BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c93148_g1_i1 len=140 path=[1:0-139]

Length=140
                                                                      Score     E

ref|XP_007029212.1|  Dicer-like protein isoform 5                     84.3    3e-17   
ref|XP_007029214.1|  Dicer-like protein isoform 7                     84.3    3e-17   
ref|XP_007029210.1|  Dicer-like protein isoform 3                     84.3    3e-17   
ref|XP_007029213.1|  Dicer-like protein isoform 6                     84.3    3e-17   
ref|XP_007029208.1|  Dicer-like protein isoform 1                     84.3    3e-17   
ref|XP_007029209.1|  Dicer-like protein isoform 2                     84.3    4e-17   
gb|KDO45679.1|  hypothetical protein CISIN_1g0030621mg                81.6    1e-16   
ref|XP_011015091.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  82.4    2e-16   
ref|XP_011015068.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  82.4    2e-16   
ref|XP_006480490.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  82.4    2e-16   
ref|XP_006428678.1|  hypothetical protein CICLE_v10010911mg           82.4    2e-16   
ref|XP_006480488.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  82.0    2e-16   
ref|XP_011015099.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  82.0    2e-16   
ref|XP_002315119.1|  hypothetical protein POPTR_0010s18870g           82.0    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006428679.1|  hypothetical protein CICLE_v10010912mg           81.6    4e-16   
ref|XP_006480493.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  81.3    4e-16   
ref|XP_010101236.1|  Endoribonuclease Dicer-2-like protein            81.3    5e-16   
ref|XP_008370841.1|  PREDICTED: endoribonuclease Dicer homolog 2      79.0    3e-15   
emb|CDP04170.1|  unnamed protein product                              78.2    5e-15   
ref|XP_002514810.1|  ATP binding protein, putative                    78.2    5e-15   Ricinus communis
ref|XP_010312604.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  77.8    7e-15   
ref|XP_010312606.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  77.8    7e-15   
ref|XP_010312607.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  77.8    7e-15   
ref|XP_008218472.1|  PREDICTED: endoribonuclease Dicer homolog 2      77.0    1e-14   
ref|XP_007208392.1|  hypothetical protein PRUPE_ppa000240mg           77.0    1e-14   
ref|XP_009340367.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  76.3    2e-14   
ref|XP_009361581.1|  PREDICTED: endoribonuclease Dicer homolog 2      75.9    4e-14   
gb|EYU39730.1|  hypothetical protein MIMGU_mgv1a0003142mg             75.5    4e-14   
ref|XP_011006570.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  75.1    5e-14   
ref|XP_004304823.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  74.7    9e-14   
ref|XP_010673887.1|  PREDICTED: endoribonuclease Dicer homolog 2      74.3    1e-13   
ref|XP_008373031.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  73.6    1e-13   
ref|XP_008373030.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  73.6    1e-13   
ref|XP_007216896.1|  hypothetical protein PRUPE_ppa019601mg           73.6    2e-13   
ref|XP_008240740.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  73.2    2e-13   
ref|XP_008443670.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  73.2    3e-13   
ref|XP_008443674.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  73.2    3e-13   
ref|XP_008443676.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  73.2    3e-13   
ref|XP_008443675.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  73.2    3e-13   
ref|XP_011084676.1|  PREDICTED: endoribonuclease Dicer homolog 2      73.2    3e-13   
ref|XP_002312197.1|  hypothetical protein POPTR_0008s07580g           72.8    4e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009348591.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  72.0    4e-13   
ref|XP_009348590.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  72.4    4e-13   
ref|XP_004139098.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  72.4    5e-13   
ref|XP_007216887.1|  hypothetical protein PRUPE_ppa020875mg           71.6    8e-13   
ref|XP_008240779.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  71.2    9e-13   
ref|XP_004303843.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  71.6    1e-12   
ref|XP_010549776.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  70.9    2e-12   
ref|XP_010549772.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  70.5    2e-12   
ref|XP_007217819.1|  hypothetical protein PRUPE_ppa027063mg           69.3    4e-12   
ref|XP_010249397.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  69.3    6e-12   
emb|CAX18337.1|  dicel-like 2                                         66.2    7e-12   Nicotiana benthamiana
ref|XP_010249398.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  68.9    7e-12   
ref|XP_008392375.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  68.2    1e-11   
ref|XP_008351646.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  68.2    1e-11   
ref|XP_010649218.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  68.6    1e-11   
ref|XP_010649215.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  68.6    1e-11   
emb|CAN77284.1|  hypothetical protein VITISV_043738                   68.6    1e-11   Vitis vinifera
ref|XP_010649214.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  68.6    1e-11   
emb|CBI17597.3|  unnamed protein product                              68.6    1e-11   
ref|XP_010649216.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  68.6    1e-11   
ref|XP_010088523.1|  Endoribonuclease Dicer-2-like protein            67.0    3e-11   
ref|XP_010038609.1|  PREDICTED: endoribonuclease Dicer homolog 2      67.0    4e-11   
gb|KCW84635.1|  hypothetical protein EUGRSUZ_B01461                   67.0    4e-11   
emb|CDO96788.1|  unnamed protein product                              66.6    5e-11   
ref|XP_006586847.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  66.6    6e-11   
ref|XP_006586846.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  66.2    6e-11   
ref|XP_003534774.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  66.2    6e-11   
gb|KHN23014.1|  Endoribonuclease Dicer like 2                         66.2    6e-11   
gb|ACE60552.1|  dicer-like protein 2                                  66.2    6e-11   Brassica rapa
ref|XP_009130358.1|  PREDICTED: endoribonuclease Dicer homolog 2      66.2    6e-11   
emb|CDY43132.1|  BnaA05g32540D                                        66.2    6e-11   
ref|XP_006408318.1|  hypothetical protein EUTSA_v10019898mg           66.2    6e-11   
ref|XP_010485670.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  66.2    6e-11   
ref|XP_010485666.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  66.2    6e-11   
ref|XP_002884369.1|  hypothetical protein ARALYDRAFT_317213           66.2    7e-11   
ref|XP_010485668.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  66.2    7e-11   
ref|XP_010508779.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  66.2    7e-11   
ref|XP_010508629.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  66.2    7e-11   
ref|XP_010508928.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  66.2    7e-11   
emb|CDY50692.1|  BnaC05g47910D                                        66.2    7e-11   
ref|XP_006300010.1|  hypothetical protein CARUB_v10016233mg           66.2    7e-11   
ref|XP_003535104.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  65.5    1e-10   
gb|ABF19797.1|  dicer-like 2 spliceform 1                             65.1    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566199.4|  endoribonuclease Dicer-like 2                       65.1    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|ABF19798.1|  dicer-like 2 spliceform 2                             64.7    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078101.1|  endoribonuclease Dicer-like 2                    64.7    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAF26098.1|AC012328_1  unknown protein                             65.1    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147466.1|  hypothetical protein PHAVU_006G127100g           63.9    5e-10   
emb|CDO96786.1|  unnamed protein product                              62.4    8e-10   
emb|CDP06207.1|  unnamed protein product                              62.4    1e-09   
emb|CDO96789.1|  unnamed protein product                              62.4    1e-09   
gb|KEH20231.1|  endoribonuclease dicer-like protein                   62.4    2e-09   
gb|KHG30500.1|  hypothetical protein F383_12835                       62.0    2e-09   
ref|XP_007147469.1|  hypothetical protein PHAVU_006G127200g           62.0    2e-09   
ref|XP_007147294.1|  hypothetical protein PHAVU_006G111800g           61.6    2e-09   
gb|KDP26899.1|  hypothetical protein JCGZ_18057                       60.8    2e-09   
gb|AES64802.2|  endoribonuclease dicer-like protein                   61.6    3e-09   
ref|XP_003594551.1|  Endoribonuclease Dicer                           61.6    3e-09   
ref|XP_004486471.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  61.2    4e-09   
ref|XP_007140643.1|  hypothetical protein PHAVU_008G129500g           61.2    4e-09   
gb|EMS67761.1|  Endoribonuclease Dicer-like protein 2a                59.7    8e-09   
ref|XP_010229604.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  59.3    2e-08   
ref|XP_004982514.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  59.3    2e-08   
ref|XP_004982513.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  59.3    2e-08   
ref|XP_002464289.1|  hypothetical protein SORBIDRAFT_01g015666        58.5    2e-08   Sorghum bicolor [broomcorn]
gb|AFW68290.1|  hypothetical protein ZEAMMB73_539070                  58.5    2e-08   
ref|XP_006651573.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  58.5    3e-08   
ref|XP_008681083.1|  PREDICTED: uncharacterized protein LOC100192...  58.5    3e-08   
ref|XP_008681082.1|  PREDICTED: uncharacterized protein LOC100192...  58.5    3e-08   
ref|XP_008681081.1|  PREDICTED: uncharacterized protein LOC100192...  58.5    3e-08   
dbj|BAD34005.1|  CAF protein-like                                     58.5    4e-08   Oryza sativa Japonica Group [Japonica rice]
sp|Q69LX2.2|DCL2B_ORYSJ  RecName: Full=Endoribonuclease Dicer hom...  58.5    4e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEE59414.1|  hypothetical protein OsJ_11564                        58.5    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982511.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  58.2    4e-08   
ref|XP_004982510.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  58.2    4e-08   
ref|NP_001050564.1|  Os03g0583900                                     58.5    4e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75643.1|  hypothetical protein OsI_12390                        58.2    4e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_004982509.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  58.2    4e-08   
gb|AAS07189.1|  putative ribonuclease III, 5'-partial (with alter...  58.2    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982512.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  57.8    4e-08   
gb|KEH42074.1|  endoribonuclease dicer-like protein                   58.2    4e-08   
gb|KHG30499.1|  hypothetical protein F383_12835                       58.2    5e-08   
ref|XP_002991514.1|  hypothetical protein SELMODRAFT_429802           57.4    5e-08   
ref|XP_006844770.1|  hypothetical protein AMTR_s00016p00258500        57.8    6e-08   
ref|XP_010233062.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  57.8    6e-08   
ref|XP_010233057.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  57.8    6e-08   
ref|XP_002991516.1|  hypothetical protein SELMODRAFT_448444           57.8    6e-08   
ref|XP_002979043.1|  hypothetical protein SELMODRAFT_444049           57.8    6e-08   
ref|XP_002991513.1|  hypothetical protein SELMODRAFT_429800           57.4    6e-08   
ref|XP_004173421.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  56.2    7e-08   
gb|AFW68291.1|  hypothetical protein ZEAMMB73_565304                  57.0    7e-08   
ref|XP_008644683.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  56.6    8e-08   
ref|XP_008644682.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  56.6    8e-08   
ref|XP_008644676.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  56.6    1e-07   
ref|XP_008644681.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  56.6    1e-07   
ref|XP_008644678.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  56.6    1e-07   
gb|AEC12444.1|  ribonuclease III family protein DCL3                  54.7    6e-07   
gb|KHG13242.1|  Endoribonuclease Dicera                               54.7    7e-07   
ref|NP_001062844.1|  Os09g0315100                                     52.4    1e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KHN43108.1|  Endoribonuclease Dicer like 2                         52.0    4e-06   
ref|XP_003553782.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  52.0    5e-06   
ref|XP_006604892.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  52.0    5e-06   
ref|XP_002464290.1|  hypothetical protein SORBIDRAFT_01g015670        52.4    5e-06   Sorghum bicolor [broomcorn]
ref|XP_011002832.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  52.0    5e-06   
ref|XP_011002830.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  52.0    5e-06   
ref|XP_011002831.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  52.0    5e-06   
ref|XP_011002834.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  52.0    5e-06   
ref|XP_011002828.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  52.0    5e-06   
emb|CDP19693.1|  unnamed protein product                              51.6    7e-06   
ref|XP_008664845.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  51.6    8e-06   
ref|XP_008664844.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  51.6    8e-06   
ref|XP_008664847.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  51.6    9e-06   
tpg|DAA49563.1|  TPA: hypothetical protein ZEAMMB73_299457            51.6    9e-06   
ref|XP_008664848.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  51.6    9e-06   
tpg|DAA49562.1|  TPA: hypothetical protein ZEAMMB73_299457            51.6    9e-06   
tpg|DAA49561.1|  TPA: hypothetical protein ZEAMMB73_299457            51.2    9e-06   
gb|EMT13587.1|  Endoribonuclease Dicer-3b-like protein                50.8    1e-05   
gb|KDP34010.1|  hypothetical protein JCGZ_07581                       50.8    1e-05   
gb|KHG04216.1|  Endoribonuclease Dicer -like protein                  50.4    2e-05   
ref|XP_002324204.2|  hypothetical protein POPTR_0018s08340g           50.1    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006661878.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  50.1    2e-05   
ref|XP_010236618.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  50.1    3e-05   
ref|XP_007012462.1|  Endoribonuclease Dicera, putative isoform 2      49.7    3e-05   
ref|XP_007012461.1|  Ribonuclease III, putative isoform 1             49.7    3e-05   
gb|KHG18654.1|  Dicer-like protein 4                                  49.7    4e-05   
gb|ABR17101.1|  unknown                                               49.3    4e-05   Picea sitchensis
ref|XP_007012011.1|  Dicer-like protein isoform 2                     49.3    4e-05   
ref|XP_007012010.1|  Dicer-like protein, putative isoform 1           49.3    4e-05   
ref|XP_009400626.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  49.3    5e-05   
ref|XP_002467056.1|  hypothetical protein SORBIDRAFT_01g018890        49.3    5e-05   Sorghum bicolor [broomcorn]
ref|XP_001772316.1|  predicted protein                                48.9    6e-05   
gb|ABV31246.1|  dicer-like 4                                          48.9    6e-05   Physcomitrella patens
ref|XP_006594229.1|  PREDICTED: dicer-like protein 4-like isoform X3  48.9    7e-05   
ref|XP_006594228.1|  PREDICTED: dicer-like protein 4-like isoform X2  48.9    7e-05   
ref|XP_006594227.1|  PREDICTED: dicer-like protein 4-like isoform X1  48.9    7e-05   
gb|KHN18588.1|  Dicer-like protein 4                                  48.9    7e-05   
ref|XP_006600705.1|  PREDICTED: dicer-like protein 4-like isoform X2  48.9    7e-05   
gb|KHN22101.1|  Dicer-like protein 4                                  48.9    7e-05   
ref|XP_003550797.1|  PREDICTED: dicer-like protein 4-like isoform X1  48.9    7e-05   
ref|XP_004508388.1|  PREDICTED: dicer-like protein 4-like             48.5    8e-05   
ref|XP_006400601.1|  hypothetical protein EUTSA_v100124260mg          48.5    9e-05   
gb|EEE51167.1|  hypothetical protein OsJ_31945                        48.5    9e-05   Oryza sativa Japonica Group [Japonica rice]
sp|Q7XD96.2|DCL3B_ORYSJ  RecName: Full=Endoribonuclease Dicer hom...  48.5    9e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008443889.1|  PREDICTED: dicer-like protein 4 isoform X3       48.5    9e-05   
ref|XP_004162460.1|  PREDICTED: LOW QUALITY PROTEIN: dicer-like p...  48.5    9e-05   
ref|XP_008443891.1|  PREDICTED: dicer-like protein 4 isoform X4       48.5    1e-04   
ref|XP_008443888.1|  PREDICTED: dicer-like protein 4 isoform X2       48.5    1e-04   
ref|XP_008443887.1|  PREDICTED: dicer-like protein 4 isoform X1       48.5    1e-04   
gb|KGN65222.1|  hypothetical protein Csa_1G267180                     48.5    1e-04   
ref|XP_004146733.1|  PREDICTED: dicer-like protein 4-like             48.5    1e-04   
gb|ABB20894.1|  dicer-like protein                                    48.1    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_007155126.1|  hypothetical protein PHAVU_003G1757001g          48.1    1e-04   
gb|KDO73670.1|  hypothetical protein CISIN_1g0003792mg                48.1    1e-04   
gb|EYU29223.1|  hypothetical protein MIMGU_mgv1a0001672mg             48.1    1e-04   
gb|KDO73669.1|  hypothetical protein CISIN_1g0003792mg                48.1    1e-04   
gb|ABV31245.1|  dicer-like 3                                          48.1    1e-04   Physcomitrella patens
ref|XP_006474520.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  48.1    1e-04   
ref|XP_001766164.1|  dsRNA-specific nuclease dicer and related ri...  48.1    1e-04   
ref|XP_006474519.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  48.1    1e-04   
ref|XP_010047157.1|  PREDICTED: dicer-like protein 4 isoform X2       48.1    1e-04   
ref|XP_010047156.1|  PREDICTED: dicer-like protein 4 isoform X1       48.1    1e-04   
ref|XP_010535851.1|  PREDICTED: LOW QUALITY PROTEIN: dicer-like p...  48.1    1e-04   
ref|XP_010520559.1|  PREDICTED: LOW QUALITY PROTEIN: dicer-like p...  48.1    1e-04   
ref|XP_007204799.1|  hypothetical protein PRUPE_ppa000144mg           47.8    1e-04   
emb|CDY35811.1|  BnaC09g37430D                                        47.8    1e-04   
emb|CDX92469.1|  BnaA10g15080D                                        47.8    2e-04   
ref|XP_008243098.1|  PREDICTED: dicer-like protein 4                  47.8    2e-04   
ref|XP_004288753.1|  PREDICTED: dicer-like protein 4-like             47.8    2e-04   
ref|XP_004501416.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  47.8    2e-04   
ref|XP_006452950.1|  hypothetical protein CICLE_v10007239mg           47.8    2e-04   
ref|XP_006452951.1|  hypothetical protein CICLE_v10007239mg           47.8    2e-04   
ref|XP_010556639.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  47.8    2e-04   
ref|XP_010556636.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  47.8    2e-04   
ref|XP_008357238.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  47.4    2e-04   
ref|XP_008357237.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  47.4    2e-04   
ref|XP_010049291.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...  47.4    2e-04   
ref|XP_010049290.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...  47.4    2e-04   
ref|XP_002308384.2|  hypothetical protein POPTR_0006s20310g           47.4    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_009359046.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  47.4    2e-04   
ref|XP_011033477.1|  PREDICTED: dicer-like protein 4                  47.4    2e-04   
ref|NP_001154662.2|  endoribonuclease Dicer-like 3                    47.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006852760.1|  hypothetical protein AMTR_s00033p00127000        47.4    2e-04   
ref|NP_001154663.2|  endoribonuclease Dicer-like 3                    47.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189978.1|  endoribonuclease Dicer-like 3                       47.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KEH32166.1|  endoribonuclease dicer-like protein                   47.0    3e-04   
gb|AES73487.2|  endoribonuclease dicer-like protein                   47.0    3e-04   
ref|XP_010541703.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...  47.0    3e-04   
ref|XP_003603236.1|  Endoribonuclease Dicer-like protein              47.0    3e-04   
ref|XP_010541702.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...  47.0    3e-04   
ref|XP_010648401.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  47.0    3e-04   
ref|XP_010648400.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  47.0    3e-04   
emb|CBI20740.3|  unnamed protein product                              47.0    3e-04   
emb|CBI38730.3|  unnamed protein product                              46.6    4e-04   
ref|XP_010661522.1|  PREDICTED: endoribonuclease Dicer homolog 1      46.6    4e-04   
gb|AIO05700.1|  putative endoribonuclease dicer-like protein 1        46.6    4e-04   
gb|KDP38631.1|  hypothetical protein JCGZ_03984                       46.2    4e-04   
ref|XP_009381868.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  46.2    4e-04   
ref|XP_008235739.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  46.6    5e-04   
gb|KFK44833.1|  hypothetical protein AALP_AA1G308600                  46.2    5e-04   
gb|KFK44835.1|  hypothetical protein AALP_AA1G308600                  46.2    5e-04   
gb|KFK44834.1|  hypothetical protein AALP_AA1G308600                  46.2    5e-04   
ref|XP_008358840.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  46.2    5e-04   
gb|KDO59383.1|  hypothetical protein CISIN_1g0003801mg                45.8    5e-04   
gb|AIO05701.1|  putative endoribonuclease dicer 3a-like protein 3a    46.2    5e-04   
ref|XP_009335261.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  46.2    5e-04   
ref|XP_002875633.1|  hypothetical protein ARALYDRAFT_484824           46.2    5e-04   
ref|XP_009335262.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  46.2    5e-04   
ref|XP_006848760.1|  hypothetical protein AMTR_s00026p00051870        45.8    6e-04   
ref|XP_007220573.1|  hypothetical protein PRUPE_ppa000070mg           46.2    6e-04   
ref|NP_001289826.1|  endoribonuclease Dicer homolog 3a                46.2    6e-04   
gb|KFK32317.1|  hypothetical protein AALP_AA6G226200                  46.2    6e-04   
ref|XP_008244191.1|  PREDICTED: endoribonuclease Dicer homolog 1      46.2    6e-04   
ref|XP_002978277.1|  hypothetical protein SELMODRAFT_108314           46.2    6e-04   
ref|XP_008337204.1|  PREDICTED: dicer-like protein 4                  45.8    6e-04   
ref|XP_006361520.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  45.8    6e-04   
ref|XP_006473958.1|  PREDICTED: dicer-like protein 4-like isoform X2  45.8    7e-04   
ref|XP_006473957.1|  PREDICTED: dicer-like protein 4-like isoform X1  45.8    7e-04   
ref|XP_006473960.1|  PREDICTED: dicer-like protein 4-like isoform X4  45.8    7e-04   
ref|XP_002966292.1|  hypothetical protein SELMODRAFT_86110            45.8    7e-04   
ref|XP_006473959.1|  PREDICTED: dicer-like protein 4-like isoform X3  45.8    7e-04   
ref|XP_009358497.1|  PREDICTED: dicer-like protein 4                  45.8    7e-04   
ref|XP_006453683.1|  hypothetical protein CICLE_v10007241mg           45.8    7e-04   
ref|XP_008783544.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  45.8    7e-04   
ref|XP_006404521.1|  hypothetical protein EUTSA_v10010061mg           45.8    7e-04   
ref|XP_006290500.1|  hypothetical protein CARUB_v10016574mg           45.8    7e-04   
ref|XP_006404520.1|  hypothetical protein EUTSA_v10010061mg           45.8    7e-04   
ref|XP_008783545.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  45.8    8e-04   
gb|EFN79336.1|  Endoribonuclease dcr-1                                45.8    8e-04   
ref|XP_010934026.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  45.8    8e-04   
ref|XP_010934025.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  45.8    8e-04   
ref|XP_010098282.1|  Dicer-like protein 4                             45.8    8e-04   
ref|XP_002264486.2|  PREDICTED: dicer-like protein 4 isoform X2       45.4    9e-04   Vitis vinifera
emb|CBI25610.3|  unnamed protein product                              45.4    9e-04   
ref|XP_010495321.1|  PREDICTED: dicer-like protein 4                  45.4    9e-04   
ref|XP_010424192.1|  PREDICTED: dicer-like protein 4                  45.4    9e-04   
ref|XP_010656556.1|  PREDICTED: dicer-like protein 4 isoform X1       45.4    9e-04   
ref|XP_004622446.1|  PREDICTED: endoribonuclease Dicer-like           45.4    9e-04   
ref|XP_010454337.1|  PREDICTED: dicer-like protein 4                  45.4    0.001   
ref|XP_010686530.1|  PREDICTED: endoribonuclease Dicer homolog 1      45.4    0.001   
ref|XP_008364841.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  45.4    0.001   
ref|XP_011025346.1|  PREDICTED: endoribonuclease Dicer homolog 1      45.4    0.001   
ref|XP_008376239.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  45.4    0.001   
ref|XP_007136903.1|  hypothetical protein PHAVU_009G083800g           45.4    0.001   



>ref|XP_007029212.1| Dicer-like protein isoform 5 [Theobroma cacao]
 gb|EOY09714.1| Dicer-like protein isoform 5 [Theobroma cacao]
Length=1077

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            KM QDHC QNV IP+ K+LEAITTKKCQE+FHLESLETLGDSFLKY
Sbjct  642  KMQQDHCVQNVTIPTMKVLEAITTKKCQENFHLESLETLGDSFLKY  687



>ref|XP_007029214.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
 gb|EOY09716.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
Length=947

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            KM QDHC QNV IP+ K+LEAITTKKCQE+FHLESLETLGDSFLKY
Sbjct  572  KMQQDHCVQNVTIPTMKVLEAITTKKCQENFHLESLETLGDSFLKY  617



>ref|XP_007029210.1| Dicer-like protein isoform 3 [Theobroma cacao]
 gb|EOY09712.1| Dicer-like protein isoform 3 [Theobroma cacao]
Length=1202

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            KM QDHC QNV IP+ K+LEAITTKKCQE+FHLESLETLGDSFLKY
Sbjct  767  KMQQDHCVQNVTIPTMKVLEAITTKKCQENFHLESLETLGDSFLKY  812



>ref|XP_007029213.1| Dicer-like protein isoform 6 [Theobroma cacao]
 gb|EOY09715.1| Dicer-like protein isoform 6 [Theobroma cacao]
Length=1114

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            KM QDHC QNV IP+ K+LEAITTKKCQE+FHLESLETLGDSFLKY
Sbjct  679  KMQQDHCVQNVTIPTMKVLEAITTKKCQENFHLESLETLGDSFLKY  724



>ref|XP_007029208.1| Dicer-like protein isoform 1 [Theobroma cacao]
 gb|EOY09710.1| Dicer-like protein isoform 1 [Theobroma cacao]
Length=1418

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM QDHC QNV IP+ K+LEAITTKKCQE+FHLESLETLGDSFLKY
Sbjct  983   KMQQDHCVQNVTIPTMKVLEAITTKKCQENFHLESLETLGDSFLKY  1028



>ref|XP_007029209.1| Dicer-like protein isoform 2 [Theobroma cacao]
 gb|EOY09711.1| Dicer-like protein isoform 2 [Theobroma cacao]
Length=1307

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            KM QDHC QNV IP+ K+LEAITTKKCQE+FHLESLETLGDSFLKY
Sbjct  872  KMQQDHCVQNVTIPTMKVLEAITTKKCQENFHLESLETLGDSFLKY  917



>gb|KDO45679.1| hypothetical protein CISIN_1g0030621mg, partial [Citrus sinensis]
Length=506

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+ DHC QNV IP++K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  420  NMLLDHCMQNVTIPTSKVLEAITTKKCQEGFHLESLETLGDSFLKY  465



>ref|XP_011015091.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Populus 
euphratica]
Length=1408

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC QNV IP+ K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  968   KMHSDHCMQNVDIPAMKVLEAITTKKCQEKFHLESLETLGDSFLKY  1013



>ref|XP_011015068.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011015076.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Populus 
euphratica]
 ref|XP_011015084.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
Length=1409

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC QNV IP+ K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  969   KMHSDHCMQNVDIPAMKVLEAITTKKCQEKFHLESLETLGDSFLKY  1014



>ref|XP_006480490.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006480491.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Citrus 
sinensis]
 ref|XP_006480492.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X5 [Citrus 
sinensis]
Length=1401

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
              M+ DHC QNV IP++K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  964   NMLLDHCMQNVTIPTSKVLEAITTKKCQEGFHLESLETLGDSFLKY  1009



>ref|XP_006428678.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
 gb|ESR41918.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
Length=1401

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
              M+ DHC QNV IP++K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  964   NMLLDHCMQNVTIPTSKVLEAITTKKCQEGFHLESLETLGDSFLKY  1009



>ref|XP_006480488.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006480489.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Citrus 
sinensis]
Length=1401

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
              M+ DHC QNV IP++K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  964   NMLLDHCMQNVTIPTSKVLEAITTKKCQEGFHLESLETLGDSFLKY  1009



>ref|XP_011015099.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Populus 
euphratica]
Length=1407

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC QNV IP+ K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  967   KMHSDHCMQNVDIPAMKVLEAITTKKCQEKFHLESLETLGDSFLKY  1012



>ref|XP_002315119.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
 gb|EEF01290.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
Length=1408

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC QNV IP+ K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  968   KMHSDHCMQNVDIPAMKVLEAITTKKCQEKFHLESLETLGDSFLKY  1013



>ref|XP_006428679.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|ESR41919.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|KDO45680.1| hypothetical protein CISIN_1g000607mg [Citrus sinensis]
Length=1396

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
              M+ DHC QNV IP+ K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  964   NMLLDHCMQNVTIPTIKVLEAITTKKCQEDFHLESLETLGDSFLKY  1009



>ref|XP_006480493.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X6 [Citrus 
sinensis]
Length=1396

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
              M+ DHC QNV IP+ K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  964   NMLLDHCMQNVTIPTIKVLEAITTKKCQEDFHLESLETLGDSFLKY  1009



>ref|XP_010101236.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB88160.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1429

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +M  DHC QNV IP+ K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  965   RMHLDHCVQNVNIPTVKVLEAITTKKCQEKFHLESLETLGDSFLKY  1010



>ref|XP_008370841.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
 ref|XP_008370842.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
Length=1397

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++V DHC QNV IP+ K+LEAITTKKCQE++HLESLE LGDSFLKY
Sbjct  962   RIVLDHCTQNVIIPTVKVLEAITTKKCQENYHLESLEALGDSFLKY  1007



>emb|CDP04170.1| unnamed protein product [Coffea canephora]
Length=1351

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +M  DHC QN  IP+ K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  917  RMHVDHCMQNDAIPTMKVLEAITTKKCQEKFHLESLETLGDSFLKY  962



>ref|XP_002514810.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47364.1| ATP binding protein, putative [Ricinus communis]
Length=1388

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             K+  DHC Q+V IP+ K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  956   KLHLDHCMQSVAIPTIKVLEAITTKKCQEKFHLESLETLGDSFLKY  1001



>ref|XP_010312604.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010312605.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
Length=1433

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC QNV IP+AKILEA+TTK C E FHLESLETLGDSFLKY
Sbjct  1001  KMHLDHCTQNVVIPTAKILEAMTTKNCLEKFHLESLETLGDSFLKY  1046



>ref|XP_010312606.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Solanum 
lycopersicum]
Length=1406

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC QNV IP+AKILEA+TTK C E FHLESLETLGDSFLKY
Sbjct  974   KMHLDHCTQNVVIPTAKILEAMTTKNCLEKFHLESLETLGDSFLKY  1019



>ref|XP_010312607.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Solanum 
lycopersicum]
Length=1370

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            KM  DHC QNV IP+AKILEA+TTK C E FHLESLETLGDSFLKY
Sbjct  938  KMHLDHCTQNVVIPTAKILEAMTTKNCLEKFHLESLETLGDSFLKY  983



>ref|XP_008218472.1| PREDICTED: endoribonuclease Dicer homolog 2 [Prunus mume]
Length=1396

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             K+V D+C QN+ IP+ K+LEAITTKKCQE FHLESLE LGDSFLKY
Sbjct  967   KIVLDNCTQNIIIPTTKVLEAITTKKCQEKFHLESLEALGDSFLKY  1012



>ref|XP_007208392.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
 gb|EMJ09591.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
Length=1415

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             K+V D+C QN+ IP+ K+LEAITTKKCQE FHLESLE LGDSFLKY
Sbjct  986   KIVLDNCMQNIIIPTTKVLEAITTKKCQEKFHLESLEALGDSFLKY  1031



>ref|XP_009340367.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
 ref|XP_009340372.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
Length=1397

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++V DHC QNV IP+ K+LEAITTKKCQE+ HLESLE LGDSFLKY
Sbjct  962   RIVLDHCTQNVIIPTVKVLEAITTKKCQENCHLESLEALGDSFLKY  1007



>ref|XP_009361581.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
 ref|XP_009361582.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
Length=1410

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++V DHC QNV IP+ K+LEAITTKKCQE+ HLESLE LGDSFLKY
Sbjct  962   RIVLDHCTQNVIIPTIKVLEAITTKKCQENCHLESLEALGDSFLKY  1007



>gb|EYU39730.1| hypothetical protein MIMGU_mgv1a0003142mg, partial [Erythranthe 
guttata]
Length=1143

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +3

Query  6    MVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            M  DHC QNV IP+  +LEAITTKKCQE+ HLESLETLGDSFLKY
Sbjct  717  MPLDHCPQNVVIPTLTVLEAITTKKCQENIHLESLETLGDSFLKY  761



>ref|XP_011006570.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Populus euphratica]
Length=1406

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DH  QNV IPS K+LEAITT KCQE+F+LESLETLGDSFLKY
Sbjct  967   KMHSDHYLQNVNIPSMKVLEAITTNKCQENFNLESLETLGDSFLKY  1012



>ref|XP_004304823.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Fragaria vesca 
subsp. vesca]
Length=1433

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
              M+ D C QNV IP+ K+LEA+TTKKCQ+ FHLESLE LGDSFLKY
Sbjct  976   NMLMDQCTQNVIIPTIKVLEAVTTKKCQDKFHLESLEALGDSFLKY  1021



>ref|XP_010673887.1| PREDICTED: endoribonuclease Dicer homolog 2 [Beta vulgaris subsp. 
vulgaris]
Length=1432

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +3

Query  6     MVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++  HC QNV IP+ K+LEAITTK+CQE  HLESLETLGDSFLKY
Sbjct  1002  IITGHCMQNVIIPATKVLEAITTKRCQEEIHLESLETLGDSFLKY  1046



>ref|XP_008373031.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Malus 
domestica]
Length=665

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  6    MVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            M+ DHC QN+ IP+ K+LE+ITTK CQE++ LESLETLGDSFLKY
Sbjct  351  MILDHCPQNITIPTIKVLESITTKGCQENYDLESLETLGDSFLKY  395



>ref|XP_008373030.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Malus 
domestica]
Length=776

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  6    MVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            M+ DHC QN+ IP+ K+LE+ITTK CQE++ LESLETLGDSFLKY
Sbjct  351  MILDHCPQNITIPTIKVLESITTKGCQENYDLESLETLGDSFLKY  395



>ref|XP_007216896.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
 gb|EMJ18095.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
Length=806

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+ D C +NV IP+ K+LEAITTK CQE+F+LESLETLGDSFLKY
Sbjct  350  NMILDRCTENVTIPTIKVLEAITTKGCQENFNLESLETLGDSFLKY  395



>ref|XP_008240740.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=804

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +MV D C +NV IP+ K+LEAITTK CQE+ HLESLE LGDSFLKY
Sbjct  374  RMVLDRCTENVTIPTIKVLEAITTKHCQENLHLESLEALGDSFLKY  419



>ref|XP_008443670.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443671.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443672.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
Length=1393

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             K+  DHC QN  IP+ K+LEAITTK CQE FHLESLETLGDSFLKY
Sbjct  960   KLNTDHCMQN-DIPTTKVLEAITTKNCQEKFHLESLETLGDSFLKY  1004



>ref|XP_008443674.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Cucumis 
melo]
Length=1365

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             K+  DHC QN  IP+ K+LEAITTK CQE FHLESLETLGDSFLKY
Sbjct  960   KLNTDHCMQN-DIPTTKVLEAITTKNCQEKFHLESLETLGDSFLKY  1004



>ref|XP_008443676.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
 ref|XP_008443677.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
Length=1306

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            K+  DHC QN  IP+ K+LEAITTK CQE FHLESLETLGDSFLKY
Sbjct  873  KLNTDHCMQN-DIPTTKVLEAITTKNCQEKFHLESLETLGDSFLKY  917



>ref|XP_008443675.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Cucumis 
melo]
Length=1346

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            K+  DHC QN  IP+ K+LEAITTK CQE FHLESLETLGDSFLKY
Sbjct  913  KLNTDHCMQN-DIPTTKVLEAITTKNCQEKFHLESLETLGDSFLKY  957



>ref|XP_011084676.1| PREDICTED: endoribonuclease Dicer homolog 2 [Sesamum indicum]
Length=1398

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  15    DHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             DHC QNV IP+  +LEAITTKKCQE  HLE+LETLGDSFLKY
Sbjct  970   DHCMQNVVIPTLMVLEAITTKKCQEKIHLETLETLGDSFLKY  1011



>ref|XP_002312197.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
 gb|EEE89564.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
Length=1468

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DH  Q+V IPS K+LEAITT KCQE+F+LESLETLGDSFLKY
Sbjct  1029  KMHSDHYLQHVNIPSMKVLEAITTNKCQENFNLESLETLGDSFLKY  1074



>ref|XP_009348591.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=581

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  6    MVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            M+ D+C QN+ IP+ K+LE+ITTK CQE+F LESLETLGDSFLKY
Sbjct  350  MILDNCPQNITIPTIKVLESITTKGCQENFDLESLETLGDSFLKY  394



>ref|XP_009348590.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=775

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  6    MVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            M+ D+C QN+ IP+ K+LE+ITTK CQE+F LESLETLGDSFLKY
Sbjct  350  MILDNCPQNITIPTIKVLESITTKGCQENFDLESLETLGDSFLKY  394



>ref|XP_004139098.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cucumis sativus]
 gb|KGN66658.1| hypothetical protein Csa_1G654870 [Cucumis sativus]
Length=1393

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             K+  DHC QN  IP+ K+LEAITTKKCQE F+LESLETLGDSFLKY
Sbjct  960   KLNSDHCMQN-DIPTTKVLEAITTKKCQEKFNLESLETLGDSFLKY  1004



>ref|XP_007216887.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
 gb|EMJ18086.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
Length=752

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +MV D C +NV IP+ K+LEAITTK C+E+ HLESLE LGDSFLKY
Sbjct  323  RMVLDRCTENVTIPTIKVLEAITTKHCKENLHLESLEALGDSFLKY  368



>ref|XP_008240779.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=781

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +MV D C +NV IP+ K+LEAITTK C+E+ HLESLE LGDSFLKY
Sbjct  352  RMVLDRCTENVTIPTIKVLEAITTKHCKENLHLESLEALGDSFLKY  397



>ref|XP_004303843.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Fragaria vesca 
subsp. vesca]
Length=1393

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +M+ D C  NV IP+ K+LEAITTKKCQE  HLESLE LGDSFLKY
Sbjct  960   RMLLDQCLPNVIIPTIKVLEAITTKKCQEKLHLESLEALGDSFLKY  1005



>ref|XP_010549776.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Tarenaya 
hassleriana]
Length=1350

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            KM  +H  + V +P+ KILEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  920  KMHLEHSTREVNVPTIKILEAITTKKCQDQFHLESLETLGDSFLKY  965



>ref|XP_010549772.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549773.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549775.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
Length=1395

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  +H  + V +P+ KILEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  965   KMHLEHSTREVNVPTIKILEAITTKKCQDQFHLESLETLGDSFLKY  1010



>ref|XP_007217819.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
 gb|EMJ19018.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
Length=758

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +MV D C +NV I + K+LEAITTK CQE+ HLESLE LGDSFLKY
Sbjct  328  RMVLDRCTENVTISTIKVLEAITTKHCQENLHLESLEALGDSFLKY  373



>ref|XP_010249397.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Nelumbo 
nucifera]
Length=1394

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             K+  DH  QNV IP  KILEAITTKKC+E F LESLETLGDSFLKY
Sbjct  962   KLQLDHYMQNVIIPLDKILEAITTKKCEEQFSLESLETLGDSFLKY  1007



>emb|CAX18337.1| dicel-like 2 [Nicotiana benthamiana]
Length=224

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  39   IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            IP+AK+LEAITTKKC E FHLESLETLGDSFLKY
Sbjct  1    IPTAKVLEAITTKKCVEKFHLESLETLGDSFLKY  34



>ref|XP_010249398.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Nelumbo 
nucifera]
Length=1188

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            K+  DH  QNV IP  KILEAITTKKC+E F LESLETLGDSFLKY
Sbjct  756  KLQLDHYMQNVIIPLDKILEAITTKKCEEQFSLESLETLGDSFLKY  801



>ref|XP_008392375.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=731

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +M+ DH  QNV IP+ K+LE+ITT+ CQE+  LESLETLGDSFLKY
Sbjct  347  QMILDHLPQNVTIPTIKVLESITTEGCQENLDLESLETLGDSFLKY  392



>ref|XP_008351646.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=730

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +M+ DH  QNV IP+ K+LE+ITT+ CQE+  LESLETLGDSFLKY
Sbjct  346  QMILDHLPQNVTIPTIKVLESITTEGCQENLDLESLETLGDSFLKY  391



>ref|XP_010649218.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Vitis 
vinifera]
Length=1405

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +3

Query  15    DHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++C+QN  IP+ K+LEAITTK CQE FHLESLETLGDSFLKY
Sbjct  976   NYCKQN-DIPTFKVLEAITTKHCQEGFHLESLETLGDSFLKY  1016



>ref|XP_010649215.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Vitis 
vinifera]
Length=1461

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +3

Query  15    DHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++C+QN  IP+ K+LEAITTK CQE FHLESLETLGDSFLKY
Sbjct  976   NYCKQN-DIPTFKVLEAITTKHCQEGFHLESLETLGDSFLKY  1016



>emb|CAN77284.1| hypothetical protein VITISV_043738 [Vitis vinifera]
Length=1296

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +3

Query  15   DHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            ++C+QN  IP+ K+LEAITTK CQE FHLESLETLGDSFLKY
Sbjct  869  NYCKQN-DIPTFKVLEAITTKHCQEGFHLESLETLGDSFLKY  909



>ref|XP_010649214.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Vitis 
vinifera]
Length=1468

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +3

Query  15    DHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++C+QN  IP+ K+LEAITTK CQE FHLESLETLGDSFLKY
Sbjct  976   NYCKQN-DIPTFKVLEAITTKHCQEGFHLESLETLGDSFLKY  1016



>emb|CBI17597.3| unnamed protein product [Vitis vinifera]
Length=1340

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +3

Query  15   DHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            ++C+QN  IP+ K+LEAITTK CQE FHLESLETLGDSFLKY
Sbjct  913  NYCKQN-DIPTFKVLEAITTKHCQEGFHLESLETLGDSFLKY  953



>ref|XP_010649216.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Vitis 
vinifera]
Length=1460

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +3

Query  15    DHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++C+QN  IP+ K+LEAITTK CQE FHLESLETLGDSFLKY
Sbjct  968   NYCKQN-DIPTFKVLEAITTKHCQEGFHLESLETLGDSFLKY  1008



>ref|XP_010088523.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB36440.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1077

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            ++  D C QN  IP+ K+LEAITTKKC+E + LE+LETLGDSFLKY
Sbjct  642  RLYLDRCMQNAVIPATKVLEAITTKKCEEKYCLETLETLGDSFLKY  687



>ref|XP_010038609.1| PREDICTED: endoribonuclease Dicer homolog 2 [Eucalyptus grandis]
Length=1403

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +++ D C +   IP+ K+LEA+TTK+CQE +HLESLETLGDSFLKY
Sbjct  970   RVLSDSCPEIAIIPTMKVLEALTTKRCQERYHLESLETLGDSFLKY  1015



>gb|KCW84635.1| hypothetical protein EUGRSUZ_B01461 [Eucalyptus grandis]
Length=1194

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +++ D C +   IP+ K+LEA+TTK+CQE +HLESLETLGDSFLKY
Sbjct  761  RVLSDSCPEIAIIPTMKVLEALTTKRCQERYHLESLETLGDSFLKY  806



>emb|CDO96788.1| unnamed protein product [Coffea canephora]
Length=726

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +M+ D C+ N  IP+ K+LEAITTK C+E+FHL SL T+GDSFLKY
Sbjct  303  RMLMDDCKLNDMIPTIKVLEAITTKNCRENFHLTSLATIGDSFLKY  348



>ref|XP_006586847.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Glycine 
max]
Length=1387

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC QN  I + K+LEAITTK+C E+FH ESLETLGDSFLKY
Sbjct  959   KMHLDHCTQN-EIQTIKVLEAITTKRCNEAFHYESLETLGDSFLKY  1003



>ref|XP_006586846.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
Length=1420

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC QN  I + K+LEAITTK+C E+FH ESLETLGDSFLKY
Sbjct  992   KMHLDHCTQN-EIQTIKVLEAITTKRCNEAFHYESLETLGDSFLKY  1036



>ref|XP_003534774.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
Length=1421

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC QN  I + K+LEAITTK+C E+FH ESLETLGDSFLKY
Sbjct  993   KMHLDHCTQN-EIQTIKVLEAITTKRCNEAFHYESLETLGDSFLKY  1037



>gb|KHN23014.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1324

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            KM  DHC QN  I + K+LEAITTK+C E+FH ESLETLGDSFLKY
Sbjct  896  KMHLDHCTQN-EIQTIKVLEAITTKRCNEAFHYESLETLGDSFLKY  940



>gb|ACE60552.1| dicer-like protein 2 [Brassica rapa]
Length=1392

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  971   VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1006



>ref|XP_009130358.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
 ref|XP_009130359.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
Length=1388

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  967   VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1002



>emb|CDY43132.1| BnaA05g32540D [Brassica napus]
Length=1388

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  967   VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1002



>ref|XP_006408318.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
 gb|ESQ49771.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
Length=1390

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  970   VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1005



>ref|XP_010485670.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Camelina 
sativa]
Length=1354

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  933  VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  968



>ref|XP_010485666.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010485667.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
Length=1398

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  977   VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1012



>ref|XP_002884369.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60628.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
Length=2033

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  1617  VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1652



>ref|XP_010485668.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
 ref|XP_010485669.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
Length=1395

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  974   VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1009



>ref|XP_010508779.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
 ref|XP_010508854.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
Length=1394

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  973   VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1008



>ref|XP_010508629.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
 ref|XP_010508709.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
Length=1397

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  976   VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1011



>ref|XP_010508928.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Camelina 
sativa]
Length=1355

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  976   VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1011



>emb|CDY50692.1| BnaC05g47910D [Brassica napus]
Length=1389

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  968   VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1003



>ref|XP_006300010.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
 gb|EOA32908.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
Length=1392

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKCQ+ FHLESLETLGDSFLKY
Sbjct  972   VNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKY  1007



>ref|XP_003535104.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
 ref|XP_006586845.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
 gb|KHN23015.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1414

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC +N  I + K+LEAITTK+C+E+FH ESLETLGDSFLKY
Sbjct  960   KMHLDHCARN-EIQTIKVLEAITTKRCKEAFHYESLETLGDSFLKY  1004



>gb|ABF19797.1| dicer-like 2 spliceform 1 [Arabidopsis thaliana]
Length=1386

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKC++ FHLESLETLGDSFLKY
Sbjct  970   VNIPTIKVLEAITTKKCEDQFHLESLETLGDSFLKY  1005



>ref|NP_566199.4| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 ref|NP_001189798.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 sp|Q3EBC8.2|DCL2_ARATH RecName: Full=Endoribonuclease Dicer homolog 2; AltName: Full=Dicer-like 
protein 2; Short=AtDCL2 [Arabidopsis thaliana]
 gb|AEE73924.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73926.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1388

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKC++ FHLESLETLGDSFLKY
Sbjct  972   VNIPTIKVLEAITTKKCEDQFHLESLETLGDSFLKY  1007



>gb|ABF19798.1| dicer-like 2 spliceform 2 [Arabidopsis thaliana]
Length=1374

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            V IP+ K+LEAITTKKC++ FHLESLETLGDSFLKY
Sbjct  958  VNIPTIKVLEAITTKKCEDQFHLESLETLGDSFLKY  993



>ref|NP_001078101.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73925.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1374

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            V IP+ K+LEAITTKKC++ FHLESLETLGDSFLKY
Sbjct  958  VNIPTIKVLEAITTKKCEDQFHLESLETLGDSFLKY  993



>gb|AAF26098.1|AC012328_1 unknown protein [Arabidopsis thaliana]
Length=2042

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             V IP+ K+LEAITTKKC++ FHLESLETLGDSFLKY
Sbjct  1626  VNIPTIKVLEAITTKKCEDQFHLESLETLGDSFLKY  1661



>ref|XP_007147466.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147467.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147468.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19460.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19461.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19462.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
Length=1392

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +3

Query  6     MVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M  DHC +N  I + K+LEAIT+K+C+E+FH ESLETLGDSFLKY
Sbjct  959   MYSDHCTKN-EIQTIKVLEAITSKRCKEAFHYESLETLGDSFLKY  1002



>emb|CDO96786.1| unnamed protein product [Coffea canephora]
Length=478

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +M+ D C+ N  IP+ K+LEAITT+ CQE+F+L+ L TLGDSFLKY
Sbjct  369  RMLMDDCKLNDMIPTIKVLEAITTENCQENFNLKLLATLGDSFLKY  414



>emb|CDP06207.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLK  137
            +M+ DHC QN  IP+ K++EAITTK CQE+ +L  L TLGDSFLK
Sbjct  321  RMLVDHCTQNDMIPTIKVVEAITTKNCQENLNLTPLATLGDSFLK  365



>emb|CDO96789.1| unnamed protein product [Coffea canephora]
Length=801

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +M+   C  N  IP+ K+LEAITTK C+E+FHL SL T+GDSFLKY
Sbjct  335  RMLMADCMLNDMIPTIKVLEAITTKNCRENFHLTSLATIGDSFLKY  380



>gb|KEH20231.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1219

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            KM  +HC QN  I + K+LEA+TTK C+E+FH ESLETLGDSFLKY
Sbjct  956  KMHLNHCPQN-RIQTFKVLEAMTTKSCKENFHYESLETLGDSFLKY  1000



>gb|KHG30500.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1290

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAK---ILEAITTKKCQESFHLESLETLGDSFLKY  140
            K+ ++H   N G+   K   +LEAITTKKC ESFHLESLETLGDSFLKY
Sbjct  857  KVWKNHVNCNAGMIQTKSGLVLEAITTKKCLESFHLESLETLGDSFLKY  905



>ref|XP_007147469.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 ref|XP_007147470.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19463.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19464.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
Length=1388

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC QN  I + K+LEAIT   C+E+FH ESLETLGDSFLKY
Sbjct  957   KMHLDHCAQN-EIQTIKVLEAITATSCKEAFHYESLETLGDSFLKY  1001



>ref|XP_007147294.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
 gb|ESW19288.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
Length=754

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLK  137
            KM+ DHC QN  IP +K+L+AIT K CQE+++ E LETLGDSFLK
Sbjct  321  KMLMDHCTQN-DIPISKVLQAITAKGCQEAYNYEYLETLGDSFLK  364



>gb|KDP26899.1| hypothetical protein JCGZ_18057 [Jatropha curcas]
Length=424

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  51   KILEAITTKKCQESFHLESLETLGDSFLKY  140
            K+LEAITTKKCQE FHLESLETLGDSFLKY
Sbjct  2    KVLEAITTKKCQEIFHLESLETLGDSFLKY  31



>gb|AES64802.2| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1377

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +M  D+C QN  I + K+LEA+TTK C+E+FH ESLETLGDSFLKY
Sbjct  952  RMHLDYCPQN-KIQTFKVLEAMTTKSCKETFHYESLETLGDSFLKY  996



>ref|XP_003594551.1| Endoribonuclease Dicer [Medicago truncatula]
Length=1418

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +M  D+C QN  I + K+LEA+TTK C+E+FH ESLETLGDSFLKY
Sbjct  993   RMHLDYCPQN-KIQTFKVLEAMTTKSCKETFHYESLETLGDSFLKY  1037



>ref|XP_004486471.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cicer arietinum]
Length=1400

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             K+  +HC QN  I + K+LEA+TTK C+E+FH ESLETLGDSFLKY
Sbjct  970   KLHLNHCPQN-QIQTFKVLEAMTTKSCKETFHYESLETLGDSFLKY  1014



>ref|XP_007140643.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
 gb|ESW12637.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
Length=1420

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM  DHC QN      K+LEAIT+K+C E FH ESLETLGDSFLKY
Sbjct  991   KMHLDHCAQN-ETQIMKVLEAITSKRCNEPFHYESLETLGDSFLKY  1035



>gb|EMS67761.1| Endoribonuclease Dicer-like protein 2a [Triticum urartu]
Length=537

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   IP+ KILEA+TTK+CQE F  ESLETLGDSFLKY
Sbjct  115  QQFAIPALKILEAVTTKECQEEFSQESLETLGDSFLKY  152



>ref|XP_010229604.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2a-like [Brachypodium distachyon]
Length=1398

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27    QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             Q   IP+ KILEAITTK+CQE F  ESLETLGDSFLKY
Sbjct  976   QQFIIPAVKILEAITTKECQEEFSQESLETLGDSFLKY  1013



>ref|XP_004982514.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Setaria italica]
Length=1199

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             IP+ KILEA+TTKKCQE F  ESLETLGDSFLKY
Sbjct  986   IPALKILEALTTKKCQEEFSQESLETLGDSFLKY  1019



>ref|XP_004982513.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=1404

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             IP+ KILEA+TTKKCQE F  ESLETLGDSFLKY
Sbjct  986   IPALKILEALTTKKCQEEFSQESLETLGDSFLKY  1019



>ref|XP_002464289.1| hypothetical protein SORBIDRAFT_01g015666 [Sorghum bicolor]
 gb|EER91287.1| hypothetical protein SORBIDRAFT_01g015666 [Sorghum bicolor]
Length=462

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   I + KILEA+TTK+CQE F LESLETLGDSFLKY
Sbjct  40   QQFNITAMKILEALTTKECQEKFSLESLETLGDSFLKY  77



>gb|AFW68290.1| hypothetical protein ZEAMMB73_539070 [Zea mays]
Length=707

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            KM      Q   IP+ KILEA+TTK CQE F  ESLETLGDSFLKY
Sbjct  281  KMQLGPSMQQFDIPALKILEALTTKNCQEEFSQESLETLGDSFLKY  326



>ref|XP_006651573.1| PREDICTED: endoribonuclease Dicer homolog 2a-like [Oryza brachyantha]
Length=1348

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   IP  KILEA+TTKKCQE F  ESLETLGDSFLKY
Sbjct  918  QQFDIPILKILEALTTKKCQEEFSQESLETLGDSFLKY  955



>ref|XP_008681083.1| PREDICTED: uncharacterized protein LOC100192986 isoform X3 [Zea 
mays]
Length=1192

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM      Q   IP+ KILEA+TTK CQE F  ESLETLGDSFLKY
Sbjct  982   KMQLGPSMQQFDIPALKILEALTTKNCQEEFSQESLETLGDSFLKY  1027



>ref|XP_008681082.1| PREDICTED: uncharacterized protein LOC100192986 isoform X2 [Zea 
mays]
Length=1401

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM      Q   IP+ KILEA+TTK CQE F  ESLETLGDSFLKY
Sbjct  975   KMQLGPSMQQFDIPALKILEALTTKNCQEEFSQESLETLGDSFLKY  1020



>ref|XP_008681081.1| PREDICTED: uncharacterized protein LOC100192986 isoform X1 [Zea 
mays]
Length=1408

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             KM      Q   IP+ KILEA+TTK CQE F  ESLETLGDSFLKY
Sbjct  982   KMQLGPSMQQFDIPALKILEALTTKNCQEEFSQESLETLGDSFLKY  1027



>dbj|BAD34005.1| CAF protein-like [Oryza sativa Japonica Group]
 dbj|BAD36404.1| CAF protein-like [Oryza sativa Japonica Group]
Length=1375

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   +P  KILEA+TTKKCQE F  ESLETLGDSFLKY
Sbjct  950  QQFDVPVLKILEALTTKKCQEEFSQESLETLGDSFLKY  987



>sp|Q69LX2.2|DCL2B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2b; AltName: Full=Dicer-like 
protein 2b; Short=OsDCL2b [Oryza sativa Japonica 
Group]
Length=1377

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   +P  KILEA+TTKKCQE F  ESLETLGDSFLKY
Sbjct  952  QQFDVPVLKILEALTTKKCQEEFSQESLETLGDSFLKY  989



>gb|EEE59414.1| hypothetical protein OsJ_11564 [Oryza sativa Japonica Group]
Length=1371

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   +P  KILEA+TTKKCQE F  ESLETLGDSFLKY
Sbjct  946  QQFDVPVLKILEALTTKKCQEEFSQESLETLGDSFLKY  983



>ref|XP_004982511.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X3 
[Setaria italica]
Length=719

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   I + KILEA+TTK+CQE F LESLETLGDSFLKY
Sbjct  298  QQFNITAMKILEALTTKECQEEFSLESLETLGDSFLKY  335



>ref|XP_004982510.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Setaria italica]
Length=720

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   I + KILEA+TTK+CQE F LESLETLGDSFLKY
Sbjct  334  QQFNITAMKILEALTTKECQEEFSLESLETLGDSFLKY  371



>ref|NP_001050564.1| Os03g0583900 [Oryza sativa Japonica Group]
 sp|Q10HL3.1|DCL2A_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2a; AltName: Full=Dicer-like 
protein 2a; Short=OsDCL2a [Oryza sativa Japonica 
Group]
 gb|AAT76309.1| putative RNA helicase/RNAseIII protein, C-terminus truncated 
[Oryza sativa Japonica Group]
 gb|ABF97330.1| Type III restriction enzyme, res subunit family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12478.1| Os03g0583900 [Oryza sativa Japonica Group]
 dbj|BAG92928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1410

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  27    QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             Q   +P  KILEA+TTKKCQE F  ESLETLGDSFLKY
Sbjct  981   QQFDVPVLKILEALTTKKCQEEFSQESLETLGDSFLKY  1018



>gb|EEC75643.1| hypothetical protein OsI_12390 [Oryza sativa Indica Group]
Length=1318

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   +P  KILEA+TTKKCQE F  ESLETLGDSFLKY
Sbjct  889  QQFDVPVLKILEALTTKKCQEEFSQESLETLGDSFLKY  926



>ref|XP_004982509.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=755

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   I + KILEA+TTK+CQE F LESLETLGDSFLKY
Sbjct  334  QQFNITAMKILEALTTKECQEEFSLESLETLGDSFLKY  371



>gb|AAS07189.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=1017

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   +P  KILEA+TTKKCQE F  ESLETLGDSFLKY
Sbjct  588  QQFDVPVLKILEALTTKKCQEEFSQESLETLGDSFLKY  625



>ref|XP_004982512.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X4 
[Setaria italica]
Length=654

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   I + KILEA+TTK+CQE F LESLETLGDSFLKY
Sbjct  334  QQFNITAMKILEALTTKECQEEFSLESLETLGDSFLKY  371



>gb|KEH42074.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1385

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            KM    C QN  I + K+LEA+TTK C+E+FH ESLETLGDSFLKY
Sbjct  954  KMHLSLCPQN-SIQTFKVLEAMTTKSCKENFHYESLETLGDSFLKY  998



>gb|KHG30499.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1358

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  54   ILEAITTKKCQESFHLESLETLGDSFLKY  140
            +LEAITTKKC ESFHLESLETLGDSFLKY
Sbjct  945  VLEAITTKKCLESFHLESLETLGDSFLKY  973



>ref|XP_002991514.1| hypothetical protein SELMODRAFT_429802 [Selaginella moellendorffii]
 gb|EFJ07436.1| hypothetical protein SELMODRAFT_429802 [Selaginella moellendorffii]
Length=569

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  39   IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            IP+AKILEAIT+KKC E F  ESLE LGDSFLKY
Sbjct  304  IPAAKILEAITSKKCHEEFSYESLELLGDSFLKY  337



>ref|XP_006844770.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
 gb|ERN06445.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
Length=1424

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +3

Query  6     MVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLK  137
             +V  H R ++ IP  K+LE +TTKKCQE F LESLETLGDSFLK
Sbjct  991   IVGQHAR-DLNIPIIKVLECLTTKKCQEEFSLESLETLGDSFLK  1033



>ref|XP_010233062.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
 ref|XP_010233066.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
Length=1144

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   +P  KILEA+TTK+CQE F  ESLETLGDSFLKY
Sbjct  707  QQFSVPDLKILEALTTKECQEEFSQESLETLGDSFLKY  744



>ref|XP_010233057.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Brachypodium distachyon]
Length=1248

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   +P  KILEA+TTK+CQE F  ESLETLGDSFLKY
Sbjct  811  QQFSVPDLKILEALTTKECQEEFSQESLETLGDSFLKY  848



>ref|XP_002991516.1| hypothetical protein SELMODRAFT_448444 [Selaginella moellendorffii]
 gb|EFJ07438.1| hypothetical protein SELMODRAFT_448444 [Selaginella moellendorffii]
Length=1719

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             IP+AKILEAIT+KKC E F  ESLE LGDSFLKY
Sbjct  1274  IPAAKILEAITSKKCHEEFSYESLELLGDSFLKY  1307



>ref|XP_002979043.1| hypothetical protein SELMODRAFT_444049 [Selaginella moellendorffii]
 gb|EFJ20000.1| hypothetical protein SELMODRAFT_444049 [Selaginella moellendorffii]
Length=1686

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             IP+AKILEAIT+KKC E F  ESLE LGDSFLKY
Sbjct  1305  IPAAKILEAITSKKCHEEFSYESLELLGDSFLKY  1338



>ref|XP_002991513.1| hypothetical protein SELMODRAFT_429800 [Selaginella moellendorffii]
 gb|EFJ07435.1| hypothetical protein SELMODRAFT_429800 [Selaginella moellendorffii]
Length=850

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  39   IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            IP+AKILEAIT+KKC E F  ESLE LGDSFLKY
Sbjct  566  IPAAKILEAITSKKCHEEFSYESLELLGDSFLKY  599



>ref|XP_004173421.1| PREDICTED: endoribonuclease Dicer homolog 2-like, partial [Cucumis 
sativus]
Length=307

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  54   ILEAITTKKCQESFHLESLETLGDSFLKY  140
            +LEAITTKKCQE F+LESLETLGDSFLKY
Sbjct  1    VLEAITTKKCQEKFNLESLETLGDSFLKY  29



>gb|AFW68291.1| hypothetical protein ZEAMMB73_565304 [Zea mays]
Length=462

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   I + KILEA+TTK+CQE F +ESLETLGDSF+KY
Sbjct  40   QQFNITAMKILEALTTKECQEKFSMESLETLGDSFIKY  77



>ref|XP_008644683.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X8 
[Zea mays]
Length=479

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   I + KILEA+TTK+CQE F +ESLETLGDSF+KY
Sbjct  57   QQFNITAMKILEALTTKECQEKFSMESLETLGDSFIKY  94



>ref|XP_008644682.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X7 
[Zea mays]
Length=486

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   I + KILEA+TTK+CQE F +ESLETLGDSF+KY
Sbjct  64   QQFNITAMKILEALTTKECQEKFSMESLETLGDSFIKY  101



>ref|XP_008644676.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Zea mays]
Length=751

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   I + KILEA+TTK+CQE F +ESLETLGDSF+KY
Sbjct  329  QQFNITAMKILEALTTKECQEKFSMESLETLGDSFIKY  366



>ref|XP_008644681.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X6 
[Zea mays]
Length=639

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   I + KILEA+TTK+CQE F +ESLETLGDSF+KY
Sbjct  329  QQFNITAMKILEALTTKECQEKFSMESLETLGDSFIKY  366



>ref|XP_008644678.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X3 
[Zea mays]
Length=717

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  27   QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            Q   I + KILEA+TTK+CQE F +ESLETLGDSF+KY
Sbjct  295  QQFNITAMKILEALTTKECQEKFSMESLETLGDSFIKY  332



>gb|AEC12444.1| ribonuclease III family protein DCL3 [Gossypium hirsutum]
Length=1655

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  15    DHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + C  N+ IPS+ ILEA+TT +C ESF +E LE LGDS LKY
Sbjct  1056  NFCSSNIDIPSSMILEALTTLRCCESFSMERLELLGDSVLKY  1097



>gb|KHG13242.1| Endoribonuclease Dicera [Gossypium arboreum]
Length=1643

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  15    DHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + C  N+ IPS+ ILEA+TT +C ESF +E LE LGDS LKY
Sbjct  1058  NFCSSNIDIPSSMILEALTTLRCCESFSMERLELLGDSVLKY  1099



>ref|NP_001062844.1| Os09g0315100 [Oryza sativa Japonica Group]
 dbj|BAF24758.1| Os09g0315100, partial [Oryza sativa Japonica Group]
Length=245

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  51   KILEAITTKKCQESFHLESLETLGDSFLKY  140
            +ILEA+TTKKCQE F  ESLETLGDSFLKY
Sbjct  17   QILEALTTKKCQEEFSQESLETLGDSFLKY  46



>gb|KHN43108.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=836

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +M+ DH   N  IP +K+L+AIT K C+E++  + LETLGDS+LKY
Sbjct  366  RMLLDHFTPN-DIPISKVLQAITAKGCEEAYDYDYLETLGDSYLKY  410



>ref|XP_003553782.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Glycine 
max]
Length=756

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +M+ DH   N  IP +K+L+AIT K C+E++  + LETLGDS+LKY
Sbjct  318  RMLLDHFTPN-DIPISKVLQAITAKGCEEAYDYDYLETLGDSYLKY  362



>ref|XP_006604892.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Glycine 
max]
Length=788

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +3

Query  3    KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            +M+ DH   N  IP +K+L+AIT K C+E++  + LETLGDS+LKY
Sbjct  318  RMLLDHFTPN-DIPISKVLQAITAKGCEEAYDYDYLETLGDSYLKY  362



>ref|XP_002464290.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
 gb|EER91288.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
Length=1385

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLK  137
             IP+ K+LEA+T KKC+E F  ESLETLGDSFLK
Sbjct  990   IPALKVLEALTAKKCKEEFSQESLETLGDSFLK  1022



>ref|XP_011002832.1| PREDICTED: endoribonuclease Dicer homolog 3-like isoform X4 [Populus 
euphratica]
Length=1633

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             NV IPS+ ILEAITT +C ESF +E LE LGDS LKY
Sbjct  1026  NVYIPSSLILEAITTLRCCESFSMERLELLGDSVLKY  1062



>ref|XP_011002830.1| PREDICTED: endoribonuclease Dicer homolog 3-like isoform X2 [Populus 
euphratica]
Length=1669

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             NV IPS+ ILEAITT +C ESF +E LE LGDS LKY
Sbjct  1062  NVYIPSSLILEAITTLRCCESFSMERLELLGDSVLKY  1098



>ref|XP_011002831.1| PREDICTED: endoribonuclease Dicer homolog 3-like isoform X3 [Populus 
euphratica]
Length=1654

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             NV IPS+ ILEAITT +C ESF +E LE LGDS LKY
Sbjct  1047  NVYIPSSLILEAITTLRCCESFSMERLELLGDSVLKY  1083



>ref|XP_011002834.1| PREDICTED: endoribonuclease Dicer homolog 3a-like isoform X5 
[Populus euphratica]
Length=1448

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  30   NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            NV IPS+ ILEAITT +C ESF +E LE LGDS LKY
Sbjct  841  NVYIPSSLILEAITTLRCCESFSMERLELLGDSVLKY  877



>ref|XP_011002828.1| PREDICTED: endoribonuclease Dicer homolog 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011002829.1| PREDICTED: endoribonuclease Dicer homolog 3-like isoform X1 [Populus 
euphratica]
Length=1671

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             NV IPS+ ILEAITT +C ESF +E LE LGDS LKY
Sbjct  1064  NVYIPSSLILEAITTLRCCESFSMERLELLGDSVLKY  1100



>emb|CDP19693.1| unnamed protein product [Coffea canephora]
Length=1583

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  27    QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             QN+ I S+ ILEA+TT KC ESF +E LE LGDS LKY
Sbjct  1072  QNIHIASSLILEALTTVKCNESFSMERLELLGDSVLKY  1109



>ref|XP_008664845.1| PREDICTED: endoribonuclease Dicer homolog 3b-like isoform X2 
[Zea mays]
Length=1572

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +3

Query  6    MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            M+    R N+     IPS+ ILEAITT +C ESF LE LE LGDS LKY
Sbjct  951  MLASQLRSNISYIQRIPSSLILEAITTLRCCESFSLERLELLGDSVLKY  999



>ref|XP_008664844.1| PREDICTED: endoribonuclease Dicer homolog 3b-like isoform X1 
[Zea mays]
Length=1644

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +3

Query  6     MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+    R N+     IPS+ ILEAITT +C ESF LE LE LGDS LKY
Sbjct  1023  MLASQLRSNISYIQRIPSSLILEAITTLRCCESFSLERLELLGDSVLKY  1071



>ref|XP_008664847.1| PREDICTED: endoribonuclease Dicer homolog 3b-like isoform X3 
[Zea mays]
Length=1568

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +3

Query  6     MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+    R N+     IPS+ ILEAITT +C ESF LE LE LGDS LKY
Sbjct  1023  MLASQLRSNISYIQRIPSSLILEAITTLRCCESFSLERLELLGDSVLKY  1071



>tpg|DAA49563.1| TPA: hypothetical protein ZEAMMB73_299457, partial [Zea mays]
Length=1517

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +3

Query  6     MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+    R N+     IPS+ ILEAITT +C ESF LE LE LGDS LKY
Sbjct  972   MLASQLRSNISYIQRIPSSLILEAITTLRCCESFSLERLELLGDSVLKY  1020



>ref|XP_008664848.1| PREDICTED: endoribonuclease Dicer homolog 3b-like isoform X4 
[Zea mays]
Length=1515

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +3

Query  6     MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+    R N+     IPS+ ILEAITT +C ESF LE LE LGDS LKY
Sbjct  1023  MLASQLRSNISYIQRIPSSLILEAITTLRCCESFSLERLELLGDSVLKY  1071



>tpg|DAA49562.1| TPA: hypothetical protein ZEAMMB73_299457 [Zea mays]
Length=1440

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +3

Query  6     MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+    R N+     IPS+ ILEAITT +C ESF LE LE LGDS LKY
Sbjct  972   MLASQLRSNISYIQRIPSSLILEAITTLRCCESFSLERLELLGDSVLKY  1020



>tpg|DAA49561.1| TPA: hypothetical protein ZEAMMB73_299457, partial [Zea mays]
Length=1199

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +3

Query  6    MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            M+    R N+     IPS+ ILEAITT +C ESF LE LE LGDS LKY
Sbjct  654  MLASQLRSNISYIQRIPSSLILEAITTLRCCESFSLERLELLGDSVLKY  702



>gb|EMT13587.1| Endoribonuclease Dicer-3b-like protein [Aegilops tauschii]
Length=1647

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 4/49 (8%)
 Frame = +3

Query  6     MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+    R+++G    IPS  ILEAITT +C E+F LE LE LGDS LKY
Sbjct  1039  MLASQLRRDIGYTQHIPSYLILEAITTLRCCETFSLERLELLGDSVLKY  1087



>gb|KDP34010.1| hypothetical protein JCGZ_07581 [Jatropha curcas]
Length=1007

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 7/52 (13%)
 Frame = +3

Query  6    MVQDHCRQNVG-------IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            M+    RQ +G       IPS+ ILEAIT+ +C E+F +E LE LGDS LKY
Sbjct  580  MLATQLRQEIGCYCPNFHIPSSLILEAITSLRCNEAFSMERLELLGDSVLKY  631



>gb|KHG04216.1| Endoribonuclease Dicer -like protein [Gossypium arboreum]
Length=776

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  15   DHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            D    N  IPS+ ILEA+TT +C ESF +E LE LGDS LKY
Sbjct  216  DFHSSNFDIPSSLILEALTTLRCCESFSMERLELLGDSVLKY  257



>ref|XP_002324204.2| hypothetical protein POPTR_0018s08340g [Populus trichocarpa]
 gb|EEF02769.2| hypothetical protein POPTR_0018s08340g [Populus trichocarpa]
Length=1476

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  30   NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            N  IPS+ ILEAITT +C ESF +E LE LGDS LKY
Sbjct  869  NFYIPSSLILEAITTLRCCESFSMERLELLGDSVLKY  905



>ref|XP_006661878.1| PREDICTED: endoribonuclease Dicer homolog 3b-like [Oryza brachyantha]
Length=1571

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +3

Query  6     MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+    R+ +G    IPS  ILEAITT +C E+F LE LE LGDS LKY
Sbjct  963   MLASQLRREIGYNQHIPSCLILEAITTLRCCETFSLERLELLGDSVLKY  1011



>ref|XP_010236618.1| PREDICTED: endoribonuclease Dicer homolog 3b-like [Brachypodium 
distachyon]
Length=1615

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +3

Query  6     MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+    R ++G    IPS  ILEAITT +C E+F LE LE LGDS LKY
Sbjct  1007  MLASQLRGDIGYIQHIPSCLILEAITTLRCCETFSLERLELLGDSVLKY  1055



>ref|XP_007012462.1| Endoribonuclease Dicera, putative isoform 2 [Theobroma cacao]
 gb|EOY30081.1| Endoribonuclease Dicera, putative isoform 2 [Theobroma cacao]
Length=1255

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  30   NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            N  IPS+ ILEA+TT +C ESF +E LE LGDS LKY
Sbjct  651  NFDIPSSLILEALTTLRCCESFSMERLELLGDSVLKY  687



>ref|XP_007012461.1| Ribonuclease III, putative isoform 1 [Theobroma cacao]
 gb|EOY30080.1| Ribonuclease III, putative isoform 1 [Theobroma cacao]
Length=1639

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  IPS+ ILEA+TT +C ESF +E LE LGDS LKY
Sbjct  1035  NFDIPSSLILEALTTLRCCESFSMERLELLGDSVLKY  1071



>gb|KHG18654.1| Dicer-like protein 4 [Gossypium arboreum]
Length=1613

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + + ++LEA+TT+KCQE F LE LE+LGDSFLK+
Sbjct  983   VTALRVLEALTTEKCQERFSLERLESLGDSFLKF  1016



>gb|ABR17101.1| unknown [Picea sitchensis]
Length=685

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39   IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            + ++++LEAITT++C E F LE LE LGD+FLKY
Sbjct  28   VTASRVLEAITTERCMEGFSLERLEVLGDAFLKY  61



>ref|XP_007012011.1| Dicer-like protein isoform 2, partial [Theobroma cacao]
 gb|EOY29630.1| Dicer-like protein isoform 2, partial [Theobroma cacao]
Length=1614

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + + K+LEA+TT+KCQE F LE LE+LGD+FLK+
Sbjct  1022  VTANKVLEALTTEKCQERFSLERLESLGDAFLKF  1055



>ref|XP_007012010.1| Dicer-like protein, putative isoform 1 [Theobroma cacao]
 gb|EOY29629.1| Dicer-like protein, putative isoform 1 [Theobroma cacao]
Length=1690

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + + K+LEA+TT+KCQE F LE LE+LGD+FLK+
Sbjct  1058  VTANKVLEALTTEKCQERFSLERLESLGDAFLKF  1091



>ref|XP_009400626.1| PREDICTED: endoribonuclease Dicer homolog 3b-like [Musa acuminata 
subsp. malaccensis]
Length=1419

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  6    MVQDHCRQNVG-----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            M+    R+ +G     IPS+ ILEA+TT +C E+F LE LE LGDS LKY
Sbjct  804  MLASQLRKEIGYNDLLIPSSLILEAMTTLRCCENFSLERLELLGDSVLKY  853



>ref|XP_002467056.1| hypothetical protein SORBIDRAFT_01g018890 [Sorghum bicolor]
 gb|EER94054.1| hypothetical protein SORBIDRAFT_01g018890 [Sorghum bicolor]
Length=1586

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 4/49 (8%)
 Frame = +3

Query  6     MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+    R+++     IPS+ ILEAITT +C E+F LE LE LGDS LKY
Sbjct  965   MLASQLRRDISYTQRIPSSLILEAITTLRCCETFSLERLELLGDSVLKY  1013



>ref|XP_001772316.1| predicted protein [Physcomitrella patens]
 gb|EDQ62787.1| predicted protein [Physcomitrella patens]
Length=1275

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  39   IPSAKILEAITTKKCQESFHLESLETLGDSFLK  137
            +P+  +LEAITT KCQESF LE LE LGD+FL+
Sbjct  509  VPANLMLEAITTSKCQESFSLEGLELLGDAFLE  541



>gb|ABV31246.1| dicer-like 4 [Physcomitrella patens]
Length=1445

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLK  137
             +P+  +LEAITT KCQESF LE LE LGD+FL+
Sbjct  1009  VPANLMLEAITTSKCQESFSLEGLELLGDAFLE  1041



>ref|XP_006594229.1| PREDICTED: dicer-like protein 4-like isoform X3 [Glycine max]
Length=1598

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             I + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1016  ISAIRVLEALTTEKCQERFSLERLEVLGDAFLKF  1049



>ref|XP_006594228.1| PREDICTED: dicer-like protein 4-like isoform X2 [Glycine max]
Length=1635

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             I + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1016  ISAIRVLEALTTEKCQERFSLERLEVLGDAFLKF  1049



>ref|XP_006594227.1| PREDICTED: dicer-like protein 4-like isoform X1 [Glycine max]
Length=1637

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             I + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1016  ISAIRVLEALTTEKCQERFSLERLEVLGDAFLKF  1049



>gb|KHN18588.1| Dicer-like protein 4 [Glycine soja]
Length=1592

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             I + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  971   ISALRVLEALTTEKCQERFSLERLEVLGDAFLKF  1004



>ref|XP_006600705.1| PREDICTED: dicer-like protein 4-like isoform X2 [Glycine max]
Length=1485

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39   IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            I + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  866  ISALRVLEALTTEKCQERFSLERLEVLGDAFLKF  899



>gb|KHN22101.1| Dicer-like protein 4 [Glycine soja]
Length=1639

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             I + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1016  ISAIRVLEALTTEKCQERFSLERLEVLGDAFLKF  1049



>ref|XP_003550797.1| PREDICTED: dicer-like protein 4-like isoform X1 [Glycine max]
Length=1636

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             I + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1017  ISALRVLEALTTEKCQERFSLERLEVLGDAFLKF  1050



>ref|XP_004508388.1| PREDICTED: dicer-like protein 4-like [Cicer arietinum]
Length=1628

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             I + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1011  ISALRVLEALTTEKCQERFSLERLEVLGDAFLKF  1044



>ref|XP_006400601.1| hypothetical protein EUTSA_v100124260mg, partial [Eutrema salsugineum]
 gb|ESQ42054.1| hypothetical protein EUTSA_v100124260mg, partial [Eutrema salsugineum]
Length=1145

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  51    KILEAITTKKCQESFHLESLETLGDSFLKY  140
             +ILEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1038  RILEALTTEKCQERFSLERLEVLGDAFLKF  1067



>gb|EEE51167.1| hypothetical protein OsJ_31945 [Oryza sativa Japonica Group]
Length=1570

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 31/49 (63%), Gaps = 4/49 (8%)
 Frame = +3

Query  6     MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+    R+ +G    IP   ILEAITT +C E+F LE LE LGDS LKY
Sbjct  961   MLASQLRREIGYNQHIPVTLILEAITTLRCCETFSLERLELLGDSVLKY  1009



>sp|Q7XD96.2|DCL3B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 3b; AltName: Full=Dicer-like 
protein 3b; Short=OsDCL3b [Oryza sativa Japonica 
Group]
Length=1637

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 31/49 (63%), Gaps = 4/49 (8%)
 Frame = +3

Query  6     MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             M+    R+ +G    IP   ILEAITT +C E+F LE LE LGDS LKY
Sbjct  1029  MLASQLRREIGYNQHIPVTLILEAITTLRCCETFSLERLELLGDSVLKY  1077



>ref|XP_008443889.1| PREDICTED: dicer-like protein 4 isoform X3 [Cucumis melo]
Length=1565

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 6/46 (13%)
 Frame = +3

Query  21    CRQNVGIPSA------KILEAITTKKCQESFHLESLETLGDSFLKY  140
             CR     P+       +ILEA+TT+KCQE   LE LE LGDSFLK+
Sbjct  1015  CRLAAAFPAGAEVTANRILEALTTEKCQERISLERLEILGDSFLKF  1060



>ref|XP_004162460.1| PREDICTED: LOW QUALITY PROTEIN: dicer-like protein 4-like [Cucumis 
sativus]
Length=1228

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 6/46 (13%)
 Frame = +3

Query  21   CRQNVGIPSA------KILEAITTKKCQESFHLESLETLGDSFLKY  140
            CR     P+       +ILEA+TT+KCQE   LE LE LGDSFLK+
Sbjct  584  CRLAAAFPAGAEVTANRILEALTTEKCQERISLERLEILGDSFLKF  629



>ref|XP_008443891.1| PREDICTED: dicer-like protein 4 isoform X4 [Cucumis melo]
Length=1418

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 6/46 (13%)
 Frame = +3

Query  21   CRQNVGIPSA------KILEAITTKKCQESFHLESLETLGDSFLKY  140
            CR     P+       +ILEA+TT+KCQE   LE LE LGDSFLK+
Sbjct  780  CRLAAAFPAGAEVTANRILEALTTEKCQERISLERLEILGDSFLKF  825



>ref|XP_008443888.1| PREDICTED: dicer-like protein 4 isoform X2 [Cucumis melo]
Length=1652

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 6/46 (13%)
 Frame = +3

Query  21    CRQNVGIPSA------KILEAITTKKCQESFHLESLETLGDSFLKY  140
             CR     P+       +ILEA+TT+KCQE   LE LE LGDSFLK+
Sbjct  1015  CRLAAAFPAGAEVTANRILEALTTEKCQERISLERLEILGDSFLKF  1060



>ref|XP_008443887.1| PREDICTED: dicer-like protein 4 isoform X1 [Cucumis melo]
Length=1653

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 6/46 (13%)
 Frame = +3

Query  21    CRQNVGIPSA------KILEAITTKKCQESFHLESLETLGDSFLKY  140
             CR     P+       +ILEA+TT+KCQE   LE LE LGDSFLK+
Sbjct  1015  CRLAAAFPAGAEVTANRILEALTTEKCQERISLERLEILGDSFLKF  1060



>gb|KGN65222.1| hypothetical protein Csa_1G267180 [Cucumis sativus]
Length=1657

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 6/46 (13%)
 Frame = +3

Query  21    CRQNVGIPSA------KILEAITTKKCQESFHLESLETLGDSFLKY  140
             CR     P+       +ILEA+TT+KCQE   LE LE LGDSFLK+
Sbjct  1014  CRLAAAFPAGAEVTANRILEALTTEKCQERISLERLEILGDSFLKF  1059



>ref|XP_004146733.1| PREDICTED: dicer-like protein 4-like [Cucumis sativus]
Length=1657

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 6/46 (13%)
 Frame = +3

Query  21    CRQNVGIPSA------KILEAITTKKCQESFHLESLETLGDSFLKY  140
             CR     P+       +ILEA+TT+KCQE   LE LE LGDSFLK+
Sbjct  1013  CRLAAAFPAGAEVTANRILEALTTEKCQERISLERLEILGDSFLKF  1058



>gb|ABB20894.1| dicer-like protein [Oryza sativa Indica Group]
Length=1116

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 31/49 (63%), Gaps = 4/49 (8%)
 Frame = +3

Query  6    MVQDHCRQNVG----IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            M+    R+ +G    IP   ILEAITT +C E+F LE LE LGDS LKY
Sbjct  509  MLASQLRREIGYNQHIPVTLILEAITTLRCCETFSLERLELLGDSVLKY  557



>ref|XP_007155126.1| hypothetical protein PHAVU_003G1757001g, partial [Phaseolus vulgaris]
 gb|ESW27120.1| hypothetical protein PHAVU_003G1757001g, partial [Phaseolus vulgaris]
Length=1443

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  3     KMVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +M+     +   + + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1000  QMLSSSFPEAAEVSALRVLEALTTEKCQERFSLERLEVLGDAFLKF  1045



>gb|KDO73670.1| hypothetical protein CISIN_1g0003792mg, partial [Citrus sinensis]
Length=1273

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  27    QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +N  IPS+ ILEA+TT  C ESF +E LE LGDS LKY
Sbjct  1039  RNFHIPSSLILEALTTLGCCESFSMERLELLGDSVLKY  1076



>gb|EYU29223.1| hypothetical protein MIMGU_mgv1a0001672mg, partial [Erythranthe 
guttata]
Length=818

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30   NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            N  I S+ ILEA+TT +C ESF +E LE LGDS LKY
Sbjct  237  NFNISSSLILEALTTLRCNESFSMERLELLGDSVLKY  273



>gb|KDO73669.1| hypothetical protein CISIN_1g0003792mg, partial [Citrus sinensis]
Length=1287

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  27    QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +N  IPS+ ILEA+TT  C ESF +E LE LGDS LKY
Sbjct  1053  RNFHIPSSLILEALTTLGCCESFSMERLELLGDSVLKY  1090



>gb|ABV31245.1| dicer-like 3 [Physcomitrella patens]
Length=1641

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             IP  ++L+A+TT +C E+F++E+LE  GDSFLKY
Sbjct  1136  IPVMEVLKALTTTRCNENFNMEALELFGDSFLKY  1169



>ref|XP_006474520.1| PREDICTED: endoribonuclease Dicer homolog 3-like isoform X2 [Citrus 
sinensis]
Length=1652

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  27    QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +N  IPS+ ILEA+TT  C ESF +E LE LGDS LKY
Sbjct  1053  RNFHIPSSLILEALTTLGCCESFSMERLELLGDSVLKY  1090



>ref|XP_001766164.1| dsRNA-specific nuclease dicer and related ribonuclease [Physcomitrella 
patens]
 gb|EDQ69013.1| dsRNA-specific nuclease dicer and related ribonuclease [Physcomitrella 
patens]
Length=1460

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             IP  ++L+A+TT +C E+F++E+LE  GDSFLKY
Sbjct  1010  IPVMEVLKALTTTRCNENFNMEALELFGDSFLKY  1043



>ref|XP_006474519.1| PREDICTED: endoribonuclease Dicer homolog 3-like isoform X1 [Citrus 
sinensis]
Length=1653

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  27    QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +N  IPS+ ILEA+TT  C ESF +E LE LGDS LKY
Sbjct  1054  RNFHIPSSLILEALTTLGCCESFSMERLELLGDSVLKY  1091



>ref|XP_010047157.1| PREDICTED: dicer-like protein 4 isoform X2 [Eucalyptus grandis]
Length=1345

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  51    KILEAITTKKCQESFHLESLETLGDSFLKY  140
             +ILEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1026  RILEALTTEKCQERFSLERLEILGDAFLKF  1055



>ref|XP_010047156.1| PREDICTED: dicer-like protein 4 isoform X1 [Eucalyptus grandis]
 gb|KCW78979.1| hypothetical protein EUGRSUZ_C00406 [Eucalyptus grandis]
Length=1658

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  51    KILEAITTKKCQESFHLESLETLGDSFLKY  140
             +ILEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1026  RILEALTTEKCQERFSLERLEILGDAFLKF  1055



>ref|XP_010535851.1| PREDICTED: LOW QUALITY PROTEIN: dicer-like protein 4 [Tarenaya 
hassleriana]
Length=1612

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  51    KILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  995   RVLEALTTEKCQERFSLERLEVLGDAFLKF  1024



>ref|XP_010520559.1| PREDICTED: LOW QUALITY PROTEIN: dicer-like protein 4 [Tarenaya 
hassleriana]
Length=1667

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  51    KILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1039  RVLEALTTEKCQERFSLERLEVLGDAFLKF  1068



>ref|XP_007204799.1| hypothetical protein PRUPE_ppa000144mg [Prunus persica]
 gb|EMJ05998.1| hypothetical protein PRUPE_ppa000144mg [Prunus persica]
Length=1639

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1011  VTAERVLEALTTEKCQERFSLERLEILGDAFLKF  1044



>emb|CDY35811.1| BnaC09g37430D [Brassica napus]
Length=1641

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  51    KILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1033  RVLEALTTEKCQERFSLERLEVLGDAFLKF  1062



>emb|CDX92469.1| BnaA10g15080D [Brassica napus]
Length=1642

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  51    KILEAITTKKCQESFHLESLETLGDSFLKY  140
             ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1034  RVLEALTTEKCQERFSLERLEVLGDAFLKF  1063



>ref|XP_008243098.1| PREDICTED: dicer-like protein 4 [Prunus mume]
Length=1659

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1029  VTAERVLEALTTEKCQERFSLERLEILGDAFLKF  1062



>ref|XP_004288753.1| PREDICTED: dicer-like protein 4-like [Fragaria vesca subsp. vesca]
Length=1630

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + + ++LEA+TT+KCQE F LE LE LGD+FLK+
Sbjct  1005  VTAQRVLEALTTEKCQERFSLERLELLGDAFLKF  1038



>ref|XP_004501416.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
3a-like [Cicer arietinum]
Length=1685

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  27    QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
              N  IPS+ ILEA+TT +C E F +E LE LGDS LKY
Sbjct  1070  NNFKIPSSLILEALTTLRCCEKFSMERLELLGDSVLKY  1107



>ref|XP_006452950.1| hypothetical protein CICLE_v10007239mg [Citrus clementina]
 gb|ESR66190.1| hypothetical protein CICLE_v10007239mg [Citrus clementina]
Length=1652

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  27    QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +N  IPS+ +LEA+TT  C ESF +E LE LGDS LKY
Sbjct  1053  RNFHIPSSLVLEALTTLGCCESFSMERLELLGDSVLKY  1090



>ref|XP_006452951.1| hypothetical protein CICLE_v10007239mg [Citrus clementina]
 gb|ESR66191.1| hypothetical protein CICLE_v10007239mg [Citrus clementina]
Length=1653

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  27    QNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +N  IPS+ +LEA+TT  C ESF +E LE LGDS LKY
Sbjct  1054  RNFHIPSSLVLEALTTLGCCESFSMERLELLGDSVLKY  1091



>ref|XP_010556639.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Tarenaya 
hassleriana]
Length=1945

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  IPS+KILEA+T   CQE+F  E  E LGD++LK+
Sbjct  1391  NFPIPSSKILEALTAASCQETFCYERAELLGDAYLKW  1427



>ref|XP_010556636.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556637.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556638.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
Length=1946

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  IPS+KILEA+T   CQE+F  E  E LGD++LK+
Sbjct  1392  NFPIPSSKILEALTAASCQETFCYERAELLGDAYLKW  1428



>ref|XP_008357238.1| PREDICTED: endoribonuclease Dicer homolog 3a-like isoform X2 
[Malus domestica]
Length=1654

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +3

Query  9     VQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +  HC  + GI S+ ILEA+TT +C + F +E LE LGDS LKY
Sbjct  1032  INYHC-SSFGISSSLILEALTTLRCNDDFSMERLELLGDSILKY  1074



>ref|XP_008357237.1| PREDICTED: endoribonuclease Dicer homolog 3a-like isoform X1 
[Malus domestica]
Length=1655

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +3

Query  9     VQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +  HC  + GI S+ ILEA+TT +C + F +E LE LGDS LKY
Sbjct  1033  INYHC-SSFGISSSLILEALTTLRCNDDFSMERLELLGDSILKY  1075



>ref|XP_010049291.1| PREDICTED: endoribonuclease Dicer homolog 3 isoform X2 [Eucalyptus 
grandis]
 gb|KCW81817.1| hypothetical protein EUGRSUZ_C03173 [Eucalyptus grandis]
Length=1680

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + +PS+ ILEA+TT +C ESF +E LE LGDS LKY
Sbjct  1056  IHVPSSLILEALTTLRCCESFSMERLELLGDSVLKY  1091



>ref|XP_010049290.1| PREDICTED: endoribonuclease Dicer homolog 3 isoform X1 [Eucalyptus 
grandis]
Length=1686

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  33    VGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + +PS+ ILEA+TT +C ESF +E LE LGDS LKY
Sbjct  1062  IHVPSSLILEALTTLRCCESFSMERLELLGDSVLKY  1097



>ref|XP_002308384.2| hypothetical protein POPTR_0006s20310g [Populus trichocarpa]
 gb|EEE91907.2| hypothetical protein POPTR_0006s20310g [Populus trichocarpa]
Length=1638

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + + ++LEA+TT+KCQE   LE LETLGD+FLK+
Sbjct  1021  VTAHRVLEALTTEKCQERLSLERLETLGDAFLKF  1054



>ref|XP_009359046.1| PREDICTED: endoribonuclease Dicer homolog 3a-like [Pyrus x bretschneideri]
Length=1655

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +3

Query  9     VQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             +  HC  + GI S+ ILEA+TT +C + F +E LE LGDS LKY
Sbjct  1033  INYHC-SSFGISSSLILEALTTLRCNDDFSMERLELLGDSILKY  1075



>ref|XP_011033477.1| PREDICTED: dicer-like protein 4 [Populus euphratica]
Length=1631

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             + + ++LEA+TT+KCQE   LE LETLGD+FLK+
Sbjct  1014  VTAHRVLEALTTEKCQERLSLERLETLGDAFLKF  1047



>ref|NP_001154662.2| endoribonuclease Dicer-like 3 [Arabidopsis thaliana]
 sp|Q9LXW7.2|DCL3_ARATH RecName: Full=Endoribonuclease Dicer homolog 3; AltName: Full=Dicer-like 
protein 3; Short=AtDCL3 [Arabidopsis thaliana]
 gb|AEE77843.1| endoribonuclease Dicer-like 3 [Arabidopsis thaliana]
Length=1580

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  I S  ILEA+TT  C ESF +E LE LGDS LKY
Sbjct  998   NFSISSTSILEAVTTLTCPESFSMERLELLGDSVLKY  1034



>ref|XP_006852760.1| hypothetical protein AMTR_s00033p00127000 [Amborella trichopoda]
 gb|ERN14227.1| hypothetical protein AMTR_s00033p00127000 [Amborella trichopoda]
Length=1653

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  36    GIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
              + SA +LEAIT+K+C E+F LE LE LGDS LKY
Sbjct  1050  NVSSALMLEAITSKRCSENFSLERLELLGDSVLKY  1084



>ref|NP_001154663.2| endoribonuclease Dicer-like 3 [Arabidopsis thaliana]
 gb|AEE77844.1| endoribonuclease Dicer-like 3 [Arabidopsis thaliana]
Length=1570

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  I S  ILEA+TT  C ESF +E LE LGDS LKY
Sbjct  988   NFSISSTSILEAVTTLTCPESFSMERLELLGDSVLKY  1024



>ref|NP_189978.1| endoribonuclease Dicer-like 3 [Arabidopsis thaliana]
 emb|CAB88120.1| putative protein [Arabidopsis thaliana]
 gb|ABF19799.1| dicer-like 3 [Arabidopsis thaliana]
 gb|AEE77842.1| endoribonuclease Dicer-like 3 [Arabidopsis thaliana]
Length=1531

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +3

Query  30   NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            N  I S  ILEA+TT  C ESF +E LE LGDS LKY
Sbjct  949  NFSISSTSILEAVTTLTCPESFSMERLELLGDSVLKY  985



>gb|KEH32166.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1625

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             I + ++LEA+TT++CQE F LE LE LGD+FLK+
Sbjct  1008  ISAHRVLEALTTEQCQERFSLERLEVLGDAFLKF  1041



>gb|AES73487.2| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1730

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  IPS+ +LEA+TT +C E F +E LE LGDS LKY
Sbjct  1093  NFKIPSSLVLEALTTLRCCEKFSMERLELLGDSVLKY  1129



>ref|XP_010541703.1| PREDICTED: endoribonuclease Dicer homolog 3 isoform X2 [Tarenaya 
hassleriana]
Length=1120

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30   NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            N  IPS+ ILEA+TT  C E+F +E LE LGDS LKY
Sbjct  543  NFSIPSSLILEALTTLLCCETFSMERLELLGDSVLKY  579



>ref|XP_003603236.1| Endoribonuclease Dicer-like protein [Medicago truncatula]
Length=1758

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  IPS+ +LEA+TT +C E F +E LE LGDS LKY
Sbjct  1121  NFKIPSSLVLEALTTLRCCEKFSMERLELLGDSVLKY  1157



>ref|XP_010541702.1| PREDICTED: endoribonuclease Dicer homolog 3 isoform X1 [Tarenaya 
hassleriana]
Length=1337

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30   NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            N  IPS+ ILEA+TT  C E+F +E LE LGDS LKY
Sbjct  760  NFSIPSSLILEALTTLLCCETFSMERLELLGDSVLKY  796



>ref|XP_010648401.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X2 [Vitis 
vinifera]
Length=1680

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             I S+ ILEAITT +C ESF +E LE LGDS LKY
Sbjct  1061  ISSSLILEAITTLRCSESFSMERLELLGDSVLKY  1094



>ref|XP_010648400.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X1 [Vitis 
vinifera]
Length=1684

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             I S+ ILEAITT +C ESF +E LE LGDS LKY
Sbjct  1065  ISSSLILEAITTLRCSESFSMERLELLGDSVLKY  1098



>emb|CBI20740.3| unnamed protein product [Vitis vinifera]
Length=1688

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  39    IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             I S+ ILEAITT +C ESF +E LE LGDS LKY
Sbjct  1069  ISSSLILEAITTLRCSESFSMERLELLGDSVLKY  1102



>emb|CBI38730.3| unnamed protein product [Vitis vinifera]
Length=1474

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  +P+AKILEA+T   CQE+F  E  E LGD++LK+
Sbjct  1363  NYPVPAAKILEALTAASCQETFCYERAELLGDAYLKW  1399



>ref|XP_010661522.1| PREDICTED: endoribonuclease Dicer homolog 1 [Vitis vinifera]
Length=1974

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  +P+AKILEA+T   CQE+F  E  E LGD++LK+
Sbjct  1422  NYPVPAAKILEALTAASCQETFCYERAELLGDAYLKW  1458



>gb|AIO05700.1| putative endoribonuclease dicer-like protein 1, partial [Cocos 
nucifera]
Length=1720

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  +PSA+ILEA+T   CQE+F  E  E LGD++LK+
Sbjct  1164  NYPVPSARILEALTAASCQETFCYERAELLGDAYLKW  1200



>gb|KDP38631.1| hypothetical protein JCGZ_03984 [Jatropha curcas]
Length=1173

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  6    MVQDHCRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            ++ D   +   + + ++LEA+TT++CQE   LE LE LGD+FLK+
Sbjct  543  LLSDSFSEGAEVTACRVLEALTTERCQERLSLERLEILGDAFLKF  587



>ref|XP_009381868.1| PREDICTED: endoribonuclease Dicer homolog 3a-like [Musa acuminata 
subsp. malaccensis]
Length=1273

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +3

Query  21   CRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            C  N  IPS  ILEAITT +C E F +E LE LGDS LKY
Sbjct  660  CSSN-PIPSFLILEAITTLRCCEDFSMERLELLGDSVLKY  698



>ref|XP_008235739.1| PREDICTED: endoribonuclease Dicer homolog 3a-like [Prunus mume]
Length=1682

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N+ I S+ ILEA+TT +C E+F LE LE LGDS LKY
Sbjct  1049  NIKISSSLILEALTTLRCCENFSLERLEFLGDSVLKY  1085



>gb|KFK44833.1| hypothetical protein AALP_AA1G308600 [Arabis alpina]
Length=1231

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +3

Query  30   NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            N  I S  ILEA+TT  C E+F +E LE LGDS LKY
Sbjct  649  NFSISSTTILEALTTMTCAETFSMERLELLGDSVLKY  685



>gb|KFK44835.1| hypothetical protein AALP_AA1G308600 [Arabis alpina]
Length=1232

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +3

Query  30   NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            N  I S  ILEA+TT  C E+F +E LE LGDS LKY
Sbjct  650  NFSISSTTILEALTTMTCAETFSMERLELLGDSVLKY  686



>gb|KFK44834.1| hypothetical protein AALP_AA1G308600 [Arabis alpina]
Length=1235

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +3

Query  30   NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            N  I S  ILEA+TT  C E+F +E LE LGDS LKY
Sbjct  650  NFSISSTTILEALTTMTCAETFSMERLELLGDSVLKY  686



>ref|XP_008358840.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Malus domestica]
Length=1969

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  +P++KILEA+T   CQE+F  E  E LGD++LK+
Sbjct  1421  NYSVPASKILEALTAASCQETFCYERAELLGDAYLKW  1457



>gb|KDO59383.1| hypothetical protein CISIN_1g0003801mg, partial [Citrus sinensis]
Length=578

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  54   ILEAITTKKCQESFHLESLETLGDSFLKY  140
            +L+A+TT+KCQE F LE LE LGD+FLKY
Sbjct  1    LLKALTTEKCQERFSLERLEILGDAFLKY  29



>gb|AIO05701.1| putative endoribonuclease dicer 3a-like protein 3a, partial [Cocos 
nucifera]
Length=1207

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +3

Query  21   CRQNVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            C  N    S  ILEAITT +C E F LE LE LGDS LKY
Sbjct  600  CPSNTSTSSFLILEAITTVRCCEDFSLERLELLGDSVLKY  639



>ref|XP_009335261.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=1971

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  +P++KILEA+T   CQE+F  E  E LGD++LK+
Sbjct  1423  NYSVPASKILEALTAASCQETFCYERAELLGDAYLKW  1459



>ref|XP_002875633.1| hypothetical protein ARALYDRAFT_484824 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51892.1| hypothetical protein ARALYDRAFT_484824 [Arabidopsis lyrata subsp. 
lyrata]
Length=1521

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +3

Query  30   NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            N  I S  ILEA+TT  C E+F +E LE LGDS LKY
Sbjct  939  NFSISSTSILEAVTTLTCPEAFSMERLELLGDSVLKY  975



>ref|XP_009335262.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=1744

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  +P++KILEA+T   CQE+F  E  E LGD++LK+
Sbjct  1423  NYSVPASKILEALTAASCQETFCYERAELLGDAYLKW  1459



>ref|XP_006848760.1| hypothetical protein AMTR_s00026p00051870 [Amborella trichopoda]
 gb|ERN10341.1| hypothetical protein AMTR_s00026p00051870 [Amborella trichopoda]
Length=1371

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  39   IPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
            I + ++LEAIT++KC E F LE LE LGD++LKY
Sbjct  731  ITAHRVLEAITSEKCMERFSLERLEILGDAYLKY  764



>ref|XP_007220573.1| hypothetical protein PRUPE_ppa000070mg [Prunus persica]
 gb|EMJ21772.1| hypothetical protein PRUPE_ppa000070mg [Prunus persica]
Length=1971

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  30    NVGIPSAKILEAITTKKCQESFHLESLETLGDSFLKY  140
             N  IP++KILEA+T   CQE+F  E  E LGD++LK+
Sbjct  1422  NYPIPASKILEALTAASCQETFCYERAELLGDAYLKW  1458



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509157648584