BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9312_g1_i2 len=272 path=[1:0-93 95:94-271]

Length=272
                                                                      Score     E

ref|XP_009760231.1|  PREDICTED: probable BOI-related E3 ubiquitin...    107   1e-25   
gb|ACD40009.1|  SBP1                                                    107   1e-25   Nicotiana alata [flowering tobacco]
ref|XP_009604888.1|  PREDICTED: probable BOI-related E3 ubiquitin...    107   1e-25   
ref|XP_006354867.1|  PREDICTED: RING finger protein B-like              104   1e-24   
gb|AAS76633.1|  S-RNase binding protein 1                               104   1e-24   Solanum chacoense
gb|AAR92230.1|  S-RNase-binding protein                                 104   1e-24   Solanum chacoense
ref|NP_001233830.1|  CONSTANS interacting protein 4                     103   2e-24   
gb|ABB77434.1|  S-RNase-binding protein                                 102   5e-24   Petunia integrifolia subsp. inflata
gb|AAF28357.2|AF223395_1  S-ribonuclease binding protein SBP1           100   2e-23   Petunia x hybrida [garden petunia]
emb|CDP01322.1|  unnamed protein product                              90.1    2e-19   
ref|XP_006434742.1|  hypothetical protein CICLE_v10001290mg           80.5    1e-15   
ref|XP_010112179.1|  RING finger protein B                            79.3    1e-15   
ref|XP_011029674.1|  PREDICTED: probable BOI-related E3 ubiquitin...  78.6    2e-15   
ref|XP_002320782.2|  S-RIBONUCLEASE BINDING protein 1                 77.4    7e-15   Populus trichocarpa [western balsam poplar]
gb|KDO84132.1|  hypothetical protein CISIN_1g0432862mg                75.1    3e-14   
ref|XP_011083881.1|  PREDICTED: probable BOI-related E3 ubiquitin...  75.1    5e-14   
gb|ABK93084.1|  unknown                                               74.7    6e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006473305.1|  PREDICTED: probable BOI-related E3 ubiquitin...  73.2    2e-13   
ref|XP_002301175.2|  hypothetical protein POPTR_0002s12630g           72.4    5e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011017185.1|  PREDICTED: probable BOI-related E3 ubiquitin...  72.4    6e-13   
gb|EYU36313.1|  hypothetical protein MIMGU_mgv1a009482mg              71.6    1e-12   
ref|XP_008220241.1|  PREDICTED: probable BOI-related E3 ubiquitin...  71.6    1e-12   
ref|XP_004291095.1|  PREDICTED: uncharacterized protein LOC101301063  70.5    3e-12   
ref|XP_002891329.1|  S-ribonuclease binding protein 1                 69.7    4e-12   
gb|AGW01013.1|  S-RNase binding protein 1-like protein                69.3    7e-12   
ref|XP_010552508.1|  PREDICTED: probable BOI-related E3 ubiquitin...  68.9    8e-12   
ref|XP_011074416.1|  PREDICTED: probable BOI-related E3 ubiquitin...  69.3    8e-12   
ref|NP_175141.1|  S-ribonuclease binding protein 1                    68.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017198.1|  S-ribonuclease binding protein 1                 67.8    3e-11   
gb|KDP41718.1|  hypothetical protein JCGZ_16125                       67.4    4e-11   
ref|XP_006305179.1|  hypothetical protein CARUB_v10009545mg           66.6    8e-11   
ref|XP_007222504.1|  hypothetical protein PRUPE_ppa008290mg           65.9    1e-10   
ref|XP_010479104.1|  PREDICTED: probable BOI-related E3 ubiquitin...  65.5    2e-10   
ref|XP_010664564.1|  PREDICTED: probable BOI-related E3 ubiquitin...  65.1    2e-10   
dbj|BAO04295.1|  S-RNase binding protein 1                            63.2    1e-09   
ref|XP_007160863.1|  hypothetical protein PHAVU_001G023100g           62.8    1e-09   
ref|XP_003550333.1|  PREDICTED: probable BOI-related E3 ubiquitin...  62.8    2e-09   
gb|KHN12793.1|  RING finger protein B                                 62.8    2e-09   
ref|XP_010461504.1|  PREDICTED: probable BOI-related E3 ubiquitin...  62.4    3e-09   
ref|XP_004499050.1|  PREDICTED: RING finger protein B-like            62.0    3e-09   
ref|XP_003589169.1|  Baculoviral IAP repeat-containing protein        61.6    4e-09   
ref|NP_001239697.1|  uncharacterized protein LOC100783373             61.2    7e-09   
ref|XP_009359780.1|  PREDICTED: probable BOI-related E3 ubiquitin...  60.8    7e-09   
ref|XP_006393634.1|  hypothetical protein EUTSA_v10011662mg           60.5    9e-09   
ref|XP_008393794.1|  PREDICTED: probable BOI-related E3 ubiquitin...  60.5    1e-08   
ref|XP_008378031.1|  PREDICTED: probable BOI-related E3 ubiquitin...  59.7    2e-08   
ref|XP_008347618.1|  PREDICTED: probable BOI-related E3 ubiquitin...  59.7    2e-08   
ref|XP_004141263.1|  PREDICTED: uncharacterized protein LOC101215...  58.2    7e-08   
emb|CDY06767.1|  BnaA10g05460D                                        57.4    1e-07   
ref|XP_010540371.1|  PREDICTED: probable BOI-related E3 ubiquitin...  57.8    1e-07   
emb|CAN66984.1|  hypothetical protein VITISV_004458                   55.8    4e-07   Vitis vinifera
gb|EPS67621.1|  hypothetical protein M569_07154                       54.7    1e-06   
ref|XP_010269519.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.7    1e-06   
ref|XP_008452569.1|  PREDICTED: probable BOI-related E3 ubiquitin...  54.7    1e-06   
ref|XP_010500210.1|  PREDICTED: uncharacterized protein LOC104777628  51.6    3e-06   
ref|XP_009123523.1|  PREDICTED: probable BOI-related E3 ubiquitin...  53.1    4e-06   
ref|XP_010061737.1|  PREDICTED: uncharacterized protein LOC104449...  51.2    6e-06   
ref|XP_008452570.1|  PREDICTED: probable BOI-related E3 ubiquitin...  52.4    7e-06   
ref|XP_009107443.1|  PREDICTED: probable BOI-related E3 ubiquitin...  52.0    8e-06   
emb|CDY17048.1|  BnaA08g04120D                                        52.0    9e-06   
ref|XP_010263518.1|  PREDICTED: probable BOI-related E3 ubiquitin...  51.2    2e-05   
ref|XP_004141264.1|  PREDICTED: uncharacterized protein LOC101215...  51.2    2e-05   
ref|XP_010061735.1|  PREDICTED: BOI-related E3 ubiquitin-protein ...  51.2    2e-05   
gb|KFK36160.1|  hypothetical protein AALP_AA4G085800                  48.9    1e-04   



>ref|XP_009760231.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Nicotiana sylvestris]
Length=337

 Score =   107 bits (266),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWN  263
            S  FRD++N+M+GQIS PV YF+GSNLP++SQHPPY+P FQVVGL P P +E  LDLQWN
Sbjct  22   SNSFRDIYNNMDGQISTPVAYFNGSNLPEQSQHPPYIPAFQVVGLAPGPADEGGLDLQWN  81

Query  264  YGL  272
            YGL
Sbjct  82   YGL  84



>gb|ACD40009.1| SBP1 [Nicotiana alata]
Length=335

 Score =   107 bits (266),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWN  263
            S  FRD++N+M+GQIS PV YF+GSNLP++SQHPPY+P FQVVGL P P +E  LDLQWN
Sbjct  20   SNSFRDIYNNMDGQISTPVAYFNGSNLPEQSQHPPYIPAFQVVGLAPGPADEGGLDLQWN  79

Query  264  YGL  272
            YGL
Sbjct  80   YGL  82



>ref|XP_009604888.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Nicotiana tomentosiformis]
Length=337

 Score =   107 bits (266),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWN  263
            S  FRD++N+M+GQIS PV YF+GSNLP++SQHPPY+P FQV GL P P +E  LDLQWN
Sbjct  22   SKSFRDIYNNMDGQISTPVAYFNGSNLPEQSQHPPYIPAFQVAGLAPGPADEGALDLQWN  81

Query  264  YGL  272
            YGL
Sbjct  82   YGL  84



>ref|XP_006354867.1| PREDICTED: RING finger protein B-like [Solanum tuberosum]
Length=341

 Score =   104 bits (260),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWN  263
            S  +RD++N+M+GQI+ PVVYF+GSNLP++SQHPPY+PPFQVVGL P   ++  LDLQWN
Sbjct  26   SKSYRDLYNNMDGQITTPVVYFNGSNLPEQSQHPPYIPPFQVVGLAPGTADDGGLDLQWN  85

Query  264  YGL  272
            YGL
Sbjct  86   YGL  88



>gb|AAS76633.1| S-RNase binding protein 1 [Solanum chacoense]
Length=337

 Score =   104 bits (260),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWN  263
            S  +RD++N+M+GQI+ PVVYF+GSNLP++SQHPPY+PPFQVVGL P   ++  LDLQWN
Sbjct  22   SKSYRDLYNNMDGQITTPVVYFNGSNLPEQSQHPPYIPPFQVVGLAPGTADDGGLDLQWN  81

Query  264  YGL  272
            YGL
Sbjct  82   YGL  84



>gb|AAR92230.1| S-RNase-binding protein [Solanum chacoense]
Length=342

 Score =   104 bits (259),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWN  263
            S  +RD++N+M+GQI+ PVVYF+GSNLP++SQHPPY+PPFQVVGL P   ++  LDLQWN
Sbjct  27   SKSYRDLYNNMDGQITTPVVYFNGSNLPEQSQHPPYIPPFQVVGLAPGTADDGGLDLQWN  86

Query  264  YGL  272
            YGL
Sbjct  87   YGL  89



>ref|NP_001233830.1| CONSTANS interacting protein 4 [Solanum lycopersicum]
 gb|AAS67372.1| CONSTANS interacting protein 4 [Solanum lycopersicum]
Length=338

 Score =   103 bits (257),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWN  263
            S  +RD++N+M+GQI+ PVVYF+GSNLP++SQHPPY+PPFQVVGL P   ++  LDLQWN
Sbjct  23   SKSYRDLYNNMDGQITNPVVYFNGSNLPEQSQHPPYIPPFQVVGLAPGTADDGGLDLQWN  82

Query  264  YGL  272
            YGL
Sbjct  83   YGL  85



>gb|ABB77434.1| S-RNase-binding protein [Petunia integrifolia subsp. inflata]
Length=335

 Score =   102 bits (255),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWN  263
            S  +RD++N+M+GQIS PV YF+GSNLP++SQHPPY+PPFQVVGL P  V++  LDLQWN
Sbjct  20   SKSYRDIYNNMDGQISTPVAYFNGSNLPEQSQHPPYIPPFQVVGLAPGLVDDGGLDLQWN  79

Query  264  YGL  272
            YGL
Sbjct  80   YGL  82



>gb|AAF28357.2|AF223395_1 S-ribonuclease binding protein SBP1 [Petunia x hybrida]
Length=332

 Score =   100 bits (250),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWN  263
            S  +RD++N+M+GQIS PV YF+ SNLP++SQHPPY+PPFQVVGL P  V++  LDLQWN
Sbjct  17   SKSYRDIYNNMDGQISTPVAYFNCSNLPEQSQHPPYIPPFQVVGLAPGLVDDGGLDLQWN  76

Query  264  YGL  272
            YGL
Sbjct  77   YGL  79



>emb|CDP01322.1| unnamed protein product [Coffea canephora]
Length=357

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = +3

Query  93   FRDMHNSMNG-QISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEE--ATLDLQWN  263
             RD++++M   QISPPV +F+G NLPD+S HPPYVPPFQVVGL P  VEE    L+LQWN
Sbjct  26   LRDIYSNMEAAQISPPVAFFNGMNLPDQSNHPPYVPPFQVVGLAPATVEEQGGGLELQWN  85

Query  264  YGL  272
            YG 
Sbjct  86   YGF  88



>ref|XP_006434742.1| hypothetical protein CICLE_v10001290mg [Citrus clementina]
 gb|ESR47982.1| hypothetical protein CICLE_v10001290mg [Citrus clementina]
Length=419

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 7/83 (8%)
 Frame = +3

Query  42   ERHFQQNSPQPHQRSMPFRDMHNSMNGQISPPVVYFDGSN-LPDRSQHPPYVPPFQVVGL  218
            + HFQQN  QP Q+S  FR+++ +M+GQISPPV Y+  +N L D+SQHPPY+PPF VVG 
Sbjct  86   QHHFQQNYQQPQQQSKSFRNLY-AMDGQISPPVAYYSSANNLQDQSQHPPYIPPFHVVGF  144

Query  219  VPVPV-----EEATLDLQWNYGL  272
             P PV      +   DLQWN GL
Sbjct  145  APGPVNATDGSDGGADLQWNSGL  167



>ref|XP_010112179.1| RING finger protein B [Morus notabilis]
 gb|EXC32845.1| RING finger protein B [Morus notabilis]
Length=338

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 6/65 (9%)
 Frame = +3

Query  93   FRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEAT-----LDLQ  257
            FR+++ S++GQISPPV Y+D + + D+SQHPPY+PPF VVG  P PV  A      +DLQ
Sbjct  23   FRNLY-SIDGQISPPVTYYDPTTVQDQSQHPPYIPPFHVVGFAPGPVAAADCSDGGVDLQ  81

Query  258  WNYGL  272
            WNY L
Sbjct  82   WNYDL  86



>ref|XP_011029674.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Populus euphratica]
Length=338

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = +3

Query  111  SMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPV-------EEATLDLQWNYG  269
            +++GQISP V YF+ SNL D+SQHPPYVPPF VVG  P PV        +  L+LQWNYG
Sbjct  26   AIDGQISPAVAYFNPSNLQDQSQHPPYVPPFHVVGFAPGPVPGPGNDGSDGGLELQWNYG  85

Query  270  L  272
            L
Sbjct  86   L  86



>ref|XP_002320782.2| S-RIBONUCLEASE BINDING protein 1 [Populus trichocarpa]
 gb|EEE99097.2| S-RIBONUCLEASE BINDING protein 1 [Populus trichocarpa]
Length=337

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 3/57 (5%)
 Frame = +3

Query  111  SMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEAT---LDLQWNYGL  272
            +++ QISP V YF+ SNL D+SQHPPYVPPF VVG  P P  + +   L+LQWNYGL
Sbjct  29   AIDSQISPAVAYFNPSNLQDQSQHPPYVPPFHVVGFAPGPGNDGSDGGLELQWNYGL  85



>gb|KDO84132.1| hypothetical protein CISIN_1g0432862mg, partial [Citrus sinensis]
Length=293

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 7/81 (9%)
 Frame = +3

Query  48   HFQQNSPQPHQRSMPFRDMHNSMNGQISPPVVYFDGSN-LPDRSQHPPYVPPFQVVGLVP  224
            HFQQN  QP Q+S  FR+++ +M+GQISPPV Y+  +N L D+SQHPPY+PPF VVG  P
Sbjct  7    HFQQNYQQPQQQSKSFRNLY-AMDGQISPPVAYYSSANNLQDQSQHPPYIPPFHVVGFAP  65

Query  225  VPV-----EEATLDLQWNYGL  272
             PV      +   DLQWN GL
Sbjct  66   GPVNATDGSDGGADLQWNSGL  86



>ref|XP_011083881.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Sesamum indicum]
Length=347

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 52/83 (63%), Gaps = 8/83 (10%)
 Frame = +3

Query  42   ERHFQQN----SPQPHQRSMPFRDM-HNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQ  206
            + HFQQ     S QP Q    FRD  +N+M GQIS  V YF+  NL D   HPPY+PPFQ
Sbjct  6    QNHFQQFLQHPSSQPQQSKPFFRDFSNNNMEGQISQQVNYFNTPNLLD--HHPPYIPPFQ  63

Query  207  VVGLVPVPV-EEATLDLQWNYGL  272
            V GL P PV EE  LDL WN+GL
Sbjct  64   VAGLAPGPVQEENGLDLHWNFGL  86



>gb|ABK93084.1| unknown [Populus trichocarpa]
Length=337

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 3/57 (5%)
 Frame = +3

Query  111  SMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEAT---LDLQWNYGL  272
            +++ QISP V YF+ SNL D+SQHPPYVPPF V G  P P  + +   L+LQWNYGL
Sbjct  29   AIDSQISPAVAYFNPSNLQDQSQHPPYVPPFHVEGFAPGPGNDGSDGGLELQWNYGL  85



>ref|XP_006473305.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2-like 
[Citrus sinensis]
Length=338

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 7/81 (9%)
 Frame = +3

Query  48   HFQQNSPQPHQRSMPFRDMHNSMNGQISPPVVYFD-GSNLPDRSQHPPYVPPFQVVGLVP  224
            HFQQN  QP Q+S  FR+++ +M+GQISPPV Y+   +NL D+SQHPPY+PPF VVG  P
Sbjct  7    HFQQNYQQPQQQSKSFRNLY-AMDGQISPPVAYYSTANNLQDQSQHPPYIPPFHVVGFAP  65

Query  225  VPV-----EEATLDLQWNYGL  272
             PV      +   DL+WN GL
Sbjct  66   GPVNATDGSDGGADLRWNSGL  86



>ref|XP_002301175.2| hypothetical protein POPTR_0002s12630g [Populus trichocarpa]
 gb|EEE80448.2| hypothetical protein POPTR_0002s12630g [Populus trichocarpa]
Length=352

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 41/57 (72%), Gaps = 3/57 (5%)
 Frame = +3

Query  111  SMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEAT---LDLQWNYGL  272
            ++ GQISP V Y + SNL D+SQHPPYVPPF VVG  PVPV + +    +LQWNY L
Sbjct  44   AIEGQISPAVAYLNPSNLQDQSQHPPYVPPFHVVGFAPVPVNDGSDGGFELQWNYRL  100



>ref|XP_011017185.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Populus euphratica]
Length=353

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = +3

Query  111  SMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEAT---LDLQWNYGL  272
            +++GQISP V Y + SNL D+SQHPPYVPPF VVG  P PV + +    +L WNY L
Sbjct  45   AIDGQISPAVAYLNRSNLQDQSQHPPYVPPFHVVGFAPGPVNDGSDGGFELLWNYRL  101



>gb|EYU36313.1| hypothetical protein MIMGU_mgv1a009482mg [Erythranthe guttata]
Length=340

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = +3

Query  90   PFRDMHNS-MNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPV-EEATLDLQWN  263
            PFRD++NS M GQIS  V YF+  NL D   HPPY+PPFQV GL P P  EE   DLQWN
Sbjct  26   PFRDVYNSNMEGQISQQVAYFNTPNLLD--HHPPYIPPFQVAGLAPGPSHEENGPDLQWN  83

Query  264  YGL  272
            +GL
Sbjct  84   FGL  86



>ref|XP_008220241.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Prunus mume]
Length=349

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 6/68 (9%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPV-----EEATL  248
            S  FR+++ +++G ++P + Y+D S L D SQHPPYVPPF VVG  P PV      +   
Sbjct  31   SKSFRNLY-TIDGHMTPAMAYYDPSTLQDHSQHPPYVPPFHVVGFAPGPVAATDGSDNGA  89

Query  249  DLQWNYGL  272
            DLQW YG 
Sbjct  90   DLQWQYGF  97



>ref|XP_004291095.1| PREDICTED: uncharacterized protein LOC101301063 [Fragaria vesca 
subsp. vesca]
Length=347

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 8/70 (11%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHP--PYVPPFQVVGLVPVPV-----EEA  242
            S  FR+++ +++GQ+SP V YFD + L D SQHP  PYVPPF VVG  P PV      + 
Sbjct  29   SKSFRNLY-AIDGQMSPAVAYFDPNALQDHSQHPPSPYVPPFHVVGFAPGPVAATDGSDN  87

Query  243  TLDLQWNYGL  272
              D QWNYGL
Sbjct  88   GADFQWNYGL  97



>ref|XP_002891329.1| S-ribonuclease binding protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67588.1| S-ribonuclease binding protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=328

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 9/76 (12%)
 Frame = +3

Query  69   QPH-QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEAT  245
             PH Q S  FRD    ++GQISP + + + +NL D+SQHPPY+PPF V G  P PV +  
Sbjct  4    HPHLQDSKNFRDF-CGIDGQISPELGFDNSTNLHDQSQHPPYIPPFHVAGFAPGPVGQID  62

Query  246  -------LDLQWNYGL  272
                    +L+WNYGL
Sbjct  63   GSDGGNGAELEWNYGL  78



>gb|AGW01013.1| S-RNase binding protein 1-like protein [Prunus avium]
Length=339

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 6/67 (9%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEAT-----L  248
            S  FR+++ +++GQ++P V Y+D S L D SQHPPYVPPF VVG  P PV          
Sbjct  21   SKSFRNLY-TIDGQMTPAVAYYDPSTLQDHSQHPPYVPPFHVVGFAPGPVAATDGSDNGA  79

Query  249  DLQWNYG  269
            DLQW YG
Sbjct  80   DLQWQYG  86



>ref|XP_010552508.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Tarenaya hassleriana]
Length=336

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 46/81 (57%), Gaps = 8/81 (10%)
 Frame = +3

Query  45   RHFQQNSPQPHQRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVP  224
            RH   N  Q  + S  FRD+   ++ QISP + +   +NL D+SQHPPY+PPF V G  P
Sbjct  4    RH--HNFQQKPRDSKNFRDL-CGIDSQISPGLGFESSANLHDQSQHPPYIPPFHVAGFAP  60

Query  225  VPV-----EEATLDLQWNYGL  272
             PV      +   DLQWNYG 
Sbjct  61   SPVVKTDGPDGASDLQWNYGF  81



>ref|XP_011074416.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Sesamum indicum]
Length=342

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 4/62 (6%)
 Frame = +3

Query  93   FRDMHNS-MNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPV-EEATLDLQWNY  266
            FRD++NS M GQIS  V YF+  NL D   HPPY+PPFQV GL P P  EE  L+LQW+ 
Sbjct  26   FRDLYNSNMEGQISQQVPYFNTPNLLD--HHPPYIPPFQVAGLAPGPSHEENGLELQWSS  83

Query  267  GL  272
            GL
Sbjct  84   GL  85



>ref|NP_175141.1| S-ribonuclease binding protein 1 [Arabidopsis thaliana]
 gb|AAG40071.1|AF324720_1 F2G19.2 [Arabidopsis thaliana]
 gb|AAG42919.1|AF329502_1 putative S-ribonuclease binding protein SBP1 [Arabidopsis thaliana]
 gb|AAG50626.1|AC083835_11 S-ribonuclease binding protein SBP1, putative [Arabidopsis thaliana]
 gb|AAK15576.1|AF349529_1 putative S-ribonuclease binding protein SBP1 [Arabidopsis thaliana]
 gb|AAL49936.1| F2G19.22/F2G19.22 [Arabidopsis thaliana]
 gb|AAM10368.1| F2G19.22/F2G19.22 [Arabidopsis thaliana]
 dbj|BAD93762.1| S-ribonuclease binding like protein [Arabidopsis thaliana]
 gb|AEE32123.1| S-ribonuclease binding protein 1 [Arabidopsis thaliana]
Length=325

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 43/76 (57%), Gaps = 9/76 (12%)
 Frame = +3

Query  69   QPH-QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEAT  245
             PH Q S  FRD    ++GQISP + +    NL D+SQHPPY+PPF V G  P PV +  
Sbjct  4    HPHLQDSKNFRDF-CGIDGQISPELGFNRSENLHDQSQHPPYIPPFHVAGFAPGPVVQID  62

Query  246  -------LDLQWNYGL  272
                    D +WNYGL
Sbjct  63   GSDGGNGADFEWNYGL  78



>ref|XP_007017198.1| S-ribonuclease binding protein 1 [Theobroma cacao]
 gb|EOY14423.1| S-ribonuclease binding protein 1 [Theobroma cacao]
Length=343

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 6/68 (9%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPV-----EEATL  248
            S  FR+++ + + QISP + Y+   NL D+SQHPPY+PPF VVG  P PV      +   
Sbjct  22   SKSFRNLYTT-DDQISPALAYYSAPNLQDQSQHPPYIPPFHVVGFAPGPVPVTDGSDGGA  80

Query  249  DLQWNYGL  272
            +LQWN G+
Sbjct  81   ELQWNNGV  88



>gb|KDP41718.1| hypothetical protein JCGZ_16125 [Jatropha curcas]
Length=339

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 6/60 (10%)
 Frame = +3

Query  111  SMNGQISPPVVYFDGSNLPDRSQHPPYV-PPFQVVGLVPVPV-----EEATLDLQWNYGL  272
            S++GQI+P + Y++ +NL D+SQ+PPY+ PPF VVG  P P       +  +DLQWNYGL
Sbjct  29   SIDGQITPSIAYYNPANLQDQSQNPPYIPPPFHVVGFAPGPAPVADGSDGGVDLQWNYGL  88



>ref|XP_006305179.1| hypothetical protein CARUB_v10009545mg, partial [Capsella rubella]
 gb|EOA38077.1| hypothetical protein CARUB_v10009545mg, partial [Capsella rubella]
Length=358

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 14/80 (18%)
 Frame = +3

Query  72   PH-QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEE---  239
            PH Q S  FRD    ++GQISP + +   +NL D+SQHPPY+PPF V G  P PV +   
Sbjct  32   PHLQDSKNFRDF-CGIDGQISPELGFDSSANLHDQSQHPPYIPPFHVAGFAPGPVVQIDG  90

Query  240  ---------ATLDLQWNYGL  272
                        D +WNYGL
Sbjct  91   SDGGNGNNGNGADFEWNYGL  110



>ref|XP_007222504.1| hypothetical protein PRUPE_ppa008290mg [Prunus persica]
 gb|EMJ23703.1| hypothetical protein PRUPE_ppa008290mg [Prunus persica]
Length=338

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 6/67 (9%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEAT-----L  248
            S  FR+++ +++G ++P + Y+D S L D SQHPPYVPPF VVG  P PV          
Sbjct  20   SKSFRNLY-TIDGHMTPAMAYYDPSTLQDHSQHPPYVPPFHVVGFAPGPVAATDGSDNGA  78

Query  249  DLQWNYG  269
            DLQW YG
Sbjct  79   DLQWQYG  85



>ref|XP_010479104.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Camelina sativa]
Length=333

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 44/78 (56%), Gaps = 12/78 (15%)
 Frame = +3

Query  72   PH-QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEE---  239
            PH Q S  FRD    ++GQISP + +   +NL D+SQHPPY+PPF V G  P PV +   
Sbjct  9    PHLQASKNFRDF-CGIDGQISPELGFDSSANLHDQSQHPPYIPPFHVAGFAPGPVVQIDG  67

Query  240  -------ATLDLQWNYGL  272
                      D +WNYGL
Sbjct  68   SDGGGGGNGADFEWNYGL  85



>ref|XP_010664564.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Vitis vinifera]
 emb|CBI19504.3| unnamed protein product [Vitis vinifera]
Length=330

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 10/76 (13%)
 Frame = +3

Query  72   PH----QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPV--  233
            PH    Q S P+R+++ +  GQIS    ++  +N  D+S HPPY+PPF V G  P P   
Sbjct  4    PHHPFQQESKPYRNLYTN-EGQISQQAAFYSTTNFQDQSHHPPYIPPFHVEGFAPGPFAA  62

Query  234  ---EEATLDLQWNYGL  272
               ++   +L+WNYGL
Sbjct  63   ADGDDGGGELRWNYGL  78



>dbj|BAO04295.1| S-RNase binding protein 1 [Malus domestica]
Length=341

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 8/70 (11%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPD--RSQHPPYVPPFQVVGLVPVPV-----EEA  242
            S  FR+++ +++GQ+SP V Y+D  NL D  + QHPPYVPPF VVG  P PV      + 
Sbjct  21   SKSFRNLY-TIDGQMSPAVAYYDPGNLHDHPQQQHPPYVPPFHVVGFAPGPVAATDGSDN  79

Query  243  TLDLQWNYGL  272
              DLQ +YG 
Sbjct  80   CADLQCHYGF  89



>ref|XP_007160863.1| hypothetical protein PHAVU_001G023100g [Phaseolus vulgaris]
 gb|ESW32857.1| hypothetical protein PHAVU_001G023100g [Phaseolus vulgaris]
Length=339

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 6/66 (9%)
 Frame = +3

Query  90   PFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEAT-----LDL  254
            PFR++  +++GQ+   V +++ S+L D+SQHPPY+PPF VVG  P P  + +     L L
Sbjct  23   PFRNLQ-AIDGQMPQQVAFYNPSDLQDQSQHPPYIPPFHVVGFAPGPPADGSDGGVDLQL  81

Query  255  QWNYGL  272
            QWNYGL
Sbjct  82   QWNYGL  87



>ref|XP_003550333.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3-like 
[Glycine max]
Length=342

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 8/68 (12%)
 Frame = +3

Query  90   PFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEA-------TL  248
             FR++  +++GQ+S  V +++ ++L D+SQHPPY+PPF VVG  P PV  A        L
Sbjct  24   SFRNLQ-TIDGQMSQQVAFYNPTDLQDQSQHPPYIPPFHVVGFAPGPVPPADGSDGGVDL  82

Query  249  DLQWNYGL  272
             LQWNYGL
Sbjct  83   QLQWNYGL  90



>gb|KHN12793.1| RING finger protein B [Glycine soja]
Length=342

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 8/68 (12%)
 Frame = +3

Query  90   PFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEA-------TL  248
             FR++  +++GQ+S  V +++ ++L D+SQHPPY+PPF VVG  P PV  A        L
Sbjct  24   SFRNLQ-TIDGQMSQQVAFYNPTDLQDQSQHPPYIPPFHVVGFAPGPVPPADGSDGGVDL  82

Query  249  DLQWNYGL  272
             LQWNYGL
Sbjct  83   QLQWNYGL  90



>ref|XP_010461504.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Camelina sativa]
Length=334

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 43/78 (55%), Gaps = 12/78 (15%)
 Frame = +3

Query  72   PH-QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEE---  239
            PH Q S  FRD    ++ QISP + +   +NL D+SQHPPY+PPF V G  P PV +   
Sbjct  9    PHLQDSKNFRDF-CGIDDQISPELGFDSSANLHDQSQHPPYIPPFHVAGFAPGPVVQIDG  67

Query  240  -------ATLDLQWNYGL  272
                      D +WNYGL
Sbjct  68   SDGGGGGNGADFEWNYGL  85



>ref|XP_004499050.1| PREDICTED: RING finger protein B-like [Cicer arietinum]
Length=342

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 6/66 (9%)
 Frame = +3

Query  90   PFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPV-----EEATLDL  254
             FR++  +++GQ+S  + +++ ++L D+SQHPPY+PPF VVG  P PV      +  +DL
Sbjct  26   SFRNLR-TIDGQMSQQMTFYNPADLQDQSQHPPYIPPFHVVGFAPGPVVPADGSDGGVDL  84

Query  255  QWNYGL  272
             WN+GL
Sbjct  85   HWNFGL  90



>ref|XP_003589169.1| Baculoviral IAP repeat-containing protein [Medicago truncatula]
 gb|AES59420.1| SBP (S-ribonuclease-binding protein) family protein [Medicago 
truncatula]
 gb|AFK37595.1| unknown [Medicago truncatula]
Length=340

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPV-----EEATL  248
            +  FR++  ++ GQ+S  + +++ ++L D+SQHPPY+PPF VVG  P PV      +  +
Sbjct  22   TKSFRNLQ-TIEGQMSQQMAFYNPTDLQDQSQHPPYIPPFHVVGFAPGPVIPADGSDGGV  80

Query  249  DLQWNYGL  272
            DL WN+GL
Sbjct  81   DLHWNFGL  88



>ref|NP_001239697.1| uncharacterized protein LOC100783373 [Glycine max]
 gb|ACU18905.1| unknown [Glycine max]
 gb|KHN35690.1| RING finger protein B [Glycine soja]
Length=351

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 8/67 (12%)
 Frame = +3

Query  93   FRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEA-------TLD  251
            FR++  +++GQ+S  V +++ ++L ++SQHPPY+PPF VVG  P PV  A        L 
Sbjct  34   FRNLQ-TIDGQMSQQVAFYNPTDLQEQSQHPPYIPPFHVVGFAPGPVPPADGSDGGVDLQ  92

Query  252  LQWNYGL  272
            LQWNYGL
Sbjct  93   LQWNYGL  99



>ref|XP_009359780.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Pyrus x bretschneideri]
Length=341

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 7/69 (10%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDR-SQHPPYVPPFQVVGLVPVPV-----EEAT  245
            S  FR+++ +++GQ+SP V Y+D  NL D   QHPPYVPPF V G  P PV      +  
Sbjct  22   SKSFRNLY-TIDGQMSPAVAYYDPGNLQDHPQQHPPYVPPFHVEGFAPGPVAATDGSDNG  80

Query  246  LDLQWNYGL  272
             DLQW+YG 
Sbjct  81   ADLQWHYGF  89



>ref|XP_006393634.1| hypothetical protein EUTSA_v10011662mg [Eutrema salsugineum]
 gb|ESQ30920.1| hypothetical protein EUTSA_v10011662mg [Eutrema salsugineum]
Length=319

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 40/73 (55%), Gaps = 8/73 (11%)
 Frame = +3

Query  72   PH-QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEE---  239
            PH   S  FRD    ++GQI   + +   +NL D+SQHPPY+PPF V G  P PV +   
Sbjct  9    PHLHDSKNFRDF-CGIDGQIPLELGFDSSTNLHDQSQHPPYIPPFHVAGFAPGPVMQIDG  67

Query  240  ---ATLDLQWNYG  269
                  D +WNYG
Sbjct  68   SDGGGTDFEWNYG  80



>ref|XP_008393794.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Malus domestica]
Length=344

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 7/69 (10%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDR-SQHPPYVPPFQVVGLVPVPV-----EEAT  245
            S  FR+++ +++GQ SP V Y+D  NL D   QHPPYVPPF V G  P PV      +  
Sbjct  25   SKSFRNLY-TIDGQXSPAVAYYDPGNLQDHPQQHPPYVPPFHVEGFAPGPVAATDGSDNG  83

Query  246  LDLQWNYGL  272
             DLQW+YG 
Sbjct  84   ADLQWHYGF  92



>ref|XP_008378031.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Malus domestica]
Length=341

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 8/70 (11%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPD--RSQHPPYVPPFQVVGLVPVPVEEAT----  245
            S  FR+++ +++GQ+SP V Y+D  NL D  + QHPPYVPPF VVG  P PV        
Sbjct  21   SKSFRNLY-TIDGQMSPAVAYYDPGNLHDHPQQQHPPYVPPFHVVGFAPGPVAATDGSDN  79

Query  246  -LDLQWNYGL  272
              DLQ +YG 
Sbjct  80   GADLQCHYGF  89



>ref|XP_008347618.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Malus domestica]
Length=341

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 8/70 (11%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPD--RSQHPPYVPPFQVVGLVPVPV-----EEA  242
            S  FR+++ +++GQ+SP V Y+D  NL D  + QHPPYVPPF VVG  P PV      + 
Sbjct  21   SKSFRNLY-TIDGQMSPAVAYYDPGNLHDHPQQQHPPYVPPFHVVGFAPGPVAATDGSDN  79

Query  243  TLDLQWNYGL  272
              DLQ +YG 
Sbjct  80   GADLQCHYGF  89



>ref|XP_004141263.1| PREDICTED: uncharacterized protein LOC101215751 isoform 1 [Cucumis 
sativus]
 ref|XP_004169663.1| PREDICTED: uncharacterized LOC101215751 isoform 1 [Cucumis sativus]
Length=340

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 6/67 (9%)
 Frame = +3

Query  87   MPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVP--VPVEEAT---LD  251
            + FR+++   +G +S P+ YF+   L D SQHPPYVPPF VVG  P   P ++A+    D
Sbjct  23   ISFRNLYTP-DGHVSQPISYFNSFTLQDHSQHPPYVPPFNVVGFAPGTAPGQDASDGVAD  81

Query  252  LQWNYGL  272
            L W YG+
Sbjct  82   LHWMYGI  88



>emb|CDY06767.1| BnaA10g05460D [Brassica napus]
Length=304

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 5/53 (9%)
 Frame = +3

Query  72   PH-QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPV  227
            PH Q S  FRD      GQISP + +   +NL D+SQHPPY+PPF V G  PV
Sbjct  9    PHLQDSKNFRDF----CGQISPELGFNSSTNLHDQSQHPPYIPPFHVAGFAPV  57



>ref|XP_010540371.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010540372.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
isoform X2 [Tarenaya hassleriana]
Length=332

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 10/81 (12%)
 Frame = +3

Query  48   HFQQNSPQPHQRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPV  227
            HFQ+  P     S    D+  + + +ISP + +   SNL D+SQHPPY+ PF V G+ P 
Sbjct  8    HFQKQPPDSKNFSW---DLCGT-DDKISPGLGFDSSSNLHDQSQHPPYILPFHVPGIAPG  63

Query  228  PV------EEATLDLQWNYGL  272
            PV      + A  DL+W+YG+
Sbjct  64   PVGRIDGPDGAAADLRWSYGV  84



>emb|CAN66984.1| hypothetical protein VITISV_004458 [Vitis vinifera]
Length=314

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 16/71 (23%)
 Frame = +3

Query  72   PH----QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEE  239
            PH    Q S P+R+++ +  GQIS    ++  +N  D+S HPPY+PP+   G        
Sbjct  4    PHHPFQQESKPYRNLYTN-EGQISQQAAFYSTTNFQDQSHHPPYIPPYDGGG--------  54

Query  240  ATLDLQWNYGL  272
               +L+WNYGL
Sbjct  55   ---ELRWNYGL  62



>gb|EPS67621.1| hypothetical protein M569_07154, partial [Genlisea aurea]
Length=335

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = +3

Query  84   SMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWN  263
            S PF D++++    + P   YF+  NL DR  H PY+PP++V G   V  EE  LDLQWN
Sbjct  22   SKPFSDLYSN---NMEPVTSYFNTPNLLDR--HAPYIPPYEVAG---VTREEDGLDLQWN  73

Query  264  YGL  272
            +G+
Sbjct  74   FGV  76



>ref|XP_010269519.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Nelumbo nucifera]
Length=342

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 41/77 (53%), Gaps = 11/77 (14%)
 Frame = +3

Query  48   HFQQNSPQPHQRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPV  227
             FQQ      Q+S   R++  SM+GQ+S PV +F+ +N  D+SQ P Y+ PF V G  P 
Sbjct  22   QFQQ------QQSKSLRNLL-SMDGQMSSPVAFFNSTNFADQSQ-PQYISPFHVAGFAPA  73

Query  228  PVEEATL---DLQWNYG  269
            P         D++W  G
Sbjct  74   PTPATDCGGGDMRWKNG  90



>ref|XP_008452569.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
isoform X1 [Cucumis melo]
Length=332

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = +3

Query  87   MPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWNY  266
            + FR+++ + +G +S P+ YF+  NL D SQHPPYVPP    G       +   DL W Y
Sbjct  23   ISFRNLYTA-DGHVSQPISYFNSFNLQDHSQHPPYVPPCTAPGQ---DASDGVADLHWMY  78

Query  267  GL  272
            G+
Sbjct  79   GI  80



>ref|XP_010500210.1| PREDICTED: uncharacterized protein LOC104777628 [Camelina sativa]
Length=150

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 13/79 (16%)
 Frame = +3

Query  72   PH-QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEE---  239
            PH Q S  FR+    ++GQISP + +   +NL ++SQHPPY+PPF V    P PV +   
Sbjct  9    PHLQDSKNFREF-CGIDGQISPELGFDSSANLHNQSQHPPYIPPFHVADFAPGPVVQIDG  67

Query  240  --------ATLDLQWNYGL  272
                       D +WNYGL
Sbjct  68   SDGGGGGGNGADFEWNYGL  86



>ref|XP_009123523.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Brassica rapa]
Length=304

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 5/53 (9%)
 Frame = +3

Query  72   PH-QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPV  227
            PH Q S  FRD      GQISP + +   +NL D+SQHPPY+PPF V G  PV
Sbjct  9    PHLQDSKNFRDF----CGQISPELGFNSSTNLHDQSQHPPYIPPFHVAGFAPV  57



>ref|XP_010061737.1| PREDICTED: uncharacterized protein LOC104449317 isoform X3 [Eucalyptus 
grandis]
Length=214

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 39/70 (56%), Gaps = 6/70 (9%)
 Frame = +3

Query  78   QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPV-----EEA  242
            + S PFR+ +    GQ+SP   ++    + DR QHPPY PP  VVG+ P  +      + 
Sbjct  24   KESSPFRNFYAD-GGQVSPLAAFYGPGAVRDRPQHPPYAPPCNVVGVAPGTLPAADGNDG  82

Query  243  TLDLQWNYGL  272
              DLQ+N+GL
Sbjct  83   GADLQFNFGL  92



>ref|XP_008452570.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
isoform X2 [Cucumis melo]
Length=330

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 12/65 (18%)
 Frame = +3

Query  87   MPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEAT---LDLQ  257
            + FR+++ + +G +S P+ YF+  NL D SQHPPYVP        P P ++A+    DL 
Sbjct  23   ISFRNLYTA-DGHVSQPISYFNSFNLQDHSQHPPYVP--------PSPGQDASDGVADLH  73

Query  258  WNYGL  272
            W YG+
Sbjct  74   WMYGI  78



>ref|XP_009107443.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 
[Brassica rapa]
Length=311

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 4/54 (7%)
 Frame = +3

Query  72   PH-QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVP  230
            PH Q S  FRD    ++GQISPP + F+ S   +  +HPPY+PPF V G  P P
Sbjct  9    PHLQDSKSFRDF-CGIDGQISPPALGFESST--NLHEHPPYIPPFHVPGFAPGP  59



>emb|CDY17048.1| BnaA08g04120D [Brassica napus]
Length=311

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 4/54 (7%)
 Frame = +3

Query  72   PH-QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVP  230
            PH Q S  FRD    ++GQISPP + F+ S   +  +HPPY+PPF V G  P P
Sbjct  9    PHLQDSKSFRDF-CGIDGQISPPALGFESST--NLHEHPPYIPPFHVPGFAPGP  59



>ref|XP_010263518.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 
[Nelumbo nucifera]
Length=334

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/88 (31%), Positives = 44/88 (50%), Gaps = 18/88 (20%)
 Frame = +3

Query  36   SMERHFQQNSPQPHQRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVG  215
            +M +H  Q  P+P +  +P       ++GQ+  P+ +F+ ++  D+S HP Y+PPF V G
Sbjct  2    AMPQHQVQQQPKPLRDLLP-------IDGQMPAPIAFFNATSFADQS-HPQYIPPFHVAG  53

Query  216  LVPVPVEEA----------TLDLQWNYG  269
              P P   A            DL+W+ G
Sbjct  54   FAPGPTPAAGCGGGGVGGGGCDLRWSGG  81



>ref|XP_004141264.1| PREDICTED: uncharacterized protein LOC101215751 isoform 2 [Cucumis 
sativus]
 ref|XP_004169664.1| PREDICTED: uncharacterized LOC101215751 isoform 2 [Cucumis sativus]
 gb|KGN55207.1| hypothetical protein Csa_4G639940 [Cucumis sativus]
Length=332

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 4/62 (6%)
 Frame = +3

Query  87   MPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPVEEATLDLQWNY  266
            + FR+++   +G +S P+ YF+   L D SQHPPYVPP    G       +   DL W Y
Sbjct  23   ISFRNLYTP-DGHVSQPISYFNSFTLQDHSQHPPYVPPCTAPGQ---DASDGVADLHWMY  78

Query  267  GL  272
            G+
Sbjct  79   GI  80



>ref|XP_010061735.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like isoform 
X1 [Eucalyptus grandis]
Length=345

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 6/70 (9%)
 Frame = +3

Query  78   QRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGLVPVPV-----EEA  242
            + S PFR+ + +  GQ+SP   ++    + DR QHPPY PP  VVG+ P  +      + 
Sbjct  24   KESSPFRNFY-ADGGQVSPLAAFYGPGAVRDRPQHPPYAPPCNVVGVAPGTLPAADGNDG  82

Query  243  TLDLQWNYGL  272
              DLQ+N+GL
Sbjct  83   GADLQFNFGL  92



>gb|KFK36160.1| hypothetical protein AALP_AA4G085800 [Arabis alpina]
Length=323

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 41/84 (49%), Gaps = 19/84 (23%)
 Frame = +3

Query  39   MERHFQQNSPQPHQRSMPFRDMHNSMNGQISPPVVYFDGSNLPDRSQHPPYVPPFQVVGL  218
            ++ H Q +S         FRD +  ++GQISP + +   +N      HPPY+PPF V G 
Sbjct  7    LDLHLQHDSKT-------FRDNY-GIDGQISPELGFDISAN-----NHPPYIPPFHVAGF  53

Query  219  VPV------PVEEATLDLQWNYGL  272
             PV        +    + +WNYG+
Sbjct  54   APVVQIDGNDNDNGGGEFEWNYGV  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518068334520