRFEYSEFPFKCDGCKEVGIGSRYKCSICDFDLHMHCAMITSPTLH-H  62

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P + +    F  KP     G T   C+ C K   GF + C+AC F +HPCCA L   +  
Sbjct  63   PFYTKCNFQFMSKP----PGDTPRYCNACEKDVSGFLYHCKACGFDLHPCCAKLPLLLD-  117

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
                 +L L    S    SP             C +CG+K     Y     +Y+LH  C 
Sbjct  118  -DGEVKLYLYRKVS----SP-------------CHRCGRKGRSWSYRSKCKNYNLHVACV  159

Query  926  KEMM  937
            ++M+
Sbjct  160  RDML  163



>ref|XP_008387338.1| PREDICTED: uncharacterized protein LOC103449799 [Malus domestica]
 ref|XP_008350298.1| PREDICTED: uncharacterized protein LOC103413619 [Malus domestica]
Length=243

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 80/183 (44%), Gaps = 24/183 (13%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L        F C GCKE G G  Y C  C+F LH  CA+  PS+  HP
Sbjct  4    NEISHFSHPQHKLKFEYTEIPFNCDGCKEVGIGSCYKCSTCDFDLHMHCAIPTPSI-FHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P     G +   C+ C K   GF + C++C F +HPCCA L   +   
Sbjct  63   FYTKCSFQFLSRP----PGDSPRFCNACEKDITGFVYHCKSCGFDLHPCCAKLPMVLD--  116

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                +L L    S                  SC +CG+K     Y     +Y+LH  C K
Sbjct  117  DGEVKLYLYRKVSS-----------------SCHRCGRKGRSWSYRSKCKEYNLHVACVK  159

Query  929  EMM  937
            EM+
Sbjct  160  EML  162



>ref|XP_006410972.1| hypothetical protein EUTSA_v10017725mg [Eutrema salsugineum]
 gb|ESQ52425.1| hypothetical protein EUTSA_v10017725mg [Eutrema salsugineum]
Length=207

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 80/176 (45%), Gaps = 24/176 (14%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLN--THPLH  574
            H +H  HPL+E  +   F C GC+ YG+ K Y C+ C++ LH++CA  P +L   THP  
Sbjct  10   HFTH-NHPLMETNIARDFICDGCETYGSDKTYRCETCDYDLHEYCATCPFTLQNFTHP--  66

Query  575  GQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
             QH+L    + +  +       CD+C +S +G  +RC+ C F +HP C  L   +++  H
Sbjct  67   -QHELSLFRQKQSTRQN--ERVCDICNESVEGLFYRCKLCEFDVHPLCTQLPQHVRHVLH  123

Query  755  AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
                            PA   +     A +C  C        + C  C + +H  C
Sbjct  124  ----------------PAHHLEFRLGGASTCMVCHGSCQSWRFRCELCKFDIHTEC  163



>ref|XP_010090730.1| hypothetical protein L484_013752 [Morus notabilis]
 gb|EXB40449.1| hypothetical protein L484_013752 [Morus notabilis]
Length=242

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 81/184 (44%), Gaps = 25/184 (14%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPEL-FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTH  565
            +E+ H  H  H L ++   E+ F C GCKE G G +Y C +C F LH  CA++ P + TH
Sbjct  5    KEISHPIHPHHKL-KLEYTEIPFNCDGCKEAGIGLKYKCLRCEFDLHKACAVARPRI-TH  62

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P + +     H  P     G  R +CD C     GF + CR C F +HPCCA L  ++  
Sbjct  63   PFYNKCDFQLHYTP----PGGARRRCDACRNEVLGFVYHCRRCDFDLHPCCANLP-QVLQ  117

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
                    L    SG                 +C  CG K  G  Y      Y+LH  C 
Sbjct  118  DDDGRAFYLCLKLSG-----------------ACHCCGGKGPGWSYRSDCRAYNLHVSCV  160

Query  926  KEMM  937
            KE++
Sbjct  161  KELL  164



>ref|XP_011040845.1| PREDICTED: uncharacterized protein LOC105137000 [Populus euphratica]
Length=246

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 86/188 (46%), Gaps = 30/188 (16%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPEL-FTCSGCKEYGAGKRYACQQ--CN--FQLHDFCALSPPS  553
             E+ H  H +H L E+   E+ FTC GCKE G G +Y+C+Q  CN  F LH  CA++PP 
Sbjct  6    REISHPIHPQHKL-ELEYTEIPFTCDGCKEAGIGLKYSCRQKYCNDQFDLHKVCAVAPPI  64

Query  554  LNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLST  733
            +N    + +    FH  P     G  +  CD C     GF + C+ C F +HPCCA L  
Sbjct  65   INN-SFYKKCVFEFHHHP----PGEEKRVCDACRNEVLGFVYHCKRCGFDLHPCCANLPQ  119

Query  734  EIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLH  913
             +      H L L    SG                 +C +CG K  G  Y      Y+LH
Sbjct  120  VLD--DGEHNLYLCLKLSG-----------------ACHRCGGKGPGWSYRSRCKTYNLH  160

Query  914  AVCAKEMM  937
              C KE++
Sbjct  161  LSCVKELL  168



>ref|XP_010467342.1| PREDICTED: uncharacterized protein LOC104747414 [Camelina sativa]
Length=244

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 82/188 (44%), Gaps = 30/188 (16%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ------CNFQLHDFCALSPPS  553
            E+ H SH +H L      + F C GC E G G RY C +      C+F LH  CA+   S
Sbjct  5    EISHFSHPQHNLKFDYTEKPFKCDGCNEVGIGSRYRCSRDDHHGSCDFDLHAHCAIPLAS  64

Query  554  LNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLST  733
            + THP + +    F   P     G  R  C+ C K   GF + C+AC F +HPCCAML  
Sbjct  65   I-THPFYKKCTFQFMAHP----PGNERRYCNACEKDVSGFLYHCKACGFDLHPCCAMLPM  119

Query  734  EIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLH  913
             +       +L L    S                  SC +CG+K     Y  +   Y+LH
Sbjct  120  VL--DDGETKLFLYRKVSS-----------------SCHRCGRKGRSWSYRSSCKKYNLH  160

Query  914  AVCAKEMM  937
              C +EM+
Sbjct  161  VACVREML  168



>ref|XP_006660116.1| PREDICTED: uncharacterized protein LOC102712928 [Oryza brachyantha]
Length=377

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 79/189 (42%), Gaps = 10/189 (5%)
 Frame = +2

Query  392  EMVHSSHA--KHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTH  565
            E  H SH    H L  +T  E F C GCKE G  +RY C+ C+F LH  CAL+PP L  H
Sbjct  121  EFAHKSHPIPNHKLKLVTADEGFNCDGCKEPGRHERYRCEPCDFDLHRPCALAPPDLPQH  180

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
             L           P   + G  R  CD CG    GF + C      +HPCCA L   +  
Sbjct  181  RLFRGRAFRLLHTPPPTEPGYLRV-CDACGDKVSGFVYHCSDLDLDIHPCCANLPDHVAL  239

Query  746  PPHAHRLKLLPPSSGLQGSPAA----GDQHGHAAAVSCGKCGKKRAGRVYGCTACD-YHL  910
                    L    +G    P       + HG +  VS  +  +++      C   +  +L
Sbjct  240  --DGVEFVLCGAGAGAGDVPRQCAFCTEDHGKSCGVSRSRLDRRKVWTYRSCYDGEAMYL  297

Query  911  HAVCAKEMM  937
            H  C KE+M
Sbjct  298  HVACVKEIM  306



>ref|XP_011092762.1| PREDICTED: uncharacterized protein LOC105172865 [Sesamum indicum]
Length=244

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 82/190 (43%), Gaps = 27/190 (14%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYAC--QQCNFQLHDFCALSPPSLNTH  565
            E+ H SH  H L        F C GCKE G G  Y C    CNF LH  CA+  PS+ TH
Sbjct  5    EISHFSHPHHNLKFEYAKAPFKCDGCKEVGIGSSYKCGGAACNFDLHTHCAIPSPSI-TH  63

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P + +    F  +P     G     C+ C KS  GF + C+ C F +HPCCA L   +  
Sbjct  64   PFYTKCSFQFLSRP----PGQEARYCNACEKSVTGFVYHCQLCGFDLHPCCAKLPMVLD-  118

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
                  +KL   S                 +  C +CG+K     Y  +   Y+LH  C 
Sbjct  119  ---DGDIKLYLFSK---------------VSAPCHRCGRKGRSWSYRSSCKKYNLHVACV  160

Query  926  KEMM-NGLQE  952
            KEM+ +  QE
Sbjct  161  KEMLVDSWQE  170



>ref|XP_002271768.1| PREDICTED: diacylglycerol kinase theta-like [Vitis vinifera]
Length=263

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 89/200 (45%), Gaps = 23/200 (12%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYG-AGKRYACQQCNFQLHDFCALSPPSLNTH  565
            + + H +H  H L E++  E + C GC+  G  G RY C  C+F LH++C   P +L++ 
Sbjct  8    KTIKHFTHPGHDLAEISTNEEYLCGGCRTPGGVGTRYRCHHCDFNLHEYCGSCPSTLSSF  67

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
             +H QH L    + +  +    +  CD+CG S +G  +RC+ C F +HP C  L   +++
Sbjct  68   -MHPQHHLNIVVRTQGARQ--NQRICDLCGDSVEGLFYRCKLCDFDVHPLCTQLPQYVRH  124

Query  746  PPHA-HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
              H  H+L L P   G                  C  C    +   Y C  C + +H  C
Sbjct  125  ALHPDHQLMLQPSVPGW-----------------CAVCKSVCSSWRYRCKTCSFDIHLEC  167

Query  923  AKEM-MNGLQENGINPPEKP  979
               +  NG   +   PP  P
Sbjct  168  ILLVPSNGASTSRSVPPTGP  187



>ref|XP_009609507.1| PREDICTED: uncharacterized protein LOC104103310 isoform X1 [Nicotiana 
tomentosiformis]
Length=264

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 87/181 (48%), Gaps = 26/181 (14%)
 Frame = +2

Query  395  MVHSSHAKHPLV--EMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT--  562
            M H +H +HP+   +      + C GC   G+GKRY C  CNF LH+ C   PP+L++  
Sbjct  9    MPHFTHPQHPITIYDDANNTKYLCEGCMIPGSGKRYHCHDCNFNLHEHCGTCPPNLSSFM  68

Query  563  HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
            HP H   +L+ H+  +Q         C+VC  + +G ++RC  C F +HP C  L   ++
Sbjct  69   HPYHSL-KLVEHNHLRQ-------RFCNVCRDTIEGLSYRCELCEFDVHPLCTQLPETLR  120

Query  743  YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
            +  H H L+LL       GS  AG       AV  G C  + +   Y C  C + +H  C
Sbjct  121  HALHKHPLRLL-------GSSEAG-----ICAVCSGGC--EASSWRYRCQLCKFDIHMGC  166

Query  923  A  925
             
Sbjct  167  V  167



>ref|XP_002305409.1| DC1 domain-containing family protein [Populus trichocarpa]
 gb|EEE85920.1| DC1 domain-containing family protein [Populus trichocarpa]
Length=237

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 79/182 (43%), Gaps = 24/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+  P++  H  
Sbjct  5    EISHFSHPQHKLKFEYSEFPFKCDGCKEVGIGSRYKCTMCDFDLHMHCAIPAPTI-FHSF  63

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  +P   K       C+ C +   GF + C+ C F +HPCCA L   +    
Sbjct  64   YTKCSFQFFSRPPGDKPRF----CNACERDVTGFVYHCKDCGFDLHPCCAKLPMVL----  115

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
            +   +KL                     + SC KCG+K     Y  +   Y+LH  C K+
Sbjct  116  NDGEIKLYLY---------------RKVSASCLKCGRKGRSWTYRSSCKKYNLHVACVKD  160

Query  932  MM  937
            M+
Sbjct  161  ML  162



>ref|XP_010658576.1| PREDICTED: uncharacterized protein LOC104881139 [Vitis vinifera]
Length=258

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 73/184 (40%), Gaps = 18/184 (10%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H SH +H L      + +TC GCKE G G RY C+ C+F LH  C   P    TH   G 
Sbjct  8    HFSHPEHSLELKNYKKPYTCDGCKEPGFGSRYRCEACDFDLHKDCMF-PAETTTHDFFGN  66

Query  581  HQLLFHDKPKQVK------SGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
                F  +P  +K          ++ CD CGK  KGF + C A +  +HPCC  L  E K
Sbjct  67   ATFKFLPRPPNLKCQEKHCRNKCKSYCDACGKVVKGFVYHCAAHNLDLHPCCRNL--ETK  124

Query  743  YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
               H     L    S           HG  + V          G  Y     DY+ H  C
Sbjct  125  MDIHGEEFWLQDKVSRRCNWCRKKKLHGRGSGVQ---------GWAYASRNEDYYFHVGC  175

Query  923  AKEM  934
              EM
Sbjct  176  VPEM  179



>ref|XP_004142194.1| PREDICTED: uncharacterized protein LOC101203482 [Cucumis sativus]
 ref|XP_004165047.1| PREDICTED: uncharacterized LOC101203482 [Cucumis sativus]
 gb|KGN54285.1| hypothetical protein Csa_4G296870 [Cucumis sativus]
Length=276

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 81/180 (45%), Gaps = 24/180 (13%)
 Frame = +2

Query  398  VHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHG  577
             H +H  HPL+ ++  + + C GCK +G+  RY C  C+F +H+ CA  P  L++   H 
Sbjct  13   FHFTHPNHPLIHLSNDQDYFCDGCKTFGSDSRYRCHCCDFDIHELCANCPAKLSSLSFH-  71

Query  578  QHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPHA  757
             H LL  D   Q+++ + R  CD+C     G  +RC  C F  HP C  L  E+++  H 
Sbjct  72   -HHLLALD--FQIRTLVDRC-CDICHDPVHGLVYRCNDCDFNAHPLCTQLPQELRHVIHD  127

Query  758  -HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKK-RAGRVYGCTACDYHLHAVCAKE  931
             H L L     G                  C  C K   +  VYGC  C  ++H  C  E
Sbjct  128  NHPLNLQKLRFG-----------------CCVVCRKDCSSLWVYGCKVCGLYIHLDCLSE  170



>ref|XP_008382114.1| PREDICTED: uncharacterized protein LOC103444922 [Malus domestica]
Length=243

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 81/184 (44%), Gaps = 26/184 (14%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPEL-FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTH  565
             E+ H SH +H L +    E+ F C GCKE G G RY C  C+F LH  CA+  PS+  H
Sbjct  4    NEISHFSHPQHKL-KFEYSEIPFKCDGCKEVGIGSRYKCATCDFDLHMHCAIPTPSI-FH  61

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P + +    F  +      G     C+ C K   GF + C++C F +HPCCA L   +  
Sbjct  62   PFYTKCSFQFLSRS----PGDNPRFCNACEKDITGFVYHCKSCGFDLHPCCAKLPMVLD-  116

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
                 +L L    S                  SC +CG+K     Y      Y+LH  C 
Sbjct  117  -DGEVKLYLYRKVSS-----------------SCHRCGRKGRSWSYRSKCKKYNLHVACV  158

Query  926  KEMM  937
            KEM+
Sbjct  159  KEML  162



>ref|XP_009350358.1| PREDICTED: uncharacterized protein LOC103941884 [Pyrus x bretschneideri]
Length=243

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 81/184 (44%), Gaps = 26/184 (14%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPEL-FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTH  565
             E+ H SH +H L +    E+ F C GCKE G G RY C  C+F LH  CA+  PS+  H
Sbjct  4    NEISHFSHPQHKL-KFEYSEIPFKCDGCKEVGIGSRYKCATCDFDLHMHCAIPTPSI-FH  61

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P + +    F  +      G     C+ C K   GF + C++C F +HPCCA L   +  
Sbjct  62   PFYTKCSFQFLSRS----PGDNPRFCNACEKDITGFVYHCKSCGFDLHPCCAKLPMVLD-  116

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
                 +L L    S                  SC +CG+K     Y      Y+LH  C 
Sbjct  117  -DGEVKLYLYRKVSS-----------------SCHRCGRKGRSWSYRSKCKKYNLHVACV  158

Query  926  KEMM  937
            KEM+
Sbjct  159  KEML  162



>ref|XP_004142190.1| PREDICTED: uncharacterized protein LOC101223041 [Cucumis sativus]
 gb|KGN54291.1| hypothetical protein Csa_4G297420 [Cucumis sativus]
Length=296

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 77/180 (43%), Gaps = 20/180 (11%)
 Frame = +2

Query  398  VHSSHAKHPL-VEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLH  574
             H +H  HPL +       + C GCK  G+G R+ C  CNF LHD+CA  P  L +  +H
Sbjct  10   FHFTHPNHPLQLHSDDRHDYICGGCKTSGSGSRFRCHSCNFDLHDYCANCPEKLISSSIH  69

Query  575  GQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
                 L   KP   +  + +  CD+C  +  G  +RC+ C F  HP C  L      P  
Sbjct  70   HHPLTLVLRKPDGAR--LNQRICDICRDAVDGLFYRCKDCDFDAHPLCTQL------PKT  121

Query  755  AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKK-RAGRVYGCTACDYHLHAVCAKE  931
             H L     +  LQ  P+ G          C  C K   +  VYGC  C  ++H  C  E
Sbjct  122  LHHLIDNKHALNLQKPPSGG----------CAVCKKDCSSNWVYGCQICRVYIHFDCLLE  171



>ref|XP_009602754.1| PREDICTED: uncharacterized protein LOC104097843 [Nicotiana tomentosiformis]
Length=272

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 80/175 (46%), Gaps = 17/175 (10%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H +H KHPL        + C GCK  G GKRY C  C F LH++C + P  L++  +H  
Sbjct  11   HFTHPKHPLTVYDSNTKYLCYGCKIPGIGKRYRCHGCEFDLHEYCGICPTILSSF-MHLN  69

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-A  757
            H L    +  Q      R  C++C  S +G  +RC  C F +HP C  L   +++  H A
Sbjct  70   HSLKLVVRKPQGNRQFDRI-CNICCDSVEGLFYRCEVCEFDVHPLCTQLPETLRHALHQA  128

Query  758  HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
            H L+LL       GS  AG       AV  G C    +   Y C  C + +H  C
Sbjct  129  HPLRLL-------GSSEAG-----TCAVCRGACNA--STWRYRCQLCKFDIHMGC  169



>ref|XP_004987115.1| PREDICTED: uncharacterized protein LOC101755021 [Setaria italica]
Length=183

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 81/199 (41%), Gaps = 30/199 (15%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPEL-------FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLN  559
            + +H +HPLV + +          FTC GC   GAG RY C  C+F LH+ CA +P +  
Sbjct  7    YDAHKEHPLVLVDIGGSSGGNGRSFTCDGCGCRGAGPRYRCGACDFDLHELCATAPGTAW  66

Query  560  THPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
                HGQH L      +    G  R  CD+C     G  +RCR C F  HP C  L    
Sbjct  67   FF-FHGQHPLALELAVEDGGDGSPR-HCDICEMDIHGMHYRCRPCGFDAHPVCLQLPGAA  124

Query  740  KYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
              P H   L +L       G P             C +CG     R Y C  CD +LH  
Sbjct  125  VSPLHPEHLVMLS-----VGGPE-----------ECTRCGADCVWR-YRCGVCDVNLHPR  167

Query  920  CAKEMMNGLQENGINPPEK  976
            C    + G  E  +N P  
Sbjct  168  C----LLGTDETPLNIPRS  182



>ref|NP_181316.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
 gb|AEC09452.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
Length=396

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 75/132 (57%), Gaps = 8/132 (6%)
 Frame = +2

Query  389  EEMV--HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT  562
            E++V  H +H  HPL ++     FTC GCK YG GK Y C +C++ LHD CA  P +L T
Sbjct  141  EQLVVQHFTHI-HPLTKVDGYGEFTCDGCKTYGFGKTYRCTRCDYNLHDHCATCPSTLAT  199

Query  563  HPLHGQHQL-LFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
              +H QH+L L    P+       +  CD+C +S +G  ++C  C F +HP C  L   +
Sbjct  200  F-MHPQHELRLVFRGPEHTHQ--NKRMCDICDESAEGLYYQCEPCGFDVHPLCTQLPQHV  256

Query  740  KYPPH-AHRLKL  772
            ++ PH AH L+L
Sbjct  257  RHVPHPAHLLEL  268



>ref|XP_011037594.1| PREDICTED: uncharacterized protein LOC105134753 [Populus euphratica]
Length=238

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 79/182 (43%), Gaps = 24/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H  H +H L        F C GCKE G G RY C  C+F LH  CA++ P++  H  
Sbjct  5    EISHFGHPQHKLKFENSEFPFKCDGCKEVGIGSRYKCTICDFDLHMHCAIAAPTI-FHSF  63

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  +P   K       C+ C +   GF + C+ C F +HPCCA L   +    
Sbjct  64   YTKCSFQFFSRPPGDKPRF----CNACERDVTGFVYHCKDCGFDLHPCCAKLPMVL----  115

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
            +   +KL                     + SC KCG+K     Y  +   Y+LH  C K+
Sbjct  116  NDGEIKLYLY---------------RKVSASCLKCGRKGRSWTYRSSCKKYNLHVACVKD  160

Query  932  MM  937
            M+
Sbjct  161  ML  162



>ref|XP_004171720.1| PREDICTED: uncharacterized LOC101223041 [Cucumis sativus]
Length=279

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 77/179 (43%), Gaps = 20/179 (11%)
 Frame = +2

Query  401  HSSHAKHPL-VEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHG  577
            H +H  HPL +       + C GCK  G+G R+ C  CNF LHD+CA  P  L +  +H 
Sbjct  11   HFTHPNHPLQLHSDDRHDYICGGCKTSGSGSRFRCHSCNFDLHDYCANCPEKLISSSIHH  70

Query  578  QHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPHA  757
                L   KP   +  + +  CD+C  +  G  +RC+ C F  HP C  L      P   
Sbjct  71   HPLTLVLRKPDGAR--LNQRICDICRDAVDGLFYRCKDCDFDAHPLCTQL------PKTL  122

Query  758  HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKK-RAGRVYGCTACDYHLHAVCAKE  931
            H L     +  LQ  P+ G          C  C K   +  VYGC  C  ++H  C  E
Sbjct  123  HHLIDNKHALNLQKPPSGG----------CAVCKKDCSSNWVYGCQICRVYIHFDCLLE  171



>gb|KFK36674.1| hypothetical protein AALP_AA4G155000 [Arabis alpina]
Length=246

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 88/191 (46%), Gaps = 26/191 (14%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H SH  HPL ++     F C GCK YG G  Y C  C++ LH  CA  PP+L +  +H Q
Sbjct  9    HFSHV-HPLTKVEGYGDFICDGCKTYGFGTTYRCVSCDYDLHYHCATCPPTLISF-MHPQ  66

Query  581  HQL--LFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
            H+L  +F +  + +++   R  CD+C ++ +G  + C  C F +HP C  L     Y PH
Sbjct  67   HELRRIFREPDQGLQN---RRMCDICDETVEGLYYHCEPCGFDVHPLCTQLPQHRNYLPH  123

Query  755  -AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTAC--DYHLHAVCA  925
             AH L+L                H  A+ + C  C        Y C+ C  D H+  V +
Sbjct  124  PAHHLEL---------------SHSGASNI-CKVCRGTIQSWRYKCSQCRLDVHMECVTS  167

Query  926  KEMMNGLQENG  958
             E     QE G
Sbjct  168  SERGETQQERG  178



>ref|XP_006384879.1| hypothetical protein POPTR_0004s21900g [Populus trichocarpa]
 gb|ERP62676.1| hypothetical protein POPTR_0004s21900g [Populus trichocarpa]
Length=246

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 86/188 (46%), Gaps = 30/188 (16%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPEL-FTCSGCKEYGAGKRYACQQ--CN--FQLHDFCALSPPS  553
             E+ H  H +H L ++   E+ FTC GCKE G G +Y+C+Q  CN  F LH  CA++PP 
Sbjct  6    REISHPIHPQHKL-KLEYTEIPFTCDGCKEAGIGLKYSCRQKYCNDQFDLHKVCAVAPPI  64

Query  554  LNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLST  733
            +N    + +    FH  P     G  +  CD C     GF + C+ C F +HPCCA L  
Sbjct  65   INN-SFYKECVFEFHHHP----PGEEKRVCDACRNEVLGFVYHCKRCGFDLHPCCANLPQ  119

Query  734  EIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLH  913
             +      H L L    SG                 +C +CG K  G  Y      Y+LH
Sbjct  120  VLD--DGEHNLYLCHKLSG-----------------ACHRCGGKGPGWSYRSRCKTYNLH  160

Query  914  AVCAKEMM  937
              C KE++
Sbjct  161  LSCVKELL  168



>gb|EPS58960.1| hypothetical protein M569_15854 [Genlisea aurea]
Length=240

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 81/183 (44%), Gaps = 25/183 (14%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ-CNFQLHDFCALSPPSLNTHP  568
            E++H SH  H L        F C GCKE G G  Y C + CNF LH  CA+   S+  HP
Sbjct  5    EILHFSHPNHVLKLGHADAPFKCDGCKEAGIGAVYRCSRACNFDLHAHCAVPSASI-AHP  63

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +    F  +P     G     C+ C +   GF++ CR+C F +HPCCA L   I   
Sbjct  64   FYTKCSFEFLSRP----PGTEARNCNACERRVTGFSYHCRSCGFDLHPCCAKLPMAID--  117

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                 LKL                +GH  A  C KCG+      Y  +   Y+LH  C K
Sbjct  118  --GGDLKLY--------------LYGHVTA-PCHKCGRLGRSWSYRSSCKKYNLHVACVK  160

Query  929  EMM  937
            E++
Sbjct  161  EIL  163



>emb|CAN78510.1| hypothetical protein VITISV_031643 [Vitis vinifera]
Length=410

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 86/182 (47%), Gaps = 30/182 (16%)
 Frame = +2

Query  395  MVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLH  574
            M H +H  H L E+   E F C GCK  G G RY C  C+F +HD+C   P +L+T  +H
Sbjct  1    MEHFTHPGHSLAEVYGSEEFQCDGCKTPGNGLRYRCHTCDFNMHDYCGRCPSTLSTF-MH  59

Query  575  GQH--QLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             QH  +L+   + +    G     CD+CG + +G  ++C  C F +HP C  L    +Y 
Sbjct  60   PQHHLKLVIGTQGRHDNEG----SCDLCGDNFEGLFYQCTLCDFNIHPLCTKLP---EYV  112

Query  749  PHA----HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
            PHA    H+LK       LQ S + G          C  C  +     YGC  C++ +H 
Sbjct  113  PHALDPVHQLK-------LQTSSSPG---------WCRVCKSECTSWRYGCRTCNFDIHL  156

Query  917  VC  922
             C
Sbjct  157  EC  158


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 42/103 (41%), Gaps = 12/103 (12%)
 Frame = +2

Query  623  GITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPHA-HRLKLLPPSSGLQG  799
            G    +CD C     G  +RC  C F MH  C    + +    H  H LKL+        
Sbjct  16   GSEEFQCDGCKTPGNGLRYRCHTCDFNMHDYCGRCPSTLSTFMHPQHHLKLV--------  67

Query  800  SPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                G Q  H    SC  CG    G  Y CT CD+++H +C K
Sbjct  68   ---IGTQGRHDNEGSCDLCGDNFEGLFYQCTLCDFNIHPLCTK  107



>ref|XP_010654237.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Vitis 
vinifera]
Length=411

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 86/182 (47%), Gaps = 30/182 (16%)
 Frame = +2

Query  395  MVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLH  574
            M H +H  H L E+   E F C GCK  G G RY C  C+F +HD+C   P +L+T  +H
Sbjct  1    MEHFTHPGHSLAEVYGSEEFQCDGCKTPGNGLRYRCHTCDFNMHDYCGRCPSTLSTF-MH  59

Query  575  GQH--QLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             QH  +L+   + +    G     CD+CG + +G  ++C  C F +HP C  L    +Y 
Sbjct  60   PQHHLKLVIGTQGRHDNEG----SCDLCGDNFEGLFYQCTLCDFNIHPLCTKLP---EYV  112

Query  749  PHA----HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
            PHA    H+LK       LQ S + G          C  C  +     YGC  C++ +H 
Sbjct  113  PHALDPVHQLK-------LQTSSSPG---------WCRVCKSECTSWRYGCRTCNFDIHL  156

Query  917  VC  922
             C
Sbjct  157  EC  158


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 44/106 (42%), Gaps = 18/106 (17%)
 Frame = +2

Query  623  GITRAKCDVCGKSTKGFTFRCRACSFQMHPCC----AMLSTEIKYPPHAHRLKLLPPSSG  790
            G    +CD C     G  +RC  C F MH  C    + LST +      H LKL+     
Sbjct  16   GSEEFQCDGCKTPGNGLRYRCHTCDFNMHDYCGRCPSTLSTFMH---PQHHLKLV-----  67

Query  791  LQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
                   G Q  H    SC  CG    G  Y CT CD+++H +C K
Sbjct  68   ------IGTQGRHDNEGSCDLCGDNFEGLFYQCTLCDFNIHPLCTK  107



>ref|XP_008448294.1| PREDICTED: uncharacterized protein LOC103490529 [Cucumis melo]
Length=275

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 81/180 (45%), Gaps = 24/180 (13%)
 Frame = +2

Query  398  VHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHG  577
             H +H  HPL+ ++  + + C  CK +G+  RY C  C+F +H+FCA  P  L++   H 
Sbjct  12   FHFTHPNHPLIHLSNDQDYFCDACKTFGSDSRYRCHCCDFDIHEFCANCPAKLSSFGFH-  70

Query  578  QHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPHA  757
             H LL  D   Q+++ + R  C +C     G  +RC+ C F  HP C  L  E+++  H 
Sbjct  71   -HHLLALD--FQIRTLVDR-YCGICHDPVHGLVYRCKDCDFDAHPLCTQLPRELRHVIHE  126

Query  758  -HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKK-RAGRVYGCTACDYHLHAVCAKE  931
             H L L     G                  C  C K   +  VYGC  C  ++H  C  E
Sbjct  127  NHPLNLQKLRFG-----------------CCVVCRKDCSSLWVYGCNVCGLYIHLDCLSE  169



>ref|XP_006298412.1| hypothetical protein CARUB_v10014481mg [Capsella rubella]
 gb|EOA31310.1| hypothetical protein CARUB_v10014481mg [Capsella rubella]
Length=247

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 81/190 (43%), Gaps = 32/190 (17%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ--------CNFQLHDFCALSP  547
            E+ H SH +H L      + F C GC E G G RY C          C+F LH  CAL  
Sbjct  6    EISHFSHPQHNLKFDYTEKPFKCDGCNEVGIGSRYRCSGNKNHHGSCCDFDLHAHCALPS  65

Query  548  PSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAML  727
             S+ THP + +    F  +P     G  R  C+ C K   GF + C+AC F +HPCCAML
Sbjct  66   TSI-THPFYKKCTFQFLAQP----PGNERRYCNACEKDVSGFLYHCKACGFDLHPCCAML  120

Query  728  STEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYH  907
               +       +L L    S                  SC +CG K     Y  +   Y+
Sbjct  121  PMVL--DDGDTKLFLYRKVSS-----------------SCHRCGIKGRSWSYRSSCKKYN  161

Query  908  LHAVCAKEMM  937
            LH  C +EM+
Sbjct  162  LHVACVREML  171



>emb|CAN76804.1| hypothetical protein VITISV_000634 [Vitis vinifera]
Length=107

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +2

Query  842   SCGKCGKKRAGRVYGCTA--CDYHLHAVCAKEMMNGLQENGINPPEKPSVLGTAVKIAGQ  1015
             SCG+C +KR GRVY CTA  CDYHLHAVCAK M+NGL+ NG+   EKPS+ GT +KIA  
Sbjct  11    SCGECKRKRPGRVYRCTATACDYHLHAVCAKNMVNGLRANGVTCLEKPSMRGTFIKIASV  70

Query  1016  VVF  1024
             VV 
Sbjct  71    VVM  73



>emb|CBI32534.3| unnamed protein product [Vitis vinifera]
Length=209

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 60/117 (51%), Gaps = 5/117 (4%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
             E+ H SH +H L    +   F C GCKE G G RY C  C++ LH  CAL  PS+ THP
Sbjct  4    NEIPHFSHPQHKLKFEYIELPFKCDGCKEAGIGSRYKCSICDYDLHTHCALPSPSI-THP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
             + +    F  +P     G     C+ C K   GF + C +C F +HPCCA L  E+
Sbjct  63   FYTKCSFQFLPRP----PGDAARFCNACEKDINGFLYHCNSCGFDLHPCCARLPMEM  115



>ref|XP_009779824.1| PREDICTED: uncharacterized protein LOC104228964 [Nicotiana sylvestris]
Length=279

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 91/212 (43%), Gaps = 20/212 (9%)
 Frame = +2

Query  389   EEMV--HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT  562
             E+M+  H +H +H L        + C GC   G GKRY C  CNF LH++C L PP L++
Sbjct  6     EDMLLQHFAHPEHLLTIYNSNTEYECDGCYMPGIGKRYCCHGCNFDLHEYCGLCPPFLSS  65

Query  563   HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
                   HQL       Q  S +    CDVC    +G  +RC  C+F +HP C  L   ++
Sbjct  66    --FMHSHQLKLTILEPQADSELV-GFCDVCCDPVEGLFYRCNRCNFDVHPLCTQLPRTLR  122

Query  743   YPPH-AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
             +  H  HRL+LL P       P          A+  G C    +   Y C  C + +H  
Sbjct  123   HALHQQHRLRLLGPY-----EPTG------RCAICRGACNA--SSWRYRCAQCRFDIHLD  169

Query  920   CA-KEMMNGLQENGINPPEKPSVLGTAVKIAG  1012
             C   +      + GI     PSV      ++G
Sbjct  170   CVLVQCETRRTQRGIQTYVPPSVFPQQQYLSG  201



>gb|EPS68374.1| hypothetical protein M569_06392 [Genlisea aurea]
Length=263

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 83/196 (42%), Gaps = 31/196 (16%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ--------------CNFQLHD  529
            E+ H +H +H L        F C GCKE G G RY C                CNF LH 
Sbjct  5    EISHFAHPQHNLKYDYSEAPFKCDGCKEAGIGSRYKCSGGGGGGGGGGGYYYACNFDLHT  64

Query  530  FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             CA+  PS+ THP + +    F  +P     G     C+ C K   GF + CR+C F +H
Sbjct  65   HCAMPSPSV-THPFYTRCSFQFMSRP----PGEAARYCNACEKDVAGFVYHCRSCGFDLH  119

Query  710  PCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGC  889
            PCCA L   +       +L L         +P +G+   H       +CG+K     Y  
Sbjct  120  PCCAKLPMVLVDDGEV-KLYLYKK----LAAPFSGNFPSH-------RCGRKGRSWCYRS  167

Query  890  TACDYHLHAVCAKEMM  937
            +   Y+ H  C KEM+
Sbjct  168  SCHSYNFHVACVKEML  183



>ref|XP_008813825.1| PREDICTED: uncharacterized protein LOC103724371 [Phoenix dactylifera]
Length=254

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 79/183 (43%), Gaps = 18/183 (10%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPP-SLNTHP  568
            E+ H SH +H L        F C GCKE G G R+ C  C++ LH  CAL+ P S+  HP
Sbjct  5    EITHFSHPQHKLQFEYTEIPFKCDGCKEAGIGSRFKCSLCDYDLHKQCALAAPSSILRHP  64

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +        P     G     C+ C +   G  + C +C F +HPCCA L       
Sbjct  65   FYPKCTFYLLPAP----PGSAARFCNACERDVAGLVYHCHSCGFDLHPCCAAL-------  113

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
            PH     +L   SG  G       H   AA  C +CG+K     Y      Y+LH  C  
Sbjct  114  PH-----VLETGSGGGGEDLRLFLHRKVAA-PCHRCGRKGRSWSYRSACKRYNLHVACVM  167

Query  929  EMM  937
            EM+
Sbjct  168  EML  170



>ref|XP_009388938.1| PREDICTED: uncharacterized protein LOC103975643 [Musa acuminata 
subsp. malaccensis]
Length=264

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 74/183 (40%), Gaps = 18/183 (10%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L        F C GCKE G G R+ C  C+F LH  CAL   +   H  
Sbjct  5    EITHFSHPQHKLRFEYAEVPFKCDGCKEVGIGSRFKCNLCDFDLHRQCALPSAAPLRHAF  64

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F  +P     G     C+ C +   GF   C AC F +HPCCA L       P
Sbjct  65   YPKCAFQFLARP----PGDALRFCNACERDVAGFVLHCGACGFDLHPCCAAL-------P  113

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
            H          +G  G  A        A   C +CG+K     Y      Y+LH  C  E
Sbjct  114  HV-------LDAGAGGGDAVRLYLYRKAGAPCHRCGRKGRSWSYRSACKKYNLHVACVME  166

Query  932  MMN  940
            M+ 
Sbjct  167  MLE  169



>gb|AIN76234.1| cysteine-histidine-rich C1 domain family protein [Gossypium hirsutum]
Length=239

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 83/187 (44%), Gaps = 32/187 (17%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLN-TH  565
             E+ H SH +H L        F C GCKE G G RY C  C+F LH  C +  PSL+ +H
Sbjct  4    NEISHFSHPQHILKFEYTEVPFKCDGCKEVGIGSRYRCSFCDFDLHMHCTV--PSLSISH  61

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA---MLSTE  736
            P + +    F  +P     G T   C+ C K   GF + C+ C F +HPCCA   M+  +
Sbjct  62   PFYTKCSFQFLSRP----PGDTPRYCNACEKDVTGFVYHCKTCGFDLHPCCAKLPMVLDD  117

Query  737  IKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
             +   + +R K+  P                     C +CG+K     Y      Y+LH 
Sbjct  118  GEVKLYLYR-KVRSP---------------------CHRCGRKGRSWSYQSACKKYNLHV  155

Query  917  VCAKEMM  937
             C +EM+
Sbjct  156  ACVREML  162



>ref|XP_007041387.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao]
 gb|EOX97218.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao]
Length=424

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 82/186 (44%), Gaps = 32/186 (17%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT-HP  568
            E+ H SH +H L        F C GCKE G G RY C  C+F LH  CA+  PSL+  HP
Sbjct  5    EISHFSHPQHILKFEYTEVPFKCDGCKEVGIGSRYRCAFCDFDLHMHCAI--PSLSIAHP  62

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA---MLSTEI  739
             + +    F  +P     G T   C+ C K   GF + C++C F +HPCCA   M+  + 
Sbjct  63   FYKKCSFQFLSRP----PGDTPRYCNACEKDVTGFVYHCKSCGFDLHPCCAKLPMVLDDG  118

Query  740  KYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
            +   + +R                        +  C +CG+K     Y      Y+LH  
Sbjct  119  EVKLYLYR----------------------KVSAPCHRCGRKGRSWSYRSACKKYNLHVA  156

Query  920  CAKEMM  937
            C +EM+
Sbjct  157  CVREML  162



>ref|XP_010526929.1| PREDICTED: uncharacterized protein LOC104804360 [Tarenaya hassleriana]
 ref|XP_010526930.1| PREDICTED: uncharacterized protein LOC104804360 [Tarenaya hassleriana]
 ref|XP_010526931.1| PREDICTED: uncharacterized protein LOC104804360 [Tarenaya hassleriana]
 ref|XP_010526932.1| PREDICTED: uncharacterized protein LOC104804360 [Tarenaya hassleriana]
Length=239

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 79/184 (43%), Gaps = 26/184 (14%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCAL--SPPSLNTH  565
            E+ H SH  H L        F C GCKE G G RY C  C+F LH  CAL  S  +  TH
Sbjct  6    EISHFSHPNHKLKFDFTDIPFKCDGCKEIGVGSRYHCP-CDFDLHAHCALPFSSAAPLTH  64

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P + +    F  +P     G +   C+ C K   GF + CR C F +HPCCAML   +  
Sbjct  65   PFYKKCSFEFLSRP----PGKSPRYCNACEKDVAGFVYHCRECGFDLHPCCAMLPMALD-  119

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
                  LKL                     +  C +CG+K     Y  +   Y++H  C 
Sbjct  120  ---DGELKLYLYRK---------------VSSPCLRCGRKGRSWSYRSSCKKYNIHVACV  161

Query  926  KEMM  937
            +EM+
Sbjct  162  REML  165



>emb|CAN63103.1| hypothetical protein VITISV_029578 [Vitis vinifera]
Length=602

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 89/200 (45%), Gaps = 23/200 (12%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKE-YGAGKRYACQQCNFQLHDFCALSPPSLNTH  565
            + + H +H  H L E++  E + C GC+   G G RY C  C+F LH++C   P +L++ 
Sbjct  347  KTIKHFTHPGHDLAEISTNEEYLCGGCRTPGGVGTRYRCHHCDFNLHEYCGSCPSTLSSF  406

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
             +H QH L    + +  +    +  CD+CG S +G  +RC+ C F +HP C  L   +++
Sbjct  407  -MHPQHHLNIVVRTQGARQ--NQRICDLCGDSVEGLFYRCKLCDFDVHPLCTQLPQYVRH  463

Query  746  PPH-AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
              H  H+L L P   G                  C  C    +   Y C  C + +H  C
Sbjct  464  ALHPDHQLMLQPSVPGW-----------------CAVCKSVCSSWRYRCKTCSFDIHLEC  506

Query  923  AKEM-MNGLQENGINPPEKP  979
               +  NG   +   PP  P
Sbjct  507  ILLVPSNGASTSRSVPPTGP  526


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 54/104 (52%), Gaps = 3/104 (3%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H ++  H L E+   E F C GCK  G G RY C  C+  LH++C + P +L+T  +H Q
Sbjct  65   HFTNPGHSLTEVYGSEEFHCDGCKTPGNGPRYRCHTCDSTLHEYCGVCPSTLSTF-MHPQ  123

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHP  712
            HQL    + +  +  +    C +C    +G  +RC  C F +HP
Sbjct  124  HQLKLEIRTQGRR--VNERLCTLCRDDVEGLFYRCTDCDFDIHP  165



>ref|XP_010253825.1| PREDICTED: uncharacterized protein LOC104594968 [Nelumbo nucifera]
Length=260

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 78/191 (41%), Gaps = 28/191 (15%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H SH +H L        +TC GCKE G G RY C  CN+ LH+ C     S  +HP +  
Sbjct  8    HFSHPQHNLQLEKSETPYTCDGCKEIGFGIRYRCDACNYDLHEDCMFPDSSSISHPFYKG  67

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPHAH  760
            +   F +       G  +  CD CG+  KGF + C    + +HPCC  L   I+      
Sbjct  68   YSFEFMEGA----PGERQRYCDACGRDIKGFVYHCPEGGYDLHPCCRRLPNVIRGEGVTL  123

Query  761  RLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKR-AGRVYGC----TACDYHLHAVCA  925
            +L+                         C KCG++   GRV G     T   YH H  C 
Sbjct  124  KLR-------------------DKVKSRCYKCGRRELWGRVTGWSYVSTCTKYHFHVSCV  164

Query  926  KEMMNGLQENG  958
            K+++    + G
Sbjct  165  KDVLLETWKRG  175



>ref|XP_009773541.1| PREDICTED: diacylglycerol kinase theta-like [Nicotiana sylvestris]
Length=268

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 77/159 (48%), Gaps = 22/159 (14%)
 Frame = +2

Query  452  FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGIT  631
            + C GC   G+GKRY C  CNF LH+ C   PP+L++  +H  H L      K V+    
Sbjct  23   YLCEGCMIPGSGKRYHCHDCNFNLHEHCGTCPPNLSSF-MHPYHSL------KLVERNHL  75

Query  632  RAK-CDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPA  808
            R + C+VC  + +G ++RC  C F +HP C  L   +++  H H L+LL       GS  
Sbjct  76   RERFCNVCRDTIEGLSYRCELCEFDVHPLCTQLPETLRHALHKHPLRLL-------GSSE  128

Query  809  AGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
            AG       AV  G+C    +   Y C  C + +H  C 
Sbjct  129  AGK-----CAVCSGECDA--SSWRYRCALCGFDIHMGCV  160



>ref|XP_009133207.1| PREDICTED: uncharacterized protein LOC103857736 [Brassica rapa]
Length=290

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 87/182 (48%), Gaps = 22/182 (12%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            E + H +H  HPL ++     F C+GC  YG+GK Y C  CN+ LHD CA  P +L+   
Sbjct  9    EVLQHFTHV-HPLTKVDDFGGFICNGCNTYGSGKTYRCASCNYDLHDCCATCPRTLHCF-  66

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
            +H QH+L    K +  K    R  C++C +  +G  ++C AC F MHP C+ L  ++ + 
Sbjct  67   VHPQHELTLVFK-EPAKMDHDRRGCNICHELAEGLYYQCEACGFDMHPLCSQLPQQVSHM  125

Query  749  PH-AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKC-GKKRAGRVYGCTACDYHLHAVC  922
             H AH L+L                  H A+  C  C G  R+ R Y C  C   +H  C
Sbjct  126  SHPAHYLELS----------------DHGASNMCMVCHGVIRSWR-YKCGPCRLDVHMEC  168

Query  923  AK  928
              
Sbjct  169  VN  170



>ref|XP_010675468.1| PREDICTED: uncharacterized protein LOC104891469 [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 86/203 (42%), Gaps = 20/203 (10%)
 Frame = +2

Query  395  MVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT--HP  568
            + H +H  HPL +++  + F C GC+  G G+RY CQ+C+F LH  C   P  L +  HP
Sbjct  20   LQHFTHLHHPLKKISEEKEFKCDGCERLGIGQRYQCQECSFNLHTHCGHCPADLTSFMHP  79

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             H  H  L         +  T   C+VCG+S  G  ++C+ C   +HP C+ L      P
Sbjct  80   KHRLHLALVQRARATFSNDHT---CEVCGESVGGLFYQCKRCQIYVHPLCSQL------P  130

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
             + H +  +  S  LQ    +          SC  CG +     Y C  C   LH  C  
Sbjct  131  QYVHYVADVGHSLELQHQEQSS---------SCTVCGVQCNHWYYKCGMCPVVLHIDCLL  181

Query  929  EMMNGLQENGINPPEKPSVLGTA  997
             M+  L+     P        TA
Sbjct  182  SMLLPLRSTYRLPSSSQKKRSTA  204



>tpg|DAA55038.1| TPA: hypothetical protein ZEAMMB73_497831 [Zea mays]
Length=321

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 82/192 (43%), Gaps = 21/192 (11%)
 Frame = +2

Query  368  PQPNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ--CNFQLHDFCAL  541
            PQP     E+ H SH +H L        F C GC E G G R+ C    C+  LH  CAL
Sbjct  54   PQPEMRYGELAHLSHPQHRLRLEHAETPFRCDGCGEVGIGARFRCPHPGCDHDLHRQCAL  113

Query  542  SPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA  721
              P+   HP + +   +F  +      G     C+ CG+   G+ + CRAC F +HPCCA
Sbjct  114  PAPAPLRHPFYPRCAFVFLAR---APGGAGARYCNACGRDVAGYVYHCRACGFDLHPCCA  170

Query  722  MLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACD  901
             L   +       RL L P +    GS AA           C +CG +  G  Y      
Sbjct  171  ALPHALDAGAGV-RLHLHPDT----GSGAA-----------CHRCGHRGRGWSYRSQCRC  214

Query  902  YHLHAVCAKEMM  937
            Y LH  C  +M+
Sbjct  215  YSLHVACVMDML  226



>gb|EYU41772.1| hypothetical protein MIMGU_mgv11b018922mg [Erythranthe guttata]
Length=274

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 87/187 (47%), Gaps = 20/187 (11%)
 Frame = +2

Query  410  HAKHPLVEMTLPELFTCSGCKEYGA-GKRYACQQ--CNFQLHDFCALSPPSLNTHPLHGQ  580
            H  HPL  +   E + C GCK  G  GKR+ C    C+F LHD+CA  P  L ++ +H  
Sbjct  8    HPGHPLTPINGDEEYLCDGCKTTGGPGKRFRCTHRGCDFDLHDYCATCPRHLTSY-MHKT  66

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-A  757
            H L    +  Q      R  CD+C    +G  +RC  C F +HP C  L  ++ +  H +
Sbjct  67   HALELMMRKGQSHRVHNRV-CDICKDPVEGLFYRCEVCGFDVHPLCTQLPEKLHHALHKS  125

Query  758  HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEMM  937
            HRL        L+ S AAG     + AV    CG   A   Y C  C++ +H  C  + +
Sbjct  126  HRLT-------LRSSRAAG-----SCAVCRTPCGS--ATWRYRCDDCNFDIHLECILKPV  171

Query  938  NGLQENG  958
               ++NG
Sbjct  172  VSWKQNG  178



>ref|XP_004507389.1| PREDICTED: uncharacterized protein LOC101513960 [Cicer arietinum]
Length=240

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 78/182 (43%), Gaps = 23/182 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E+ H SH +H L        F C GCKE G G RY C  C++ LH  CA+   +   HP 
Sbjct  5    EITHFSHPQHKLRFEYNEFPFKCDGCKEIGIGSRYKCCICDYDLHMQCAIINSNTLFHPF  64

Query  572  HGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPP  751
            + +    F   P     G     C+ C K  KGF + C++C F +HPCCA L   ++   
Sbjct  65   YTKCSFQFMSIP----PGNIARYCNACEKDVKGFVYHCKSCGFDLHPCCAKLPAVME---  117

Query  752  HAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKE  931
                +KL   S                 + +C  CG+K     Y      Y++H  C +E
Sbjct  118  -EGEVKLYLCSK---------------VSSACHGCGRKGGSWSYRSKCKSYNMHVACVRE  161

Query  932  MM  937
            M+
Sbjct  162  ML  163



>ref|XP_009801635.1| PREDICTED: uncharacterized protein LOC104247346 [Nicotiana sylvestris]
Length=267

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 78/175 (45%), Gaps = 17/175 (10%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H +H KH L        + C GCK  G GKRY C  C F LH++C   P  L++  +H  
Sbjct  11   HFTHPKHSLTVYDSNTKYLCDGCKIPGIGKRYRCHGCEFDLHEYCGTCPTILSSF-MHPN  69

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-A  757
            H L    +  Q      R  C+VC  S +G  +RC  C F +HP C  L   +++  H A
Sbjct  70   HSLKLVVRKPQGNRQFDRI-CNVCCDSVEGLFYRCEVCEFDVHPLCTQLPETLRHALHQA  128

Query  758  HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
            H L+LL  SS   GS           AV  G C    +   Y C  C + +H  C
Sbjct  129  HPLRLL--SSSEPGS----------CAVCRGTCNA--SSWRYRCQLCQFDIHMGC  169



>gb|EYU42639.1| hypothetical protein MIMGU_mgv1a023213mg [Erythranthe guttata]
Length=245

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 74/189 (39%), Gaps = 33/189 (17%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYAC--QQCNFQLHDFCALSPPSLNT  562
             E+ H SH  H L        F C GC+E G G  Y C    C+F LH  CA+  P++  
Sbjct  4    SEISHFSHPHHTLKPQHTEAPFKCDGCREVGIGSSYKCGGAACDFDLHTHCAIPSPTV-V  62

Query  563  HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
            HP +      F  +P     G     C+ C K   GF + CR C F +HPCCA L   + 
Sbjct  63   HPFYTMCSFQFLSRP----PGTEARYCNACEKRVTGFVYHCRTCGFDLHPCCAKLPMVL-  117

Query  743  YPPHAHRLKLLPPSSGLQGSPAAGDQHGH----AAAVSCGKCGKKRAGRVYGCTACDYHL  910
                                 A GD   H      A    +CG+K     Y  T   Y+ 
Sbjct  118  ---------------------ADGDTKLHLYSKVNAPFVIRCGRKGRSWSYRSTCLKYNF  156

Query  911  HAVCAKEMM  937
            H  C KEM+
Sbjct  157  HVACVKEML  165



>ref|XP_007026910.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma 
cacao]
 gb|EOY07412.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma 
cacao]
Length=299

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 64/125 (51%), Gaps = 4/125 (3%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H +H  HPL E+     F C GC+  G G RY C+ C+F LHD CA  P  L++  +H  
Sbjct  11   HFTH-DHPLTEVDARTEFVCDGCRTLGVGTRYGCESCDFDLHDHCATCPLELSSF-MHEH  68

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-A  757
               L   KP Q  S      CD+CG   +G  ++CR C F +HP C  L   +++  H  
Sbjct  69   DLKLVVSKP-QATSLQNERFCDLCGNPVQGIFYQCRLCEFDVHPLCTKLPEYVRHVMHKE  127

Query  758  HRLKL  772
            H L+L
Sbjct  128  HPLRL  132



>ref|XP_011036079.1| PREDICTED: uncharacterized protein LOC105133695 [Populus euphratica]
Length=257

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 85/202 (42%), Gaps = 30/202 (15%)
 Frame = +2

Query  350  VEFPTSPQPNNGGEEMVHSSHAKHPLVEMTLPE--LFTCSGCKEYGAGKRYACQQCNFQL  523
            +  P+SP+P    + + H SH  HPL E  LP    F C GC+  G  K Y C  CNF L
Sbjct  1    MSMPSSPRP----QMLRHPSHI-HPLFEFHLPVGGEFICDGCRTCGYEKSYRCTYCNFDL  55

Query  524  HDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQ  703
            H++CA  P  L +  LH  H+L        V    TR  CD+C +   G  + C  C F 
Sbjct  56   HEYCASCPKKLRS-GLH-VHELTL------VSLVGTRKVCDICEECADGLFYACNVCDFN  107

Query  704  MHPCCAMLSTEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVY  883
            +HP C  + T+++   H H    LP  S     P    +        C  C        Y
Sbjct  108  VHPVCTQIPTKLQ---HGH----LPNHSLTLRQPRMSSR--------CVVCWDACTSWRY  152

Query  884  GCTACDYHLHAVCAKEMMNGLQ  949
            GC  C   +H  C  E    LQ
Sbjct  153  GCDICQVDVHLDCVYEPFYDLQ  174



>emb|CDY07768.1| BnaA03g17430D [Brassica napus]
Length=423

 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 89/183 (49%), Gaps = 22/183 (12%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            E + H +H  HPL ++     F C+GC  YG+GK Y C  CN+ LHD CA  P +L+   
Sbjct  199  EVLQHFTHV-HPLTKVYDFGGFICNGCNTYGSGKTYRCASCNYDLHDCCATCPRTLHCF-  256

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
            +H QH+L    K +  K    R  C++C +  +G  ++C AC F MHP C+ L  ++ + 
Sbjct  257  VHPQHELTLVFK-EPAKMDHDRRGCNICHELAEGLYYQCEACGFDMHPLCSQLPQQVSHM  315

Query  749  PH-AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKC-GKKRAGRVYGCTACDYHLHAVC  922
             H AH L+L                  H A+  C +C G  R+ R Y C  C   +H  C
Sbjct  316  SHPAHYLELS----------------DHGASNMCMECHGVIRSWR-YKCGPCRLDVHMEC  358

Query  923  AKE  931
              +
Sbjct  359  PSQ  361


 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +2

Query  419  HPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQL-LF  595
            HPL ++     FTC GCK +G GK Y C  C++ LH+ CA   P+L +  +H QH+L L 
Sbjct  18   HPLTKVDGYGEFTCGGCKTFGFGKTYRCSWCDYNLHEHCATCSPTLFSF-IHPQHELKLV  76

Query  596  HDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
               P+Q      +  C++C +  +G  ++C  C F +HP C  L   +
Sbjct  77   FRGPEQTHH--EKRMCNICDEPAEGLFYQCHPCGFDVHPLCTQLPQRV  122



>ref|XP_006493589.1| PREDICTED: uncharacterized protein LOC102620618 [Citrus sinensis]
Length=335

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 6/137 (4%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            + + H +H  H L +      + C GCK  G G R+ C  C+F LH++C   P +L++  
Sbjct  8    KTIEHFTHPDHKLFQFNNDNWYLCKGCKTAGDGTRFRCHDCDFDLHEYCGTCPMTLSSF-  66

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCR-ACSFQMHPCCAMLSTEIKY  745
            +H QHQL   ++  Q      R  C VCG S +G  +RC+  C F +HP CA L  + ++
Sbjct  67   MHPQHQLKLVNRMPQATRQNVRF-CRVCGHSVEGLFYRCKLQCEFDVHPVCAQLPQQARH  125

Query  746  ---PPHAHRLKLLPPSS  787
               P H   L L P SS
Sbjct  126  VLDPSHPLTLTLQPLSS  142



>ref|XP_010922353.1| PREDICTED: uncharacterized protein LOC105045685 [Elaeis guineensis]
Length=249

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 83/192 (43%), Gaps = 40/192 (21%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ-CNFQLHDFCALSPPSLNTHP  568
            E++HSSH  H L+       + C GCKE G G RY C++ CNF LH  CA SP +  THP
Sbjct  5    EIIHSSHPDHKLILEHRDTPYNCDGCKELGFGSRYTCEESCNFHLHKDCA-SPEATITHP  63

Query  569  LHGQHQLLFH--DKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
                    FH   KP +         CD CG+  KG+ + C    + +HP CA+L   I+
Sbjct  64   FFPGCLFHFHAIGKPDRF--------CDACGRDIKGYVYHCFRKGWDLHPSCALLPRIIE  115

Query  743  YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGR-------VYGCTACD  901
                   +KL+                       C +CGKK   +       V  C  C 
Sbjct  116  ----DGEMKLVLRRE---------------VTSKCYRCGKKELRKGAKSWSYVSTCKEC-  155

Query  902  YHLHAVCAKEMM  937
             HLH  C KE++
Sbjct  156  -HLHVACVKEIL  166



>ref|XP_009406820.1| PREDICTED: uncharacterized protein LOC103989633 [Musa acuminata 
subsp. malaccensis]
Length=145

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 58/113 (51%), Gaps = 7/113 (6%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
              + H  H  HPLV       F CS C+  G G RY C +CNF+LH+ CA  P +++ H 
Sbjct  6    RHVTHLLHPDHPLVYQYHEASFVCSVCRITGDGLRYRCDRCNFELHEHCARCPSTISFH-  64

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAML  727
            +H QH L  H +P   +       C VC     G  ++CR C F +HP C+++
Sbjct  65   MHPQHLLTLHARPGTAR------LCRVCRVHVGGMVYQCRTCGFDLHPLCSLV  111



>emb|CDY59486.1| BnaC03g72080D [Brassica napus]
Length=250

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 70/130 (54%), Gaps = 5/130 (4%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            +  VH     H L ++     FTC GCK +G GK Y C  C++ LH+ CA  PP+L +  
Sbjct  8    QHTVHHFTHIHSLTKVDGYGEFTCGGCKTFGFGKTYRCSWCDYNLHEHCATCPPTLFSF-  66

Query  569  LHGQHQL-LFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            +H QH+L L    P+Q      +  C++C +  +G  ++C  C F +HP C  L   +++
Sbjct  67   MHPQHELQLVFRGPEQTHH--EKRMCNICDEPAEGLFYQCHPCGFDVHPLCTQLPQHVRH  124

Query  746  PPH-AHRLKL  772
             PH AH L+L
Sbjct  125  VPHAAHHLEL  134



>emb|CDY59485.1| BnaC03g72070D [Brassica napus]
Length=233

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 60/112 (54%), Gaps = 6/112 (5%)
 Frame = +2

Query  416  KHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHG-QHQLL  592
             HPL E+ +   +TC+GCK YG GK Y C +C++ LH++CA   P+L     HG  H+L 
Sbjct  17   NHPLTEVNVVGTYTCNGCKLYGVGKTYRCNECDYDLHEYCATCLPTLRN-TWHGPDHELN  75

Query  593  FHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
                P  + + +    C VC    +G  ++C+ CSF+ HP C    T   YP
Sbjct  76   LMSSPAHMTARV----CYVCRVYIQGMFYKCKHCSFESHPLCTHGPTHASYP  123



>emb|CAN64093.1| hypothetical protein VITISV_016055 [Vitis vinifera]
Length=252

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 85/193 (44%), Gaps = 16/193 (8%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E  H SH +HPL      + + C GCKE G G RY C+ CN+ LH  CA +  S  +H  
Sbjct  5    ENTHFSHPQHPLDLKNYQKPYICDGCKEQGFGSRYRCELCNYDLHADCAFT-DSTTSHKF  63

Query  572  HGQHQLLFHD-KPKQVKSGITRA---KCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
                   F D +P +  +   +     CD CGK   GF + C+   + +HPCC  L+ E+
Sbjct  64   FKACTFKFLDQRPGKCCNSHCKDCMRYCDACGKPIHGFVYHCKEKGWDLHPCCRNLTNEL  123

Query  740  KYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
                    L+    S  +       +Q     +VS    G +    V  C   +Y  H  
Sbjct  124  DIDGIKFHLRGTVSSKCIW-----CNQRNPPGSVS----GIRGWSYVSKCK--NYRFHVY  172

Query  920  CAKEMMNGLQENG  958
            CA EM+N + +NG
Sbjct  173  CATEMVNQVWKNG  185



>ref|XP_010658564.1| PREDICTED: uncharacterized protein LOC104881134 [Vitis vinifera]
 ref|XP_010658565.1| PREDICTED: uncharacterized protein LOC104881134 [Vitis vinifera]
 ref|XP_010658566.1| PREDICTED: uncharacterized protein LOC104881134 [Vitis vinifera]
 ref|XP_010658568.1| PREDICTED: uncharacterized protein LOC104881134 [Vitis vinifera]
 ref|XP_010658569.1| PREDICTED: uncharacterized protein LOC104881134 [Vitis vinifera]
Length=252

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 85/193 (44%), Gaps = 16/193 (8%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPL  571
            E  H SH +HPL      + + C GCKE G G RY C+ CN+ LH  CA +  S  +H  
Sbjct  5    ENTHFSHPQHPLDLKNYQKPYICDGCKEQGFGSRYRCELCNYDLHADCAFT-DSTTSHKF  63

Query  572  HGQHQLLFHD-KPKQVKSGITRA---KCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
                   F D +P +  +   +     CD CGK   GF + C+   + +HPCC  L+ E+
Sbjct  64   FKACTFKFLDQRPGKCCNSHCKDCMRYCDACGKPIHGFVYHCKEKGWDLHPCCRNLTNEL  123

Query  740  KYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
                    L+    S  +       +Q     +VS    G +    V  C   +Y  H  
Sbjct  124  DIDGIKFHLRGTVSSKCIW-----CNQRNPPGSVS----GIRGWSYVSKCK--NYRFHVY  172

Query  920  CAKEMMNGLQENG  958
            CA EM+N + +NG
Sbjct  173  CATEMVNQVWKNG  185



>ref|XP_008448327.1| PREDICTED: uncharacterized protein LOC103490554 [Cucumis melo]
 ref|XP_008448336.1| PREDICTED: uncharacterized protein LOC103490554 [Cucumis melo]
Length=297

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 69/162 (43%), Gaps = 21/162 (13%)
 Frame = +2

Query  452  FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGIT  631
            + C GCK  G+G R+ C  CNF LHD+CA  P  L +  +H     L    P+  +  I 
Sbjct  29   YICGGCKTSGSGSRFRCHSCNFDLHDYCANCPEKLISSSVHHHPLTLVVRNPEGAR--IN  86

Query  632  RAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY-PPHAHRLKLLPPSSGLQGSPA  808
               CD+C  +  G  +RC+ C F  HP C  L   +++     H L L  P SG      
Sbjct  87   DRICDICRDAVDGLFYRCKDCEFDAHPLCTQLPKSLRHLIDDKHYLNLQKPPSG------  140

Query  809  AGDQHGHAAAVSCGKCGKK-RAGRVYGCTACDYHLHAVCAKE  931
                        C  C K   +  VYGC  C  ++H  C  E
Sbjct  141  -----------GCAVCKKDCSSLWVYGCQICRVYIHFDCLWE  171



>emb|CDY07769.1| BnaA03g17420D [Brassica napus]
Length=233

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 4/111 (4%)
 Frame = +2

Query  416  KHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLF  595
             HPL E+ +   +TC+GCK YG GK Y C +C++ LH++CA   P+L        H+L  
Sbjct  17   NHPLTEVNVVGTYTCNGCKLYGVGKTYRCNECDYDLHEYCATCLPTLRNTWHAPDHELNL  76

Query  596  HDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
               P  + + +    C VC    +G  ++C+ CSF+ HP C    T   YP
Sbjct  77   MSSPAHMTARV----CYVCRVYIQGMFYKCKHCSFESHPLCTHGPTHASYP  123



>gb|AAD26948.1| hypothetical protein [Arabidopsis thaliana]
Length=167

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 59/117 (50%), Gaps = 10/117 (9%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQ-----QCNFQLHDFCALSPPSL  556
            ++ H SH +H L      + F C GC E G G RY C       C+F LH  CAL   S+
Sbjct  5    DISHFSHPQHNLKFDYTEKPFKCDGCNEVGIGSRYRCSGDNHGSCDFDLHAHCALPSASI  64

Query  557  NTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAML  727
             THP + +    F  +P     G  R  C+ C K   GF + C+AC F +HPCCAML
Sbjct  65   -THPFYKKCTFQFVARP----PGNERRYCNACEKDVSGFLYHCKACGFDLHPCCAML  116



>ref|NP_001144613.1| uncharacterized protein LOC100277629 [Zea mays]
 gb|ACG41796.1| hypothetical protein [Zea mays]
Length=264

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 79/184 (43%), Gaps = 21/184 (11%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ--CNFQLHDFCALSPPSLNTH  565
            E+ H SH +H L        F C GC E G G R+ C    C+  LH  CAL  P+   H
Sbjct  5    ELAHLSHPQHRLRLEHAETPFRCDGCGEVGIGARFRCPHPGCDHDLHRQCALPAPAPLRH  64

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P + +   +F     +   G     C+ CG+   G+ + CRAC F +HPCCA L   +  
Sbjct  65   PFYPRCAFVF---LARAPGGAGARYCNACGRDVAGYVYHCRACGFDLHPCCAALPHALDA  121

Query  746  PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCA  925
                 RL L P +    GS AA           C +CG +  G  Y      Y LH  C 
Sbjct  122  GAGV-RLHLHPDT----GSGAA-----------CHRCGHRGRGWSYRSQCRCYSLHVACV  165

Query  926  KEMM  937
             +M+
Sbjct  166  MDML  169



>ref|XP_010690591.1| PREDICTED: uncharacterized protein LOC104904101 [Beta vulgaris 
subsp. vulgaris]
Length=249

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 78/185 (42%), Gaps = 25/185 (14%)
 Frame = +2

Query  386  GEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ-CNFQLHDFCALSPPSLNT  562
             +E+ H  H +H L        F C+GCKE G G +Y C + C+F LH  CAL+  +LN 
Sbjct  10   NKELFHPIHPQHKLNLEYSNIPFNCNGCKEAGIGFKYTCHKFCDFNLHKSCALACSTLN-  68

Query  563  HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIK  742
            HP + +     H+ P     G     CD C    +GF + C+ C F +HPCC  L   + 
Sbjct  69   HPFYKKCHFQLHNLP----PGAILRLCDACHNEVQGFVYHCKKCGFDLHPCCVNLPQVLN  124

Query  743  YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
                   L L                     + SC  CG+K  G  Y      + LH  C
Sbjct  125  NGERDLYLHL-------------------KLSRSCHYCGRKGQGWAYVSKCKMFSLHVSC  165

Query  923  AKEMM  937
             K+++
Sbjct  166  VKKLL  170



>gb|EYU41773.1| hypothetical protein MIMGU_mgv1a024136mg, partial [Erythranthe 
guttata]
Length=262

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 86/193 (45%), Gaps = 18/193 (9%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYG-AGKRYACQQ--CNFQLHDFCALSPPSLN  559
            + + H  H  HPL        + C GCK  G AGKR+ C    C+F LHD+CA  P  L 
Sbjct  13   KSIDHFIHPGHPLTPFDGDTEYLCDGCKTVGGAGKRFRCSHSVCDFDLHDYCATCPRQLT  72

Query  560  THPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
            +  +H  H L    +  Q +  +    CDVC    +G  +RC+ C F +HP C  L  ++
Sbjct  73   SF-MHKPHALALVMRKGQSQR-VNERVCDVCKDPVEGLFYRCKECEFDVHPLCTQLPEKL  130

Query  740  KYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAV  919
            ++  H       P    L+ S  AG     + AV  G CG   +   Y C  C++ +H  
Sbjct  131  QHALHK------PHPLTLRSSQIAG-----SCAVCRGPCGS--STWRYRCGECNFDIHLE  177

Query  920  CAKEMMNGLQENG  958
            C    +   Q+ G
Sbjct  178  CILVPVVSCQQKG  190



>ref|XP_002271800.1| PREDICTED: uncharacterized protein LOC100252758 [Vitis vinifera]
Length=287

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +2

Query  395  MVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLH  574
            + H ++  H L E+   E F C GCK  G G RY C  C+  LH++C + P +L+T  +H
Sbjct  6    IEHFTNPGHSLTEVYGSEEFHCDGCKTPGNGPRYRCHTCDSTLHEYCGVCPSTLSTF-MH  64

Query  575  GQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
             QHQL    + +  +  +    C +C    +G  +RC  C F +HP C  +   +  P H
Sbjct  65   PQHQLKLEIRTQGRR--VNERLCTLCRDDVEGLFYRCTDCDFDIHPLCTKIPEYVPDPLH  122

Query  755  -AHRLKLLPPSSG  790
              H+LKL   SSG
Sbjct  123  PTHQLKLQTSSSG  135



>ref|XP_010509275.1| PREDICTED: uncharacterized protein LOC104785709 [Camelina sativa]
Length=191

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = +2

Query  419  HPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFH  598
            HPL E+     +TC+GCK YG GK Y C +C++ LH++CA  PPSL        H+L+ +
Sbjct  12   HPLTEVNGVGTYTCNGCKLYGEGKTYRCNECDYDLHEYCATCPPSLRNSCHGHDHELILY  71

Query  599  DKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAML  727
              P      +T   C VC    +G  + C+ C+F+ HP C  +
Sbjct  72   SGPTH----MTERSCYVCRVYIQGMFYICKNCNFESHPLCTHV  110



>gb|KDO48121.1| hypothetical protein CISIN_1g042921mg, partial [Citrus sinensis]
Length=317

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 6/137 (4%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            + + H +H  H L +      + C GCK  G G R+ C  C+F LH++C   P +L++  
Sbjct  8    KTIEHFTHPGHKLFQFNNDNWYLCKGCKTAGDGTRFRCHDCDFDLHEYCGTCPMTLSSF-  66

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCR-ACSFQMHPCCAMLSTEIKY  745
            +H QHQL   ++  Q      R  C VCG S +G  +RC+  C F +HP CA L  + ++
Sbjct  67   MHPQHQLNLVNRMPQATRQNVRF-CRVCGHSVEGLFYRCKLQCEFDVHPVCAQLPQQARH  125

Query  746  ---PPHAHRLKLLPPSS  787
               P H   L L P SS
Sbjct  126  VLDPSHPLTLTLQPLSS  142



>ref|XP_007200840.1| hypothetical protein PRUPE_ppa026298mg [Prunus persica]
 gb|EMJ02039.1| hypothetical protein PRUPE_ppa026298mg [Prunus persica]
Length=236

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 84/189 (44%), Gaps = 35/189 (19%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ--CNFQLHDFCALSPPSLNT  562
            +E+ H SH +H L +    +LF C+GC E G G  Y C Q  C+F LH +CA+ P  L  
Sbjct  5    DEIPHPSHPEHKLEQRWTGKLFMCNGCNEPGIGSHYTCPQSSCSFDLHMYCAI-PLGLFH  63

Query  563  HPLH-GQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEI  739
            HP   G    L    P+  +S      C+ CG+   GF + CR C   +HPCCA L  ++
Sbjct  64   HPFQRGCSFQLLPSPPENTRS------CNACGEKGTGFVYHCRGCKSNLHPCCAKLPMKL  117

Query  740  KYPPHAHRLKLLPPSSGLQGSPAAGDQHGH---AAAVSCGKCGKKRAGRVYGCTACDYHL  910
            +                      AGD + +        C +CG K  G  Y       +L
Sbjct  118  E----------------------AGDVNLYLYEKVKKPCQECGYKGKGWSYRSVDKKCYL  155

Query  911  HAVCAKEMM  937
            H  CAK+++
Sbjct  156  HVACAKKLI  164



>ref|XP_004246862.2| PREDICTED: uncharacterized protein LOC101250920 [Solanum lycopersicum]
Length=527

 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 77/175 (44%), Gaps = 17/175 (10%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H  H  H L        + C GCK  G GKR+ C +C+F LH++C   P +L++  LH  
Sbjct  287  HLLHPNHSLTLFDSNTKYVCDGCKTLGIGKRFNCSECDFDLHEYCGTCPMNLSSF-LHPY  345

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-A  757
            H L    +       + R  C+VC  S +G  +RC+ C F +HP C +L   +++  H  
Sbjct  346  HSLKLVTRMPHGNRQLDRI-CNVCCDSIEGLFYRCKTCEFDVHPLCTLLPQTLRHVLHEE  404

Query  758  HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
            H L+LL  S                  V C       + R Y C  CD+ +H  C
Sbjct  405  HPLRLLSSSES-------------RTCVICKGACNAFSWR-YRCALCDFDIHMEC  445


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 91/200 (46%), Gaps = 23/200 (12%)
 Frame = +2

Query  401  HSSHAKHPLV--EMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLH  574
            H +H KH L+    T+   + C GC  YG G RY C  C   LH+ CA  P  L +  +H
Sbjct  10   HFTH-KHSLILHHDTINPKYLCEGCMTYGFGTRYHCHACTSNLHEDCAKCPRILWSF-MH  67

Query  575  GQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
              H L   ++  Q  SG  RA C++C +  +G ++RC  C F +HP C +L   + +  H
Sbjct  68   PHHPLRLVERDHQ--SG-DRA-CNICRELIEGLSYRCEPCGFDVHPICTLLPETLNHILH  123

Query  755  A-HRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK-  928
              H L+LL  SS  QG             V C       + R Y C  C++ +H  C   
Sbjct  124  QPHPLRLL--SSIEQG----------ITCVICRGACNAFSWR-YRCALCNFDIHIRCVPI  170

Query  929  EMMNGLQENGINPPEKPSVL  988
            +  N     GI+    PS+L
Sbjct  171  QCQNKTTHRGISTYFPPSIL  190



>gb|EYU37744.1| hypothetical protein MIMGU_mgv1a012062mg [Erythranthe guttata]
Length=262

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 78/188 (41%), Gaps = 29/188 (15%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRY-----ACQQCNFQLHDFCALSPPS  553
             E+ H SH  H L        F C GCKE G G RY         CNF LH  CA+  PS
Sbjct  4    NEISHFSHPHHNLKFEYSEAPFKCDGCKEAGIGSRYRCCGGGGGHCNFDLHTHCAVPSPS  63

Query  554  LNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLST  733
            + +HP + +    F  +      G     C+ C K   GF + C +C F +HPCCA L  
Sbjct  64   I-SHPFYTKCSFQFMSRT----PGAVARYCNACEKDVAGFVYHCNSCGFDLHPCCAKLPM  118

Query  734  EIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLH  913
             +       +L L    S    SP             C +CG+K     Y  +   Y+LH
Sbjct  119  VLD--DGEIKLYLYKKVS----SP-------------CHRCGRKGRSWSYRSSCKKYNLH  159

Query  914  AVCAKEMM  937
              C KEM+
Sbjct  160  VACVKEML  167



>ref|XP_010478691.1| PREDICTED: uncharacterized protein LOC104757632 [Camelina sativa]
Length=234

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 80/182 (44%), Gaps = 25/182 (14%)
 Frame = +2

Query  422  PLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFHD  601
            PL ++     FTC GCK YG+GK Y C  C++ LHD CA  P +L T  +H QH+L    
Sbjct  19   PLTKVDTYGDFTCGGCKTYGSGKTYRCVLCDYDLHDHCATCPSTLLTF-MHPQHEL----  73

Query  602  KPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-AHRLKLLP  778
              K V +G     CD+C    +G  + C AC  + HP C      ++Y PH AH L+L  
Sbjct  74   --KLVVNG-AEHMCDICHGLVEGLYYSCEACCIKFHPLCTQQRQFLRYVPHSAHLLEL--  128

Query  779  PSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAKEMMNGLQENG  958
                         Q G  A+ +C  C        Y C  C   +H  C       + E  
Sbjct  129  ------------SQCG--ASNTCMVCRGAILSWRYKCDLCMLDVHVECVNSSTPAVTETQ  174

Query  959  IN  964
            ++
Sbjct  175  MD  176



>ref|XP_008775784.1| PREDICTED: uncharacterized protein LOC103696057 [Phoenix dactylifera]
Length=252

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 78/183 (43%), Gaps = 18/183 (10%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPP-SLNTHP  568
            E+ H SH +H L        F C GCKE G G R+ C  C+F LH  CAL+ P S+  HP
Sbjct  5    EITHFSHPQHKLRFEYAEVPFKCDGCKEAGIGSRFKCGLCDFDLHKQCALAAPSSILRHP  64

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +       +P     G     C+ C +   G  + C +C F +HPCCA L       
Sbjct  65   FYPKCAFYLLPRP----PGNAPRFCNACERDVAGLVYHCHSCGFDLHPCCAAL-------  113

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
            PH     +L       G       H   AA  C +CG+K     Y      Y+LH  C  
Sbjct  114  PH-----VLDAGGDGGGGELRLFLHRKVAA-PCHRCGRKGRSWSYTSACKQYNLHVACVM  167

Query  929  EMM  937
            E++
Sbjct  168  EIL  170



>ref|XP_010910318.1| PREDICTED: uncharacterized protein LOC105036256 [Elaeis guineensis]
Length=253

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 77/183 (42%), Gaps = 19/183 (10%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCAL-SPPSLNTHP  568
            E+ H  H +H L        F C GCKE G G R+ C  C++ LH  CAL +P S+  HP
Sbjct  5    EITHFGHPQHKLRFEYAEIPFKCDGCKEAGIGSRFKCSLCDYDLHKQCALAAPSSILRHP  64

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
             + +       +P     G     C+ C +   G  + C +C F +HPCCA L       
Sbjct  65   FYPKCAFYLLPRP----PGNGPRYCNACERDVSGLVYHCHSCGFDLHPCCANL-------  113

Query  749  PHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVCAK  928
            PH     +L   SG  G            +  C +CG+K     Y      Y+LH  C  
Sbjct  114  PH-----VLDADSGGGGELRLFLH--RKVSAPCHRCGRKGRSWSYRSACKQYNLHVACVM  166

Query  929  EMM  937
            EM+
Sbjct  167  EML  169



>gb|EYU27121.1| hypothetical protein MIMGU_mgv1a025457mg [Erythranthe guttata]
Length=366

 Score = 82.4 bits (202),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 82/183 (45%), Gaps = 31/183 (17%)
 Frame = +2

Query  407  SHAKHP------LVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHP  568
            SH  HP      +   TL  LF C+GCK    G  Y+C  C++ LH  C      + THP
Sbjct  12   SHFSHPHPLKLIVYNQTLNILFPCAGCKLKPYGVLYSCLDCDYFLHQSCFEMRKKI-THP  70

Query  569  LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
            LH +H L     P        R  CD CG++ KGF++ C+ CSF +H  CAML   + + 
Sbjct  71   LHKKHDLTLMINPAY------RLVCDACGETGKGFSYHCKPCSFDLHILCAMLPLSVTHE  124

Query  749  PH-AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKC---GKKRAGRVYGCTACDYHLHA  916
             H  H+L L   SS     P            SC  C   G ++   +Y C +C +  H 
Sbjct  125  SHKMHKLNLTSESS----YP--------VNKFSCDICLSVGSRQ--WLYRCKSCGFDAHL  170

Query  917  VCA  925
             CA
Sbjct  171  KCA  173



>ref|XP_010653882.1| PREDICTED: uncharacterized protein LOC104880120 [Vitis vinifera]
Length=290

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 77/183 (42%), Gaps = 19/183 (10%)
 Frame = +2

Query  389  EEMVHSSHAKHPLVEMTLPE----LFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSL  556
            + ++H    +HPL  M L +      TCSGC+   +G  Y C  CN+ LH  C+  P  L
Sbjct  6    DPIIHHFSHEHPLKRMNLQDQTTKTVTCSGCEFEASGWVYGCNTCNYFLHKPCSKMPEIL  65

Query  557  NTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTE  736
            N HP    H LL    P           CD C +   GF++ C  C   +H  CA L T 
Sbjct  66   N-HPFDPDHTLLLFPNPVYPGGAFI---CDACREIGTGFSYHCTECQIDLHNLCAFLPTS  121

Query  737  IKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
            + +  H H L L        GSP   ++        C   G K+   +Y C +C +  H 
Sbjct  122  VDHSSHHHTLDL------WSGSPYKNEE---FLCDICQDPGSKQW--LYRCNSCQFDAHM  170

Query  917  VCA  925
             CA
Sbjct  171  SCA  173


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 6/99 (6%)
 Frame = +2

Query  452  FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGIT  631
            F C  C+E G G  Y C +C   LH+ CA  P S++ H  H     L+   P + +  + 
Sbjct  88   FICDACREIGTGFSYHCTECQIDLHNLCAFLPTSVD-HSSHHHTLDLWSGSPYKNEEFL-  145

Query  632  RAKCDVCGK-STKGFTFRCRACSFQMHPCCAMLSTEIKY  745
               CD+C    +K + +RC +C F  H  CA++  + ++
Sbjct  146  ---CDICQDPGSKQWLYRCNSCQFDAHMSCALVDIQSQH  181



>ref|XP_009133208.1| PREDICTED: uncharacterized protein LOC103857738 [Brassica rapa]
Length=250

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 5/120 (4%)
 Frame = +2

Query  419  HPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQL-LF  595
            HPL ++     FTC GCK +G GK Y C  C++ LH+ CA   P+L +  +H QH+L L 
Sbjct  18   HPLTKVDGYGEFTCGGCKTFGFGKTYRCSWCDYNLHEHCATCSPTLFSF-IHPQHELKLV  76

Query  596  HDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-AHRLKL  772
               P+Q      +  C++C +  +G  ++C  C F +HP C  L   +++ PH AH L+L
Sbjct  77   FRGPEQTHH--EKRMCNICDEPAEGLFYQCHHCGFDVHPLCTQLPQRVRHVPHSAHPLEL  134



>gb|AFK36976.1| unknown [Lotus japonicus]
Length=261

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 79/188 (42%), Gaps = 25/188 (13%)
 Frame = +2

Query  377  NNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQ-CNFQLHDFCALSPPS  553
            N    E+ H SH KH L        F C GCKE G G RY C   C++ LH  CA+  PS
Sbjct  17   NTKCSEISHFSHPKHKLRFEYSEFPFKCDGCKEVGIGSRYKCSSICDYDLHMHCAIPSPS  76

Query  554  LNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLST  733
            L  HP + +    F  KP     G     C+ C K   GF + C  C F +HPCCA L  
Sbjct  77   L-YHPFYPKCSFQFLSKP----PGNIPRYCNACEKGVTGFVYHCMTCGFDLHPCCAKLPM  131

Query  734  EIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLH  913
             +       +L L    S    SP             C +CG+K     Y  +    +LH
Sbjct  132  VLD--DGEIKLYLYRKVS----SP-------------CHRCGQKGRSWSYRSSCKKCNLH  172

Query  914  AVCAKEMM  937
              C +EM+
Sbjct  173  VACVREMI  180



>ref|XP_009135902.1| PREDICTED: uncharacterized protein LOC103860043 [Brassica rapa]
Length=233

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 57/111 (51%), Gaps = 4/111 (4%)
 Frame = +2

Query  416  KHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLF  595
             HPL E+ +   +TC+GCK YG GK Y C +C++ LH++CA   P+L        H+L  
Sbjct  17   NHPLTEVNVVGTYTCNGCKLYGVGKTYRCNECDYDLHEYCATCLPTLRNTWHAPDHELNL  76

Query  596  HDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYP  748
               P  + + +    C VC    +G  ++C+ CSF+ HP C        YP
Sbjct  77   MSSPAHMTARV----CYVCRVYIQGMFYKCKHCSFESHPLCTHGPMHASYP  123



>gb|KCW66146.1| hypothetical protein EUGRSUZ_G03410 [Eucalyptus grandis]
Length=362

 Score = 82.0 bits (201),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 90/201 (45%), Gaps = 26/201 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLV--EMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTH  565
             ++H SH  HPL       P+  +CSGCK   AG  Y C  C++ LH  C+  PP +N H
Sbjct  7    SIIHFSHP-HPLTLNHQPQPQHASCSGCKLKTAGWTYGCAPCSYFLHISCSKMPPQIN-H  64

Query  566  PLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY  745
            P+   H +L          G+ R  CD CGK   GF++RC +C+  +H  CA +     +
Sbjct  65   PVDQYHHILTLIPTPVYPVGVFR--CDACGKQGSGFSYRCASCNLDLHITCASMPLTQTH  122

Query  746  PPHAHRLKLL--PPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGR-VYGCTACDYHLHA  916
            P H H L L   PP +                + SC  C    + + +Y C +C++  H 
Sbjct  123  PSHHHLLNLTFSPPYTN--------------RSFSCDICQNLGSSQWLYRCHSCEFDAHL  168

Query  917  VCAKEMMNGLQENGINPPEKP  979
             C    M    +N   PP+ P
Sbjct  169  SCT---MKKPAQNHQPPPQLP  186



>ref|XP_009609510.1| PREDICTED: uncharacterized protein LOC104103312 [Nicotiana tomentosiformis]
Length=224

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 70/168 (42%), Gaps = 14/168 (8%)
 Frame = +2

Query  401  HSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQ  580
            H +H +H L E      + C GCK  G GKRY C  C F LH++C   P  L++  +H  
Sbjct  11   HFTHPEHSLTEYDSNTGYLCDGCKIPGIGKRYRCHGCEFDLHEYCGTCPTILSSF-MHPY  69

Query  581  HQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKY-----  745
            H L    +  Q      R  C+VC  S +G  +RC  C F +HP C  L   +++     
Sbjct  70   HSLKLVVRKPQGNRQFDRI-CNVCCDSVEGLFYRCEICEFDVHPLCTQLPETLRHVLHQI  128

Query  746  -------PPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKR  868
                     H   LK L    G+   P   D +        GK G+ +
Sbjct  129  ACTVGDKKSHIDGLKELFEDLGVVWLPVDKDNNSGIEIDVAGKSGRNK  176



>gb|EYU35251.1| hypothetical protein MIMGU_mgv1a019158mg, partial [Erythranthe 
guttata]
Length=170

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 65/117 (56%), Gaps = 7/117 (6%)
 Frame = +2

Query  374  PNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPS  553
            P +  + + H +  KHPL  +T+ + F C+GC+E G+G R+ C+ C+  LH+FCA  P +
Sbjct  4    PPSKKQTVRHFTDPKHPLHLVTISDEFQCNGCRELGSGTRFRCKACDVNLHEFCATCPAT  63

Query  554  LNTHPLHGQHQL-LFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA  721
            + +  L  ++ L L +++P       T   CD+C    KG  + C  C+ ++HP C 
Sbjct  64   IRSSVLQIKYPLTLVNERPA------TERICDICRDPVKGLHYSCPPCAVEVHPLCT  114



>ref|XP_002323327.2| DC1 domain-containing family protein [Populus trichocarpa]
 gb|EEF05088.2| DC1 domain-containing family protein [Populus trichocarpa]
Length=675

 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 81/184 (44%), Gaps = 13/184 (7%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLP-----ELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSL  556
            E+ H SH  HPL+ +        EL  CSGC E   G  Y+C  C F LH  CA  P  +
Sbjct  2    EVEHFSHPVHPLILINQVLEYSGELVICSGCDEPIWGPCYSCTSCYFFLHKTCAELPREI  61

Query  557  NTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTE  736
              H +H +H L    KP      I    CD+C K+ + F + C  C F +H  CA     
Sbjct  62   KRH-IHFKHPLHLLAKPPS--HYILGCICDLCKKTCESFVYHCSVCKFDLHIKCAFQQCF  118

Query  737  IKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
             +    AH+   +  S       +  +Q  H   V C  C +  +G  Y CT+C++ LH 
Sbjct  119  FEVDSQAHQFAHIDHS-----LISNEEQEFHVEGVMCSGCDEPISGPSYRCTSCNFFLHK  173

Query  917  VCAK  928
             C +
Sbjct  174  KCTE  177


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 71/176 (40%), Gaps = 18/176 (10%)
 Frame = +2

Query  407  SHAKHPLVEMTLPEL----FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLH  574
            +H  H L+     E       CSGC E  +G  Y C  CNF LH  C   P  +    LH
Sbjct  129  AHIDHSLISNEEQEFHVEGVMCSGCDEPISGPSYRCTSCNFFLHKKCTELPQEIKR-CLH  187

Query  575  GQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
             QH L    KP    +G  +  CD+C K+ K F +RC  C+F +   CA+     +    
Sbjct  188  PQHPLHLLAKPPAHHTG--KWMCDLCNKTCKSFVYRCSFCNFYLDIKCALPPCLSEVEGQ  245

Query  755  AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
             H+   LP S  L+             + +C  CG       + CT C   +H  C
Sbjct  246  EHQFICLPKSLPLK-----------IVSFTCNACGTDGDDSPFVCTMCQLIVHKTC  290


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 72/191 (38%), Gaps = 29/191 (15%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLPELF-----TCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSL  556
            E+    H KHPL  +  P         C  CK+      Y C  C F LH  CA      
Sbjct  60   EIKRHIHFKHPLHLLAKPPSHYILGCICDLCKKTCESFVYHCSVCKFDLHIKCAFQQCFF  119

Query  557  NTHP-----LHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCA  721
                      H  H L+ +++ +    G+    C  C +   G ++RC +C+F +H  C 
Sbjct  120  EVDSQAHQFAHIDHSLISNEEQEFHVEGVM---CSGCDEPISGPSYRCTSCNFFLHKKCT  176

Query  722  MLSTEIK---YPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCT  892
             L  EIK   +P H   L   PP+              H     C  C K     VY C+
Sbjct  177  ELPQEIKRCLHPQHPLHLLAKPPAH-------------HTGKWMCDLCNKTCKSFVYRCS  223

Query  893  ACDYHLHAVCA  925
             C+++L   CA
Sbjct  224  FCNFYLDIKCA  234



>ref|XP_010068899.1| PREDICTED: uncharacterized protein LOC104455890 [Eucalyptus grandis]
Length=229

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 69/142 (49%), Gaps = 13/142 (9%)
 Frame = +2

Query  362  TSPQ----PNNGGEEMVHSSHAKHPLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHD  529
            T+PQ    P      + H  H  HPL+++ +   F C GC   G G+ Y C  C+F LH+
Sbjct  12   TTPQAQAIPPQASRTLNHGLH-PHPLLDIYINREFKCDGCNALGQGRHYRCSGCDFDLHE  70

Query  530  FCALSPPSLNTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMH  709
             CA  P +L++H LH  H L        V   + R  C +CG+  +G  +RC  C F +H
Sbjct  71   RCATCPATLSSH-LHPSHPL------DLVCLSLGRV-CGLCGEEVRGLYYRCGPCGFDIH  122

Query  710  PCCAMLSTEIKYPPHAHRLKLL  775
            P C  L   +++  H H L  L
Sbjct  123  PLCTDLPATVEHAVHPHLLLTL  144



>ref|XP_008458931.1| PREDICTED: uncharacterized protein LOC103498191 [Cucumis melo]
Length=272

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/190 (27%), Positives = 80/190 (42%), Gaps = 25/190 (13%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLP---ELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNT  562
            E+V  +H  HP   + L    E +TC GCKE G G RY C +C+F LH  C  +   L++
Sbjct  6    EIVLRNHPSHPWHRLELKNYVEPYTCDGCKEKGFGPRYRCGRCDFDLHQACTYTSLRLSS  65

Query  563  HPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLS----  730
            H      +  F   P +        +CD C K+ KG+ F C+     +HPCC  L     
Sbjct  66   HDYFPGSKFKFLRNPPKPCHPECIIRCDACRKTIKGYVFHCKEDDIDLHPCCRNLKQSYQ  125

Query  731  -TEIKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYH  907
              ++K+  H  +++        +     G+ +G +    C                 +YH
Sbjct  126  IEDVKFKLH-RKMREKCMWCNRKNLKDGGNDNGWSYVSKCD----------------NYH  168

Query  908  LHAVCAKEMM  937
            +H  C  EM+
Sbjct  169  VHVACVTEMV  178



>ref|XP_010456774.1| PREDICTED: uncharacterized protein LOC104738272 [Camelina sativa]
Length=328

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 63/118 (53%), Gaps = 9/118 (8%)
 Frame = +2

Query  422  PLVEMTLPELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLHGQHQLLFHD  601
            PL ++     FTC GCK YG+GK Y C  C++ LHD CA  P +L T  +H QH+L    
Sbjct  19   PLTKVDKYGDFTCGGCKTYGSGKTYRCVLCDYDLHDHCATCPSTLLTF-MHPQHEL----  73

Query  602  KPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH-AHRLKL  772
              K V +G     CD+C    +G  + C AC  + HP C      ++Y PH AH L+L
Sbjct  74   --KLVVNG-AEHTCDICHGLVEGLYYSCEACCIKFHPLCTQQRQFLRYVPHSAHLLEL  128



>ref|XP_011039456.1| PREDICTED: uncharacterized protein LOC105136013 isoform X1 [Populus 
euphratica]
Length=674

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 81/184 (44%), Gaps = 13/184 (7%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLP-----ELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSL  556
            E+ H SH  HPL+ +        EL  CSGC E   G  Y+C  C F LH  CA  P  +
Sbjct  2    EVEHFSHPVHPLILINQELEYCGELVICSGCDEPIWGPCYSCTSCYFFLHKKCAELPREI  61

Query  557  NTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTE  736
              H +H +H L    KP      I    CD+C K+ + F + C  C F +H  CA     
Sbjct  62   KRH-IHFKHPLHLLAKPP--SHYIWGCICDLCKKTCESFVYHCSVCKFDLHIKCAFQQCF  118

Query  737  IKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
             +    AH+   +  S       +  +Q  H   V C  C +  +G  Y CT+C++ LH 
Sbjct  119  FEVDGQAHQFAHIDHS-----LISNEEQEFHVEGVMCSGCDEPISGPSYRCTSCNFFLHK  173

Query  917  VCAK  928
             C +
Sbjct  174  KCTE  177


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 71/176 (40%), Gaps = 18/176 (10%)
 Frame = +2

Query  407  SHAKHPLVEMTLPEL----FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLH  574
            +H  H L+     E       CSGC E  +G  Y C  CNF LH  C   P  +    LH
Sbjct  129  AHIDHSLISNEEQEFHVEGVMCSGCDEPISGPSYRCTSCNFFLHKKCTELPQEIKR-CLH  187

Query  575  GQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
             QH L    KP    +   +  CD+C K+ K F +RC  C+F +   CA+    ++    
Sbjct  188  PQHPLHLSAKPPAHHTW--KWMCDLCNKTCKSFVYRCSFCNFYLDIKCALPQCLLEVEGQ  245

Query  755  AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
             H+   LP S  L+             + +C  CG       + CT C   +H  C
Sbjct  246  EHQFICLPKSLPLK-----------IVSFTCNACGTDGDDSPFVCTMCQLIVHKTC  290



>ref|XP_011039457.1| PREDICTED: uncharacterized protein LOC105136013 isoform X2 [Populus 
euphratica]
Length=649

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 81/184 (44%), Gaps = 13/184 (7%)
 Frame = +2

Query  392  EMVHSSHAKHPLVEMTLP-----ELFTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSL  556
            E+ H SH  HPL+ +        EL  CSGC E   G  Y+C  C F LH  CA  P  +
Sbjct  2    EVEHFSHPVHPLILINQELEYCGELVICSGCDEPIWGPCYSCTSCYFFLHKKCAELPREI  61

Query  557  NTHPLHGQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTE  736
              H +H +H L    KP      I    CD+C K+ + F + C  C F +H  CA     
Sbjct  62   KRH-IHFKHPLHLLAKPP--SHYIWGCICDLCKKTCESFVYHCSVCKFDLHIKCAFQQCF  118

Query  737  IKYPPHAHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHA  916
             +    AH+   +  S       +  +Q  H   V C  C +  +G  Y CT+C++ LH 
Sbjct  119  FEVDGQAHQFAHIDHS-----LISNEEQEFHVEGVMCSGCDEPISGPSYRCTSCNFFLHK  173

Query  917  VCAK  928
             C +
Sbjct  174  KCTE  177


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 71/176 (40%), Gaps = 18/176 (10%)
 Frame = +2

Query  407  SHAKHPLVEMTLPEL----FTCSGCKEYGAGKRYACQQCNFQLHDFCALSPPSLNTHPLH  574
            +H  H L+     E       CSGC E  +G  Y C  CNF LH  C   P  +    LH
Sbjct  129  AHIDHSLISNEEQEFHVEGVMCSGCDEPISGPSYRCTSCNFFLHKKCTELPQEIKR-CLH  187

Query  575  GQHQLLFHDKPKQVKSGITRAKCDVCGKSTKGFTFRCRACSFQMHPCCAMLSTEIKYPPH  754
             QH L    KP    +   +  CD+C K+ K F +RC  C+F +   CA+    ++    
Sbjct  188  PQHPLHLSAKPPAHHTW--KWMCDLCNKTCKSFVYRCSFCNFYLDIKCALPQCLLEVEGQ  245

Query  755  AHRLKLLPPSSGLQGSPAAGDQHGHAAAVSCGKCGKKRAGRVYGCTACDYHLHAVC  922
             H+   LP S  L+             + +C  CG       + CT C   +H  C
Sbjct  246  EHQFICLPKSLPLK-----------IVSFTCNACGTDGDDSPFVCTMCQLIVHKTC  290



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3249488224448