BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c93089_g1_i1 len=733 path=[1:0-732]

Length=733
                                                                      Score     E

ref|XP_009772739.1|  PREDICTED: uncharacterized protein DDB_G0273...    309   2e-96   
ref|XP_009629697.1|  PREDICTED: uncharacterized protein DDB_G0273...    307   1e-95   
ref|XP_009619194.1|  PREDICTED: uncharacterized protein LOC104111...    307   1e-95   
ref|XP_009619130.1|  PREDICTED: uncharacterized protein LOC104111...    307   2e-95   
emb|CDP07070.1|  unnamed protein product                                296   1e-91   
ref|XP_006340214.1|  PREDICTED: uncharacterized protein DDB_G0273...    293   2e-90   
ref|XP_007016825.1|  P-loop containing nucleoside triphosphate hy...    286   5e-90   
ref|XP_009376067.1|  PREDICTED: uncharacterized protein DDB_G0273...    292   1e-89   
ref|XP_004251159.1|  PREDICTED: uncharacterized protein LOC101266299    289   8e-89   
ref|XP_009367032.1|  PREDICTED: uncharacterized protein DDB_G0273...    288   1e-88   
ref|XP_009367031.1|  PREDICTED: uncharacterized protein DDB_G0273...    288   1e-88   
ref|XP_009367030.1|  PREDICTED: uncharacterized protein DDB_G0273...    289   2e-88   
gb|EYU18801.1|  hypothetical protein MIMGU_mgv1a002235mg                287   2e-88   
gb|KHG09222.1|  hypothetical protein F383_15788                         285   4e-88   
gb|KHG14615.1|  hypothetical protein F383_19567                         283   6e-88   
ref|XP_006424515.1|  hypothetical protein CICLE_v10027892mg             286   1e-87   
gb|EYU36164.1|  hypothetical protein MIMGU_mgv1a001992mg                286   1e-87   
ref|XP_007016824.1|  P-loop containing nucleoside triphosphate hy...    285   2e-87   
emb|CBI17176.3|  unnamed protein product                                285   2e-87   
ref|XP_006488044.1|  PREDICTED: uncharacterized protein DDB_G0273...    285   3e-87   
gb|KDO60189.1|  hypothetical protein CISIN_1g004662mg                   285   4e-87   
ref|XP_002313526.2|  2-phosphoglycerate kinase-related family pro...    284   9e-87   Populus trichocarpa [western balsam poplar]
ref|XP_008226166.1|  PREDICTED: uncharacterized protein DDB_G0273...    282   1e-86   
ref|XP_002277270.1|  PREDICTED: uncharacterized protein DDB_G0273...    283   1e-86   Vitis vinifera
ref|XP_011000530.1|  PREDICTED: uncharacterized protein DDB_G0273...    283   3e-86   
ref|XP_008226161.1|  PREDICTED: uncharacterized protein DDB_G0273...    282   3e-86   
ref|XP_011016180.1|  PREDICTED: uncharacterized protein DDB_G0273...    283   3e-86   
ref|XP_011016178.1|  PREDICTED: uncharacterized protein DDB_G0273...    282   3e-86   
ref|XP_007204974.1|  hypothetical protein PRUPE_ppa002445mg             280   7e-86   
ref|XP_009356894.1|  PREDICTED: uncharacterized protein DDB_G0273...    279   5e-85   
ref|XP_006384932.1|  2-phosphoglycerate kinase-related family pro...    278   1e-84   
ref|XP_011040919.1|  PREDICTED: uncharacterized protein DDB_G0273...    278   1e-84   
ref|XP_011040918.1|  PREDICTED: uncharacterized protein DDB_G0273...    278   2e-84   
ref|XP_011040916.1|  PREDICTED: uncharacterized protein DDB_G0273...    278   2e-84   
ref|XP_011040917.1|  PREDICTED: uncharacterized protein DDB_G0273...    278   2e-84   
ref|XP_010520382.1|  PREDICTED: uncharacterized protein DDB_G0273...    277   3e-84   
ref|XP_004291572.1|  PREDICTED: uncharacterized protein DDB_G0273...    275   1e-83   
ref|XP_003538154.1|  PREDICTED: uncharacterized protein DDB_G0273...    274   4e-83   
gb|KHN38732.1|  Hypothetical protein glysoja_008281                     273   5e-83   
ref|XP_006591125.1|  PREDICTED: uncharacterized protein DDB_G0273...    274   5e-83   
ref|XP_010253954.1|  PREDICTED: uncharacterized protein DDB_G0273...    273   7e-83   
gb|KHM98923.1|  Hypothetical protein glysoja_043335                     270   7e-82   
ref|XP_003539779.1|  PREDICTED: uncharacterized protein DDB_G0273...    270   7e-82   
emb|CDX99167.1|  BnaA06g18580D                                          269   2e-81   
ref|XP_002534208.1|  conserved hypothetical protein                     269   3e-81   Ricinus communis
ref|XP_009150092.1|  PREDICTED: uncharacterized protein DDB_G0273...    268   4e-81   
ref|XP_004506048.1|  PREDICTED: uncharacterized protein LOC101503547    269   4e-81   
ref|XP_010514847.1|  PREDICTED: uncharacterized protein DDB_G0273...    268   6e-81   
ref|XP_010503159.1|  PREDICTED: uncharacterized protein DDB_G0273...    268   6e-81   
gb|KHG19068.1|  hypothetical protein F383_04916                         265   7e-81   
gb|KHG22570.1|  hypothetical protein F383_07390                         265   7e-81   
ref|XP_010456724.1|  PREDICTED: uncharacterized protein DDB_G0273...    267   1e-80   
ref|XP_010496750.1|  PREDICTED: uncharacterized protein DDB_G0273...    266   3e-80   
gb|KEH39377.1|  2-phosphoglycerate kinase                               266   3e-80   
ref|XP_006827415.1|  hypothetical protein AMTR_s00009p00066600          267   3e-80   
ref|XP_008465362.1|  PREDICTED: uncharacterized protein DDB_G0273...    266   4e-80   
ref|XP_004151185.1|  PREDICTED: uncharacterized protein DDB_G0273...    265   4e-80   
emb|CAB72147.1|  putative protein                                       266   5e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566873.1|  P-loop containing nucleoside triphosphate hydro...    265   6e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120610.1|  PREDICTED: uncharacterized protein DDB_G0273...    265   8e-80   
emb|CDY26985.1|  BnaC09g35980D                                          265   9e-80   
ref|XP_011089938.1|  PREDICTED: uncharacterized protein DDB_G0273...    265   1e-79   
ref|XP_011089937.1|  PREDICTED: uncharacterized protein DDB_G0273...    265   1e-79   
emb|CDY53124.1|  BnaC03g74690D                                          265   1e-79   
ref|XP_002864701.1|  hypothetical protein ARALYDRAFT_496224             265   2e-79   
ref|XP_002877383.1|  hypothetical protein ARALYDRAFT_323187             264   2e-79   
gb|KDP44001.1|  hypothetical protein JCGZ_05468                         264   2e-79   
ref|XP_006400815.1|  hypothetical protein EUTSA_v10012777mg             264   3e-79   
gb|KFK27601.1|  hypothetical protein AALP_AA8G404800                    263   4e-79   
gb|KEH30009.1|  P-loop nucleoside triphosphate hydrolase superfam...    263   5e-79   
ref|NP_200884.2|  phytic acid metabolising protein                      263   5e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443881.1|  PREDICTED: uncharacterized protein DDB_G0273...    263   7e-79   
ref|XP_010241850.1|  PREDICTED: uncharacterized protein LOC104586...    262   7e-79   
ref|XP_006290667.1|  hypothetical protein CARUB_v10016758mg             262   7e-79   
gb|KGN64816.1|  hypothetical protein Csa_1G111370                       263   8e-79   
gb|KGN46861.1|  hypothetical protein Csa_6G147540                       263   9e-79   
ref|XP_007132294.1|  hypothetical protein PHAVU_011G082700g             263   9e-79   
ref|XP_010241849.1|  PREDICTED: uncharacterized protein DDB_G0273...    261   2e-78   
ref|XP_004487082.1|  PREDICTED: uncharacterized protein DDB_G0273...    260   8e-78   
ref|XP_004487078.1|  PREDICTED: uncharacterized protein DDB_G0273...    260   9e-78   
ref|XP_004145814.1|  PREDICTED: uncharacterized protein LOC101212242    262   9e-78   
ref|XP_008359867.1|  PREDICTED: uncharacterized protein LOC103423554    258   1e-77   
ref|XP_004160091.1|  PREDICTED: uncharacterized LOC101212242            261   2e-77   
ref|XP_010689106.1|  PREDICTED: uncharacterized protein DDB_G0273...    259   2e-77   
gb|EPS65360.1|  hypothetical protein M569_09418                         257   3e-77   
ref|XP_010689105.1|  PREDICTED: uncharacterized protein DDB_G0273...    259   7e-77   
gb|EPS70965.1|  hypothetical protein M569_03793                         254   9e-77   
ref|XP_006280066.1|  hypothetical protein CARUB_v10025948mg             256   4e-76   
ref|XP_006419071.1|  hypothetical protein EUTSA_v10002416mg             254   1e-75   
ref|XP_009385691.1|  PREDICTED: uncharacterized protein LOC103972985    254   1e-75   
ref|XP_010483729.1|  PREDICTED: uncharacterized protein DDB_G0273...    253   2e-75   
ref|XP_008800532.1|  PREDICTED: uncharacterized protein LOC103714872    254   4e-75   
ref|XP_009408203.1|  PREDICTED: uncharacterized protein DDB_G0273...    253   5e-75   
ref|XP_010933088.1|  PREDICTED: uncharacterized protein DDB_G0273...    251   6e-75   
ref|XP_010933085.1|  PREDICTED: uncharacterized protein DDB_G0273...    251   6e-75   
ref|XP_010109471.1|  hypothetical protein L484_007491                   253   8e-75   
ref|XP_008789555.1|  PREDICTED: uncharacterized protein DDB_G0273...    251   1e-74   
ref|XP_006488045.1|  PREDICTED: uncharacterized protein DDB_G0273...    251   1e-74   
ref|XP_003637522.1|  Mutant low phytic acid protein                     251   2e-74   
ref|XP_010043793.1|  PREDICTED: uncharacterized protein DDB_G0273...    250   3e-74   
dbj|BAJ93796.1|  predicted protein                                      247   2e-73   
ref|XP_009126583.1|  PREDICTED: uncharacterized protein DDB_G0273...    248   2e-73   
emb|CDY71070.1|  BnaAnng35980D                                          243   8e-73   
ref|XP_009417422.1|  PREDICTED: uncharacterized protein LOC103997819    247   1e-72   
gb|KEH16029.1|  2-phosphoglycerate kinase                               233   2e-72   
ref|XP_010653595.1|  PREDICTED: uncharacterized protein DDB_G0273...    242   5e-72   
ref|XP_010940625.1|  PREDICTED: uncharacterized protein DDB_G0273...    242   5e-72   
emb|CBI32757.3|  unnamed protein product                                243   6e-72   
ref|XP_003596768.1|  hypothetical protein MTR_2g085430                  233   7e-72   
ref|XP_003570409.1|  PREDICTED: uncharacterized protein DDB_G0273...    243   1e-71   
ref|XP_002276632.1|  PREDICTED: uncharacterized protein DDB_G0273...    242   2e-71   Vitis vinifera
ref|XP_010653591.1|  PREDICTED: uncharacterized protein DDB_G0273...    242   2e-71   
ref|XP_010940623.1|  PREDICTED: uncharacterized protein DDB_G0273...    242   4e-71   
ref|XP_010940624.1|  PREDICTED: uncharacterized protein DDB_G0273...    242   5e-71   
gb|EMT25573.1|  hypothetical protein F775_31896                         240   1e-70   
emb|CDY09185.1|  BnaA02g06110D                                          240   1e-70   
dbj|BAJ93340.1|  predicted protein                                      240   1e-70   
gb|AFW74057.1|  hypothetical protein ZEAMMB73_995838                    239   3e-70   
gb|EMT12718.1|  hypothetical protein F775_19985                         239   5e-70   
ref|XP_009408128.1|  PREDICTED: uncharacterized protein DDB_G0273...    238   1e-69   
ref|XP_008681136.1|  PREDICTED: uncharacterized protein LOC100193...    238   1e-69   
emb|CDM84881.1|  unnamed protein product                                237   1e-69   
ref|XP_008681135.1|  PREDICTED: uncharacterized protein LOC100193...    238   2e-69   
gb|AFW74058.1|  hypothetical protein ZEAMMB73_995838                    238   2e-69   
ref|NP_001145638.1|  hypothetical protein                               236   6e-69   Zea mays [maize]
ref|XP_004954396.1|  PREDICTED: uncharacterized protein DDB_G0273...    235   1e-68   
gb|ACB38657.1|  mutant low phytic acid protein 1                        234   3e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004169815.1|  PREDICTED: uncharacterized protein LOC101229867    233   3e-68   
gb|EEC74258.1|  hypothetical protein OsI_09470                          234   5e-68   Oryza sativa Indica Group [Indian rice]
gb|EEE58056.1|  hypothetical protein OsJ_08893                          233   6e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003560284.1|  PREDICTED: uncharacterized protein DDB_G0273...    232   1e-67   
ref|XP_010696609.1|  PREDICTED: uncharacterized protein DDB_G0273...    232   2e-67   
gb|EMS49876.1|  hypothetical protein TRIUR3_07100                       232   2e-67   
ref|NP_974387.1|  P-loop containing nucleoside triphosphate hydro...    230   6e-67   Arabidopsis thaliana [mouse-ear cress]
gb|EMS62712.1|  hypothetical protein TRIUR3_21504                       229   2e-66   
ref|XP_002975910.1|  hypothetical protein SELMODRAFT_104408             228   4e-66   
gb|EMT04376.1|  hypothetical protein F775_16884                         229   5e-66   
ref|XP_003578703.1|  PREDICTED: uncharacterized protein DDB_G0273...    226   3e-65   
ref|XP_010238553.1|  PREDICTED: uncharacterized protein DDB_G0273...    226   3e-65   
ref|XP_006648126.1|  PREDICTED: uncharacterized protein DDB_G0273...    224   5e-65   
emb|CAN72472.1|  hypothetical protein VITISV_006041                     224   3e-64   Vitis vinifera
ref|XP_010279555.1|  PREDICTED: uncharacterized protein LOC104613435    223   7e-64   
ref|NP_001063996.1|  Os09g0572200                                       218   4e-62   Oryza sativa Japonica Group [Japonica rice]
gb|EEC85102.1|  hypothetical protein OsI_32482                          218   4e-62   Oryza sativa Indica Group [Indian rice]
ref|NP_001130408.1|  hypothetical protein                               217   8e-62   Zea mays [maize]
ref|XP_002459870.1|  hypothetical protein SORBIDRAFT_02g012650          216   1e-61   Sorghum bicolor [broomcorn]
ref|XP_010653592.1|  PREDICTED: uncharacterized protein LOC100260...    212   2e-60   
gb|EMS65521.1|  hypothetical protein TRIUR3_04088                       209   1e-59   
gb|EMT16535.1|  hypothetical protein F775_08208                         210   2e-59   
ref|XP_001754753.1|  predicted protein                                  209   2e-59   
ref|XP_001766862.1|  predicted protein                                  205   1e-58   
ref|XP_001753199.1|  predicted protein                                  204   6e-58   
gb|EMS58315.1|  hypothetical protein TRIUR3_08412                       204   3e-57   
ref|XP_002968571.1|  hypothetical protein SELMODRAFT_89331              198   2e-55   
ref|XP_006661579.1|  PREDICTED: uncharacterized protein DDB_G0273...    195   5e-54   
tpg|DAA60668.1|  TPA: hypothetical protein ZEAMMB73_042132              174   3e-49   
ref|XP_008789557.1|  PREDICTED: uncharacterized protein DDB_G0273...    160   5e-42   
ref|XP_008464657.1|  PREDICTED: uncharacterized protein LOC103502490    158   4e-41   
ref|XP_003638065.1|  Mutant low phytic acid protein                     139   1e-37   
ref|XP_003638077.1|  2-phosphoglycerate kinase                          145   2e-36   
ref|XP_008363522.1|  PREDICTED: uncharacterized protein LOC103427234    140   5e-36   
ref|XP_005644750.1|  hypothetical protein COCSUDRAFT_67534              129   8e-31   
ref|XP_002649184.1|  hypothetical protein DDB_G0273453                  125   5e-29   Dictyostelium discoideum AX4
ref|XP_008466869.1|  PREDICTED: uncharacterized protein LOC103504181    119   6e-29   
ref|XP_003293690.1|  hypothetical protein DICPUDRAFT_158593             123   1e-28   
ref|XP_003638078.1|  hypothetical protein MTR_117s0049                  117   1e-28   
ref|XP_004360330.1|  hypothetical protein DFA_04607                     120   1e-27   
dbj|GAM23845.1|  hypothetical protein SAMD00019534_070200               120   2e-27   
ref|XP_002952613.1|  hypothetical protein VOLCADRAFT_105596             122   2e-27   
gb|EFA85558.1|  hypothetical protein PPL_01517                          118   2e-27   Polysphondylium pallidum PN500
gb|EJY87786.1|  hypothetical protein OXYTRI_23647                       115   2e-25   
ref|XP_009533694.1|  hypothetical protein PHYSODRAFT_287138             109   2e-23   
ref|XP_001429197.1|  hypothetical protein                               107   2e-23   Paramecium tetraurelia strain d4-2
ref|XP_005845927.1|  hypothetical protein CHLNCDRAFT_136554             108   4e-23   
ref|XP_005824437.1|  hypothetical protein GUITHDRAFT_58146              101   4e-22   
ref|XP_008344879.1|  PREDICTED: uncharacterized protein LOC103407782    104   5e-22   
ref|XP_004337685.1|  hypothetical protein ACA1_377870                   102   3e-21   
ref|XP_001433077.1|  hypothetical protein                               102   7e-21   Paramecium tetraurelia strain d4-2
gb|ETK71656.1|  hypothetical protein L915_21130                         100   2e-20   
ref|XP_008898612.1|  hypothetical protein PPTG_06444                    100   2e-20   
ref|XP_001452064.1|  hypothetical protein                               100   3e-20   Paramecium tetraurelia strain d4-2
emb|CDS04634.1|  hypothetical protein LRAMOSA07220                    95.9    1e-19   
ref|XP_002902823.1|  conserved hypothetical protein                   97.8    2e-19   
emb|CDW78661.1|  UNKNOWN                                              96.7    8e-19   
gb|KDD75878.1|  hypothetical protein H632_c458p0                      94.0    3e-18   
gb|KDO27640.1|  hypothetical protein SPRG_06911                       93.2    5e-18   
ref|XP_008617667.1|  hypothetical protein SDRG_13362                  91.7    2e-17   
gb|KDO16266.1|  hypothetical protein SPRG_18200                       91.3    3e-17   
emb|CCA28030.1|  conserved hypothetical protein                       91.3    3e-17   
emb|CCI45713.1|  unnamed protein product                              90.1    7e-17   
ref|XP_008880874.1|  hypothetical protein H310_14729                  89.4    7e-17   
gb|EAR99658.2|  AAA domain protein                                    89.7    1e-16   
ref|XP_001019903.1|  hypothetical protein TTHERM_00589950             89.7    2e-16   Tetrahymena thermophila
ref|NP_001048534.1|  Os02g0819400                                     86.7    6e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001304249.1|  hypothetical protein                             83.6    9e-16   Trichomonas vaginalis G3
ref|XP_004027216.1|  hypothetical protein IMG5_187150                 85.1    1e-15   
ref|XP_009840892.1|  hypothetical protein, variant                    85.9    2e-15   
ref|XP_009840891.1|  hypothetical protein H257_14695                  85.5    2e-15   
ref|WP_019009042.1|  2-phosphoglycerate kinase                        70.1    2e-10   
ref|WP_011019236.1|  2-phosphoglycerate kinase                        68.9    2e-10   
ref|WP_012692638.1|  2-phosphoglycerate kinase                        68.2    7e-10   
ref|WP_017869259.1|  MULTISPECIES: 2-phosphoglycerate kinase          67.4    1e-09   
ref|WP_014684312.1|  2-phosphoglycerate kinase                        65.9    4e-09   
ref|WP_019586341.1|  2-phosphoglycerate kinase                        65.1    7e-09   
gb|ESL10801.1|  hypothetical protein TRSC58_01459                     65.5    7e-09   
ref|WP_029479082.1|  2-phosphoglycerate kinase                        64.7    1e-08   
ref|WP_039683178.1|  2-phosphoglycerate kinase                        64.7    1e-08   
ref|WP_034356182.1|  2-phosphoglycerate kinase                        64.3    1e-08   
ref|WP_034385411.1|  2-phosphoglycerate kinase                        64.3    1e-08   
gb|EPZ31831.1|  hypothetical protein O9G_000310                       63.9    1e-08   
ref|WP_034413103.1|  2-phosphoglycerate kinase                        63.9    2e-08   
ref|WP_034350737.1|  2-phosphoglycerate kinase                        63.5    2e-08   
ref|WP_010888153.1|  2-phosphoglycerate kinase                        63.5    2e-08   
ref|WP_034341469.1|  hypothetical protein                             63.2    3e-08   
ref|WP_013180873.1|  2-phosphoglycerate kinase                        62.4    4e-08   
ref|XP_829328.1|  hypothetical protein                                63.2    4e-08   Trypanosoma brucei brucei TREU927
gb|KFM28644.1|  Uncharacterized protein F751_0801                     62.4    5e-08   
ref|XP_005707760.1|  2-phosphoglycerate kinase                        62.4    6e-08   
ref|WP_027460050.1|  2-phosphoglycerate kinase                        62.4    6e-08   
ref|WP_034407008.1|  2-phosphoglycerate kinase                        62.4    7e-08   
ref|WP_004593510.1|  2-phosphoglycerate kinase                        61.6    7e-08   
ref|WP_015791993.1|  2-phosphoglycerate kinase                        61.6    9e-08   
ref|WP_014121222.1|  2-phosphoglycerate kinase                        61.2    1e-07   
ref|WP_015733331.1|  2-phosphoglycerate kinase                        61.2    1e-07   
ref|WP_013100499.1|  2-phosphoglycerate kinase                        61.2    1e-07   
emb|CBH18293.1|  hypothetical protein, conserved                      61.6    1e-07   Trypanosoma brucei gambiense DAL972
ref|WP_011171375.1|  2-phosphoglycerate kinase                        60.8    1e-07   
dbj|BAP61772.1|  2-phosphoglycerate kinase                            60.8    1e-07   
ref|WP_011972550.1|  2-phosphoglycerate kinase                        60.8    2e-07   
ref|WP_011867924.1|  2-phosphoglycerate kinase                        60.8    2e-07   
gb|AIJ06342.1|  2-phosphoglycerate kinase                             60.5    2e-07   
ref|WP_013557932.1|  2-phosphoglycerate kinase                        60.8    2e-07   
ref|WP_011977065.1|  2-phosphoglycerate kinase                        60.5    2e-07   
ref|WP_012193993.1|  2-phosphoglycerate kinase                        60.5    2e-07   
ref|WP_012980571.1|  2-phosphoglycerate kinase                        60.5    2e-07   
ref|WP_027482695.1|  2-phosphoglycerate kinase                        60.8    2e-07   
ref|WP_013614490.1|  2-phosphoglycerate kinase                        60.5    2e-07   
ref|WP_010871004.1|  2-phosphoglycerate kinase                        60.1    3e-07   
ref|WP_013866430.1|  2-phosphoglycerate kinase                        60.1    3e-07   
ref|XP_009310045.1|  hypothetical protein DQ04_02341040               60.5    3e-07   
ref|WP_011249989.1|  2-phosphoglycerate kinase                        59.7    3e-07   
ref|WP_018154587.1|  2-phosphoglycerate kinase                        59.7    4e-07   
ref|WP_015858344.1|  2-phosphoglycerate kinase                        59.3    4e-07   
gb|ESS67550.1|  hypothetical protein TCDM_03829                       60.1    4e-07   
gb|EKG02454.1|  hypothetical protein TCSYLVIO_006517                  60.1    5e-07   
emb|CDO65879.1|  conserved Plasmodium protein, unknown function       59.3    5e-07   
ref|WP_019264682.1|  2-phosphoglycerate kinase                        58.9    6e-07   
ref|WP_019266572.1|  2-phosphoglycerate kinase                        58.5    8e-07   
ref|WP_013704281.1|  2-phosphoglycerate kinase                        58.9    8e-07   
ref|WP_012955624.1|  2-phosphoglycerate kinase                        58.5    9e-07   
ref|WP_019262776.1|  MULTISPECIES: 2-phosphoglycerate kinase          58.5    9e-07   
ref|XP_809506.1|  hypothetical protein                                58.9    1e-06   Trypanosoma cruzi strain CL Brener
ref|WP_010884260.1|  2-phosphoglycerate kinase                        58.2    1e-06   
ref|WP_004033138.1|  2-phosphoglycerate kinase                        58.5    1e-06   
ref|XP_001349812.1|  proteinase inhibitor, putative                   58.5    1e-06   Plasmodium falciparum 3D7
ref|WP_013798947.1|  2-phosphoglycerate kinase                        58.2    1e-06   
gb|ETW29659.1|  hypothetical protein PFFCH_02929                      58.2    1e-06   
ref|WP_007044592.1|  2-phosphoglycerate kinase                        58.2    1e-06   
ref|XP_817218.1|  hypothetical protein                                58.5    1e-06   Trypanosoma cruzi strain CL Brener
ref|WP_011530891.1|  2-phosphoglycerate kinase                        58.5    1e-06   
ref|XP_009498031.1|  hypothetical protein H696_05988                  58.5    1e-06   
ref|WP_013748155.1|  2-phosphoglycerate kinase                        57.8    2e-06   
ref|WP_012766188.1|  2-phosphoglycerate kinase                        57.8    2e-06   
ref|WP_004068208.1|  2-phosphoglycerate kinase                        57.4    2e-06   
ref|WP_013466726.1|  2-phosphoglycerate kinase                        57.4    2e-06   
ref|WP_006090316.1|  2-phosphoglycerate kinase                        57.4    2e-06   
ref|WP_014733290.1|  2-phosphoglycerate kinase                        57.0    3e-06   
ref|XP_001562687.1|  conserved hypothetical protein                   57.8    3e-06   Leishmania braziliensis MHOM/BR/75/M2904
gb|AHL22604.1|  2-phosphoglycerate kinase                             57.0    3e-06   
ref|WP_012571702.1|  2-phosphoglycerate kinase                        57.0    3e-06   
ref|XP_628231.1|  phosphoglycerate kinase family protein              57.4    3e-06   Cryptosporidium parvum Iowa II
ref|XP_668369.1|  hypothetical protein                                57.0    3e-06   Cryptosporidium hominis TU502
ref|XP_010704304.1|  hypothetical protein LPMP_090660                 57.4    3e-06   
ref|WP_015234828.1|  2-phosphoglycerate kinase                        57.4    3e-06   
ref|WP_014011831.1|  2-phosphoglycerate kinase                        56.6    4e-06   
ref|WP_010478050.1|  2-phosphoglycerate kinase                        56.6    4e-06   
ref|WP_014789766.1|  2-phosphoglycerate kinase                        56.6    4e-06   
ref|WP_011011190.1|  2-phosphoglycerate kinase                        56.6    4e-06   
ref|WP_010151491.1|  2-phosphoglycerate kinase                        56.6    4e-06   
ref|WP_011972973.1|  2-phosphoglycerate kinase                        56.6    5e-06   
ref|WP_013413328.1|  2-phosphoglycerate kinase                        56.2    5e-06   
gb|ADI19253.1|  2-phosphoglycerate kinase                             56.6    5e-06   
ref|WP_013177356.1|  2-phosphoglycerate kinase                        55.8    5e-06   
ref|WP_011406043.1|  2-phosphoglycerate kinase                        55.8    7e-06   
ref|WP_013295281.1|  2-phosphoglycerate kinase                        55.8    7e-06   
dbj|BAM70969.1|  2-phosphoglycerate kinase                            55.8    7e-06   
ref|WP_013826061.1|  2-phosphoglycerate kinase                        55.8    8e-06   
gb|EKF30931.1|  hypothetical protein MOQ_005239                       56.2    8e-06   
ref|XP_003872747.1|  conserved hypothetical protein                   55.8    1e-05   
gb|AHY45933.1|  2-phosphoglycerate kinase                             55.5    1e-05   
gb|AIU70768.1|  2-phosphoglycerate kinase                             55.5    1e-05   
gb|AIF68748.1|  hypothetical protein PAP_01540                        55.5    1e-05   
ref|WP_013178507.1|  2-phosphoglycerate kinase                        55.8    1e-05   
ref|WP_038683827.1|  hypothetical protein                             55.1    1e-05   
ref|WP_011563763.1|  2-phosphoglycerate kinase                        55.5    1e-05   
emb|CCC53877.1|  conserved hypothetical protein                       55.5    1e-05   
ref|WP_010867272.1|  2-phosphoglycerate kinase                        54.7    2e-05   
gb|ADI19076.1|  2-phosphoglycerate kinase                             55.1    2e-05   
ref|WP_038067132.1|  2-phosphoglycerate kinase                        55.1    2e-05   
ref|XP_002142076.1|  hypothetical protein                             54.7    2e-05   
ref|XP_010507192.1|  PREDICTED: uncharacterized protein DDB_G0273...  54.3    2e-05   
ref|WP_010877485.1|  2-phosphoglycerate kinase                        54.3    3e-05   
emb|CCD16001.1|  unnamed protein product                              54.7    3e-05   
gb|ACB38660.1|  mutant low phytic acid protein 1                      54.3    3e-05   
ref|WP_013906165.1|  2-phosphoglycerate kinase                        53.9    3e-05   
ref|WP_016358882.1|  2-phosphoglycerate kinase Pgk2                   53.9    4e-05   
ref|WP_019307500.1|  hypothetical protein                             53.9    4e-05   
gb|ACB38659.1|  mutant low phytic acid protein 1                      53.9    5e-05   
ref|WP_011018405.1|  hypothetical protein                             53.5    5e-05   
ref|XP_002261978.1|  nucleoside triphosphate hydrolase                53.5    5e-05   
ref|WP_022847189.1|  AT hook motif                                    53.5    5e-05   
ref|WP_013157815.1|  2-phosphoglycerate kinase                        53.5    6e-05   
gb|AAR37468.1|  2-phosphoglycerate kinase                             53.1    7e-05   
ref|XP_001463527.1|  conserved hypothetical protein                   53.5    7e-05   
ref|XP_003858750.1|  hypothetical protein, conserved                  53.1    8e-05   
ref|XP_008814299.1|  hypothetical protein C922_00461                  53.1    8e-05   
ref|XP_001681239.1|  conserved hypothetical protein                   53.1    8e-05   
ref|WP_014630040.1|  2-phosphoglycerate kinase                        53.1    9e-05   
ref|WP_008631773.1|  MULTISPECIES: 2-phosphoglycerate kinase          52.8    9e-05   
ref|WP_011172576.1|  2-phosphoglycerate kinase                        52.8    9e-05   
gb|EPY21685.1|  hypothetical protein AGDE_13858                       52.4    1e-04   
ref|XP_670449.1|  hypothetical protein                                50.8    1e-04   
ref|XP_004224699.1|  nucleoside triphosphate hydrolase                52.4    2e-04   
ref|WP_037897521.1|  hypothetical protein                             51.6    2e-04   
ref|WP_024118965.1|  2-phosphoglycerate kinase                        52.0    2e-04   
ref|WP_011227976.1|  2-phosphoglycerate kinase                        52.0    2e-04   
ref|WP_013637707.1|  AT hook motif                                    51.6    2e-04   
ref|XP_001617014.1|  hypothetical protein                             52.0    2e-04   
ref|WP_027882880.1|  2-phosphoglycerate kinase                        51.6    3e-04   
ref|WP_027888854.1|  2-phosphoglycerate kinase                        51.6    3e-04   
ref|XP_008623159.1|  hypothetical protein YYE_01259                   51.6    3e-04   
ref|WP_013457950.1|  2-phosphoglycerate kinase                        51.2    3e-04   
ref|WP_018465198.1|  hypothetical protein                             51.2    3e-04   
ref|WP_027892326.1|  2-phosphoglycerate kinase                        51.2    3e-04   
ref|WP_027353041.1|  hypothetical protein                             49.7    4e-04   
ref|WP_028494253.1|  2-phosphoglycerate kinase                        51.2    4e-04   
ref|WP_027876799.1|  2-phosphoglycerate kinase                        51.2    4e-04   
ref|WP_038041670.1|  2-phosphoglycerate kinase                        50.8    4e-04   
ref|WP_013012787.1|  2-phosphoglycerate kinase                        50.8    4e-04   
emb|CDH57112.1|  2-phosphoglycerate expressed                         50.4    4e-04   
gb|EUD74148.1|  hypothetical protein YYG_00095                        50.8    5e-04   
ref|WP_003045173.1|  2-phosphoglycerate kinase                        50.8    5e-04   
ref|WP_039458812.1|  2-phosphoglycerate kinase                        50.8    5e-04   
ref|WP_015586344.1|  2-phosphoglycerate kinase                        50.4    5e-04   
emb|CDS51442.1|  conserved Plasmodium protein, unknown function       50.4    5e-04   
ref|WP_022798474.1|  2-phosphoglycerate kinase                        50.4    6e-04   
ref|WP_014516144.1|  2-phosphoglycerate kinase                        50.4    7e-04   
ref|XP_725281.1|  hypothetical protein                                50.1    8e-04   
ref|WP_038057808.1|  2-phosphoglycerate kinase                        50.1    0.001   



>ref|XP_009772739.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Nicotiana sylvestris]
Length=729

 Score =   309 bits (792),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/245 (68%), Positives = 196/245 (80%), Gaps = 2/245 (1%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFA-  178
            QSTLQLMGCK RHAFKISR VF+K+R+ C G+  VS       QDNL     ++ + F  
Sbjct  30   QSTLQLMGCKPRHAFKISRTVFDKMRSECMGDKLVSADRVQAGQDNLKGLHHKESSAFID  89

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
            A LDK D+RS+S PFELYK+RTTVVV+R TFLDV+CDAL EY Y+G NQRADL +ACR+R
Sbjct  90   AFLDKGDNRSESKPFELYKRRTTVVVKRKTFLDVVCDALTEYKYMGPNQRADLILACRIR  149

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK+NPLLWAST
Sbjct  150  ERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQNPLLWAST  209

Query  539  YHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLISP  718
            YHAGE+LD +AV+EAK K++AKKLAG STP  QK+   N  T GK P  G +S   LIS 
Sbjct  210  YHAGEYLDQVAVSEAKVKKRAKKLAGISTPPIQKE-GVNGPTNGKSPPVGISSAVDLISA  268

Query  719  KQMAI  733
            ++MA+
Sbjct  269  REMAV  273



>ref|XP_009629697.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Nicotiana tomentosiformis]
Length=728

 Score =   307 bits (786),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 194/245 (79%), Gaps = 3/245 (1%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFA-  178
            QSTLQLMGCK RHAFKISR VF+K+R+ C G+  VS       QDNL     ++ + F  
Sbjct  30   QSTLQLMGCKPRHAFKISRTVFDKMRSECMGDKLVSADRVQAGQDNLKGLHHKESSAFND  89

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
            A LDK D+RS+S PFELYK+RTTVVV+R  FLDV+CDAL EY Y+G NQRADL +ACR+R
Sbjct  90   AFLDKGDNRSESRPFELYKRRTTVVVKREIFLDVVCDALTEYKYMGPNQRADLILACRIR  149

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK+NPLLWAST
Sbjct  150  ERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQNPLLWAST  209

Query  539  YHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLISP  718
            YHAGE+LD +AV+EAK K++AKKLAG STP  QK    N  T GK P  G +S   LIS 
Sbjct  210  YHAGEYLDQVAVSEAKVKKRAKKLAGISTPPTQK--GVNGPTNGKSPPVGISSAVDLISA  267

Query  719  KQMAI  733
            ++MA+
Sbjct  268  REMAV  272



>ref|XP_009619194.1| PREDICTED: uncharacterized protein LOC104111167 isoform X2 [Nicotiana 
tomentosiformis]
Length=733

 Score =   307 bits (786),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 194/246 (79%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDN-LNTFQEEDYNYFA  178
            QSTLQLMGCK R AFKIS  VF+ IR+   G++ V V  E   QD+    +  E  NY  
Sbjct  35   QSTLQLMGCKPRQAFKISGVVFKLIRSEWIGDNLVPVDRELSRQDDSKGLYPNEANNYID  94

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
            A LDK DDRSKS PFELYKKRTTVVVRR TFLDV+C+AL EY Y+G NQRADL +ACR+R
Sbjct  95   ACLDKVDDRSKSKPFELYKKRTTVVVRRETFLDVVCNALTEYKYMGPNQRADLALACRIR  154

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER++S+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK+NPLLWAST
Sbjct  155  ERKDSVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQNPLLWAST  214

Query  539  YHAGEHLDPLavaeakakr-kakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLIS  715
            YHAGE+LDP+AV+EAKAK+ KA KLAG STP  QK    N + +GK P E  +S   +IS
Sbjct  215  YHAGEYLDPIAVSEAKAKQHKANKLAGISTPPLQKKDGVNGVAVGKSPLEVISSAVDVIS  274

Query  716  PKQMAI  733
             KQMAI
Sbjct  275  SKQMAI  280



>ref|XP_009619130.1| PREDICTED: uncharacterized protein LOC104111167 isoform X1 [Nicotiana 
tomentosiformis]
Length=740

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 194/246 (79%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDN-LNTFQEEDYNYFA  178
            QSTLQLMGCK R AFKIS  VF+ IR+   G++ V V  E   QD+    +  E  NY  
Sbjct  35   QSTLQLMGCKPRQAFKISGVVFKLIRSEWIGDNLVPVDRELSRQDDSKGLYPNEANNYID  94

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
            A LDK DDRSKS PFELYKKRTTVVVRR TFLDV+C+AL EY Y+G NQRADL +ACR+R
Sbjct  95   ACLDKVDDRSKSKPFELYKKRTTVVVRRETFLDVVCNALTEYKYMGPNQRADLALACRIR  154

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER++S+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK+NPLLWAST
Sbjct  155  ERKDSVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQNPLLWAST  214

Query  539  YHAGEHLDPLavaeakakr-kakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLIS  715
            YHAGE+LDP+AV+EAKAK+ KA KLAG STP  QK    N + +GK P E  +S   +IS
Sbjct  215  YHAGEYLDPIAVSEAKAKQHKANKLAGISTPPLQKKDGVNGVAVGKSPLEVISSAVDVIS  274

Query  716  PKQMAI  733
             KQMAI
Sbjct  275  SKQMAI  280



>emb|CDP07070.1| unnamed protein product [Coffea canephora]
Length=734

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 187/253 (74%), Gaps = 9/253 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCKSRHAFKIS+R FE IR  C GE+  +  TE     +     +++++ ++ 
Sbjct  40   QSTLQLMGCKSRHAFKISQRAFEMIRGGCFGENLGTCVTEISGLGDSKVHSQKEFDIYSG  99

Query  182  SLDK---------QDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
             LD          +DD +   PFELYKKRTT+V++R  FLDV+CDALAEY YVGLNQRAD
Sbjct  100  ILDNASGVTHTDLKDDDNNGQPFELYKKRTTIVIKRKIFLDVVCDALAEYKYVGLNQRAD  159

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
            L +ACR+RE++ES+TVLLCGTSGCGKSTLSALL SRLGITTVISTDSIRHMMRSFV E+E
Sbjct  160  LALACRIREKKESVTVLLCGTSGCGKSTLSALLASRLGITTVISTDSIRHMMRSFVSEQE  219

Query  515  NPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNA  694
            NPLLWASTYHAGEHLD  A+AEA AK+KAK  AG  TP   KD A +   + K   EGN+
Sbjct  220  NPLLWASTYHAGEHLDREAIAEATAKKKAKNSAGILTPPLSKDDAVDGPAVKKSTLEGNS  279

Query  695  STFKLISPKQMAI  733
                 ISPKQMAI
Sbjct  280  GMVDFISPKQMAI  292



>ref|XP_006340214.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Solanum tuberosum]
Length=733

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 193/246 (78%), Gaps = 9/246 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQE-EDYNYFA  178
            QSTLQLMGCK RHAFKISR VF+K+R+ C G+  VS     L QDN       E   +  
Sbjct  38   QSTLQLMGCKPRHAFKISRTVFDKMRSECMGDKLVSADRAQLGQDNSKGLHHRESSTFMN  97

Query  179  ASLDKQDDRSKS-IPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRL  355
            A +DK +++S+S IPFELYK+RTTV+V+R TFLDV+CDAL EY Y+G NQRADL +ACR+
Sbjct  98   AFMDKGNNQSESSIPFELYKRRTTVIVKRGTFLDVVCDALTEYKYMGPNQRADLILACRI  157

Query  356  RERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAS  535
            RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK+NPLLWAS
Sbjct  158  RERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQNPLLWAS  217

Query  536  TYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLIS  715
            TYHAGE+LDP+AV+EAKAK++AKKLAG STP  QK+         K P    ++   LIS
Sbjct  218  TYHAGEYLDPVAVSEAKAKKRAKKLAGISTPPIQKEGV-------KSPPVRISNAVDLIS  270

Query  716  PKQMAI  733
             ++MA+
Sbjct  271  SREMAV  276



>ref|XP_007016825.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2, partial [Theobroma cacao]
 gb|EOY34444.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2, partial [Theobroma cacao]
Length=496

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 164/247 (66%), Positives = 195/247 (79%), Gaps = 9/247 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVF  IR+  +  S +   +ETL  D L    E++    A 
Sbjct  34   QSTLQLMGCKARHAFKISQRVFALIRSESSYNSLLQEGSETLNSDGLRGNSEKEDVCPA-  92

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                  DR+KSIPFELYK+RT+VVV+R TFLDV+CDALAEY YVG NQRADL +ACR+RE
Sbjct  93   ----NGDRNKSIPFELYKRRTSVVVKRETFLDVVCDALAEYKYVGPNQRADLILACRIRE  148

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTVISTDSIRHMMRSFV+EK+NPLLWASTY
Sbjct  149  RKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVISTDSIRHMMRSFVNEKQNPLLWASTY  208

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK---YPQEGNASTFKLI  712
            HAGE LDP+AVAEAKAK+KAKKLAG +  +P K   A+  + GK    P E  +++ +LI
Sbjct  209  HAGECLDPVAVAEAKAKKKAKKLAGTTQSLP-KGEQADGSSAGKSNAQPMENGSTSTELI  267

Query  713  SPKQMAI  733
            S KQMA+
Sbjct  268  SLKQMAV  274



>ref|XP_009376067.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Pyrus x bretschneideri]
Length=762

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 195/247 (79%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QS+LQLMGCK RHAFKIS+RVFE IRN    ESS +V       +N+   ++E  N+  +
Sbjct  84   QSSLQLMGCKPRHAFKISQRVFELIRN----ESSSNVLLPE-GTENVPPSKDEAGNHLGS  138

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                +DDRSKS+PFELYK RTTVVVRR TFLDV+CDALAEY YVG NQRADL +ACR+RE
Sbjct  139  G---KDDRSKSVPFELYKARTTVVVRRKTFLDVVCDALAEYKYVGPNQRADLALACRIRE  195

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY
Sbjct  196  RKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  255

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP---QEGNASTFKLI  712
            HAGE LDP+AVAEAKAK+KAKKLAG    +P KD   +    GK      +  +ST +LI
Sbjct  256  HAGECLDPVAVAEAKAKKKAKKLAGTPHLLP-KDGMPDGSAFGKSDARLSDVGSSTAELI  314

Query  713  SPKQMAI  733
            SPKQMA+
Sbjct  315  SPKQMAV  321



>ref|XP_004251159.1| PREDICTED: uncharacterized protein LOC101266299 [Solanum lycopersicum]
Length=733

 Score =   289 bits (740),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 192/246 (78%), Gaps = 9/246 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQE-EDYNYFA  178
            QS LQLMGCK RHAFKISR VF+K+R+ C G+  VS       QDN       E   +  
Sbjct  38   QSALQLMGCKPRHAFKISRTVFDKMRSECMGDKLVSADRAQPGQDNSKGLHHRESSTFMN  97

Query  179  ASLDKQDDRSKS-IPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRL  355
            A +DK++++S+S IPFELYK+RTTV+++R TFLDV+CDAL EY Y+G NQRADL +ACR+
Sbjct  98   AFMDKKNNQSESSIPFELYKRRTTVIIKRGTFLDVVCDALTEYKYMGPNQRADLILACRI  157

Query  356  RERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAS  535
            RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK+NPLLWAS
Sbjct  158  RERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQNPLLWAS  217

Query  536  TYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLIS  715
            TYHAGE+LDP+AV+EAKAK++AKKLAG STP  QK+         K P    ++   LIS
Sbjct  218  TYHAGEYLDPVAVSEAKAKKRAKKLAGISTPPIQKEGV-------KSPPVRISNAVDLIS  270

Query  716  PKQMAI  733
             ++MA+
Sbjct  271  SREMAV  276



>ref|XP_009367032.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X3 [Pyrus x bretschneideri]
Length=722

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 190/247 (77%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QS+LQLMGCK RHAFKIS+RVFE IRN    ESS +V       +N+   ++E  N+  +
Sbjct  84   QSSLQLMGCKPRHAFKISQRVFELIRN----ESSSNVLLPE-GTENVPPSKDEAGNHLGS  138

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                +DDRSKS+PFELYK RTTVVVRR TFLDV+CDALAEY YVG NQRADL +ACR+RE
Sbjct  139  G---KDDRSKSVPFELYKARTTVVVRRKTFLDVVCDALAEYKYVGPNQRADLALACRIRE  195

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY
Sbjct  196  RKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  255

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP---QEGNASTFKLI  712
            HAGE LDP+A    K K+KAKKLAG    +P KD   +    GK      +  +ST +LI
Sbjct  256  HAGECLDPVAGGGDKTKKKAKKLAGTPHLLP-KDGMPDGSAFGKSDARLSDVGSSTAELI  314

Query  713  SPKQMAI  733
            SPKQMA+
Sbjct  315  SPKQMAV  321



>ref|XP_009367031.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Pyrus x bretschneideri]
Length=723

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 190/247 (77%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QS+LQLMGCK RHAFKIS+RVFE IRN    ESS +V       +N+   ++E  N+  +
Sbjct  84   QSSLQLMGCKPRHAFKISQRVFELIRN----ESSSNVLLPE-GTENVPPSKDEAGNHLGS  138

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                +DDRSKS+PFELYK RTTVVVRR TFLDV+CDALAEY YVG NQRADL +ACR+RE
Sbjct  139  G---KDDRSKSVPFELYKARTTVVVRRKTFLDVVCDALAEYKYVGPNQRADLALACRIRE  195

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY
Sbjct  196  RKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  255

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP---QEGNASTFKLI  712
            HAGE LDP+A    K K+KAKKLAG    +P KD   +    GK      +  +ST +LI
Sbjct  256  HAGECLDPVAGGGDKTKKKAKKLAGTPHLLP-KDGMPDGSAFGKSDARLSDVGSSTAELI  314

Query  713  SPKQMAI  733
            SPKQMA+
Sbjct  315  SPKQMAV  321



>ref|XP_009367030.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Pyrus x bretschneideri]
Length=762

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 190/247 (77%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QS+LQLMGCK RHAFKIS+RVFE IRN    ESS +V       +N+   ++E  N+  +
Sbjct  84   QSSLQLMGCKPRHAFKISQRVFELIRN----ESSSNVLLPE-GTENVPPSKDEAGNHLGS  138

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                +DDRSKS+PFELYK RTTVVVRR TFLDV+CDALAEY YVG NQRADL +ACR+RE
Sbjct  139  G---KDDRSKSVPFELYKARTTVVVRRKTFLDVVCDALAEYKYVGPNQRADLALACRIRE  195

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY
Sbjct  196  RKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  255

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP---QEGNASTFKLI  712
            HAGE LDP+A    K K+KAKKLAG    +P KD   +    GK      +  +ST +LI
Sbjct  256  HAGECLDPVAGGGDKTKKKAKKLAGTPHLLP-KDGMPDGSAFGKSDARLSDVGSSTAELI  314

Query  713  SPKQMAI  733
            SPKQMA+
Sbjct  315  SPKQMAV  321



>gb|EYU18801.1| hypothetical protein MIMGU_mgv1a002235mg [Erythranthe guttata]
Length=697

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 187/245 (76%), Gaps = 18/245 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSV-SVCTETLEQDNLNTFQEEDYNYFA  178
            QSTLQL+GCK RHAFKIS+RVFE +R     E+ V + C    +QD             A
Sbjct  40   QSTLQLIGCKPRHAFKISQRVFEMVRQGSPVETLVYTTCIGVPQQD-----------VDA  88

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
            ++LD  +D+SKS PFELYKKRTTVVVRR  FLDV+C+AL+EY YVG NQRADL IACR+R
Sbjct  89   SNLDLDEDKSKSRPFELYKKRTTVVVRRKFFLDVVCEALSEYKYVGPNQRADLVIACRIR  148

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER+ES+TVLLCGTSGCGKSTLSALLGSRLGITT++STDSIRHMMRSF DEKENPLLWAST
Sbjct  149  ERKESVTVLLCGTSGCGKSTLSALLGSRLGITTIVSTDSIRHMMRSFFDEKENPLLWAST  208

Query  539  YHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLISP  718
            YHAGE LDP+AV+ AKAKRKAKK    S  V + D+  NH +  K    GN +T  LISP
Sbjct  209  YHAGECLDPIAVSGAKAKRKAKK----SNSVNKHDALINHTSGNK--SNGNKTTSDLISP  262

Query  719  KQMAI  733
            KQMA+
Sbjct  263  KQMAV  267



>gb|KHG09222.1| hypothetical protein F383_15788 [Gossypium arboreum]
Length=632

 Score =   285 bits (729),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 192/255 (75%), Gaps = 11/255 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQE-EDYNYFA  178
            QSTLQLMGCK+RHAFKIS+ VFE IR+    +S      ETL  D+     E ED     
Sbjct  34   QSTLQLMGCKARHAFKISQSVFELIRSDPFYKSLHYEGNETLNSDSFKGNSEREDVRPTN  93

Query  179  ASL----------DKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQR  328
             +L            +DD +K+IPFELYK+RTTVVVRR TFLDV+C+ALAEY YVG NQR
Sbjct  94   GNLGGAEAGSCFVSDKDDGNKTIPFELYKRRTTVVVRRETFLDVVCEALAEYKYVGPNQR  153

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
            ADL +A R+RER+ES+TVLLCGTSGCGKSTLSALLG RLGITTVISTDSIRHMMRSF DE
Sbjct  154  ADLILASRIRERKESVTVLLCGTSGCGKSTLSALLGGRLGITTVISTDSIRHMMRSFADE  213

Query  509  KENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEG  688
            KENPLLWASTYHAGE LDP+AVAEAKA+++AKKLAG +  +P+ +        G +P EG
Sbjct  214  KENPLLWASTYHAGECLDPVAVAEAKARKQAKKLAGIAQSLPKGEVDDGSSAKGAHPMEG  273

Query  689  NASTFKLISPKQMAI  733
            ++++ +LIS KQMA+
Sbjct  274  SSASTELISSKQMAV  288



>gb|KHG14615.1| hypothetical protein F383_19567 [Gossypium arboreum]
Length=586

 Score =   283 bits (725),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 201/276 (73%), Gaps = 33/276 (12%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFK------------------ISRRVFEKIRNVCAGESSVSVCTETL  127
            QSTLQLMGCK+RHAFK                  ISRRVFE +R+  +  S +   +ETL
Sbjct  34   QSTLQLMGCKARHAFKFLWRVDPLAECILCISYQISRRVFELVRSEASYSSLLQQGSETL  93

Query  128  EQDNL--NTFQEEDYNYF-------AAS--LDKQDDRSKSIPFELYKKRTTVVVRRHTFL  274
              D L  N+ +E+ Y+ F       A S     +DDR+K IPFELYK+RT+VVV+R  FL
Sbjct  94   NSDGLRWNSEKEDAYSNFNDFQRAEAGSRLASNEDDRNKGIPFELYKRRTSVVVKREAFL  153

Query  275  DVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGIT  454
            DV+CDALAEY YVG NQRADL +ACR+RE++ES+TVLLCGTSGCGKSTLSALLGSRLGIT
Sbjct  154  DVVCDALAEYKYVGPNQRADLVLACRIREKKESVTVLLCGTSGCGKSTLSALLGSRLGIT  213

Query  455  TVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVP  634
            TVISTDSIRHMMRSFV+EKENPLLWASTYHAGE LDP+AV EAKAK++AKKLAG S  + 
Sbjct  214  TVISTDSIRHMMRSFVNEKENPLLWASTYHAGECLDPVAVTEAKAKKRAKKLAGISQSL-  272

Query  635  QKDSAANHMTIGKY---PQEGNASTFKLISPKQMAI  733
             K   A+  + GK    P EG+++  +LI P+QMA+
Sbjct  273  SKSELADRTSAGKSDARPVEGSSTGTELIGPRQMAV  308



>ref|XP_006424515.1| hypothetical protein CICLE_v10027892mg [Citrus clementina]
 gb|ESR37755.1| hypothetical protein CICLE_v10027892mg [Citrus clementina]
Length=733

 Score =   286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 167/252 (66%), Positives = 192/252 (76%), Gaps = 14/252 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVF+ IR     ES  S   +          +++D     +
Sbjct  41   QSTLQLMGCKARHAFKISQRVFKMIRT----ESPTSAQHQEGADCLKGNLEKDDGCNPGS  96

Query  182  SLDKQD-----DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIA  346
            S  K++     DRSK IPFELYK+RTTVVV R TF+DV+CDAL EY YVG NQRADL +A
Sbjct  97   SFCKEEVSESGDRSKRIPFELYKRRTTVVVSRETFIDVVCDALTEYKYVGHNQRADLVLA  156

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
            CR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+NPLL
Sbjct  157  CRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLL  216

Query  527  WASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK---YPQEGNAS  697
            WASTYHAGE LDP AVAEAKAK+ A+KLAG +  VP KD A+N    GK    P+ G +S
Sbjct  217  WASTYHAGEFLDPDAVAEAKAKKHARKLAGAALSVP-KDEASNSSATGKSDTRPEVG-SS  274

Query  698  TFKLISPKQMAI  733
              +LISPKQMAI
Sbjct  275  AAELISPKQMAI  286



>gb|EYU36164.1| hypothetical protein MIMGU_mgv1a001992mg [Erythranthe guttata]
Length=729

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 191/248 (77%), Gaps = 7/248 (3%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYF--  175
            QSTLQLMGCK+RHAFKIS+RVFE++R  C+ E  VS C +   QD    + + D +Y   
Sbjct  41   QSTLQLMGCKARHAFKISQRVFERMRLECSVEKLVSECIDMSLQD-AKVYPQRDTDYLDK  99

Query  176  --AASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIAC  349
                 L ++ D SKS PFELYK+RTT  V R  FLDV+C+AL+EY YVG NQ+ADL +AC
Sbjct  100  ENVNHLSQEGDVSKSKPFELYKRRTTTFVGRKKFLDVVCEALSEYKYVGPNQKADLVLAC  159

Query  350  RLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLW  529
            R+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFV E++NPLLW
Sbjct  160  RIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVAEEQNPLLW  219

Query  530  ASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKL  709
            ASTYHAGE+LDP+AVAEAKAK++AKK AG       K+    + T GK   EGNA+T  L
Sbjct  220  ASTYHAGEYLDPVAVAEAKAKKRAKKSAGIPASSLAKNEVLGNSTTGK--PEGNATTTDL  277

Query  710  ISPKQMAI  733
            ++PKQMA+
Sbjct  278  VNPKQMAV  285



>ref|XP_007016824.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY34443.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=723

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 164/247 (66%), Positives = 195/247 (79%), Gaps = 9/247 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVF  IR+  +  S +   +ETL  D L    E++    A 
Sbjct  34   QSTLQLMGCKARHAFKISQRVFALIRSESSYNSLLQEGSETLNSDGLRGNSEKEDVCPA-  92

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                  DR+KSIPFELYK+RT+VVV+R TFLDV+CDALAEY YVG NQRADL +ACR+RE
Sbjct  93   ----NGDRNKSIPFELYKRRTSVVVKRETFLDVVCDALAEYKYVGPNQRADLILACRIRE  148

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTVISTDSIRHMMRSFV+EK+NPLLWASTY
Sbjct  149  RKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVISTDSIRHMMRSFVNEKQNPLLWASTY  208

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK---YPQEGNASTFKLI  712
            HAGE LDP+AVAEAKAK+KAKKLAG +  +P K   A+  + GK    P E  +++ +LI
Sbjct  209  HAGECLDPVAVAEAKAKKKAKKLAGTTQSLP-KGEQADGSSAGKSNAQPMENGSTSTELI  267

Query  713  SPKQMAI  733
            S KQMA+
Sbjct  268  SLKQMAV  274



>emb|CBI17176.3| unnamed protein product [Vitis vinifera]
Length=704

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 189/248 (76%), Gaps = 14/248 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNT-FQEEDYNYFA  178
            QSTLQLMGCK+RHAFKISRRVFE +++ C G+  V   T     D     F++ED     
Sbjct  34   QSTLQLMGCKARHAFKISRRVFELMKSECTGDGLVPSGTNFSGLDTSKMHFKKED-----  88

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
                ++D RSKS+PFELYK+RTTVVVRR TFLDV+C AL EY Y+G NQRADL +ACR+R
Sbjct  89   ----EKDGRSKSVPFELYKRRTTVVVRRETFLDVVCSALTEYKYMGPNQRADLVLACRIR  144

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSF DEK+NPLLWAST
Sbjct  145  ERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFADEKQNPLLWAST  204

Query  539  YHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK---YPQEGNASTFKL  709
            YHAGE LDP+AV+EAKAKRKAKKLA  S   P KD A      GK      E  +ST +L
Sbjct  205  YHAGECLDPVAVSEAKAKRKAKKLAHISHSRP-KDEAFEGSRTGKSETQSSEVGSSTAEL  263

Query  710  ISPKQMAI  733
            I PKQMAI
Sbjct  264  IRPKQMAI  271



>ref|XP_006488044.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Citrus sinensis]
Length=738

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 164/253 (65%), Positives = 188/253 (74%), Gaps = 11/253 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYN----  169
            QSTLQLMGCK+RHAFKIS+RVF+ IR      +      E      L    E+D      
Sbjct  41   QSTLQLMGCKARHAFKISQRVFKMIRTESPTSAHHQEGAEVFGSHCLKGNLEKDDGCNPG  100

Query  170  --YFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTI  343
              +    + +  DRSK IPFELYK+RTTVV+ R TF+DV+CDAL EY YVG NQRADL +
Sbjct  101  SCFCKEEVSESGDRSKRIPFELYKRRTTVVISRETFIDVVCDALTEYKYVGHNQRADLVL  160

Query  344  ACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPL  523
            ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+NPL
Sbjct  161  ACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPL  220

Query  524  LWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK---YPQEGNA  694
            LWASTYHAGE LDP AVAEAKAK+ A+KLAG +  VP KD A+N    GK    P+ G +
Sbjct  221  LWASTYHAGEFLDPDAVAEAKAKKHARKLAGAALSVP-KDEASNSSATGKSDIRPEVG-S  278

Query  695  STFKLISPKQMAI  733
            S  +LISPKQMAI
Sbjct  279  SAAELISPKQMAI  291



>gb|KDO60189.1| hypothetical protein CISIN_1g004662mg [Citrus sinensis]
Length=738

 Score =   285 bits (729),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 164/253 (65%), Positives = 188/253 (74%), Gaps = 11/253 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYN----  169
            QSTLQLMGCK+RHAFKIS+RVF+ IR      +      E      L    E+D      
Sbjct  41   QSTLQLMGCKARHAFKISQRVFKMIRTESPTSAHHQEGAEVFGSHCLKGNLEKDDGCNPG  100

Query  170  --YFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTI  343
              +    + +  DRSK IPFELYK+RTTVV+ R TF+DV+CDAL EY YVG NQRADL +
Sbjct  101  SCFCKEEVSESGDRSKRIPFELYKRRTTVVISRETFIDVVCDALTEYKYVGHNQRADLVL  160

Query  344  ACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPL  523
            ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+NPL
Sbjct  161  ACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPL  220

Query  524  LWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK---YPQEGNA  694
            LWASTYHAGE LDP AVAEAKAK+ A+KLAG +  VP KD A+N    GK    P+ G +
Sbjct  221  LWASTYHAGEFLDPDAVAEAKAKKHARKLAGAALSVP-KDEASNSSATGKSDIRPEVG-S  278

Query  695  STFKLISPKQMAI  733
            S  +LISPKQMAI
Sbjct  279  SAAELISPKQMAI  291



>ref|XP_002313526.2| 2-phosphoglycerate kinase-related family protein [Populus trichocarpa]
 gb|EEE87481.2| 2-phosphoglycerate kinase-related family protein [Populus trichocarpa]
Length=730

 Score =   284 bits (726),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 191/247 (77%), Gaps = 8/247 (3%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVFE +RN  + E S+S   E    D      E +    + 
Sbjct  39   QSTLQLMGCKARHAFKISKRVFEVMRNEFSNEVSLSKEVEIRVVDASKENSEREDGLSSG  98

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                ++DR+KSIPFELYK+RTTVVVRR +FL+V+CDAL EY YVG NQR DL +ACR+RE
Sbjct  99   ----EEDRNKSIPFELYKRRTTVVVRRESFLNVVCDALTEYKYVGPNQREDLVLACRIRE  154

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLG+RLG+TTVISTDSIRHMMRSFVDEK+NPLLWASTY
Sbjct  155  RKESVTVLLCGTSGCGKSTLSALLGNRLGVTTVISTDSIRHMMRSFVDEKQNPLLWASTY  214

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKY---PQEGNASTFKLI  712
            HAGE+LDP AVAEAKAKRKAKKLAG +  +  KD  ++  T GK      E  + T + I
Sbjct  215  HAGEYLDPEAVAEAKAKRKAKKLAGIAN-LRSKDELSDGYTAGKSGSGAPEVTSGTAEFI  273

Query  713  SPKQMAI  733
            SPKQMAI
Sbjct  274  SPKQMAI  280



>ref|XP_008226166.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Prunus mume]
Length=672

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 193/247 (78%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QS+LQLMGCK RHAFKIS+RVFE IRN    ESS SV       +N++  + E   +F +
Sbjct  34   QSSLQLMGCKPRHAFKISQRVFELIRN----ESSSSVLLPE-GTENVSPSKAEACKHFVS  88

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                +DD +KS+PFELYK RTTVVV R TFLDV+CDALAEY YVG NQRADL +ACR+RE
Sbjct  89   G---KDDSNKSVPFELYKIRTTVVVTRETFLDVVCDALAEYKYVGPNQRADLALACRIRE  145

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSFVD+K+NPLLWASTY
Sbjct  146  RKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFVDDKQNPLLWASTY  205

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP---QEGNASTFKLI  712
            HAGE LDP++VAEAKAK+KAKKLAG    +P KD   +    GK      +  +ST +LI
Sbjct  206  HAGECLDPVSVAEAKAKKKAKKLAGTLHSLP-KDGMPDGSAFGKSDTRMSDVGSSTAELI  264

Query  713  SPKQMAI  733
            SPKQMA+
Sbjct  265  SPKQMAV  271



>ref|XP_002277270.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Vitis vinifera]
Length=723

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 169/258 (66%), Positives = 190/258 (74%), Gaps = 15/258 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNT-FQEEDYNYFA  178
            QSTLQLMGCK+RHAFKISRRVFE +++ C G+  V   T     D     F++ED     
Sbjct  34   QSTLQLMGCKARHAFKISRRVFELMKSECTGDGLVPSGTNFSGLDTSKMHFKKEDGCSTG  93

Query  179  ASLDK----------QDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQR  328
              L K          +D RSKS+PFELYK+RTTVVVRR TFLDV+C AL EY Y+G NQR
Sbjct  94   GCLGKIEAGNCLVVEKDGRSKSVPFELYKRRTTVVVRRETFLDVVCSALTEYKYMGPNQR  153

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
            ADL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSF DE
Sbjct  154  ADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFADE  213

Query  509  KENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK---YP  679
            K+NPLLWASTYHAGE LDP+AV+EAKAKRKAKKLA  S   P KD A      GK     
Sbjct  214  KQNPLLWASTYHAGECLDPVAVSEAKAKRKAKKLAHISHSRP-KDEAFEGSRTGKSETQS  272

Query  680  QEGNASTFKLISPKQMAI  733
             E  +ST +LI PKQMAI
Sbjct  273  SEVGSSTAELIRPKQMAI  290



>ref|XP_011000530.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Populus euphratica]
 ref|XP_011016179.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Populus euphratica]
Length=742

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 164/257 (64%), Positives = 196/257 (76%), Gaps = 14/257 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQD-NLNTFQEEDYNYFA  178
            QSTLQLMGCK+RHAFKIS+RVFE +R+  + + S+S   E    D +    + ED     
Sbjct  37   QSTLQLMGCKARHAFKISKRVFEVMRHEFSNKVSLSKEVEIRGVDASKENSEREDGLSSG  96

Query  179  ASLDK---------QDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRA  331
             SL K         ++DR+KSIPFELYK+RTTVVVRR +FL+V+CDAL EY YVG NQR 
Sbjct  97   GSLGKIEVSNRLVSEEDRNKSIPFELYKRRTTVVVRRESFLNVVCDALTEYKYVGPNQRE  156

Query  332  DLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK  511
            DL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLG+RLG+TTVISTDSIRHMMRSFVDEK
Sbjct  157  DLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGNRLGVTTVISTDSIRHMMRSFVDEK  216

Query  512  ENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKY---PQ  682
            +NPLLWASTYHAGE+LDP AVAEAKA+RKAKKLAG +  +  KD  ++  T GK      
Sbjct  217  QNPLLWASTYHAGEYLDPEAVAEAKARRKAKKLAGIAN-LRSKDELSDGYTAGKSGSGAP  275

Query  683  EGNASTFKLISPKQMAI  733
            E  +ST + ISPKQ+AI
Sbjct  276  EVTSSTAEFISPKQLAI  292



>ref|XP_008226161.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Prunus mume]
Length=712

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 193/247 (78%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QS+LQLMGCK RHAFKIS+RVFE IRN    ESS SV       +N++  + E   +F +
Sbjct  34   QSSLQLMGCKPRHAFKISQRVFELIRN----ESSSSVLLPE-GTENVSPSKAEACKHFVS  88

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                +DD +KS+PFELYK RTTVVV R TFLDV+CDALAEY YVG NQRADL +ACR+RE
Sbjct  89   G---KDDSNKSVPFELYKIRTTVVVTRETFLDVVCDALAEYKYVGPNQRADLALACRIRE  145

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSFVD+K+NPLLWASTY
Sbjct  146  RKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFVDDKQNPLLWASTY  205

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP---QEGNASTFKLI  712
            HAGE LDP++VAEAKAK+KAKKLAG    +P KD   +    GK      +  +ST +LI
Sbjct  206  HAGECLDPVSVAEAKAKKKAKKLAGTLHSLP-KDGMPDGSAFGKSDTRMSDVGSSTAELI  264

Query  713  SPKQMAI  733
            SPKQMA+
Sbjct  265  SPKQMAV  271



>ref|XP_011016180.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X3 [Populus euphratica]
Length=742

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 164/257 (64%), Positives = 196/257 (76%), Gaps = 14/257 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQD-NLNTFQEEDYNYFA  178
            QSTLQLMGCK+RHAFKIS+RVFE +R+  + + S+S   E    D +    + ED     
Sbjct  37   QSTLQLMGCKARHAFKISKRVFEVMRHEFSNKVSLSKEVEIRGVDASKENSEREDGLSSG  96

Query  179  ASLDK---------QDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRA  331
             SL K         ++DR+KSIPFELYK+RTTVVVRR +FL+V+CDAL EY YVG NQR 
Sbjct  97   GSLGKIEVSNRLVSEEDRNKSIPFELYKRRTTVVVRRESFLNVVCDALTEYKYVGPNQRE  156

Query  332  DLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK  511
            DL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLG+RLG+TTVISTDSIRHMMRSFVDEK
Sbjct  157  DLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGNRLGVTTVISTDSIRHMMRSFVDEK  216

Query  512  ENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKY---PQ  682
            +NPLLWASTYHAGE+LDP AVAEAKA+RKAKKLAG +  +  KD  ++  T GK      
Sbjct  217  QNPLLWASTYHAGEYLDPEAVAEAKARRKAKKLAGIAN-LRSKDELSDGYTAGKSGSGAP  275

Query  683  EGNASTFKLISPKQMAI  733
            E  +ST + ISPKQ+AI
Sbjct  276  EVTSSTAEFISPKQLAI  292



>ref|XP_011016178.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Populus euphratica]
Length=744

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 164/257 (64%), Positives = 196/257 (76%), Gaps = 14/257 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQD-NLNTFQEEDYNYFA  178
            QSTLQLMGCK+RHAFKIS+RVFE +R+  + + S+S   E    D +    + ED     
Sbjct  39   QSTLQLMGCKARHAFKISKRVFEVMRHEFSNKVSLSKEVEIRGVDASKENSEREDGLSSG  98

Query  179  ASLDK---------QDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRA  331
             SL K         ++DR+KSIPFELYK+RTTVVVRR +FL+V+CDAL EY YVG NQR 
Sbjct  99   GSLGKIEVSNRLVSEEDRNKSIPFELYKRRTTVVVRRESFLNVVCDALTEYKYVGPNQRE  158

Query  332  DLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK  511
            DL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLG+RLG+TTVISTDSIRHMMRSFVDEK
Sbjct  159  DLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGNRLGVTTVISTDSIRHMMRSFVDEK  218

Query  512  ENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKY---PQ  682
            +NPLLWASTYHAGE+LDP AVAEAKA+RKAKKLAG +  +  KD  ++  T GK      
Sbjct  219  QNPLLWASTYHAGEYLDPEAVAEAKARRKAKKLAGIAN-LRSKDELSDGYTAGKSGSGAP  277

Query  683  EGNASTFKLISPKQMAI  733
            E  +ST + ISPKQ+AI
Sbjct  278  EVTSSTAEFISPKQLAI  294



>ref|XP_007204974.1| hypothetical protein PRUPE_ppa002445mg [Prunus persica]
 gb|EMJ06173.1| hypothetical protein PRUPE_ppa002445mg [Prunus persica]
Length=672

 Score =   280 bits (716),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 164/247 (66%), Positives = 192/247 (78%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QS+LQLMGCK RHAFKIS+RVFE IRN    ESS SV       +N++  + E   +  +
Sbjct  34   QSSLQLMGCKPRHAFKISQRVFELIRN----ESSSSVLLPE-GTENVSPSKAEACKHLVS  88

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                +DD +KS+PFELYK RTTVVV R TFLDV+CDALAEY YVG NQRADL +ACR+RE
Sbjct  89   G---KDDSNKSVPFELYKIRTTVVVARETFLDVVCDALAEYKYVGPNQRADLALACRIRE  145

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSFVD+K+NPLLWASTY
Sbjct  146  RKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFVDDKQNPLLWASTY  205

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP---QEGNASTFKLI  712
            HAGE LDP++VAEAKAK+KAKKLAG    +P KD   +    GK      +  +ST +LI
Sbjct  206  HAGECLDPVSVAEAKAKKKAKKLAGTLHSLP-KDGMPDGSAFGKSDTRMSDVGSSTAELI  264

Query  713  SPKQMAI  733
            SPKQMA+
Sbjct  265  SPKQMAV  271



>ref|XP_009356894.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Pyrus x bretschneideri]
 ref|XP_009356897.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Pyrus x bretschneideri]
Length=712

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 192/247 (78%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QS+LQLMGCK RHAFKIS+RVFE IRN    ESS +V       +N+   + E  N+  +
Sbjct  34   QSSLQLMGCKPRHAFKISQRVFESIRN----ESSSNVLLPE-GTENVPPGKSEACNHLGS  88

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                +DDRSKS+PFELYK RTTVVVRR TFL+V+CDA AEY YVG NQ+ADL +ACR+RE
Sbjct  89   G---KDDRSKSVPFELYKARTTVVVRRKTFLNVVCDAQAEYKYVGPNQQADLALACRIRE  145

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+ VLLCGTSG GKSTLS+LLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY
Sbjct  146  RKESVIVLLCGTSGWGKSTLSSLLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  205

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP---QEGNASTFKLI  712
            HAGE LDP+AVAE+KAK+KAKKLAG   P+P KD   +  + GK      +  +ST +LI
Sbjct  206  HAGECLDPVAVAESKAKKKAKKLAGTPRPLP-KDGMPDGSSSGKSDTRLSDIGSSTAELI  264

Query  713  SPKQMAI  733
            S KQ+A+
Sbjct  265  SAKQLAV  271



>ref|XP_006384932.1| 2-phosphoglycerate kinase-related family protein [Populus trichocarpa]
 gb|ERP62729.1| 2-phosphoglycerate kinase-related family protein [Populus trichocarpa]
Length=739

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 163/256 (64%), Positives = 194/256 (76%), Gaps = 17/256 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNY---  172
            QSTLQLMGCK+RHAFKIS+RVFE +R+V     S  +    ++  N N  +E+  +    
Sbjct  40   QSTLQLMGCKARHAFKISQRVFELMRSVS---HSKEIEITGVDASNGNNEKEDGLSSGVF  96

Query  173  -----FAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
                    SL  ++DR KSIPFELYK+RTTVVVRR  FL+ +CDAL EY YVG NQR DL
Sbjct  97   LGKTEVGNSLVSEEDRYKSIPFELYKRRTTVVVRREAFLNFVCDALTEYKYVGPNQREDL  156

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKEN  517
             +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTVISTDSIRHMMRSFVDEK+N
Sbjct  157  VLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVISTDSIRHMMRSFVDEKQN  216

Query  518  PLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK----YPQE  685
            PLLWASTYHAGE LDP+AVAEAKAKRKAKKLAG  T +  KD  ++  T GK     P+ 
Sbjct  217  PLLWASTYHAGEFLDPVAVAEAKAKRKAKKLAGTGT-LHSKDEVSDGFTTGKSGSGAPKV  275

Query  686  GNASTFKLISPKQMAI  733
             + +T ++ISPKQMA+
Sbjct  276  SSGAT-EVISPKQMAV  290



>ref|XP_011040919.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
isoform X4 [Populus euphratica]
Length=743

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 165/253 (65%), Positives = 194/253 (77%), Gaps = 11/253 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGE----SSVSVCTETLE-QDNLNTFQEEDY  166
            QSTLQLMGCK+RHAFKIS+RVFE +R+V   +    + V       E +D L++      
Sbjct  44   QSTLQLMGCKARHAFKISQRVFELMRSVSHSKEVEITGVDASKGNNEKEDGLSSGVFLGK  103

Query  167  NYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIA  346
                 SL  +DDR+KSIPFELYK+RTTVVVRR  FL+ +CDAL EY YVG NQR DL +A
Sbjct  104  AEGGNSLVSEDDRNKSIPFELYKRRTTVVVRREAFLNFVCDALTEYKYVGPNQREDLVLA  163

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
            CR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTVISTDSIRHMMRSFVDEK+NPLL
Sbjct  164  CRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVISTDSIRHMMRSFVDEKQNPLL  223

Query  527  WASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK----YPQEGNA  694
            WASTYHAGE LDP+AVAEAKAKRKAKKLAG  T +  KD  ++  T GK     P+  + 
Sbjct  224  WASTYHAGEFLDPVAVAEAKAKRKAKKLAGTGT-LRSKDELSDGYTTGKSGSGAPKVSSG  282

Query  695  STFKLISPKQMAI  733
            +T ++ISPKQMAI
Sbjct  283  AT-EVISPKQMAI  294



>ref|XP_011040918.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
isoform X3 [Populus euphratica]
Length=747

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 165/253 (65%), Positives = 194/253 (77%), Gaps = 11/253 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGE----SSVSVCTETLE-QDNLNTFQEEDY  166
            QSTLQLMGCK+RHAFKIS+RVFE +R+V   +    + V       E +D L++      
Sbjct  44   QSTLQLMGCKARHAFKISQRVFELMRSVSHSKEVEITGVDASKGNNEKEDGLSSGVFLGK  103

Query  167  NYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIA  346
                 SL  +DDR+KSIPFELYK+RTTVVVRR  FL+ +CDAL EY YVG NQR DL +A
Sbjct  104  AEGGNSLVSEDDRNKSIPFELYKRRTTVVVRREAFLNFVCDALTEYKYVGPNQREDLVLA  163

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
            CR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTVISTDSIRHMMRSFVDEK+NPLL
Sbjct  164  CRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVISTDSIRHMMRSFVDEKQNPLL  223

Query  527  WASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK----YPQEGNA  694
            WASTYHAGE LDP+AVAEAKAKRKAKKLAG  T +  KD  ++  T GK     P+  + 
Sbjct  224  WASTYHAGEFLDPVAVAEAKAKRKAKKLAGTGT-LRSKDELSDGYTTGKSGSGAPKVSSG  282

Query  695  STFKLISPKQMAI  733
            +T ++ISPKQMAI
Sbjct  283  AT-EVISPKQMAI  294



>ref|XP_011040916.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
isoform X1 [Populus euphratica]
Length=773

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 165/253 (65%), Positives = 194/253 (77%), Gaps = 11/253 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGE----SSVSVCTETLE-QDNLNTFQEEDY  166
            QSTLQLMGCK+RHAFKIS+RVFE +R+V   +    + V       E +D L++      
Sbjct  44   QSTLQLMGCKARHAFKISQRVFELMRSVSHSKEVEITGVDASKGNNEKEDGLSSGVFLGK  103

Query  167  NYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIA  346
                 SL  +DDR+KSIPFELYK+RTTVVVRR  FL+ +CDAL EY YVG NQR DL +A
Sbjct  104  AEGGNSLVSEDDRNKSIPFELYKRRTTVVVRREAFLNFVCDALTEYKYVGPNQREDLVLA  163

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
            CR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTVISTDSIRHMMRSFVDEK+NPLL
Sbjct  164  CRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVISTDSIRHMMRSFVDEKQNPLL  223

Query  527  WASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK----YPQEGNA  694
            WASTYHAGE LDP+AVAEAKAKRKAKKLAG  T +  KD  ++  T GK     P+  + 
Sbjct  224  WASTYHAGEFLDPVAVAEAKAKRKAKKLAGTGT-LRSKDELSDGYTTGKSGSGAPKVSSG  282

Query  695  STFKLISPKQMAI  733
            +T ++ISPKQMAI
Sbjct  283  AT-EVISPKQMAI  294



>ref|XP_011040917.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
isoform X2 [Populus euphratica]
Length=764

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 165/253 (65%), Positives = 194/253 (77%), Gaps = 11/253 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGE----SSVSVCTETLE-QDNLNTFQEEDY  166
            QSTLQLMGCK+RHAFKIS+RVFE +R+V   +    + V       E +D L++      
Sbjct  44   QSTLQLMGCKARHAFKISQRVFELMRSVSHSKEVEITGVDASKGNNEKEDGLSSGVFLGK  103

Query  167  NYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIA  346
                 SL  +DDR+KSIPFELYK+RTTVVVRR  FL+ +CDAL EY YVG NQR DL +A
Sbjct  104  AEGGNSLVSEDDRNKSIPFELYKRRTTVVVRREAFLNFVCDALTEYKYVGPNQREDLVLA  163

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
            CR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTVISTDSIRHMMRSFVDEK+NPLL
Sbjct  164  CRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVISTDSIRHMMRSFVDEKQNPLL  223

Query  527  WASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK----YPQEGNA  694
            WASTYHAGE LDP+AVAEAKAKRKAKKLAG  T +  KD  ++  T GK     P+  + 
Sbjct  224  WASTYHAGEFLDPVAVAEAKAKRKAKKLAGTGT-LRSKDELSDGYTTGKSGSGAPKVSSG  282

Query  695  STFKLISPKQMAI  733
            +T ++ISPKQMAI
Sbjct  283  AT-EVISPKQMAI  294



>ref|XP_010520382.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Tarenaya hassleriana]
Length=725

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 189/263 (72%), Gaps = 30/263 (11%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRN--VCAG------------ESSVSVCTETLEQDN  139
            QSTLQLMGCK+RHAFKISRRVFE IR    CA             ++  S C   ++ D 
Sbjct  39   QSTLQLMGCKARHAFKISRRVFELIRGEGSCASLPLNGKEPDIEKDNGASECAGLVKVDK  98

Query  140  LNTFQEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGL  319
            +N    +            DD+ KS PFELYK+R TV V R  FLDV+CDALAEY YVG 
Sbjct  99   VNPLPSDG-----------DDKMKSKPFELYKRRKTVTVSREIFLDVVCDALAEYKYVGH  147

Query  320  NQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSF  499
            +QRADL +ACR+RER+ES+TVLLCGTSGCGKSTLS+LLG RLGITTV+STDSIRHMMRSF
Sbjct  148  DQRADLILACRIRERKESVTVLLCGTSGCGKSTLSSLLGGRLGITTVVSTDSIRHMMRSF  207

Query  500  VDEKENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP  679
            VDEKENPLLWASTYHAGE+LDP+AVAEAKAKR+AKKLAG +  VP+ +   +   +    
Sbjct  208  VDEKENPLLWASTYHAGEYLDPVAVAEAKAKRRAKKLAGVARSVPKGEQTNDSRGVKPIS  267

Query  680  QE----GNAST-FKLISPKQMAI  733
            Q+    G+ ST  +L+SPKQMAI
Sbjct  268  QQIGDAGSKSTAMELLSPKQMAI  290



>ref|XP_004291572.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Fragaria vesca subsp. vesca]
Length=710

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 186/247 (75%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QS+LQLMGCK RHAFKIS+RVFE IRNV + E+ +   TE +         E   N  + 
Sbjct  34   QSSLQLMGCKPRHAFKISQRVFELIRNVSSCEALLPEGTENVSPSK----SEASKNTVSG  89

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                +D +SKS+PFE+YK RTTVVVRR TFLDV+CDALAEY YVG NQRADL  ACR+RE
Sbjct  90   ----KDHKSKSVPFEMYKTRTTVVVRRETFLDVVCDALAEYKYVGPNQRADLVFACRVRE  145

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSF DEK+NPLLWASTY
Sbjct  146  RKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFADEKQNPLLWASTY  205

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQE---GNASTFKLI  712
            HAGE LDP+AVAEAKAK+KAKK A  S  +  KD   +    G+   +     +ST +LI
Sbjct  206  HAGECLDPVAVAEAKAKKKAKKSAASSQSL-SKDGMVDGSPSGRSDSQMSDAGSSTAELI  264

Query  713  SPKQMAI  733
            S KQMAI
Sbjct  265  SSKQMAI  271



>ref|XP_003538154.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Glycine max]
 ref|XP_006591126.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X3 [Glycine max]
Length=704

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 159/246 (65%), Positives = 189/246 (77%), Gaps = 15/246 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVFE+ R     E+S  +    LE + L+ F     + F  
Sbjct  30   QSTLQLMGCKARHAFKISQRVFEQTRK----ENSTDILK--LEVEALSGF-----DAFKK  78

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            +  K+D RS  +PFELYK+RT+  VRR TFLD+ CDALAEY YVG NQRADL +ACR+RE
Sbjct  79   NFVKKDGRS--VPFELYKRRTSAFVRRETFLDIACDALAEYKYVGPNQRADLVLACRIRE  136

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF +EKENPLLWASTY
Sbjct  137  RKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFANEKENPLLWASTY  196

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQ--EGNASTFKLIS  715
            HAGE LDP+AVAEAKA+RKAKKLAG S  V ++D    H +     +  E ++   +L+S
Sbjct  197  HAGECLDPVAVAEAKARRKAKKLAGVSHSVSKEDVTEGHNSSKSDVRTLEMSSGPTELLS  256

Query  716  PKQMAI  733
            PKQMAI
Sbjct  257  PKQMAI  262



>gb|KHN38732.1| Hypothetical protein glysoja_008281 [Glycine soja]
Length=704

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 190/247 (77%), Gaps = 17/247 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVFE+ R     E+S  +    LE + L+ F     + F  
Sbjct  30   QSTLQLMGCKARHAFKISQRVFEQTRK----ENSTDILK--LEVEALSGF-----DAFKK  78

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            +  K+D RS  +PFELYK+RT+  VRR TFLD+ CDALAEY YVG NQRADL +ACR+RE
Sbjct  79   NFVKKDGRS--VPFELYKRRTSAFVRRETFLDIACDALAEYKYVGPNQRADLVLACRIRE  136

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF +EKENPLLWASTY
Sbjct  137  RKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFANEKENPLLWASTY  196

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQ---EGNASTFKLI  712
            HAGE LDP+AVAEAKA+RKAKKLAG S  V ++D    H +  K+     E ++   +L+
Sbjct  197  HAGECLDPVAVAEAKARRKAKKLAGVSHSVSKEDVTEGHNS-SKFDVRTLEMSSGPTELL  255

Query  713  SPKQMAI  733
            SPKQMAI
Sbjct  256  SPKQMAI  262



>ref|XP_006591125.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Glycine max]
Length=723

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 159/246 (65%), Positives = 189/246 (77%), Gaps = 15/246 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVFE+ R     E+S  +    LE + L+ F     + F  
Sbjct  30   QSTLQLMGCKARHAFKISQRVFEQTRK----ENSTDILK--LEVEALSGF-----DAFKK  78

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            +  K+D RS  +PFELYK+RT+  VRR TFLD+ CDALAEY YVG NQRADL +ACR+RE
Sbjct  79   NFVKKDGRS--VPFELYKRRTSAFVRRETFLDIACDALAEYKYVGPNQRADLVLACRIRE  136

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF +EKENPLLWASTY
Sbjct  137  RKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFANEKENPLLWASTY  196

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQ--EGNASTFKLIS  715
            HAGE LDP+AVAEAKA+RKAKKLAG S  V ++D    H +     +  E ++   +L+S
Sbjct  197  HAGECLDPVAVAEAKARRKAKKLAGVSHSVSKEDVTEGHNSSKSDVRTLEMSSGPTELLS  256

Query  716  PKQMAI  733
            PKQMAI
Sbjct  257  PKQMAI  262



>ref|XP_010253954.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Nelumbo nucifera]
 ref|XP_010253955.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Nelumbo nucifera]
 ref|XP_010253956.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Nelumbo nucifera]
Length=735

 Score =   273 bits (699),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 158/255 (62%), Positives = 186/255 (73%), Gaps = 12/255 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE +R+ C+G++  SV  E    D L  + E++    A 
Sbjct  35   QSTLQLMGCKARHAFKISRRVFEVMRSECSGDALSSVGMEIAGLDVLEGYSEKENGQRAG  94

Query  182  S-LDK----------QDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQR  328
              LDK          +DD   S PFELYK++TT+ V+R TFL+V+CD+LA Y YVG NQR
Sbjct  95   GFLDKGTVDNHLVSEKDDGYNSKPFELYKRQTTLFVKRETFLNVVCDSLALYKYVGPNQR  154

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
            ADL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE
Sbjct  155  ADLLLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  214

Query  509  KENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEG  688
            K+NPLLWASTYHAGE LDP+AVA A +KRKA+KLA  S     KD  +N         + 
Sbjct  215  KQNPLLWASTYHAGEFLDPVAVAVANSKRKARKLAHVSYS-QSKDEISNGTGPDTRTPDV  273

Query  689  NASTFKLISPKQMAI  733
              ST +LI  KQM I
Sbjct  274  GPSTTELIGTKQMVI  288



>gb|KHM98923.1| Hypothetical protein glysoja_043335 [Glycine soja]
Length=716

 Score =   270 bits (691),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 186/246 (76%), Gaps = 15/246 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVFE  R     E+S  V    +E  +       D++ F  
Sbjct  42   QSTLQLMGCKARHAFKISQRVFELTRK----ENSTDVLKPEVEALS-------DFDVFKR  90

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            +  K+D   KS+PFELYK+RT+  VRR  FLD+ CDALAEY YVG NQRADL +ACR+RE
Sbjct  91   NFVKRD--GKSVPFELYKRRTSAFVRREIFLDIACDALAEYKYVGPNQRADLVLACRIRE  148

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF +EKENPLLWASTY
Sbjct  149  RKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFANEKENPLLWASTY  208

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQ--EGNASTFKLIS  715
            HAGE LDP+AVAEAKA+RKAKKLAG S  V ++D    H +     +  E ++   +L+S
Sbjct  209  HAGECLDPVAVAEAKARRKAKKLAGVSHLVSKEDVTEGHNSSKSDIRTLETSSGPTELLS  268

Query  716  PKQMAI  733
            PKQMAI
Sbjct  269  PKQMAI  274



>ref|XP_003539779.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Glycine max]
Length=704

 Score =   270 bits (691),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 186/246 (76%), Gaps = 15/246 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVFE  R     E+S  V    +E  +       D++ F  
Sbjct  30   QSTLQLMGCKARHAFKISQRVFELTRK----ENSTDVLKPEVEALS-------DFDVFKR  78

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            +  K+D   KS+PFELYK+RT+  VRR  FLD+ CDALAEY YVG NQRADL +ACR+RE
Sbjct  79   NFVKRD--GKSVPFELYKRRTSAFVRREIFLDIACDALAEYKYVGPNQRADLVLACRIRE  136

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF +EKENPLLWASTY
Sbjct  137  RKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFANEKENPLLWASTY  196

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQ--EGNASTFKLIS  715
            HAGE LDP+AVAEAKA+RKAKKLAG S  V ++D    H +     +  E ++   +L+S
Sbjct  197  HAGECLDPVAVAEAKARRKAKKLAGVSHLVSKEDVTEGHNSSKSDIRTLETSSGPTELLS  256

Query  716  PKQMAI  733
            PKQMAI
Sbjct  257  PKQMAI  262



>emb|CDX99167.1| BnaA06g18580D [Brassica napus]
Length=714

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 182/245 (74%), Gaps = 17/245 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE IR       S   C  + E      F ++     A 
Sbjct  29   QSTLQLMGCKARHAFKISRRVFELIR-------SEGSCNSSPEHGKEPEFSKKAGGGSAY  81

Query  182  SLDKQD-DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
             L   D D+ KS PFE+YK+RTTV V R  FLDV+CDALAEY YVG +QRADL +ACR+R
Sbjct  82   CLVADDVDKDKSKPFEMYKRRTTVFVTRQIFLDVVCDALAEYKYVGRDQRADLILACRIR  141

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+NPLLWAST
Sbjct  142  ERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLWAST  201

Query  539  YHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLISP  718
            YHAGE+LDP+AVAE+KAKRKAKKL G S  V   +S    M  G      N+ST +L+S 
Sbjct  202  YHAGEYLDPVAVAESKAKRKAKKLKG-SRGV---NSNTQKMDAG-----SNSSTTELLSD  252

Query  719  KQMAI  733
            KQMAI
Sbjct  253  KQMAI  257



>ref|XP_002534208.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28172.1| conserved hypothetical protein [Ricinus communis]
Length=716

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 191/249 (77%), Gaps = 21/249 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVFE +R+    ESS       LE   ++  +  ++  F+ 
Sbjct  35   QSTLQLMGCKARHAFKISQRVFELMRS----ESSSDALLPKLEVTGVDISKGNEWKEFS-  89

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                    +KS+PFELYK+RTTV+VRR  FL+V+C++L EY YVG NQRADL +ACR+RE
Sbjct  90   --------TKSLPFELYKRRTTVIVRREAFLNVVCESLTEYKYVGPNQRADLVLACRIRE  141

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+NPLLWASTY
Sbjct  142  RKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTY  201

Query  542  HAGEHLDPLavaeakakrkakklaGYSTP-VPQKDSAANHMTIGK----YPQEGNASTFK  706
            HAGE+LDP+AVAEAKAK+KAKKLA  S P    KD   +  T+ K     P  G++ T +
Sbjct  202  HAGEYLDPVAVAEAKAKKKAKKLA--SIPNARHKDEEYDGSTMVKADSQAPDMGSSIT-E  258

Query  707  LISPKQMAI  733
            LISPKQMA+
Sbjct  259  LISPKQMAV  267



>ref|XP_009150092.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
[Brassica rapa]
Length=713

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 182/245 (74%), Gaps = 17/245 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE IR       S   C  + E      F ++     A 
Sbjct  29   QSTLQLMGCKARHAFKISRRVFELIR-------SEGSCNSSPEHGKEPEFSKKAGAGSAY  81

Query  182  SLDKQD-DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
             L   D D+ KS PFE+YK+RTTV V R  FLDV+CDALAEY YVG +QRADL +ACR+R
Sbjct  82   CLVADDVDKDKSKPFEMYKRRTTVFVTRQIFLDVVCDALAEYKYVGRDQRADLILACRIR  141

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+NPLLWAST
Sbjct  142  ERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLWAST  201

Query  539  YHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLISP  718
            YHAGE+LDP+AVAE+KAKRKAKKL G S  V   +S    M  G      N+ST +L+S 
Sbjct  202  YHAGEYLDPVAVAESKAKRKAKKLKG-SRGV---NSNTQKMDAG-----SNSSTTELLSD  252

Query  719  KQMAI  733
            KQMAI
Sbjct  253  KQMAI  257



>ref|XP_004506048.1| PREDICTED: uncharacterized protein LOC101503547 [Cicer arietinum]
Length=763

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 161/261 (62%), Positives = 194/261 (74%), Gaps = 21/261 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIR-----NVCAGESSVSVCTETLEQDNLNTFQEED-  163
            QSTLQLMGCK+RHAFKIS+RVFE+ R     +    +++VS   + L++   N  ++E  
Sbjct  54   QSTLQLMGCKARHAFKISQRVFERTRSQSFADTLQPDAAVSSGLDALKR---NFVKKEGC  110

Query  164  --------YNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGL  319
                     +    SL  +D+RSKSIPFELYK+RT+V V R TFL+++CDALAEY YVG 
Sbjct  111  HAGVCLGRVDLGNQSLLGKDNRSKSIPFELYKRRTSVFVWRETFLEIVCDALAEYKYVGP  170

Query  320  NQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSF  499
            NQRADL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF
Sbjct  171  NQRADLILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSF  230

Query  500  VDEKENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP  679
             DEKENPLLWASTYHAGE LDP+AVA+AKA+RKAKK+AG S  +  KD   N    GK  
Sbjct  231  ADEKENPLLWASTYHAGECLDPVAVAKAKARRKAKKMAGVSHSL-TKDEVINGHNAGKSD  289

Query  680  ---QEGNASTFKLISPKQMAI  733
                E ++S  +  SPKQMAI
Sbjct  290  IRTSETSSSATEHPSPKQMAI  310



>ref|XP_010514847.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Camelina sativa]
Length=709

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 183/249 (73%), Gaps = 19/249 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTE-----TLEQDNLNTFQEEDY  166
            QSTLQLMGCK+RHAFKISRRVFE IR+    E S S   E        ++N  +   E  
Sbjct  35   QSTLQLMGCKARHAFKISRRVFELIRS----EGSCSTSPEHGKEPKFAKENGGSTCVEKL  90

Query  167  NYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIA  346
            N   A  D   D++KS PFE+YK+RTTVVV R  FLDV+CDALAEY YVG +QRADL +A
Sbjct  91   NRLVAD-DVDVDKNKSKPFEMYKRRTTVVVSREIFLDVVCDALAEYKYVGRDQRADLILA  149

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
            CR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+NPLL
Sbjct  150  CRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNPLL  209

Query  527  WASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFK  706
            WASTYHAGE LDP+AVAE+KAKRKAKKL G            N  T+ K     N+ST  
Sbjct  210  WASTYHAGECLDPVAVAESKAKRKAKKLKG--------SRGVNSNTL-KTDAGSNSSTND  260

Query  707  LISPKQMAI  733
            L+S KQMA+
Sbjct  261  LLSDKQMAV  269



>ref|XP_010503159.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Camelina sativa]
Length=710

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 183/249 (73%), Gaps = 19/249 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTE-----TLEQDNLNTFQEEDY  166
            QSTLQLMGCK+RHAFKISRRVFE IR+    E S S   E        ++N  +   E  
Sbjct  36   QSTLQLMGCKARHAFKISRRVFELIRS----EGSCSTSPEHGKEPKFAKENGGSTCVEKL  91

Query  167  NYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIA  346
            N   A  D   D++KS PFE+YK+RTTVVV R  FLDV+CDALAEY YVG +QRADL +A
Sbjct  92   NRLVAD-DVDVDKNKSKPFEMYKRRTTVVVSREIFLDVVCDALAEYKYVGRDQRADLILA  150

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
            CR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+NPLL
Sbjct  151  CRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNPLL  210

Query  527  WASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFK  706
            WASTYHAGE LDP+AVAE+KAKRKAKKL G            N  T+ K     N+ST  
Sbjct  211  WASTYHAGECLDPVAVAESKAKRKAKKLKG--------SRGVNSNTL-KTDAGSNSSTND  261

Query  707  LISPKQMAI  733
            L+S KQMA+
Sbjct  262  LLSDKQMAV  270



>gb|KHG19068.1| hypothetical protein F383_04916 [Gossypium arboreum]
Length=584

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 191/255 (75%), Gaps = 11/255 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNL--NTFQEEDY--N  169
            Q TLQLMGCK+RHAFKIS+R FE I    +  S +   ++TL  D L  NT +E+ +  N
Sbjct  33   QGTLQLMGCKARHAFKISQRTFELITRKSSYNSLLQEGSKTLNSDGLKGNTKKEDIHPTN  92

Query  170  YF---AAS--LDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
            ++   A S  +  +D R KSIPFELYK+RT++VV R  FLDV+C AL EY YVG ++RAD
Sbjct  93   FYRTEAGSCLVSGEDTRDKSIPFELYKRRTSIVVTRKCFLDVVCQALYEYKYVGPSERAD  152

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
            L +ACR+RER+ESITVLLCGTSGCGKSTLSALL SRLG+TTVISTDSIRHMMRSFVDEKE
Sbjct  153  LILACRIRERKESITVLLCGTSGCGKSTLSALLASRLGVTTVISTDSIRHMMRSFVDEKE  212

Query  515  NPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSA--ANHMTIGKYPQEG  688
            NPLLWASTYHAGE LDP+AVA+AKAK+KAKKLAG +   P+ + A  ++       P E 
Sbjct  213  NPLLWASTYHAGECLDPVAVAQAKAKKKAKKLAGTAQSFPKGERADGSSASKCDAQPMES  272

Query  689  NASTFKLISPKQMAI  733
             +   +LI PKQ+A+
Sbjct  273  GSICTELIGPKQIAV  287



>gb|KHG22570.1| hypothetical protein F383_07390 [Gossypium arboreum]
Length=598

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 191/255 (75%), Gaps = 11/255 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNL--NTFQEEDY--N  169
            Q TLQLMGCK+RHAFKIS+R FE I    +  S +   ++TL  D L  NT +E+ +  N
Sbjct  33   QGTLQLMGCKARHAFKISQRTFELITRKSSYNSLLQEGSKTLNSDGLKGNTKKEDIHPTN  92

Query  170  YF---AAS--LDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
            ++   A S  +  +D R KSIPFELYK+RT++VV R  FLDV+C AL EY YVG ++RAD
Sbjct  93   FYRTEAGSCLVSGEDTRDKSIPFELYKRRTSIVVTRKCFLDVVCQALYEYKYVGPSERAD  152

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
            L +ACR+RER+ESITVLLCGTSGCGKSTLSALL SRLG+TTVISTDSIRHMMRSFVDEKE
Sbjct  153  LILACRIRERKESITVLLCGTSGCGKSTLSALLASRLGVTTVISTDSIRHMMRSFVDEKE  212

Query  515  NPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSA--ANHMTIGKYPQEG  688
            NPLLWASTYHAGE LDP+AVA+AKAK+KAKKLAG +   P+ + A  ++       P E 
Sbjct  213  NPLLWASTYHAGECLDPVAVAQAKAKKKAKKLAGTAQSFPKGERADGSSASKCDAQPMES  272

Query  689  NASTFKLISPKQMAI  733
             +   +LI PKQ+A+
Sbjct  273  GSICTELIGPKQIAV  287



>ref|XP_010456724.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Camelina sativa]
 ref|XP_010456727.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Camelina sativa]
 ref|XP_010456731.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Camelina sativa]
Length=715

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 189/256 (74%), Gaps = 25/256 (10%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCA-------GESSV-SVCTETLEQDNLNTFQE  157
            QSTLQLMGCK+RHAFKISRRVFE IR+  +       G+ SV    ++ +    +N+   
Sbjct  42   QSTLQLMGCKARHAFKISRRVFELIRSEGSLILSPSHGKCSVFDKTSDDVATSAVNSLAT  101

Query  158  EDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
            +D           DD+SKS PFE+YK+RTTVVV R  F++V+CDALAEY YVG +QRADL
Sbjct  102  DD-----------DDKSKSKPFEMYKRRTTVVVSREIFVNVVCDALAEYKYVGHDQRADL  150

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKEN  517
             +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK+N
Sbjct  151  ILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQN  210

Query  518  PLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNA-  694
            PLLWASTYHAGE+LDP+AVAE+KAK++  K    +    +K +A+  +      Q+ +A 
Sbjct  211  PLLWASTYHAGEYLDPVAVAESKAKKRRAKKLDDTE--DEKVNASEGVKANNNTQQTDAV  268

Query  695  ---STFKLISPKQMAI  733
               +T  L+SPKQMA+
Sbjct  269  SKSTTPVLLSPKQMAV  284



>ref|XP_010496750.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Camelina sativa]
Length=707

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 185/251 (74%), Gaps = 25/251 (10%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE IR       S   C+ + E      F +E  N  + 
Sbjct  35   QSTLQLMGCKARHAFKISRRVFELIR-------SEGSCSTSPEHGKEPKFAKE--NGGST  85

Query  182  SLDKQD-------DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLT  340
             ++K +       D++KS PFE+YK+RTTVVV R  FLDV+CDALAEY YVG +QRADL 
Sbjct  86   CVEKLNCLVADDVDKNKSKPFEMYKRRTTVVVSREIFLDVVCDALAEYKYVGRDQRADLI  145

Query  341  IACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENP  520
            +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+NP
Sbjct  146  LACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNP  205

Query  521  LLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAST  700
            LLWASTYHAGE LDP+AVAE+KAKRKAKKL G            N  T+ K     N+ST
Sbjct  206  LLWASTYHAGECLDPVAVAESKAKRKAKKLKG--------SRGVNSNTL-KTDAGSNSST  256

Query  701  FKLISPKQMAI  733
             +L+S KQMA+
Sbjct  257  TELLSDKQMAV  267



>gb|KEH39377.1| 2-phosphoglycerate kinase [Medicago truncatula]
Length=736

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 158/261 (61%), Positives = 192/261 (74%), Gaps = 22/261 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQ---EEDYNY  172
            QSTLQLMGCK+RHAFKISRRVFE  R   +G S+ +  +E +     +  +   ++D   
Sbjct  33   QSTLQLMGCKARHAFKISRRVFELTR---SGSSTDAFKSEGIVLSGFDASKGNVKKDCQE  89

Query  173  FAAS----------LDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLN  322
             +A           L  +D+ SKS+PFELYK+RTTV VRR TFLD++CD LAEY YVG N
Sbjct  90   ASACSRKTDVGNHLLSGKDNGSKSVPFELYKRRTTVFVRRETFLDIVCDVLAEYKYVGPN  149

Query  323  QRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFV  502
            QRADL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMR F 
Sbjct  150  QRADLMLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRGFA  209

Query  503  DEKENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP-  679
            +EKENPLLWASTYHAGE LDP+AVAEAKAKR+AKK+AG S  +P+ +    H T  K+  
Sbjct  210  NEKENPLLWASTYHAGECLDPVAVAEAKAKRRAKKMAGVSQSLPKDEVTEGH-TSSKFDI  268

Query  680  ---QEGNASTFKLISPKQMAI  733
               + G  +T +L S KQMA+
Sbjct  269  HTLEAGCGATERLNS-KQMAV  288



>ref|XP_006827415.1| hypothetical protein AMTR_s00009p00066600 [Amborella trichopoda]
 gb|ERM94831.1| hypothetical protein AMTR_s00009p00066600 [Amborella trichopoda]
Length=752

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 156/256 (61%), Positives = 189/256 (74%), Gaps = 14/256 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQ MGCK+RHAFKIS+RVFE +R+  +  +  S   + L   +      E ++  ++
Sbjct  41   QSTLQSMGCKARHAFKISKRVFEIMRSEFSSNNLFSDKEDILRASDSERSSCEGFSTRSS  100

Query  182  S---------LDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
            +         + KQ D+  ++PFELYK RTTVVV R TFLDV+CDAL+EY YVG NQRAD
Sbjct  101  TGPAEVDEPLIRKQADKINNLPFELYKSRTTVVVSRETFLDVVCDALSEYKYVGPNQRAD  160

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
            L +ACR+RER+ES+T+LLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE
Sbjct  161  LVLACRVRERKESVTILLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  220

Query  515  NPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQK---DSAANHMTIGKYPQE  685
            NPLLWASTYHAGE LDP+AVA+AKAKRKAKK+AG S  + ++   D +AN  +  K    
Sbjct  221  NPLLWASTYHAGECLDPMAVAKAKAKRKAKKMAGVSPSLSKEEISDGSANKKSESK--ST  278

Query  686  GNASTFKLISPKQMAI  733
              A   + I PKQMAI
Sbjct  279  DTAGGIEPIGPKQMAI  294



>ref|XP_008465362.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Cucumis melo]
Length=724

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 189/249 (76%), Gaps = 10/249 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRN----VCAGESSVSVCTETLEQDNLNTFQEEDYN  169
            QSTLQLMGCK+RHAFKIS+R FE +R     +  G  + S   E ++  ++   + E +N
Sbjct  34   QSTLQLMGCKARHAFKISQRAFELLRKRHDLLPEGLGTKSSEKECIKSWDVRFAEPEVWN  93

Query  170  YFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIAC  349
            +  +S   +D  +K+IPFE+YK+RTT+ V+R TFLDV+C ALAEY YV  NQRADL +AC
Sbjct  94   HLNSS---KDGGNKNIPFEMYKRRTTLSVKRATFLDVVCKALAEYKYVSPNQRADLILAC  150

Query  350  RLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLW  529
            R+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSF DEK+NPLLW
Sbjct  151  RIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFADEKQNPLLW  210

Query  530  ASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQ-KDSAANHMTIGKYPQEGNASTFK  706
            ASTYHAGE LDP+AVAEAK K+KAKKLAG   P    KD      +IGK+  + +  + +
Sbjct  211  ASTYHAGECLDPVAVAEAKLKKKAKKLAG--NPHSHLKDEVPESSSIGKFDGQPSDRSTE  268

Query  707  LISPKQMAI  733
            L+S KQMA+
Sbjct  269  LLSEKQMAV  277



>ref|XP_004151185.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Cucumis sativus]
Length=685

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 154/253 (61%), Positives = 182/253 (72%), Gaps = 22/253 (9%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK RHAFKIS+ VFE IR   + E+ +      L   +L    E D N +  
Sbjct  34   QSTLQLMGCKPRHAFKISKWVFELIRKEASTENFLPEERNILGSVSLGEKTETDGNRYYN  93

Query  182  SLD---------KQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
              D         ++ D + +IPFELYK+  T VV R  FLDVICD+LA+Y YVG NQRAD
Sbjct  94   CFDGKETFNQSPREGDNNNNIPFELYKRSRTAVVGRELFLDVICDSLAKYKYVGPNQRAD  153

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
            L +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+
Sbjct  154  LILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQ  213

Query  515  NPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNA  694
            NPLLW+STYHAGE LDP+AVAE+KA++KAKKLAG S    + ++A             NA
Sbjct  214  NPLLWSSTYHAGEFLDPVAVAESKARKKAKKLAGISHKHLKDETA-------------NA  260

Query  695  STFKLISPKQMAI  733
            +  +LISPKQMAI
Sbjct  261  NNLELISPKQMAI  273



>emb|CAB72147.1| putative protein [Arabidopsis thaliana]
Length=716

 Score =   266 bits (679),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 157/252 (62%), Positives = 181/252 (72%), Gaps = 26/252 (10%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEE-------  160
            QSTLQLMGCK+RHAFKISRRVFE IR       S   C  + E      F +E       
Sbjct  35   QSTLQLMGCKARHAFKISRRVFELIR-------SEGSCNTSPENGKEPEFAKEVGGSTCV  87

Query  161  -DYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
               N    + D   D++KS PFE+YK+RTTVVV R  F+DV+CDALAEY YVG +QRADL
Sbjct  88   EKLNCLVVAGDV--DKNKSKPFEMYKRRTTVVVSREIFVDVVCDALAEYKYVGRDQRADL  145

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKEN  517
             +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+N
Sbjct  146  ILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQN  205

Query  518  PLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAS  697
            PLLWASTYHAGE+LDP+AVAE+KAKRKAKKL G         S   +    K     N+S
Sbjct  206  PLLWASTYHAGEYLDPVAVAESKAKRKAKKLKG---------SRGVNSNAQKTDAGSNSS  256

Query  698  TFKLISPKQMAI  733
            T +L+S KQMAI
Sbjct  257  TTELLSHKQMAI  268



>ref|NP_566873.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 gb|AAL07147.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20312.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77991.1| uncharacterized protein AT3G45090 [Arabidopsis thaliana]
Length=717

 Score =   265 bits (678),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 157/252 (62%), Positives = 181/252 (72%), Gaps = 26/252 (10%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEE-------  160
            QSTLQLMGCK+RHAFKISRRVFE IR       S   C  + E      F +E       
Sbjct  36   QSTLQLMGCKARHAFKISRRVFELIR-------SEGSCNTSPENGKEPEFAKEVGGSTCV  88

Query  161  -DYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
               N    + D   D++KS PFE+YK+RTTVVV R  F+DV+CDALAEY YVG +QRADL
Sbjct  89   EKLNCLVVAGDV--DKNKSKPFEMYKRRTTVVVSREIFVDVVCDALAEYKYVGRDQRADL  146

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKEN  517
             +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+N
Sbjct  147  ILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQN  206

Query  518  PLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAS  697
            PLLWASTYHAGE+LDP+AVAE+KAKRKAKKL G         S   +    K     N+S
Sbjct  207  PLLWASTYHAGEYLDPVAVAESKAKRKAKKLKG---------SRGVNSNAQKTDAGSNSS  257

Query  698  TFKLISPKQMAI  733
            T +L+S KQMAI
Sbjct  258  TTELLSHKQMAI  269



>ref|XP_009120610.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
[Brassica rapa]
 emb|CDY50323.1| BnaA10g13560D [Brassica napus]
Length=725

 Score =   265 bits (678),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 160/204 (78%), Gaps = 25/204 (12%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCA-------GESSV--------SVCTETLEQD  136
            QSTLQLMGCK+RHAFKISRRVFE IR+  +       G+ SV        S C    + +
Sbjct  44   QSTLQLMGCKARHAFKISRRVFELIRSEGSLILSPSHGKESVFGKAVDAPSACDGVEKVN  103

Query  137  NLNTFQEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVG  316
             +N         F+A+ D  DD+SKS PFE+YKKRTTVVV R TF++V+CDALAEY YVG
Sbjct  104  KVN---------FSATND-ADDKSKSKPFEMYKKRTTVVVLRETFVNVVCDALAEYKYVG  153

Query  317  LNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRS  496
             +QRADL +AC++RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRS
Sbjct  154  HDQRADLILACKIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRS  213

Query  497  FVDEKENPLLWASTYHAGEHLDPL  568
            FVDEK++PLLWASTYHAGE+LDP+
Sbjct  214  FVDEKQDPLLWASTYHAGEYLDPV  237



>emb|CDY26985.1| BnaC09g35980D [Brassica napus]
Length=705

 Score =   265 bits (676),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 154/189 (81%), Gaps = 15/189 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRR FE IR       + S C    + + +N         F+A
Sbjct  44   QSTLQLMGCKARHAFKISRRAFELIRI-----DAPSACDGVEKVNKVN---------FSA  89

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            + D  DD+S+S PFE+YKKRTTVVV R TF++V+CDALAEY YVG +QRADL +AC++RE
Sbjct  90   TND-ADDKSRSKPFEMYKKRTTVVVLRETFVNVVCDALAEYKYVGHDQRADLILACKIRE  148

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK++PLLWASTY
Sbjct  149  RKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQDPLLWASTY  208

Query  542  HAGEHLDPL  568
            HAGE+LDPL
Sbjct  209  HAGEYLDPL  217



>ref|XP_011089938.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Sesamum indicum]
Length=750

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 183/252 (73%), Gaps = 10/252 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVFE +R+        S       +D     Q E      A
Sbjct  42   QSTLQLMGCKARHAFKISQRVFEIMRSESFMVKMASDSVNVPPKDAKIYPQRETECCTHA  101

Query  182  SLDKQD--------DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
            SLD+          D++K+  FELYK+ TTV+V R  FLDV+CDAL+EY YVG NQRADL
Sbjct  102  SLDEAGIDNLSRGADKTKTRTFELYKRLTTVIVGRTPFLDVVCDALSEYKYVGPNQRADL  161

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKEN  517
             +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFV E++N
Sbjct  162  VLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVGEEQN  221

Query  518  PLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAS  697
            PLLWASTYHAGEHLDP+AVA AKAK+KA K AG S     KD   ++ T GK   +G+++
Sbjct  222  PLLWASTYHAGEHLDPVAVAAAKAKKKANKSAGVSAASLAKDEVVSNSTYGK--SDGSST  279

Query  698  TFKLISPKQMAI  733
            T  L S KQMAI
Sbjct  280  TSDLPSLKQMAI  291



>ref|XP_011089937.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Sesamum indicum]
Length=753

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 183/252 (73%), Gaps = 10/252 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVFE +R+        S       +D     Q E      A
Sbjct  42   QSTLQLMGCKARHAFKISQRVFEIMRSESFMVKMASDSVNVPPKDAKIYPQRETECCTHA  101

Query  182  SLDKQD--------DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
            SLD+          D++K+  FELYK+ TTV+V R  FLDV+CDAL+EY YVG NQRADL
Sbjct  102  SLDEAGIDNLSRGADKTKTRTFELYKRLTTVIVGRTPFLDVVCDALSEYKYVGPNQRADL  161

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKEN  517
             +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFV E++N
Sbjct  162  VLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVGEEQN  221

Query  518  PLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAS  697
            PLLWASTYHAGEHLDP+AVA AKAK+KA K AG S     KD   ++ T GK   +G+++
Sbjct  222  PLLWASTYHAGEHLDPVAVAAAKAKKKANKSAGVSAASLAKDEVVSNSTYGK--SDGSST  279

Query  698  TFKLISPKQMAI  733
            T  L S KQMAI
Sbjct  280  TSDLPSLKQMAI  291



>emb|CDY53124.1| BnaC03g74690D [Brassica napus]
Length=717

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 182/248 (73%), Gaps = 20/248 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE IR       S   C  + E      F ++       
Sbjct  29   QSTLQLMGCKARHAFKISRRVFELIR-------SEGSCNSSPEHGKEPEFSKKGGGGGGG  81

Query  182  S---LDKQD-DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIAC  349
            S   L   D D+ KS PFE+YK+RTTV V R  FLDV+CD+LAEY YVG +QRADL +AC
Sbjct  82   STHCLVADDVDKDKSKPFEMYKRRTTVFVTRQIFLDVVCDSLAEYKYVGRDQRADLILAC  141

Query  350  RLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLW  529
            R+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+NPLLW
Sbjct  142  RIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLW  201

Query  530  ASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKL  709
            ASTYHAGE+LDP+AVAE+KAKRKAKKL G S  V   +S    M  G      N+ST +L
Sbjct  202  ASTYHAGEYLDPVAVAESKAKRKAKKLKG-SRGV---NSNTQKMDAG-----SNSSTTEL  252

Query  710  ISPKQMAI  733
            +S KQMAI
Sbjct  253  LSDKQMAI  260



>ref|XP_002864701.1| hypothetical protein ARALYDRAFT_496224 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40960.1| hypothetical protein ARALYDRAFT_496224 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/255 (60%), Positives = 185/255 (73%), Gaps = 14/255 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE IR+  +   S S+     E+   + FQ+       A
Sbjct  43   QSTLQLMGCKARHAFKISRRVFELIRSEGSLILSPSLSPTHSEE---SEFQKRGDTSACA  99

Query  182  SLDKQD----------DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRA  331
            +++K +          D+SKS PFE+YK+RTTVVV R  F++V+CDALAEY YVG +QRA
Sbjct  100  NVEKANKVNSLATDDVDKSKSKPFEVYKRRTTVVVSRDIFVNVVCDALAEYKYVGHDQRA  159

Query  332  DLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK  511
            DL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK
Sbjct  160  DLILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEK  219

Query  512  ENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGN  691
            +NPLLWASTYHAGE+LDP+AVAE+KAKR+  K          K S        +    G+
Sbjct  220  QNPLLWASTYHAGEYLDPVAVAESKAKRRRAKRLDSIENEKAKASEGVKANNTQQTDVGS  279

Query  692  ASTFK-LISPKQMAI  733
             ST   L+SPKQMA+
Sbjct  280  KSTTPVLLSPKQMAV  294



>ref|XP_002877383.1| hypothetical protein ARALYDRAFT_323187 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53642.1| hypothetical protein ARALYDRAFT_323187 [Arabidopsis lyrata subsp. 
lyrata]
Length=718

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 182/245 (74%), Gaps = 11/245 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTET-LEQDNLNTFQEEDYNYFA  178
            QSTLQLMGCK+RHA KISRRVFE IR+  +  SS     ET   ++   +   E  N   
Sbjct  37   QSTLQLMGCKARHACKISRRVFELIRSEGSCNSSPENGKETEFTKEVGGSTCVEKLNCLV  96

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
            A  D   D++KS PFE+YK+RTTVVV R  FLDV+CDALAEY YVG +QRADL +ACR+R
Sbjct  97   AD-DVDVDKNKSKPFEMYKRRTTVVVSREIFLDVVCDALAEYKYVGRDQRADLILACRIR  155

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+NPLLWAST
Sbjct  156  ERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLWAST  215

Query  539  YHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLISP  718
            YHAGE+LDP+AVAE+KAKRKAKKL G         S   +    K     N+ T +L+S 
Sbjct  216  YHAGEYLDPVAVAESKAKRKAKKLKG---------SRGVNSNTQKTDAGSNSGTTELLSH  266

Query  719  KQMAI  733
            KQMAI
Sbjct  267  KQMAI  271



>gb|KDP44001.1| hypothetical protein JCGZ_05468 [Jatropha curcas]
Length=710

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 184/247 (74%), Gaps = 20/247 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVFE +R+    ++ +    E +                 A
Sbjct  34   QSTLQLMGCKARHAFKISQRVFELMRSESFNDALLWKEGEAI----------------GA  77

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
              +  +  S S  FELYK+RTTV+VRR TF+ V+CD+L EY YVG NQRADL +ACR+RE
Sbjct  78   ESEWTNTTSNSPTFELYKRRTTVIVRRETFIKVVCDSLTEYKYVGPNQRADLVLACRIRE  137

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+NPLLWASTY
Sbjct  138  RKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTY  197

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQK---DSAANHMTIGKYPQEGNASTFKLI  712
            HAGE LDP+AVAEAKAK++AKKLAG +   P+    DS+    +  + P  G+ +T +LI
Sbjct  198  HAGEFLDPVAVAEAKAKKQAKKLAGIANSRPKDELTDSSTTVKSDSQSPDVGSGTT-ELI  256

Query  713  SPKQMAI  733
            SPKQMAI
Sbjct  257  SPKQMAI  263



>ref|XP_006400815.1| hypothetical protein EUTSA_v10012777mg [Eutrema salsugineum]
 gb|ESQ42268.1| hypothetical protein EUTSA_v10012777mg [Eutrema salsugineum]
Length=737

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/252 (60%), Positives = 187/252 (74%), Gaps = 8/252 (3%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQE----EDYN  169
            QSTLQLMGCK+RHAFKISRRVFE IR+  +   S S   E++ +   +        + +N
Sbjct  42   QSTLQLMGCKARHAFKISRRVFELIRSEGSLILSPSHGKESVFEKTGDPASACAGVQKFN  101

Query  170  YFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIAC  349
                S     D+SKS PFE+YK+RTTVVV R  F++V+CDALAEY YVG +QRADL +AC
Sbjct  102  KANCSATDDVDKSKSKPFEMYKRRTTVVVSREVFVNVVCDALAEYKYVGHDQRADLILAC  161

Query  350  RLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLW  529
            ++RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK++PLLW
Sbjct  162  KIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQDPLLW  221

Query  530  ASTYHAGEHLDPLavaeakakrkakkl-aGYSTPV--PQKDSAANHMTIGKYPQEGNAST  700
            ASTYHAGE+LDP+AVAE+KA+R+  K    Y   +   +K +A+   T  +    G+ ST
Sbjct  222  ASTYHAGEYLDPVAVAESKARRRRAKKLDAYENSILDDEKANASEKSTSSQQTDVGSKST  281

Query  701  FK-LISPKQMAI  733
               L+SPKQMA+
Sbjct  282  APVLLSPKQMAV  293



>gb|KFK27601.1| hypothetical protein AALP_AA8G404800 [Arabis alpina]
Length=735

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 152/255 (60%), Positives = 186/255 (73%), Gaps = 23/255 (9%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE IR+    E S+ +          +  +E +++    
Sbjct  44   QSTLQLMGCKARHAFKISRRVFELIRS----EGSLILSP--------SHRKESEFDNSCD  91

Query  182  SLDK-----QDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIA  346
            +++K      DD  KS PFE+YK+RTTVVV R  FL+V+CDALAEY YVG +QRADL +A
Sbjct  92   AVEKLNKVNNDDVDKSKPFEMYKRRTTVVVSREIFLNVVCDALAEYKYVGHDQRADLILA  151

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
            C++RER+E +TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK+NPLL
Sbjct  152  CKIRERKECVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQNPLL  211

Query  527  WASTYHAGEHLDPLavaeakakrkakkla-GYSTPV--PQKDSAANHMTIGKYPQEGNAS  697
            WASTYHAGE+LDP+AVAE+KAKR+  K   GY   +   +K +A   +      Q  N S
Sbjct  212  WASTYHAGEYLDPVAVAESKAKRRRAKKMDGYEKSILEEEKANAFEGVKSSNTQQADNGS  271

Query  698  ---TFKLISPKQMAI  733
               T  L+SPKQMA+
Sbjct  272  KSTTPTLLSPKQMAV  286



>gb|KEH30009.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=738

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 182/246 (74%), Gaps = 14/246 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQ+MGCK+RHAFKI +RVFE     C    S    T+ L+ D   + +    +    
Sbjct  50   QSTLQIMGCKARHAFKICKRVFE-----CTKSKST---TDLLQPDAAISLE----DLGNQ  97

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            SL  +D + KSIPFELYK+RT+V VRR TFLD++CDALAEY Y+G NQRADL +ACRLRE
Sbjct  98   SLLSKDSKIKSIPFELYKRRTSVFVRRETFLDIVCDALAEYKYLGPNQRADLVLACRLRE  157

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            ++ES+TVLLCGTSGCGKSTLSA+LGSRLGITTV+STDSIRHMMRSF  EKENPLLWASTY
Sbjct  158  KKESVTVLLCGTSGCGKSTLSAILGSRLGITTVVSTDSIRHMMRSFASEKENPLLWASTY  217

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDS--AANHMTIGKYPQEGNASTFKLIS  715
            HAGE LDP+AVAEAKAK+KAKK+AG S  +P+ +S    N         E  +   +  S
Sbjct  218  HAGECLDPVAVAEAKAKKKAKKMAGVSQSLPKDESTDGQNSSKPDTRTSETGSCATEHPS  277

Query  716  PKQMAI  733
            PKQMAI
Sbjct  278  PKQMAI  283



>ref|NP_200884.2| phytic acid metabolising protein [Arabidopsis thaliana]
 dbj|BAB10097.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO22756.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42372.1| unknown protein [Arabidopsis thaliana]
 gb|AED97374.1| phytic acid metabolising protein [Arabidopsis thaliana]
Length=738

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 183/266 (69%), Gaps = 36/266 (14%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCA------------------GESSVSVCTETL  127
            QSTLQLMGCK+RHAFKISRRVFE IR+  +                       S C    
Sbjct  42   QSTLQLMGCKARHAFKISRRVFELIRSEGSLILSPSLSPSHSKESEFQKTGDASACANVE  101

Query  128  EQDNLNTFQEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYN  307
            + + +N+   +D            D+SKS PFE+YK+RTTVVV R  F++V+CDALAEY 
Sbjct  102  KANKVNSLATDDV-----------DKSKSKPFEVYKRRTTVVVSREIFVNVVCDALAEYK  150

Query  308  YVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHM  487
            YVG +QRADL ++CR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHM
Sbjct  151  YVGHDQRADLILSCRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHM  210

Query  488  MRSFVDEKENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTI  667
            MRSFVDEK+NPLLWASTYHAGE+LDP+AVAE+KA+R+  K       +  + + A+    
Sbjct  211  MRSFVDEKQNPLLWASTYHAGEYLDPVAVAESKARRRRAKKMD---SIEDEKAKASEGGK  267

Query  668  GKYPQEGNASTFK----LISPKQMAI  733
             K  Q+ +  + K    L+SPKQMA+
Sbjct  268  AKNTQQTDVGSTKNTPVLLSPKQMAV  293



>ref|XP_010443881.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Camelina sativa]
 ref|XP_010443882.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Camelina sativa]
Length=715

 Score =   263 bits (671),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 153/190 (81%), Gaps = 5/190 (3%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE IR+    E S+ +     +    +   ++       
Sbjct  42   QSTLQLMGCKARHAFKISRRVFELIRS----EGSLILSPSHGKGSVFDKTSDDAATSPVN  97

Query  182  SLDKQD-DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
            SL   D D+SKS PFE+YK+RTTVVV R  F++V+CDALAEY YVG +QRADL +ACR+R
Sbjct  98   SLATDDVDKSKSKPFEMYKRRTTVVVSREIFVNVVCDALAEYKYVGHDQRADLILACRIR  157

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK+NPLLWAST
Sbjct  158  ERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQNPLLWAST  217

Query  539  YHAGEHLDPL  568
            YHAGE+LDP+
Sbjct  218  YHAGEYLDPV  227



>ref|XP_010241850.1| PREDICTED: uncharacterized protein LOC104586348 isoform X2 [Nelumbo 
nucifera]
Length=698

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 188/258 (73%), Gaps = 15/258 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE +RN C+G++   +  E    D    + E++ +  + 
Sbjct  35   QSTLQLMGCKARHAFKISRRVFEVMRNECSGDALPFMGMEIAGLDVSEGYSEKESDQHSD  94

Query  182  SLDKQ-----------DDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQR  328
               KQ           ++ S S PFELYK++TTV V+R  FLDV+CDALA Y YVG N+R
Sbjct  95   GCLKQGEVGDDLVSEKNEGSYSKPFELYKRQTTVFVKREAFLDVVCDALALYKYVGPNKR  154

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
            +DL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFV+E
Sbjct  155  SDLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVNE  214

Query  509  KENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK---YP  679
            K+NPLLWASTYHAGE LDP AVAEAKAKRKAKKLA  S  +  KD  +     G+    P
Sbjct  215  KQNPLLWASTYHAGEFLDPEAVAEAKAKRKAKKLAHVSHSL-SKDEVSEGPGNGRPDTRP  273

Query  680  QEGNASTFKLISPKQMAI  733
             +  + T +LI  KQMAI
Sbjct  274  SDVGSCTNELIGAKQMAI  291



>ref|XP_006290667.1| hypothetical protein CARUB_v10016758mg [Capsella rubella]
 gb|EOA23565.1| hypothetical protein CARUB_v10016758mg [Capsella rubella]
Length=711

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 180/252 (71%), Gaps = 25/252 (10%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQE--------  157
            QSTLQLMGCK+RHAFKISRRVFE IR       S   C  + E+     F +        
Sbjct  35   QSTLQLMGCKARHAFKISRRVFELIR-------SEGSCNTSPERGKEPEFAKGVGGSACV  87

Query  158  EDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
            E  N      D   D++KS PFE+YK+RTTVVV R  FLDV+CDALAEY YVG +QRADL
Sbjct  88   EKLNCLVTG-DVDVDKNKSKPFEMYKRRTTVVVSREIFLDVVCDALAEYKYVGRDQRADL  146

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKEN  517
             +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+N
Sbjct  147  ILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQN  206

Query  518  PLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAS  697
            PLLWASTYHAGE LDP+AVAE+KAKRKAKKL G         S   +    K     N+S
Sbjct  207  PLLWASTYHAGECLDPVAVAESKAKRKAKKLKG---------SRGVNANTQKTDAGSNSS  257

Query  698  TFKLISPKQMAI  733
            T +L+S K+MA+
Sbjct  258  TTELLSHKKMAV  269



>gb|KGN64816.1| hypothetical protein Csa_1G111370 [Cucumis sativus]
Length=735

 Score =   263 bits (671),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 184/258 (71%), Gaps = 15/258 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK RHAFKIS+ VFE IR   + E+ +      L   +L    E D N +  
Sbjct  67   QSTLQLMGCKPRHAFKISKWVFELIRKEASTENFLPEERNILGSVSLGEKTETDGNRYYN  126

Query  182  SLD---------KQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
              D         ++ D + +IPFELYK+  T VV R  FLDVICD+LA+Y YVG NQRAD
Sbjct  127  CFDGKETFNQSPREGDNNNNIPFELYKRSRTAVVGRELFLDVICDSLAKYKYVGPNQRAD  186

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
            L +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+
Sbjct  187  LILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQ  246

Query  515  NPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTI--GKYPQEG  688
            NPLLW+STYHAGE LDP+AVAE+KA++KAKKLAG S     KD  AN +       P  G
Sbjct  247  NPLLWSSTYHAGEFLDPVAVAESKARKKAKKLAGISHK-HLKDETANGLISRNSDNPLIG  305

Query  689  N---ASTFKLISPKQMAI  733
                A+  +LISPKQMAI
Sbjct  306  PAKVANNLELISPKQMAI  323



>gb|KGN46861.1| hypothetical protein Csa_6G147540 [Cucumis sativus]
Length=723

 Score =   263 bits (671),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 187/249 (75%), Gaps = 10/249 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRN----VCAGESSVSVCTETLEQDNLNTFQEEDYN  169
            QSTLQLMGCK+RHAFKIS+R F  +R     +  G  + S   E ++  ++   + E +N
Sbjct  34   QSTLQLMGCKARHAFKISQRAFALLRKRHGLLPEGLGTRSSEKECVKSWDVRFAETEVWN  93

Query  170  YFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIAC  349
            +  +S   +D  +K+IPFE+YK+RTT+ V+R TFLDV+C AL EY YV  NQRADL +AC
Sbjct  94   HLNSS---KDGDNKNIPFEIYKRRTTLFVKRETFLDVVCKALTEYKYVSPNQRADLLLAC  150

Query  350  RLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLW  529
            R+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSF DEK+NPLLW
Sbjct  151  RIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFADEKQNPLLW  210

Query  530  ASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQ-KDSAANHMTIGKYPQEGNASTFK  706
            ASTYHAGE LDP+AVAEAK KRKAKKLAG   P    KD      +IGK+  + +  + +
Sbjct  211  ASTYHAGECLDPVAVAEAKVKRKAKKLAG--NPHSHLKDEVLESSSIGKFDGQPSDRSTE  268

Query  707  LISPKQMAI  733
            L+S KQMA+
Sbjct  269  LLSQKQMAV  277



>ref|XP_007132294.1| hypothetical protein PHAVU_011G082700g [Phaseolus vulgaris]
 ref|XP_007132295.1| hypothetical protein PHAVU_011G082700g [Phaseolus vulgaris]
 gb|ESW04288.1| hypothetical protein PHAVU_011G082700g [Phaseolus vulgaris]
 gb|ESW04289.1| hypothetical protein PHAVU_011G082700g [Phaseolus vulgaris]
Length=729

 Score =   263 bits (671),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 185/257 (72%), Gaps = 16/257 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIR-----NVCAGESSVSVCTETLEQDNLNTFQEEDY  166
            QSTLQLMGCK+RHAFKIS+RVFE  R     ++   E       +  + +NL   ++ D 
Sbjct  30   QSTLQLMGCKARHAFKISQRVFELTRKAHSTDILQPEVEALSGFDAFKGNNLK--KDGDA  87

Query  167  NYFAASLDKQ-----DDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRA  331
            +   A L  Q     D + KS+PFELYK+RT+  +RR  FLD++CDALAEY YVG NQRA
Sbjct  88   SLDIADLRNQLLSGKDYKIKSVPFELYKRRTSAFIRRENFLDIVCDALAEYKYVGPNQRA  147

Query  332  DLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK  511
            DL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLG RLGITTV+STDSIRHMMRSF +EK
Sbjct  148  DLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGGRLGITTVVSTDSIRHMMRSFANEK  207

Query  512  ENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP---Q  682
            ENPLLWASTYHAGE LDP+AVA AKA+RKAKKLAG S  +  KD A       K      
Sbjct  208  ENPLLWASTYHAGECLDPVAVAGAKARRKAKKLAGVSRSL-SKDEATEGNNSSKSDSRMS  266

Query  683  EGNASTFKLISPKQMAI  733
            E ++   +L+SPKQMAI
Sbjct  267  ETSSGPTELLSPKQMAI  283



>ref|XP_010241849.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
isoform X1 [Nelumbo nucifera]
Length=729

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 188/258 (73%), Gaps = 15/258 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE +RN C+G++   +  E    D    + E++ +  + 
Sbjct  35   QSTLQLMGCKARHAFKISRRVFEVMRNECSGDALPFMGMEIAGLDVSEGYSEKESDQHSD  94

Query  182  SLDKQ-----------DDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQR  328
               KQ           ++ S S PFELYK++TTV V+R  FLDV+CDALA Y YVG N+R
Sbjct  95   GCLKQGEVGDDLVSEKNEGSYSKPFELYKRQTTVFVKREAFLDVVCDALALYKYVGPNKR  154

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
            +DL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFV+E
Sbjct  155  SDLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVNE  214

Query  509  KENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK---YP  679
            K+NPLLWASTYHAGE LDP AVAEAKAKRKAKKLA  S  +  KD  +     G+    P
Sbjct  215  KQNPLLWASTYHAGEFLDPEAVAEAKAKRKAKKLAHVSHSL-SKDEVSEGPGNGRPDTRP  273

Query  680  QEGNASTFKLISPKQMAI  733
             +  + T +LI  KQMAI
Sbjct  274  SDVGSCTNELIGAKQMAI  291



>ref|XP_004487082.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X5 [Cicer arietinum]
Length=731

 Score =   260 bits (664),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 187/257 (73%), Gaps = 23/257 (9%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQ---EEDYNY  172
            QSTLQLMGCK+RHAFKISRRVFE  R   +G S+ +  TE +     +      ++D + 
Sbjct  38   QSTLQLMGCKARHAFKISRRVFELTR---SGSSTDAFKTEGMVLSGFDASTGNVKKDCHD  94

Query  173  FAASLDKQDDR----------SKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLN  322
             AA L K D            SKS+PFELYK+RTT+ V+R TFL+++CD LAEY YVG N
Sbjct  95   AAACLGKTDMGNHLLSGKGYGSKSVPFELYKRRTTIFVQRETFLNIVCDVLAEYKYVGPN  154

Query  323  QRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFV  502
            QRADL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTV+STDSIRHMMRSF 
Sbjct  155  QRADLMLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVVSTDSIRHMMRSFA  214

Query  503  DEKENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQ  682
            +EKENPLLWASTYHAGE LDP+AVAEAK KRKAKK+AG +       S ++  T+     
Sbjct  215  NEKENPLLWASTYHAGECLDPVAVAEAKVKRKAKKMAGVTE--GHNSSKSDIQTL-----  267

Query  683  EGNASTFKLISPKQMAI  733
            EG     +L++ KQMA+
Sbjct  268  EGGCGASELLNAKQMAV  284



>ref|XP_004487078.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Cicer arietinum]
 ref|XP_004487079.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Cicer arietinum]
 ref|XP_004487080.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X3 [Cicer arietinum]
 ref|XP_004487081.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X4 [Cicer arietinum]
Length=733

 Score =   260 bits (664),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 187/257 (73%), Gaps = 23/257 (9%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQ---EEDYNY  172
            QSTLQLMGCK+RHAFKISRRVFE  R   +G S+ +  TE +     +      ++D + 
Sbjct  38   QSTLQLMGCKARHAFKISRRVFELTR---SGSSTDAFKTEGMVLSGFDASTGNVKKDCHD  94

Query  173  FAASLDKQDDR----------SKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLN  322
             AA L K D            SKS+PFELYK+RTT+ V+R TFL+++CD LAEY YVG N
Sbjct  95   AAACLGKTDMGNHLLSGKGYGSKSVPFELYKRRTTIFVQRETFLNIVCDVLAEYKYVGPN  154

Query  323  QRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFV  502
            QRADL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTV+STDSIRHMMRSF 
Sbjct  155  QRADLMLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVVSTDSIRHMMRSFA  214

Query  503  DEKENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQ  682
            +EKENPLLWASTYHAGE LDP+AVAEAK KRKAKK+AG +       S ++  T+     
Sbjct  215  NEKENPLLWASTYHAGECLDPVAVAEAKVKRKAKKMAGVTE--GHNSSKSDIQTL-----  267

Query  683  EGNASTFKLISPKQMAI  733
            EG     +L++ KQMA+
Sbjct  268  EGGCGASELLNAKQMAV  284



>ref|XP_004145814.1| PREDICTED: uncharacterized protein LOC101212242 [Cucumis sativus]
Length=873

 Score =   262 bits (670),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 187/249 (75%), Gaps = 10/249 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRN----VCAGESSVSVCTETLEQDNLNTFQEEDYN  169
            QSTLQLMGCK+RHAFKIS+R F  +R     +  G  + S   E ++  ++   + E +N
Sbjct  34   QSTLQLMGCKARHAFKISQRAFALLRKRHGLLPEGLGTRSSEKECVKSWDVRFAETEVWN  93

Query  170  YFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIAC  349
            +  +S   +D  +K+IPFE+YK+RTT+ V+R TFLDV+C AL EY YV  NQRADL +AC
Sbjct  94   HLNSS---KDGDNKNIPFEIYKRRTTLFVKRETFLDVVCKALTEYKYVSPNQRADLLLAC  150

Query  350  RLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLW  529
            R+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSF DEK+NPLLW
Sbjct  151  RIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFADEKQNPLLW  210

Query  530  ASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQ-KDSAANHMTIGKYPQEGNASTFK  706
            ASTYHAGE LDP+AVAEAK KRKAKKLAG   P    KD      +IGK+  + +  + +
Sbjct  211  ASTYHAGECLDPVAVAEAKVKRKAKKLAG--NPHSHLKDEVLESSSIGKFDGQPSDRSTE  268

Query  707  LISPKQMAI  733
            L+S KQMA+
Sbjct  269  LLSQKQMAV  277



>ref|XP_008359867.1| PREDICTED: uncharacterized protein LOC103423554 [Malus domestica]
Length=640

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 179/231 (77%), Gaps = 12/231 (5%)
 Frame = +2

Query  50   ISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAASLDKQDDRSKSIPFEL  229
            IS+RVFE IRN    ESS +V       +N+   ++E  N+  +    +DDRSKS+PFEL
Sbjct  21   ISQRVFELIRN----ESSSNVLLPE-GTENVPPSKDEAGNHLGSG---KDDRSKSVPFEL  72

Query  230  YKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCG  409
            YK RTTVVVRR TFLDV+CDALAEY YVG NQRADL +ACR+RER+ES+TVLLCGTSGCG
Sbjct  73   YKARTTVVVRRKTFLDVVCDALAEYKYVGPNQRADLALACRIRERKESVTVLLCGTSGCG  132

Query  410  KSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPLavaeaka  589
            KSTLS+LLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE LDP+AVAEAKA
Sbjct  133  KSTLSSLLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGECLDPVAVAEAKA  192

Query  590  krkakklaGYSTPVPQKDSAANHMTIGKYP---QEGNASTFKLISPKQMAI  733
            K+KAKKLAG    +  KD   +    GK      +  +ST +LISPKQMA+
Sbjct  193  KKKAKKLAGTPHSL-XKDGMPDGSAFGKSDTRLSDVGSSTAELISPKQMAV  242



>ref|XP_004160091.1| PREDICTED: uncharacterized LOC101212242 [Cucumis sativus]
Length=823

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 187/249 (75%), Gaps = 10/249 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRN----VCAGESSVSVCTETLEQDNLNTFQEEDYN  169
            QSTLQLMGCK+RHAFKIS+R F  +R     +  G  + S   E ++  ++   + E +N
Sbjct  34   QSTLQLMGCKARHAFKISQRAFALLRKRHGLLPEGLGTRSSEKECVKSWDVRFAETEVWN  93

Query  170  YFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIAC  349
            +  +S   +D  +K+IPFE+YK+RTT+ V+R TFL+V+C AL EY YV  NQRADL +AC
Sbjct  94   HLNSS---KDGDNKNIPFEIYKRRTTLFVKRETFLEVVCKALTEYKYVSPNQRADLLLAC  150

Query  350  RLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLW  529
            R+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSF DEK+NPLLW
Sbjct  151  RIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFADEKQNPLLW  210

Query  530  ASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQ-KDSAANHMTIGKYPQEGNASTFK  706
            ASTYHAGE LDP+AVAEAK KRKAKKLAG   P    KD      +IGK+  + +  + +
Sbjct  211  ASTYHAGECLDPVAVAEAKVKRKAKKLAG--NPHSHLKDEVLESSSIGKFDGQPSDRSTE  268

Query  707  LISPKQMAI  733
            L+S KQMA+
Sbjct  269  LLSQKQMAV  277



>ref|XP_010689106.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=746

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 187/256 (73%), Gaps = 13/256 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVF+ +++  + E++  V         + +  +E  +  + 
Sbjct  38   QSTLQLMGCKARHAFKISKRVFDMVKSQNSSEAAAGVSAYGAGISGIRSKSQEPLSNGSR  97

Query  182  SLDKQ---------DDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
             +  Q         D  +KS+  ELYK+RTTV + R  FLDV+CDAL+EY YVG NQR D
Sbjct  98   VVKAQVINNIAVEKDGGTKSLLSELYKRRTTVFIGRDKFLDVVCDALSEYKYVGPNQRED  157

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
              +ACR+RER+ES+T+LLCGTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSFVDEKE
Sbjct  158  FNLACRIRERKESMTILLCGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFVDEKE  217

Query  515  NPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQ---KDSAANHMTIGKYPQE  685
            NPLLWASTYHAGE+LDP+AVAEAKAKRKAKK AG +    +    D+  N  T  + P+ 
Sbjct  218  NPLLWASTYHAGEYLDPVAVAEAKAKRKAKKKAGSTQSFSKDGLSDNVQNVKTDHQKPEM  277

Query  686  GNASTFKLISPKQMAI  733
            G+ +T  LISPKQMA+
Sbjct  278  GSNNT-DLISPKQMAV  292



>gb|EPS65360.1| hypothetical protein M569_09418, partial [Genlisea aurea]
Length=651

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/251 (60%), Positives = 182/251 (73%), Gaps = 9/251 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK RHAFKIS+RVFE ++  C  E   S  +E + +D    + E+  ++   
Sbjct  47   QSTLQLMGCKPRHAFKISQRVFEMMKLECTMEKLASAFSELISEDRHRVYPEQQDHHIWC  106

Query  182  SLDK------QDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTI  343
              D         D +K+  FELYK+RTTVVV R  FLDV+C+AL+EY Y+G NQRADL +
Sbjct  107  DKDGLKSSSIWKDWTKTKLFELYKRRTTVVVARKKFLDVVCEALSEYKYLGPNQRADLVL  166

Query  344  ACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPL  523
            ACR+RER+ES+TVLLCG SGCGKSTLSALL  RLGITTV+STDSIRHMMRSFVDE++NPL
Sbjct  167  ACRIRERKESVTVLLCGASGCGKSTLSALLAGRLGITTVVSTDSIRHMMRSFVDEQQNPL  226

Query  524  LWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAST-  700
            LWASTYHAGE+LDP+AVAEAKAKRKAKKL+G ST         +    GK   EG+++  
Sbjct  227  LWASTYHAGEYLDPVAVAEAKAKRKAKKLSGVSTTATSLAKDESSSEAGK--SEGSSTIQ  284

Query  701  FKLISPKQMAI  733
              +I  KQMAI
Sbjct  285  GDVIGRKQMAI  295



>ref|XP_010689105.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=788

 Score =   259 bits (661),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 187/256 (73%), Gaps = 13/256 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVF+ +++  + E++  V         + +  +E  +  + 
Sbjct  80   QSTLQLMGCKARHAFKISKRVFDMVKSQNSSEAAAGVSAYGAGISGIRSKSQEPLSNGSR  139

Query  182  SLDKQ---------DDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
             +  Q         D  +KS+  ELYK+RTTV + R  FLDV+CDAL+EY YVG NQR D
Sbjct  140  VVKAQVINNIAVEKDGGTKSLLSELYKRRTTVFIGRDKFLDVVCDALSEYKYVGPNQRED  199

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
              +ACR+RER+ES+T+LLCGTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSFVDEKE
Sbjct  200  FNLACRIRERKESMTILLCGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFVDEKE  259

Query  515  NPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQ---KDSAANHMTIGKYPQE  685
            NPLLWASTYHAGE+LDP+AVAEAKAKRKAKK AG +    +    D+  N  T  + P+ 
Sbjct  260  NPLLWASTYHAGEYLDPVAVAEAKAKRKAKKKAGSTQSFSKDGLSDNVQNVKTDHQKPEM  319

Query  686  GNASTFKLISPKQMAI  733
            G+ +T  LISPKQMA+
Sbjct  320  GSNNT-DLISPKQMAV  334



>gb|EPS70965.1| hypothetical protein M569_03793 [Genlisea aurea]
Length=596

 Score =   254 bits (649),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 181/246 (74%), Gaps = 18/246 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK RHAFKIS+RVF+ +R     E S     E       N+  ++      A
Sbjct  44   QSTLQLMGCKPRHAFKISQRVFQMVREQEEAEGSF----EASNGCRTNSCSDK------A  93

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            S   +DDRS+  PF+LYK+RTTV++ R  FLD+ CDAL+EY YVG NQRADL +ACR+RE
Sbjct  94   SDKDEDDRSQ--PFDLYKRRTTVIIGRKVFLDLTCDALSEYKYVGPNQRADLILACRIRE  151

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+ +LLCGTSGCGKSTLSALLGSRLGITT++STDSIRHMMRSFVDEK+NPLLWASTY
Sbjct  152  RKESVIILLCGTSGCGKSTLSALLGSRLGITTIVSTDSIRHMMRSFVDEKQNPLLWASTY  211

Query  542  HAGEHLDPLavaeakakrkakklaGY--STPVPQKDSAANHMTIGKYPQEGNASTFKLIS  715
            HAG++LDP+AVAEAKAKRKAKK AG   ST +  ++      T     +   A+T  LIS
Sbjct  212  HAGDYLDPVAVAEAKAKRKAKKSAGIISSTSITNQEQE----TAKPEGRTSTAATSHLIS  267

Query  716  PKQMAI  733
             KQMA+
Sbjct  268  KKQMAV  273



>ref|XP_006280066.1| hypothetical protein CARUB_v10025948mg [Capsella rubella]
 gb|EOA12964.1| hypothetical protein CARUB_v10025948mg [Capsella rubella]
Length=739

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 150/260 (58%), Positives = 177/260 (68%), Gaps = 23/260 (9%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRN-----VCAGESSVSVCTETLEQD-----NLNTF  151
            QSTLQLMGCK+RHAFKISRRVFE IR+     V       SV  +T +       N+   
Sbjct  42   QSTLQLMGCKARHAFKISRRVFELIRSEGSLIVSPSHGKESVFGKTSDAATSACANVEKV  101

Query  152  QEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRA  331
                 N  A   D  D    S PFE+YK+R TVVV R  F++V+CDALAEY YVG +QRA
Sbjct  102  NNNKVNCLAT--DDVDKSKSSKPFEVYKRRATVVVSRDIFVNVVCDALAEYKYVGHDQRA  159

Query  332  DLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK  511
            DL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK
Sbjct  160  DLILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEK  219

Query  512  ENPLLWASTYHAGEHLDPLavaeakakrkakklaG------YSTPVPQKDSAANHMTIGK  673
            +NPLLWASTYHAGE+LDP+AVAE+KAKR+  K          ++    K        +G 
Sbjct  220  QNPLLWASTYHAGEYLDPVAVAESKAKRRRAKKMDSIEDEKANSSEGVKADNTQKTEVGS  279

Query  674  YPQEGNASTFKLISPKQMAI  733
             P     +T  L+SPKQMA+
Sbjct  280  KP-----TTPVLLSPKQMAV  294



>ref|XP_006419071.1| hypothetical protein EUTSA_v10002416mg [Eutrema salsugineum]
 gb|ESQ37507.1| hypothetical protein EUTSA_v10002416mg [Eutrema salsugineum]
Length=729

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 176/252 (70%), Gaps = 28/252 (11%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEED------  163
            QSTLQLMGCK+RHAFKISRRVFE IR       S   C  + E   +  F +E       
Sbjct  39   QSTLQLMGCKARHAFKISRRVFELIR-------SEGSCNSSPEHGKVPEFAKESGGSNCV  91

Query  164  --YNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
               N   A    +D R    PFE+YK+RTTVVV R  FLDV+CDALAEY YVG +QRADL
Sbjct  92   QKANCLVADDVDKDKR----PFEMYKRRTTVVVSRQIFLDVVCDALAEYKYVGRDQRADL  147

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKEN  517
             +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+N
Sbjct  148  ILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQN  207

Query  518  PLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAS  697
            PLLWASTYHAGE LD +AVAE+KAKR+AKKL G            N  T   +    N+S
Sbjct  208  PLLWASTYHAGECLDRVAVAESKAKRRAKKLKG--------SRGLNSNTENTHAG-SNSS  258

Query  698  TFKLISPKQMAI  733
              +L+S KQMAI
Sbjct  259  NPELLSDKQMAI  270



>ref|XP_009385691.1| PREDICTED: uncharacterized protein LOC103972985 [Musa acuminata 
subsp. malaccensis]
Length=760

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 153/198 (77%), Gaps = 10/198 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDY-----  166
            QSTLQLMGCK+RHAFKISRRVF+ +R+ C+G S +S    + +   + + +E +Y     
Sbjct  42   QSTLQLMGCKARHAFKISRRVFDVMRDECSGGSLLSDAASS-DAWKIPSNEEHEYSITCG  100

Query  167  ----NYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
                N    S  +  D S    FELYK+ TTVVV R  FLD++CDALA YNYVG NQRAD
Sbjct  101  LGQGNMAHQSTVENVDTSGGSSFELYKRLTTVVVSREHFLDIVCDALALYNYVGPNQRAD  160

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
            L +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTVISTDSIRHMMRS+VDEK+
Sbjct  161  LLLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVISTDSIRHMMRSYVDEKQ  220

Query  515  NPLLWASTYHAGEHLDPL  568
            NPLLWASTYHAGE LDP+
Sbjct  221  NPLLWASTYHAGECLDPV  238



>ref|XP_010483729.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Camelina sativa]
Length=715

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 149/190 (78%), Gaps = 5/190 (3%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFK+    FE IR+    E S+ +     +    +   ++       
Sbjct  42   QSTLQLMGCKARHAFKVXXXXFELIRS----EGSLILSPSHGKGSVFDKTSDDAATSPVN  97

Query  182  SLDKQD-DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
            SL   D D+SKS PFE+YK+RTTVVV R  F++V+CDALAEY YVG +QRADL +ACR+R
Sbjct  98   SLATDDVDKSKSKPFEMYKRRTTVVVSREIFVNVVCDALAEYKYVGHDQRADLILACRIR  157

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK+NPLLWAST
Sbjct  158  ERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQNPLLWAST  217

Query  539  YHAGEHLDPL  568
            YHAGE+LDP+
Sbjct  218  YHAGEYLDPV  227



>ref|XP_008800532.1| PREDICTED: uncharacterized protein LOC103714872 [Phoenix dactylifera]
Length=766

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 187/249 (75%), Gaps = 9/249 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIR--NVCAGESSVSVCTETLEQDNLNTFQEEDYNYF  175
            QSTLQLMGCK+RHAFKISRRVFE +R  ++   ++S S  ++  EQ       +E+ +  
Sbjct  68   QSTLQLMGCKARHAFKISRRVFEVMRSEHITKSDASESSSSKENEQRLAGCSSQEEVS--  125

Query  176  AASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRL  355
            + S  +  D S +IPFELYK+ TTVVV R  FL+V+CDAL+ Y YVG NQRADL +ACR+
Sbjct  126  SHSTQEAVDTSSTIPFELYKRLTTVVVTRENFLNVVCDALSMYKYVGPNQRADLLLACRI  185

Query  356  RERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAS  535
            RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTVISTDSIRHMMRSFVDEK+NPLLWAS
Sbjct  186  RERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVISTDSIRHMMRSFVDEKQNPLLWAS  245

Query  536  TYHAGEHLDPLavaeakakrkakklaGYSTPVPQK---DSAANHMTIGKYPQEGNASTFK  706
            TYHAGE LDP+AVA+AKAKRKAKK A  S P+ ++   D   N  + G+       S  +
Sbjct  246  TYHAGECLDPVAVAKAKAKRKAKKRAVVSHPMVKEELSDGTLNEKSDGRSTDP--VSGTE  303

Query  707  LISPKQMAI  733
            LI  KQMAI
Sbjct  304  LIGKKQMAI  312



>ref|XP_009408203.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Musa acuminata subsp. malaccensis]
Length=724

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 149/193 (77%), Gaps = 4/193 (2%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLN-TFQEEDYNYFA  178
            QSTLQL+GCK RHAFKISRR +E +++ C+ + S S    T      + + Q E  N   
Sbjct  35   QSTLQLIGCKPRHAFKISRRAYEIVQSKCSADGSRSDAAGTSVSGLWDGSIQAEPLNLRE  94

Query  179  ASLDKQD---DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIAC  349
            A+L       +   SIPFELYK++TT  V R TFL+++CDAL+EY YVG NQR DL +AC
Sbjct  95   ANLQSSKGNVETRSSIPFELYKRQTTAFVTRDTFLNLVCDALSEYKYVGPNQRTDLVLAC  154

Query  350  RLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLW  529
            R+RER+ES+T+LLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+NPLLW
Sbjct  155  RIRERKESVTILLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLW  214

Query  530  ASTYHAGEHLDPL  568
            ASTYHAGE LDP+
Sbjct  215  ASTYHAGECLDPV  227



>ref|XP_010933088.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Elaeis guineensis]
Length=679

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 153/260 (59%), Positives = 182/260 (70%), Gaps = 22/260 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGE-----------SSVSVCTETLEQD--NL  142
            QSTLQLMGCK+RHAFKIS+RV+E IR VC  +           S VS      + D    
Sbjct  33   QSTLQLMGCKARHAFKISQRVYEVIRTVCPADLWFPHGAKISKSDVSGSPSGRQNDFKQS  92

Query  143  NTFQEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLN  322
            N   E +  Y +A   +  + S S+ F LYK++TT+VV+R  FL+VIC  L+EY YVG N
Sbjct  93   NCLGEGNVTYHSAQ--ENVETSSSMAFALYKRQTTIVVKREKFLNVICSVLSEYKYVGPN  150

Query  323  QRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFV  502
            QRADL +ACR+RER+E + VLL GTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSFV
Sbjct  151  QRADLVLACRIRERKELVIVLLSGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFV  210

Query  503  DEKENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQK---DSAANHMTIGK  673
            DEK+NPLLWASTYHAGE LDP+AVAEAK KRKAKK AG S  + ++   D+A      G+
Sbjct  211  DEKQNPLLWASTYHAGECLDPVAVAEAKVKRKAKKPAGASYLMLKEELYDNAPTEQHDGR  270

Query  674  YPQEGNASTFKLISPKQMAI  733
             P     S  KLIS KQMA+
Sbjct  271  SPD----SRLKLISKKQMAV  286



>ref|XP_010933085.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010933086.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Elaeis guineensis]
Length=682

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 153/260 (59%), Positives = 182/260 (70%), Gaps = 22/260 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGE-----------SSVSVCTETLEQD--NL  142
            QSTLQLMGCK+RHAFKIS+RV+E IR VC  +           S VS      + D    
Sbjct  33   QSTLQLMGCKARHAFKISQRVYEVIRTVCPADLWFPHGAKISKSDVSGSPSGRQNDFKQS  92

Query  143  NTFQEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLN  322
            N   E +  Y +A   +  + S S+ F LYK++TT+VV+R  FL+VIC  L+EY YVG N
Sbjct  93   NCLGEGNVTYHSAQ--ENVETSSSMAFALYKRQTTIVVKREKFLNVICSVLSEYKYVGPN  150

Query  323  QRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFV  502
            QRADL +ACR+RER+E + VLL GTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMRSFV
Sbjct  151  QRADLVLACRIRERKELVIVLLSGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRSFV  210

Query  503  DEKENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQK---DSAANHMTIGK  673
            DEK+NPLLWASTYHAGE LDP+AVAEAK KRKAKK AG S  + ++   D+A      G+
Sbjct  211  DEKQNPLLWASTYHAGECLDPVAVAEAKVKRKAKKPAGASYLMLKEELYDNAPTEQHDGR  270

Query  674  YPQEGNASTFKLISPKQMAI  733
             P     S  KLIS KQMA+
Sbjct  271  SPD----SRLKLISKKQMAV  286



>ref|XP_010109471.1| hypothetical protein L484_007491 [Morus notabilis]
 gb|EXC22882.1| hypothetical protein L484_007491 [Morus notabilis]
Length=754

 Score =   253 bits (645),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 153/282 (54%), Positives = 190/282 (67%), Gaps = 39/282 (14%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFK--------------------------ISRRVFEKIRN-------  82
            QSTLQLMGCK+RHAFK                          I + VFE IR+       
Sbjct  36   QSTLQLMGCKARHAFKACSSTLSGFAWNVFYESSEFHSWKSEICQGVFELIRSEKFIDPL  95

Query  83   VCAGE--SSVSVCTETLEQDNLNTFQEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVV  256
            +  G+  S  +  T   E+++       D       + ++D   KS+PFELYK+RTTV+V
Sbjct  96   LPEGKEKSDSNDSTGKWEKEDALLTDLTDTEAGKQFISRKDGSGKSVPFELYKRRTTVIV  155

Query  257  RRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLG  436
             R TFL+++C+ALAEY YVG NQRADL +ACR+RE++ES+TVLLCG SGCGKSTLSALLG
Sbjct  156  MRETFLNIVCNALAEYKYVGPNQRADLVLACRIREKKESVTVLLCGASGCGKSTLSALLG  215

Query  437  SRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPLavaeakakrkakklaG  616
            SRLGITTVISTDSIRHMMRSFVDEK+NPLLWASTYHAGE LDP+AVAEA+AK+KA+K+AG
Sbjct  216  SRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFLDPVAVAEARAKKKAQKMAG  275

Query  617  YSTPVPQKDSAANHMTIG---KYPQEGNASTFKLISPKQMAI  733
                + ++D  A+  T G      QE  + T +L+SPKQMAI
Sbjct  276  TPHTLLKED-IADGSTAGISEMQKQEAGSGTTELLSPKQMAI  316



>ref|XP_008789555.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
isoform X1 [Phoenix dactylifera]
Length=679

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 152/255 (60%), Positives = 182/255 (71%), Gaps = 16/255 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIR-------NVCAGESSVSVCTETLEQDNLNTFQEE  160
            QSTLQLMGCK+RHAFKISRRVFE +R       + C   SS     +  E        +E
Sbjct  37   QSTLQLMGCKARHAFKISRRVFEVMRSENISKSDACERPSSKGNGCKKNEHCQAGCLSQE  96

Query  161  DYNYFAASLDKQD-DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
            +    ++ L ++  D S +I FELYK+ TTVVV R  FLDV+CDAL+ Y YVG NQRADL
Sbjct  97   E---VSSHLTREGIDTSSTILFELYKRLTTVVVTRENFLDVVCDALSMYKYVGPNQRADL  153

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKEN  517
             +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTVISTDSIRHMMRSF+DEK+N
Sbjct  154  LLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVISTDSIRHMMRSFMDEKQN  213

Query  518  PLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQK---DSAANHMTIGKYPQEG  688
            PLLWASTYHAGE LDP+AVA+AKA+RK KK A  S P+ ++   DS  N  + G+     
Sbjct  214  PLLWASTYHAGECLDPVAVAKAKARRKGKKRAVVSHPMVKEELYDSTLNKKSDGRSADP-  272

Query  689  NASTFKLISPKQMAI  733
                 +LI  KQMAI
Sbjct  273  -VCGTELIGKKQMAI  286



>ref|XP_006488045.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Citrus sinensis]
Length=675

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 154/181 (85%), Gaps = 5/181 (3%)
 Frame = +2

Query  200  DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESIT  379
            DRSK IPFELYK+RTTVV+ R TF+DV+CDAL EY YVG NQRADL +ACR+RER+ES+T
Sbjct  50   DRSKRIPFELYKRRTTVVISRETFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVT  109

Query  380  VLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHL  559
            VLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+NPLLWASTYHAGE L
Sbjct  110  VLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFL  169

Query  560  DPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGK---YPQEGNASTFKLISPKQMA  730
            DP AVAEAKAK+ A+KLAG +  VP KD A+N    GK    P+ G +S  +LISPKQMA
Sbjct  170  DPDAVAEAKAKKHARKLAGAALSVP-KDEASNSSATGKSDIRPEVG-SSAAELISPKQMA  227

Query  731  I  733
            I
Sbjct  228  I  228



>ref|XP_003637522.1| Mutant low phytic acid protein [Medicago truncatula]
Length=753

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 182/266 (68%), Gaps = 34/266 (13%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFK--------------------ISRRVFEKIRNVCAGESSVSVCTE  121
            QSTLQ+MGCK+RHAFK                    I +RVFE     C    S    T+
Sbjct  45   QSTLQIMGCKARHAFKEQCSILLPRPIAPFNGSKGLICKRVFE-----CTKSKST---TD  96

Query  122  TLEQDNLNTFQEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAE  301
             L+ D   + ++        SL  +D + KSIPFELYK+RT+V VRR TFLD++CDALAE
Sbjct  97   LLQPDAAISLED----LGNQSLLSKDSKIKSIPFELYKRRTSVFVRRETFLDIVCDALAE  152

Query  302  YNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIR  481
            Y Y+G NQRADL +ACRLRE++ES+TVLLCGTSGCGKSTLSA+LGSRLGITTV+STDSIR
Sbjct  153  YKYLGPNQRADLVLACRLREKKESVTVLLCGTSGCGKSTLSAILGSRLGITTVVSTDSIR  212

Query  482  HMMRSFVDEKENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDS--AAN  655
            HMMRSF  EKENPLLWASTYHAGE LDP+AVAEAKAK+KAKK+AG S  +P+ +S    N
Sbjct  213  HMMRSFASEKENPLLWASTYHAGECLDPVAVAEAKAKKKAKKMAGVSQSLPKDESTDGQN  272

Query  656  HMTIGKYPQEGNASTFKLISPKQMAI  733
                     E  +   +  SPKQMAI
Sbjct  273  SSKPDTRTSETGSCATEHPSPKQMAI  298



>ref|XP_010043793.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Eucalyptus grandis]
 ref|XP_010043794.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Eucalyptus grandis]
 gb|KCW85783.1| hypothetical protein EUGRSUZ_B02534 [Eucalyptus grandis]
Length=724

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 182/246 (74%), Gaps = 10/246 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFK+S+RVFE +RN    E+SV    +    + +    E D +    
Sbjct  35   QSTLQLMGCKARHAFKMSQRVFELMRN----EASV----DGFFPEGMEVPSEFDASKGHT  86

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                 D  S S  FELYK+R TVVVRR TFLD++C +L+EY YVG NQRADL +ACR+RE
Sbjct  87   CKAAADKHSSSGAFELYKRRRTVVVRRETFLDIVCSSLSEYKYVGANQRADLVLACRIRE  146

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+NPLLWASTY
Sbjct  147  RKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTY  206

Query  542  HAGEHLDPLavaeakakrkakklaGY--STPVPQKDSAANHMTIGKYPQEGNASTFKLIS  715
            HAGE+LDP+AVAEAKAKRKA KLAG   ST   +K   +          E + +  +LIS
Sbjct  207  HAGEYLDPVAVAEAKAKRKATKLAGISRSTVKAEKSDGSKPGKPDATASEESGAASELIS  266

Query  716  PKQMAI  733
            PKQMA+
Sbjct  267  PKQMAV  272



>dbj|BAJ93796.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=668

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 148/189 (78%), Gaps = 5/189 (3%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS++VF  IRN        S     ++++N  +   ED +    
Sbjct  31   QSTLQLMGCKARHAFKISKKVFSVIRNEFL---DASRSDRAVKEENARSHIGEDADMLNT  87

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             +   D  S S+PFELYK +TT+++ R  FL+++CDAL+ Y YVG NQ+ADL +ACR++E
Sbjct  88   EI--PDASSSSMPFELYKTQTTILISREKFLNIVCDALSSYKYVGPNQKADLLLACRIKE  145

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            ++ES+TVLLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMRSF DEK+NPLL+ASTY
Sbjct  146  KKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLYASTY  205

Query  542  HAGEHLDPL  568
            HAGEHLDP+
Sbjct  206  HAGEHLDPV  214



>ref|XP_009126583.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Brassica rapa]
Length=719

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 154/194 (79%), Gaps = 8/194 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRN-----VCAGESSVSVCTETLEQDNLNTFQEEDY  166
            QSTLQLMGCK+RHAFKISRRVFE IR+     +       SV  +T +  +     E+  
Sbjct  45   QSTLQLMGCKARHAFKISRRVFELIRSEGTLILSPTHGKESVFDKTCDAASACAGVEK--  102

Query  167  NYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIA  346
              F+++ D  D +SKS PFE++K+RTTVVV R  F++V+C ALAEY YVG +QRADL +A
Sbjct  103  VSFSSTTDDVD-KSKSKPFEMHKRRTTVVVPREIFVNVVCHALAEYKYVGHDQRADLILA  161

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
            C++RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK++PLL
Sbjct  162  CKIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQDPLL  221

Query  527  WASTYHAGEHLDPL  568
            WASTYHAGE LDP+
Sbjct  222  WASTYHAGECLDPV  235



>emb|CDY71070.1| BnaAnng35980D, partial [Brassica napus]
Length=544

 Score =   243 bits (619),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 149/189 (79%), Gaps = 14/189 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE IR+    E S+ +     ++   +  +  D     A
Sbjct  46   QSTLQLMGCKARHAFKISRRVFELIRS----EGSLKLSPTHGKESVFD--KTCDAASACA  99

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             ++K        PFE++K+RTTVVV R  F++V+C ALAEY YVG +QRADL +AC++RE
Sbjct  100  GVEK--------PFEMHKRRTTVVVPREIFVNVVCHALAEYKYVGHDQRADLILACKIRE  151

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK++PLLWASTY
Sbjct  152  RKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQDPLLWASTY  211

Query  542  HAGEHLDPL  568
            HAGE+LDP+
Sbjct  212  HAGEYLDPV  220



>ref|XP_009417422.1| PREDICTED: uncharacterized protein LOC103997819 [Musa acuminata 
subsp. malaccensis]
Length=807

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 149/197 (76%), Gaps = 8/197 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTET--------LEQDNLNTFQE  157
            QSTLQLMGCK+RHAFKISRRVFE +R+  + +   S  T +         E ++  T   
Sbjct  108  QSTLQLMGCKARHAFKISRRVFEVMRDESSVDDLPSDATSSNDWRIPSNAEYESNETGGL  167

Query  158  EDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
            +  N     + +  D +  IPFELYK+ TTVVV R  FLD++CDALA Y YVG NQRADL
Sbjct  168  DQANMTNDLIQENVDTTCGIPFELYKRLTTVVVSRERFLDIVCDALALYKYVGRNQRADL  227

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKEN  517
             +ACR+RER+ES+TVLLCGTSGCGKSTLS+LLG RLG+TTVISTDSIRHMMRSF+DEK+N
Sbjct  228  LLACRIRERKESVTVLLCGTSGCGKSTLSSLLGGRLGVTTVISTDSIRHMMRSFMDEKQN  287

Query  518  PLLWASTYHAGEHLDPL  568
            PLLWASTYHAGE LDP+
Sbjct  288  PLLWASTYHAGECLDPV  304



>gb|KEH16029.1| 2-phosphoglycerate kinase, partial [Medicago truncatula]
Length=259

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 166/230 (72%), Gaps = 14/230 (6%)
 Frame = +2

Query  50   ISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAASLDKQDDRSKSIPFEL  229
            I +RVFE     C    S    T+ L+ D   + +    +    SL  +D + KSIPFEL
Sbjct  1    ICKRVFE-----CTKSKST---TDLLQPDAAISLE----DLGNQSLLSKDSKIKSIPFEL  48

Query  230  YKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCG  409
            YK+RT+V VRR TFLD++CDALAEY Y+G NQRADL +ACRLRE++ES+TVLLCGTSGCG
Sbjct  49   YKRRTSVFVRRETFLDIVCDALAEYKYLGPNQRADLVLACRLREKKESVTVLLCGTSGCG  108

Query  410  KSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPLavaeaka  589
            KSTLSA+LGSRLGITTV+STDSIRHMMRSF  EKENPLLWASTYHAGE LDP+AVAEAKA
Sbjct  109  KSTLSAILGSRLGITTVVSTDSIRHMMRSFASEKENPLLWASTYHAGECLDPVAVAEAKA  168

Query  590  krkakklaGYSTPVPQKDS--AANHMTIGKYPQEGNASTFKLISPKQMAI  733
            K+KAKK+AG S  +P+ +S    N         E  +   +  SPKQMAI
Sbjct  169  KKKAKKMAGVSQSLPKDESTDGQNSSKPDTRTSETGSCATEHPSPKQMAI  218



>ref|XP_010653595.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X4 [Vitis vinifera]
Length=592

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 148/205 (72%), Gaps = 21/205 (10%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNV------------CAGESSVSVCTETLEQDN--  139
            Q+TLQLMGCK RHAFKISRRVFE +R+              +G      C E  E++N  
Sbjct  35   QTTLQLMGCKPRHAFKISRRVFEVLRSESFVDAWRPTGMEASGVGDAEGCCE--EENNCC  92

Query  140  --LNTFQEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYV  313
              ++  + E  + FA+   ++DD   + PFELYK+ TTVVV R TF D +C  L EY Y+
Sbjct  93   TGVSVSEGEVGDLFAS---QKDDECYAKPFELYKRLTTVVVGRETFFDFVCCVLTEYKYI  149

Query  314  GLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMR  493
            G NQRADL +ACR+RER ES+TVLLCGTSGCGKSTLS LL  RLGITTVISTDSIRHMMR
Sbjct  150  GPNQRADLALACRIREREESVTVLLCGTSGCGKSTLSTLLAGRLGITTVISTDSIRHMMR  209

Query  494  SFVDEKENPLLWASTYHAGEHLDPL  568
            SFVDEK+NPLLWASTYHAGE+LDP+
Sbjct  210  SFVDEKQNPLLWASTYHAGEYLDPM  234



>ref|XP_010940625.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
isoform X3 [Elaeis guineensis]
Length=615

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 181/255 (71%), Gaps = 18/255 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE +R+      ++S C + LE+      + ++  +  A
Sbjct  36   QSTLQLMGCKARHAFKISRRVFEVMRS-----ENMSKC-DALERPFSKGNECKENEHCQA  89

Query  182  SLDKQDD-----------RSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQR  328
                Q++            S +IPFELYK+  TV V R  FL+V+CDAL+ Y Y+G NQR
Sbjct  90   GCLSQEEVSSHLTREGMVTSSTIPFELYKRLATVAVTRENFLNVVCDALSIYKYIGPNQR  149

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
            ADL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTV+STDSIRHMMRSF+DE
Sbjct  150  ADLLLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVVSTDSIRHMMRSFMDE  209

Query  509  KENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEG  688
            K+NPLLWASTYHAGE LDP+AVA+AKAKRKAKK A  S P+ ++ S    +         
Sbjct  210  KQNPLLWASTYHAGECLDPVAVAKAKAKRKAKKHAVVSHPMVEELSDGT-LNESDGQSAD  268

Query  689  NASTFKLISPKQMAI  733
              S  KLI  KQMAI
Sbjct  269  PVSGTKLIGKKQMAI  283



>emb|CBI32757.3| unnamed protein product [Vitis vinifera]
Length=640

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 143/190 (75%), Gaps = 15/190 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTET-LEQDNLNTFQEEDYNYFA  178
            Q+TLQLMGCK RHAFKISRRVFE +R+    ES V     T +E   +        + FA
Sbjct  35   QTTLQLMGCKPRHAFKISRRVFEVLRS----ESFVDAWRPTGMEASGVG-------DLFA  83

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
            +   ++DD   + PFELYK+ TTVVV R TF D +C  L EY Y+G NQRADL +ACR+R
Sbjct  84   S---QKDDECYAKPFELYKRLTTVVVGRETFFDFVCCVLTEYKYIGPNQRADLALACRIR  140

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER ES+TVLLCGTSGCGKSTLS LL  RLGITTVISTDSIRHMMRSFVDEK+NPLLWAST
Sbjct  141  EREESVTVLLCGTSGCGKSTLSTLLAGRLGITTVISTDSIRHMMRSFVDEKQNPLLWAST  200

Query  539  YHAGEHLDPL  568
            YHAGE+LDP+
Sbjct  201  YHAGEYLDPM  210



>ref|XP_003596768.1| hypothetical protein MTR_2g085430, partial [Medicago truncatula]
Length=292

 Score =   233 bits (594),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 166/230 (72%), Gaps = 14/230 (6%)
 Frame = +2

Query  50   ISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAASLDKQDDRSKSIPFEL  229
            I +RVFE     C    S    T+ L+ D   + +    +    SL  +D + KSIPFEL
Sbjct  34   ICKRVFE-----CTKSKST---TDLLQPDAAISLE----DLGNQSLLSKDSKIKSIPFEL  81

Query  230  YKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCG  409
            YK+RT+V VRR TFLD++CDALAEY Y+G NQRADL +ACRLRE++ES+TVLLCGTSGCG
Sbjct  82   YKRRTSVFVRRETFLDIVCDALAEYKYLGPNQRADLVLACRLREKKESVTVLLCGTSGCG  141

Query  410  KSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPLavaeaka  589
            KSTLSA+LGSRLGITTV+STDSIRHMMRSF  EKENPLLWASTYHAGE LDP+AVAEAKA
Sbjct  142  KSTLSAILGSRLGITTVVSTDSIRHMMRSFASEKENPLLWASTYHAGECLDPVAVAEAKA  201

Query  590  krkakklaGYSTPVPQKDS--AANHMTIGKYPQEGNASTFKLISPKQMAI  733
            K+KAKK+AG S  +P+ +S    N         E  +   +  SPKQMAI
Sbjct  202  KKKAKKMAGVSQSLPKDESTDGQNSSKPDTRTSETGSCATEHPSPKQMAI  251



>ref|XP_003570409.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Brachypodium distachyon]
Length=681

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 147/191 (77%), Gaps = 8/191 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS+RVF  ++      S +    +      L+  ++      A 
Sbjct  35   QSTLQLMGCKARHAFKISKRVFNMMKGEFLDTSKLDRAVKEGNSPGLDIGED------AK  88

Query  182  SLDKQ--DDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRL  355
             L+ +  D  S S+PFELYK +TT++V R  FL+V+CDAL+ Y YVG NQ+ADL +ACR+
Sbjct  89   MLNPETSDASSNSVPFELYKTQTTIIVSREKFLNVVCDALSSYKYVGPNQKADLLLACRI  148

Query  356  RERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAS  535
            +ER+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMRSF DEK+NPLL+AS
Sbjct  149  KERKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLYAS  208

Query  536  TYHAGEHLDPL  568
            TYHAGE+LDP+
Sbjct  209  TYHAGEYLDPI  219



>ref|XP_002276632.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Vitis vinifera]
Length=678

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 148/205 (72%), Gaps = 21/205 (10%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNV------------CAGESSVSVCTETLEQDN--  139
            Q+TLQLMGCK RHAFKISRRVFE +R+              +G      C E  E++N  
Sbjct  35   QTTLQLMGCKPRHAFKISRRVFEVLRSESFVDAWRPTGMEASGVGDAEGCCE--EENNCC  92

Query  140  --LNTFQEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYV  313
              ++  + E  + FA+   ++DD   + PFELYK+ TTVVV R TF D +C  L EY Y+
Sbjct  93   TGVSVSEGEVGDLFAS---QKDDECYAKPFELYKRLTTVVVGRETFFDFVCCVLTEYKYI  149

Query  314  GLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMR  493
            G NQRADL +ACR+RER ES+TVLLCGTSGCGKSTLS LL  RLGITTVISTDSIRHMMR
Sbjct  150  GPNQRADLALACRIREREESVTVLLCGTSGCGKSTLSTLLAGRLGITTVISTDSIRHMMR  209

Query  494  SFVDEKENPLLWASTYHAGEHLDPL  568
            SFVDEK+NPLLWASTYHAGE+LDP+
Sbjct  210  SFVDEKQNPLLWASTYHAGEYLDPM  234



>ref|XP_010653591.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Vitis vinifera]
Length=679

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 148/205 (72%), Gaps = 21/205 (10%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNV------------CAGESSVSVCTETLEQDN--  139
            Q+TLQLMGCK RHAFKISRRVFE +R+              +G      C E  E++N  
Sbjct  35   QTTLQLMGCKPRHAFKISRRVFEVLRSESFVDAWRPTGMEASGVGDAEGCCE--EENNCC  92

Query  140  --LNTFQEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYV  313
              ++  + E  + FA+   ++DD   + PFELYK+ TTVVV R TF D +C  L EY Y+
Sbjct  93   TGVSVSEGEVGDLFAS---QKDDECYAKPFELYKRLTTVVVGRETFFDFVCCVLTEYKYI  149

Query  314  GLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMR  493
            G NQRADL +ACR+RER ES+TVLLCGTSGCGKSTLS LL  RLGITTVISTDSIRHMMR
Sbjct  150  GPNQRADLALACRIREREESVTVLLCGTSGCGKSTLSTLLAGRLGITTVISTDSIRHMMR  209

Query  494  SFVDEKENPLLWASTYHAGEHLDPL  568
            SFVDEK+NPLLWASTYHAGE+LDP+
Sbjct  210  SFVDEKQNPLLWASTYHAGEYLDPM  234



>ref|XP_010940623.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
isoform X1 [Elaeis guineensis]
Length=731

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 181/255 (71%), Gaps = 18/255 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE +R+      ++S C + LE+      + ++  +  A
Sbjct  36   QSTLQLMGCKARHAFKISRRVFEVMRS-----ENMSKC-DALERPFSKGNECKENEHCQA  89

Query  182  SLDKQDD-----------RSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQR  328
                Q++            S +IPFELYK+  TV V R  FL+V+CDAL+ Y Y+G NQR
Sbjct  90   GCLSQEEVSSHLTREGMVTSSTIPFELYKRLATVAVTRENFLNVVCDALSIYKYIGPNQR  149

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
            ADL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTV+STDSIRHMMRSF+DE
Sbjct  150  ADLLLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVVSTDSIRHMMRSFMDE  209

Query  509  KENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEG  688
            K+NPLLWASTYHAGE LDP+AVA+AKAKRKAKK A  S P+ ++ S    +         
Sbjct  210  KQNPLLWASTYHAGECLDPVAVAKAKAKRKAKKHAVVSHPMVEELSDGT-LNESDGQSAD  268

Query  689  NASTFKLISPKQMAI  733
              S  KLI  KQMAI
Sbjct  269  PVSGTKLIGKKQMAI  283



>ref|XP_010940624.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
isoform X2 [Elaeis guineensis]
Length=727

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 181/255 (71%), Gaps = 18/255 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKISRRVFE +R+      ++S C + LE+      + ++  +  A
Sbjct  36   QSTLQLMGCKARHAFKISRRVFEVMRS-----ENMSKC-DALERPFSKGNECKENEHCQA  89

Query  182  SLDKQDD-----------RSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQR  328
                Q++            S +IPFELYK+  TV V R  FL+V+CDAL+ Y Y+G NQR
Sbjct  90   GCLSQEEVSSHLTREGMVTSSTIPFELYKRLATVAVTRENFLNVVCDALSIYKYIGPNQR  149

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
            ADL +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTV+STDSIRHMMRSF+DE
Sbjct  150  ADLLLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVVSTDSIRHMMRSFMDE  209

Query  509  KENPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEG  688
            K+NPLLWASTYHAGE LDP+AVA+AKAKRKAKK A  S P+ ++ S    +         
Sbjct  210  KQNPLLWASTYHAGECLDPVAVAKAKAKRKAKKHAVVSHPMVEELSDGT-LNESDGQSAD  268

Query  689  NASTFKLISPKQMAI  733
              S  KLI  KQMAI
Sbjct  269  PVSGTKLIGKKQMAI  283



>gb|EMT25573.1| hypothetical protein F775_31896 [Aegilops tauschii]
Length=671

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/244 (54%), Positives = 173/244 (71%), Gaps = 11/244 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK+RHAFKIS++VF  +R+        S     ++++N  +   ED +    
Sbjct  31   QSTLQLMGCKARHAFKISKKVFSVMRSEFL---DASRSGRAVKEENAPSCIGEDADMLNT  87

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             +   D  S S+PFELYK +TT++V R  FL+++CDAL+ Y YVG NQ+ADL +ACR++E
Sbjct  88   EI--PDASSSSMPFELYKTQTTILVSREKFLNIVCDALSSYKYVGPNQKADLLLACRIKE  145

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            ++ES+TVLLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMRSF DEK+NPLL+ASTY
Sbjct  146  KKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLYASTY  205

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLISPK  721
            HAGE+LDP+AVA++KAK+ +             D  ++H +    P+       +LI  K
Sbjct  206  HAGEYLDPVAVAKSKAKKLSTVSHTNGGKDGTSDVKSHHGSSDLPPRT------ELIGNK  259

Query  722  QMAI  733
            QMAI
Sbjct  260  QMAI  263



>emb|CDY09185.1| BnaA02g06110D [Brassica napus]
Length=703

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 152/190 (80%), Gaps = 16/190 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEE-DYNYFA  178
            QSTLQLMGCK+RHAFKISRRVFE IR+    E S+ + + T  ++++  F +  D     
Sbjct  46   QSTLQLMGCKARHAFKISRRVFELIRS----EGSL-ILSPTHGKESV--FDKTCDAASAC  98

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
            A ++K        PFE++K+RTTVVV R  F++V+C ALAEY YVG +QRADL +AC++R
Sbjct  99   AGVEK--------PFEMHKRRTTVVVPREIFVNVVCHALAEYKYVGHDQRADLILACKIR  150

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEK++PLLWAST
Sbjct  151  ERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQDPLLWAST  210

Query  539  YHAGEHLDPL  568
            YHAGE LDP+
Sbjct  211  YHAGECLDPV  220



>dbj|BAJ93340.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=677

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 148/191 (77%), Gaps = 8/191 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRN--VCAGESSVSVCTETLEQDNLNTFQEEDYNYF  175
            QSTLQLMGCK+RHAFKIS+RVF  +R+  + A  S  +V  E     ++     ED    
Sbjct  31   QSTLQLMGCKARHAFKISKRVFSVMRSEFLEASRSDRAVKDENASSLDIG----EDAEML  86

Query  176  AASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRL  355
             + +   D  S S+PFELYK +TTV+V R  FL+++CDAL+ Y YVG NQ+ADL +ACR+
Sbjct  87   KSEI--PDASSSSLPFELYKTQTTVLVSRERFLNIVCDALSSYKYVGPNQKADLLLACRI  144

Query  356  RERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAS  535
            +E++ES+TVLLCGTSGCGKSTLS+LLG RLGITTV+STDSIRHMMRSF DEK+NPLL+AS
Sbjct  145  KEKKESVTVLLCGTSGCGKSTLSSLLGGRLGITTVVSTDSIRHMMRSFADEKQNPLLYAS  204

Query  536  TYHAGEHLDPL  568
            TYHAGE+LDP+
Sbjct  205  TYHAGEYLDPV  215



>gb|AFW74057.1| hypothetical protein ZEAMMB73_995838 [Zea mays]
Length=683

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 172/247 (70%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTL LMGCK RHAFKIS+RVF  +++     S     T+   Q+N   F   D      
Sbjct  36   QSTLHLMGCKPRHAFKISKRVFNVMKSEFLATSKSDGATK---QENYPAFGLGDGTDTPK  92

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             L++ +    S+PFELYK +TTVVV R  F+ V+CDAL+ Y YVG NQ+ADL +ACR++E
Sbjct  93   MLERSN---SSVPFELYKNQTTVVVSREEFVSVVCDALSLYKYVGPNQKADLLLACRIKE  149

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+ +LLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMRSF DEK++PLL+ASTY
Sbjct  150  RKESVAILLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRSFADEKQSPLLYASTY  209

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAST---FKLI  712
            HAGE+LDP+AVA+AKAKR A K    S P     S    +T G   Q G++      +LI
Sbjct  210  HAGEYLDPIAVAQAKAKRNANKPTVVSHP---NTSGDKDVTSGDKSQHGSSELPPRAELI  266

Query  713  SPKQMAI  733
              KQMA+
Sbjct  267  GNKQMAV  273



>gb|EMT12718.1| hypothetical protein F775_19985 [Aegilops tauschii]
Length=727

 Score =   239 bits (610),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 144/189 (76%), Gaps = 14/189 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QS LQLMGCK RHAFKIS+RVF+  R            ++ ++   L+   +ED    A 
Sbjct  32   QSALQLMGCKPRHAFKISKRVFDVTR------------SDFVDSSKLDGSTQEDGMKVAE  79

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             LD ++    +IPFELYK +TT VV R  FLDV+CDAL  Y YVG NQRADL +ACR++E
Sbjct  80   LLDAEN--MANIPFELYKTQTTAVVSREEFLDVVCDALTLYKYVGPNQRADLLLACRIKE  137

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS+LLG+RLGITTV+STDSIRHMMRSFV+EKENPLL+ASTY
Sbjct  138  RKESVTVLLCGTSGCGKSTLSSLLGNRLGITTVVSTDSIRHMMRSFVEEKENPLLYASTY  197

Query  542  HAGEHLDPL  568
            HAG+ LDP+
Sbjct  198  HAGDCLDPV  206



>ref|XP_009408128.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
[Musa acuminata subsp. malaccensis]
Length=737

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 147/196 (75%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAG-----ESSVSVCTE--TLEQDNLNTFQEE  160
            QSTLQLMGCK+RHAFKISRRVFE +R+  +G     +   S C +  + E++  +     
Sbjct  40   QSTLQLMGCKARHAFKISRRVFEVMRDENSGGRLPPDGRSSDCWKIPSSEKNRHDIDGLG  99

Query  161  DYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLT  340
              N       +  D S  +PFELYK+ TTVVV R  FLD++CDAL  Y YV  +QR DL 
Sbjct  100  QANMTNRLTPENVDMSSGMPFELYKRLTTVVVSRERFLDIVCDALTLYKYVSPHQRTDLL  159

Query  341  IACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENP  520
            +ACR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLG+TTVISTDSIRHMMRS+VDE++NP
Sbjct  160  LACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGVTTVISTDSIRHMMRSYVDEEQNP  219

Query  521  LLWASTYHAGEHLDPL  568
            LLWASTYHAGE LDP+
Sbjct  220  LLWASTYHAGECLDPV  235



>ref|XP_008681136.1| PREDICTED: uncharacterized protein LOC100193323 isoform X2 [Zea 
mays]
Length=744

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 172/247 (70%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTL LMGCK RHAFKIS+RVF  +++     S     T+   Q+N   F   D      
Sbjct  97   QSTLHLMGCKPRHAFKISKRVFNVMKSEFLATSKSDGATK---QENYPAFGLGDGTDTPK  153

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             L++ +    S+PFELYK +TTVVV R  F+ V+CDAL+ Y YVG NQ+ADL +ACR++E
Sbjct  154  MLERSN---SSVPFELYKNQTTVVVSREEFVSVVCDALSLYKYVGPNQKADLLLACRIKE  210

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+ +LLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMRSF DEK++PLL+ASTY
Sbjct  211  RKESVAILLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRSFADEKQSPLLYASTY  270

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAS---TFKLI  712
            HAGE+LDP+AVA+AKAKR A K    S P     S    +T G   Q G++      +LI
Sbjct  271  HAGEYLDPIAVAQAKAKRNANKPTVVSHP---NTSGDKDVTSGDKSQHGSSELPPRAELI  327

Query  713  SPKQMAI  733
              KQMA+
Sbjct  328  GNKQMAV  334



>emb|CDM84881.1| unnamed protein product [Triticum aestivum]
Length=671

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 173/246 (70%), Gaps = 14/246 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRN--VCAGESSVSVCTETLEQDNLNTFQEEDYNYF  175
            QSTLQLMGCK+RHAFKIS++VF  +R+  + A +S  ++  E      +     ED N  
Sbjct  31   QSTLQLMGCKARHAFKISKKVFSVMRSEFLDASKSDRAIKEENAPSLGIG----EDANMV  86

Query  176  AASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRL  355
               +   D  S S+PFELY  +TT+++ R  FL+++CDAL+ Y YVG NQ+ADL +ACR+
Sbjct  87   NTEI--PDASSSSMPFELYMTQTTILISREKFLNIVCDALSSYKYVGPNQKADLLLACRI  144

Query  356  RERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAS  535
            +E++ES+TVLLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMRSF DEK+NPLL+AS
Sbjct  145  KEKKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLYAS  204

Query  536  TYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLIS  715
            TYHAGE+LDP+AVA++K+K+ A             D  ++H +    P+       +LI 
Sbjct  205  TYHAGEYLDPVAVAKSKSKKLATVSHTNGGKDGTSDVKSHHGSSDLPPRT------ELIG  258

Query  716  PKQMAI  733
             KQMAI
Sbjct  259  NKQMAI  264



>ref|XP_008681135.1| PREDICTED: uncharacterized protein LOC100193323 isoform X1 [Zea 
mays]
 gb|AFW74059.1| hypothetical protein ZEAMMB73_995838 [Zea mays]
Length=773

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 172/247 (70%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTL LMGCK RHAFKIS+RVF  +++     S     T+   Q+N   F   D      
Sbjct  126  QSTLHLMGCKPRHAFKISKRVFNVMKSEFLATSKSDGATK---QENYPAFGLGDGTDTPK  182

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             L++ +    S+PFELYK +TTVVV R  F+ V+CDAL+ Y YVG NQ+ADL +ACR++E
Sbjct  183  MLERSN---SSVPFELYKNQTTVVVSREEFVSVVCDALSLYKYVGPNQKADLLLACRIKE  239

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+ +LLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMRSF DEK++PLL+ASTY
Sbjct  240  RKESVAILLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRSFADEKQSPLLYASTY  299

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAS---TFKLI  712
            HAGE+LDP+AVA+AKAKR A K    S P     S    +T G   Q G++      +LI
Sbjct  300  HAGEYLDPIAVAQAKAKRNANKPTVVSHP---NTSGDKDVTSGDKSQHGSSELPPRAELI  356

Query  713  SPKQMAI  733
              KQMA+
Sbjct  357  GNKQMAV  363



>gb|AFW74058.1| hypothetical protein ZEAMMB73_995838 [Zea mays]
Length=740

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 172/247 (70%), Gaps = 12/247 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTL LMGCK RHAFKIS+RVF  +++     S     T+   Q+N   F   D      
Sbjct  126  QSTLHLMGCKPRHAFKISKRVFNVMKSEFLATSKSDGATK---QENYPAFGLGDGTDTPK  182

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             L++ +    S+PFELYK +TTVVV R  F+ V+CDAL+ Y YVG NQ+ADL +ACR++E
Sbjct  183  MLERSN---SSVPFELYKNQTTVVVSREEFVSVVCDALSLYKYVGPNQKADLLLACRIKE  239

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+ +LLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMRSF DEK++PLL+ASTY
Sbjct  240  RKESVAILLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRSFADEKQSPLLYASTY  299

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAST---FKLI  712
            HAGE+LDP+AVA+AKAKR A K    S P     S    +T G   Q G++      +LI
Sbjct  300  HAGEYLDPIAVAQAKAKRNANKPTVVSHP---NTSGDKDVTSGDKSQHGSSELPPRAELI  356

Query  713  SPKQMAI  733
              KQMA+
Sbjct  357  GNKQMAV  363



>ref|NP_001145638.1| hypothetical protein [Zea mays]
 gb|ACN25157.1| unknown [Zea mays]
 gb|AFW63977.1| hypothetical protein ZEAMMB73_515953 [Zea mays]
Length=691

 Score =   236 bits (601),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 145/196 (74%), Gaps = 20/196 (10%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTL LMGCK RHAFKIS+RVF+ ++            +E L Q   +   +++ NY A 
Sbjct  36   QSTLHLMGCKPRHAFKISKRVFDVMK------------SEFLAQSKSDGAGKQE-NYPAL  82

Query  182  SLDKQDDRSK-------SIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLT  340
             L    D  K       SIPFELYK +TTVV+ R  F+ V+CDAL+ Y YVG NQ+ADL 
Sbjct  83   GLGDGTDTQKMLERSDSSIPFELYKNQTTVVISREEFVSVVCDALSLYKYVGPNQKADLL  142

Query  341  IACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENP  520
            +ACR++ER+ES+T+LLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMR F D+K+NP
Sbjct  143  LACRIKERKESVTILLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRGFADQKQNP  202

Query  521  LLWASTYHAGEHLDPL  568
            LL+ASTYHAGE+LDP+
Sbjct  203  LLYASTYHAGEYLDPI  218



>ref|XP_004954396.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Setaria italica]
Length=682

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 145/190 (76%), Gaps = 10/190 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETL-EQDNLNTFQEEDYNYFA  178
            QSTL LMGCK RHAFKIS+RVF    NV   E   +  ++ L +Q+N       D  +  
Sbjct  36   QSTLHLMGCKPRHAFKISKRVF----NVMKSELLAASTSDGLTKQENYPALG--DSTHTP  89

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
             +L++    S SIPFELYK +TTVV+ R  F+ V+CDAL+ Y YVG NQ+AD  +ACR++
Sbjct  90   KNLERS---SSSIPFELYKNQTTVVISREQFVSVVCDALSMYKYVGPNQKADFLLACRIK  146

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER+ES+T+LLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMR F DEK+NPLL+AST
Sbjct  147  ERKESVTILLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRGFADEKQNPLLYAST  206

Query  539  YHAGEHLDPL  568
            YHAG++LDP+
Sbjct  207  YHAGDYLDPI  216



>gb|ACB38657.1| mutant low phytic acid protein 1 [Oryza sativa Japonica Group]
Length=685

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 175/259 (68%), Gaps = 36/259 (14%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            Q TLQLMGCK+RHAFKIS+RVF  +R            +E L+    +T   E+    A 
Sbjct  36   QGTLQLMGCKARHAFKISKRVFNVMR------------SEFLDASKSDTADNEEN---AP  80

Query  182  SLDKQDDRSK---------SIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
            SL K  +  K         SIPFELYK +TT+VV R  FL V+CDAL+ Y YVG NQ+AD
Sbjct  81   SLVKDVEMLKPKILEATLSSIPFELYKTQTTIVVSREKFLSVVCDALSSYKYVGPNQKAD  140

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
              +ACR++ER+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMR F DEK+
Sbjct  141  FLLACRIKERKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRGFTDEKQ  200

Query  515  NPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQK------DSAANHMTIGKY  676
            NPLL+ASTYHAGE LDP+AVA+AKAKRKA+KL   S P   +      D  A+H +    
Sbjct  201  NPLLYASTYHAGECLDPVAVAQAKAKRKAQKLDIVSHPNTNEGRDDTSDDKAHHGSSELP  260

Query  677  PQEGNASTFKLISPKQMAI  733
            P+       +LI  KQMAI
Sbjct  261  PRT------ELIGSKQMAI  273



>ref|XP_004169815.1| PREDICTED: uncharacterized protein LOC101229867, partial [Cucumis 
sativus]
Length=636

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 167/237 (70%), Gaps = 22/237 (9%)
 Frame = +2

Query  50   ISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAASLD---------KQDD  202
            IS+ VFE IR   + E+ +      L   +L    E D N +    D         ++ D
Sbjct  1    ISKWVFELIRKEASTENFLPEERNILGSVSLGEKTETDGNRYYNCFDGKETFNQSPREGD  60

Query  203  RSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITV  382
             + +IPFELYK+  T VV R  FLDVICD+LA+Y YVG NQRADL +ACR+RER+ES+TV
Sbjct  61   NNNNIPFELYKRSRTAVVGRELFLDVICDSLAKYKYVGPNQRADLILACRIRERKESVTV  120

Query  383  LLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLD  562
            LLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+NPLLW+STYHAGE LD
Sbjct  121  LLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWSSTYHAGEFLD  180

Query  563  PLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLISPKQMAI  733
            P+AVAE+KA++KAKKLAG S    + ++A             NA+  +LISPKQMAI
Sbjct  181  PVAVAESKARKKAKKLAGISHKHLKDETA-------------NANNLELISPKQMAI  224



>gb|EEC74258.1| hypothetical protein OsI_09470 [Oryza sativa Indica Group]
Length=713

 Score =   234 bits (596),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 175/259 (68%), Gaps = 36/259 (14%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            Q TLQLMGCK+RHAFKIS+RVF  +R            +E L+    +T   E+    A 
Sbjct  64   QGTLQLMGCKARHAFKISKRVFNVMR------------SEFLDASKSDTADNEEN---AP  108

Query  182  SLDKQDDRSK---------SIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
            SL K  +  K         SIPFELYK +TT+VV R  FL V+CDAL+ Y YVG NQ+AD
Sbjct  109  SLVKDVEMLKPKILEATLSSIPFELYKTQTTIVVSREKFLSVVCDALSSYKYVGPNQKAD  168

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
              +ACR++ER+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMR F DEK+
Sbjct  169  FLLACRIKERKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRGFTDEKQ  228

Query  515  NPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQK------DSAANHMTIGKY  676
            NPLL+ASTYHAGE LDP+AVA+AKAKRKA+KL   S P   +      D  A+H +    
Sbjct  229  NPLLYASTYHAGECLDPVAVAQAKAKRKAQKLDIVSHPNTNEGRDDTSDDKAHHGSSELP  288

Query  677  PQEGNASTFKLISPKQMAI  733
            P+       +LI  KQMAI
Sbjct  289  PRT------ELIGSKQMAI  301



>gb|EEE58056.1| hypothetical protein OsJ_08893 [Oryza sativa Japonica Group]
Length=714

 Score =   233 bits (595),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 175/259 (68%), Gaps = 36/259 (14%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            Q TLQLMGCK+RHAFKIS+RVF  +R            +E L+    +T   E+    A 
Sbjct  65   QGTLQLMGCKARHAFKISKRVFNVMR------------SEFLDASKSDTADNEEN---AP  109

Query  182  SLDKQDDRSK---------SIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
            SL K  +  K         SIPFELYK +TT+VV R  FL V+CDAL+ Y YVG NQ+AD
Sbjct  110  SLVKDVEMLKPKILEATLSSIPFELYKTQTTIVVSREKFLSVVCDALSSYKYVGPNQKAD  169

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
              +ACR++ER+ES+TVLLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMR F DEK+
Sbjct  170  FLLACRIKERKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRGFTDEKQ  229

Query  515  NPLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQK------DSAANHMTIGKY  676
            NPLL+ASTYHAGE LDP+AVA+AKAKRKA+KL   S P   +      D  A+H +    
Sbjct  230  NPLLYASTYHAGECLDPVAVAQAKAKRKAQKLDIVSHPNTNEGRDDTSDDKAHHGSSELP  289

Query  677  PQEGNASTFKLISPKQMAI  733
            P+       +LI  KQMAI
Sbjct  290  PRT------ELIGSKQMAI  302



>ref|XP_003560284.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Brachypodium distachyon]
Length=686

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 142/189 (75%), Gaps = 13/189 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK RHAFKISRRVFE           V+   E+L   +    QE D +   A
Sbjct  29   QSTLQLMGCKPRHAFKISRRVFE-----------VTKTDESL--GSPKPGQENDGSIIDA  75

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            +     +   ++PF+LYK +TT +V R  FLDV+C AL  Y YVG NQRADL +ACR++E
Sbjct  76   AAADLFNTDSNVPFQLYKTQTTALVSREEFLDVVCHALTLYKYVGPNQRADLLLACRIKE  135

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS+LLG+RLGITT++STDSIRHMMRSFVDE++NPLL+ASTY
Sbjct  136  RKESVTVLLCGTSGCGKSTLSSLLGNRLGITTIVSTDSIRHMMRSFVDEEQNPLLYASTY  195

Query  542  HAGEHLDPL  568
            HAG+ LDP+
Sbjct  196  HAGDFLDPV  204



>ref|XP_010696609.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Beta vulgaris subsp. vulgaris]
Length=688

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 175/250 (70%), Gaps = 20/250 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK R+A KIS+RVF  +++  +             +D  ++      N    
Sbjct  36   QSTLQLMGCKPRYAKKISKRVFGSMQSQSS-------------EDGKDSLGRLTANAPGR  82

Query  182  SLDKQDDR--SKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRL  355
             L K  ++  SK++  E YK+RTTV + R  FL ++CDAL EY Y+G NQR DL +ACR+
Sbjct  83   CLVKSGEKKGSKNMSSESYKRRTTVSISREKFLGLVCDALTEYKYIGPNQREDLILACRI  142

Query  356  RERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAS  535
            RER+ES+TVLLCGTSGCGKSTLS++L SRLGITTVISTDSIRHMMRSFVDEK+NPLLWAS
Sbjct  143  RERKESLTVLLCGTSGCGKSTLSSILASRLGITTVISTDSIRHMMRSFVDEKKNPLLWAS  202

Query  536  TYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKY----PQEGNASTF  703
            TYHAGE LDP+AVAEAKA+RKA+K+AG    +  KD  ++ +   K+    P+    ST 
Sbjct  203  TYHAGECLDPVAVAEAKARRKARKMAGLPYAI-SKDGMSDCIQTQKFDRLQPEAVANSTE  261

Query  704  KLISPKQMAI  733
              ISPKQMAI
Sbjct  262  HNISPKQMAI  271



>gb|EMS49876.1| hypothetical protein TRIUR3_07100 [Triticum urartu]
Length=683

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 140/183 (77%), Gaps = 14/183 (8%)
 Frame = +2

Query  20   MGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAASLDKQD  199
            MGCK RHAFKIS+RVF+  R            ++ ++   LN   +ED    A  LD ++
Sbjct  1    MGCKPRHAFKISKRVFDVTR------------SDFVDSSKLNGSTQEDGMKVAELLDAEN  48

Query  200  DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESIT  379
                +IPFELYK +TT VV R  FLDV+CDAL  Y YVG NQRADL +ACR++ER+ES+T
Sbjct  49   --MTNIPFELYKTQTTAVVSREEFLDVVCDALTLYKYVGPNQRADLLLACRIKERKESVT  106

Query  380  VLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHL  559
            VLLCGTSGCGKSTLS+LLG+RLGITTV+STDSIRHMMRSF++E+ENPLL+ASTYHAG++L
Sbjct  107  VLLCGTSGCGKSTLSSLLGNRLGITTVVSTDSIRHMMRSFIEERENPLLYASTYHAGDYL  166

Query  560  DPL  568
            DP+
Sbjct  167  DPV  169



>ref|NP_974387.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 gb|AEE77990.1| uncharacterized protein AT3G45090 [Arabidopsis thaliana]
Length=698

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 164/235 (70%), Gaps = 26/235 (11%)
 Frame = +2

Query  53   SRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEE--------DYNYFAASLDKQDDRS  208
            SRRVFE IR       S   C  + E      F +E          N    + D   D++
Sbjct  34   SRRVFELIR-------SEGSCNTSPENGKEPEFAKEVGGSTCVEKLNCLVVAGDV--DKN  84

Query  209  KSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLL  388
            KS PFE+YK+RTTVVV R  F+DV+CDALAEY YVG +QRADL +ACR+RER+ES+TVLL
Sbjct  85   KSKPFEMYKRRTTVVVSREIFVDVVCDALAEYKYVGRDQRADLILACRIRERKESVTVLL  144

Query  389  CGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPL  568
            CGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSF DEK+NPLLWASTYHAGE+LDP+
Sbjct  145  CGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLWASTYHAGEYLDPV  204

Query  569  avaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLISPKQMAI  733
            AVAE+KAKRKAKKL G         S   +    K     N+ST +L+S KQMAI
Sbjct  205  AVAESKAKRKAKKLKG---------SRGVNSNAQKTDAGSNSSTTELLSHKQMAI  250



>gb|EMS62712.1| hypothetical protein TRIUR3_21504 [Triticum urartu]
Length=718

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 164/244 (67%), Gaps = 27/244 (11%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
             STLQLMGCK RHAF+ISRRVF+ +R   A         E   Q      Q  +    A 
Sbjct  30   HSTLQLMGCKPRHAFEISRRVFDVVRGDPA---------EMESQGKSGGVQRYELPDAAT  80

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            S        +   FELYK+RTTV++ R  FL ++C ALA Y Y+  NQR  LT+ACR+RE
Sbjct  81   S-------PRQFQFELYKRRTTVLIPRDLFLHLVCQALALYKYLAPNQRNHLTLACRIRE  133

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS LLGSRLGITTV+STDSIRHMMRSFVD+KENPLLWASTY
Sbjct  134  RKESVTVLLCGTSGCGKSTLSTLLGSRLGITTVVSTDSIRHMMRSFVDDKENPLLWASTY  193

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLISPK  721
            HAGE LDP+AV++AKA+RKAKK +G ST     +S  +      Y   G+    K I  K
Sbjct  194  HAGECLDPVAVSKAKARRKAKKRSGVST-----NSGMD------YEGSGDKVEGKPIGKK  242

Query  722  QMAI  733
            QMAI
Sbjct  243  QMAI  246



>ref|XP_002975910.1| hypothetical protein SELMODRAFT_104408 [Selaginella moellendorffii]
 gb|EFJ22815.1| hypothetical protein SELMODRAFT_104408 [Selaginella moellendorffii]
Length=718

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 135/189 (71%), Gaps = 13/189 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQ MGCK+RHAFKIS RVF+ +R        V   ++  E       Q+E    F  
Sbjct  45   QSTLQFMGCKARHAFKISVRVFDVLR--------VEPPSKVFEYHGYPVEQQEIAEEF--  94

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             L++   R    P    KKR+ VV+ R  FLDV+CDALA+Y YVG NQRADL +ACR RE
Sbjct  95   -LEQSSFRKP--PASRSKKRSMVVIGREKFLDVVCDALAQYQYVGPNQRADLMLACRYRE  151

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ S+TVLLCGTSGCGKSTLS+LL SRLGITTV+STDSIRHMMRSF DEK NPLLWASTY
Sbjct  152  RKSSVTVLLCGTSGCGKSTLSSLLASRLGITTVVSTDSIRHMMRSFADEKSNPLLWASTY  211

Query  542  HAGEHLDPL  568
            HAGE LDP+
Sbjct  212  HAGEFLDPV  220



>gb|EMT04376.1| hypothetical protein F775_16884 [Aegilops tauschii]
Length=762

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 163/244 (67%), Gaps = 23/244 (9%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
             STLQLMGCK RHAF+ISRRVF+ +R             +  E + L    +        
Sbjct  30   HSTLQLMGCKPRHAFEISRRVFDVVRG------------DPAEMEMLMAMSQGKRGVQRY  77

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             L       +   FELYK+RTTV++ R  FL ++C ALA Y Y+  NQR  LT+ACR+RE
Sbjct  78   ELPDAATSPRQFQFELYKRRTTVLIPRDLFLHLVCQALALYKYLAPNQRNHLTLACRIRE  137

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS LLGSRLGITTV+STDSIRHMMRSFVDEKENPLLWASTY
Sbjct  138  RKESVTVLLCGTSGCGKSTLSTLLGSRLGITTVVSTDSIRHMMRSFVDEKENPLLWASTY  197

Query  542  HAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLISPK  721
            HAGE LDP+AV+EAKA+RKAKK +G S+     +S  +      Y   G+    K I  K
Sbjct  198  HAGECLDPVAVSEAKARRKAKKRSGVSS-----NSGMD------YEGSGDKVEGKPIGKK  246

Query  722  QMAI  733
            QMAI
Sbjct  247  QMAI  250



>ref|XP_003578703.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X2 [Brachypodium distachyon]
Length=716

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 132/189 (70%), Gaps = 12/189 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
             STLQLMGCK RHAF+ISR+VF+ +R             +  E D +             
Sbjct  28   HSTLQLMGCKPRHAFEISRKVFDVVRG------------DPAEMDLMMMAGGGKGGVQRY  75

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             L       +   FELYK+RTTV++ R  FL ++C ALA Y YV  NQR DL +ACR+RE
Sbjct  76   ELPDATTSPRQFQFELYKRRTTVLIPRDLFLHLVCQALALYKYVAPNQRNDLILACRIRE  135

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS LLGSRLGITTV+STDSIRHMMRSFVDEKENPLLWASTY
Sbjct  136  RKESVTVLLCGTSGCGKSTLSTLLGSRLGITTVVSTDSIRHMMRSFVDEKENPLLWASTY  195

Query  542  HAGEHLDPL  568
            HAGE LDP+
Sbjct  196  HAGECLDPV  204



>ref|XP_010238553.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
isoform X1 [Brachypodium distachyon]
Length=717

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 132/189 (70%), Gaps = 12/189 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
             STLQLMGCK RHAF+ISR+VF+ +R             +  E D +             
Sbjct  28   HSTLQLMGCKPRHAFEISRKVFDVVRG------------DPAEMDLMMMAGGGKGGVQRY  75

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             L       +   FELYK+RTTV++ R  FL ++C ALA Y YV  NQR DL +ACR+RE
Sbjct  76   ELPDATTSPRQFQFELYKRRTTVLIPRDLFLHLVCQALALYKYVAPNQRNDLILACRIRE  135

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+TVLLCGTSGCGKSTLS LLGSRLGITTV+STDSIRHMMRSFVDEKENPLLWASTY
Sbjct  136  RKESVTVLLCGTSGCGKSTLSTLLGSRLGITTVVSTDSIRHMMRSFVDEKENPLLWASTY  195

Query  542  HAGEHLDPL  568
            HAGE LDP+
Sbjct  196  HAGECLDPV  204



>ref|XP_006648126.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Oryza brachyantha]
Length=645

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 140/190 (74%), Gaps = 18/190 (9%)
 Frame = +2

Query  20   MGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAASLDKQD  199
            MGCK+RHAFKIS+RVF  +R         S   +  + D+++  +EE+    A   D   
Sbjct  1    MGCKARHAFKISKRVFNVMR---------SEFLDVSKSDSVD--KEENAPSHAIVKDVDT  49

Query  200  DRSK-------SIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
             R K       SIPFELYK RTTVVV R  FL V+CDAL+ Y YVG NQ+ADL +ACR++
Sbjct  50   LRPKILEATISSIPFELYKTRTTVVVSRDKFLTVVCDALSSYKYVGPNQKADLLLACRIK  109

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            E++ES+T+LLCGTSGCGKSTLS+LLGSRLGITTVISTDSIRHMMR F DEK+NPLL+AST
Sbjct  110  EKKESVTILLCGTSGCGKSTLSSLLGSRLGITTVISTDSIRHMMRGFTDEKQNPLLYAST  169

Query  539  YHAGEHLDPL  568
            YHAGE LDP+
Sbjct  170  YHAGECLDPV  179



>emb|CAN72472.1| hypothetical protein VITISV_006041 [Vitis vinifera]
Length=792

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 147/240 (61%), Gaps = 56/240 (23%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNV------------CAGESSVSVCTETLEQDN--  139
            Q+TLQLMGCK RHAFKISRRVFE +R+              +G      C E  E++N  
Sbjct  35   QTTLQLMGCKPRHAFKISRRVFEVLRSESFVDAWRPTGMEASGVGDAEGCCE--EENNCC  92

Query  140  --LNTFQEEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYV  313
              ++    E  + FA+   ++DD   + PFELYK+ TTVVV R TF D +C  L EY Y+
Sbjct  93   TGVSVSXGEVGDLFAS---QKDDECYAKPFELYKRLTTVVVGRETFFDFVCCVLTEYKYI  149

Query  314  GLNQRADLTIACRL-----------------------------------RERRESITVLL  388
            G NQRADL +ACRL                                   RER ES+TVLL
Sbjct  150  GPNQRADLALACRLTSVLYCGHXGYXTHLKRTLTGIVSMDGLIKYLGRIREREESVTVLL  209

Query  389  CGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPL  568
            CGTSGCGKSTLS LL  RLGITTVISTDSIRHMMRSFVDEK+NPLLWASTYHAGE+LDP+
Sbjct  210  CGTSGCGKSTLSTLLAGRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEYLDPM  269



>ref|XP_010279555.1| PREDICTED: uncharacterized protein LOC104613435 [Nelumbo nucifera]
 ref|XP_010279556.1| PREDICTED: uncharacterized protein LOC104613435 [Nelumbo nucifera]
 ref|XP_010279557.1| PREDICTED: uncharacterized protein LOC104613435 [Nelumbo nucifera]
 ref|XP_010279558.1| PREDICTED: uncharacterized protein LOC104613435 [Nelumbo nucifera]
Length=748

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 143/199 (72%), Gaps = 11/199 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDN---LNTFQEEDYNY  172
            QS LQL+GCK  HAFKISRRVF+ + N     +       T   D    L+  ++E ++ 
Sbjct  46   QSVLQLVGCKVHHAFKISRRVFDILENENLKRAVDFEVRGTFVSDGITELSYIRKEGHDD  105

Query  173  FAAS-----LDKQDDRS---KSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQR  328
            F  S     +D ++D S   +  P++LYKKR +  V+R  FLDVIC  L +Y YVG +Q 
Sbjct  106  FKTSKGQLHVDMKNDHSAKDRDKPYDLYKKRVSATVKRGRFLDVICSTLEKYRYVGPSQC  165

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
            AD+ +ACRLRE++ES+T+LLCGTSGCGKSTLS+LL SRLGITTV+STDSIRHMMRSF++E
Sbjct  166  ADIGLACRLREKKESVTILLCGTSGCGKSTLSSLLASRLGITTVVSTDSIRHMMRSFINE  225

Query  509  KENPLLWASTYHAGEHLDP  565
            KENPLLWASTYHAGE LDP
Sbjct  226  KENPLLWASTYHAGEFLDP  244



>ref|NP_001063996.1| Os09g0572200 [Oryza sativa Japonica Group]
 dbj|BAD46616.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25910.1| Os09g0572200 [Oryza sativa Japonica Group]
 gb|EEE70279.1| hypothetical protein OsJ_30434 [Oryza sativa Japonica Group]
Length=713

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 135/189 (71%), Gaps = 14/189 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
             STLQLMGCK RHAF+IS RVF++IR    G+ ++                      +  
Sbjct  33   HSTLQLMGCKPRHAFEISGRVFDEIRGHMGGDMAMGGGGGV--------------QRYEL  78

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            + D +    +   FELYK+RTT+++ R  FL ++C ALA Y YV  +QR+DL  ACR+RE
Sbjct  79   AADAEAASPRQFQFELYKRRTTLLIPRPLFLRLVCHALALYKYVAPDQRSDLHRACRIRE  138

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+T+LLCGTSGCGKSTLS LLGSRLGITTV+STDSIRHMMRSFV+EK+NPLLWASTY
Sbjct  139  RKESVTILLCGTSGCGKSTLSTLLGSRLGITTVVSTDSIRHMMRSFVEEKQNPLLWASTY  198

Query  542  HAGEHLDPL  568
            HAGE LDP+
Sbjct  199  HAGECLDPV  207



>gb|EEC85102.1| hypothetical protein OsI_32482 [Oryza sativa Indica Group]
Length=715

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 135/189 (71%), Gaps = 14/189 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
             STLQLMGCK RHAF+IS RVF++IR    G+ ++                      +  
Sbjct  35   HSTLQLMGCKPRHAFEISGRVFDEIRGHMGGDMAMGGGGGV--------------QRYEL  80

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            + D +    +   FELYK+RTT+++ R  FL ++C ALA Y YV  +QR+DL  ACR+RE
Sbjct  81   AADAEAASPRQFQFELYKRRTTLLIPRPLFLRLVCHALALYKYVAPDQRSDLHRACRIRE  140

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ES+T+LLCGTSGCGKSTLS LLGSRLGITTV+STDSIRHMMRSFV+EK+NPLLWASTY
Sbjct  141  RKESVTILLCGTSGCGKSTLSTLLGSRLGITTVVSTDSIRHMMRSFVEEKQNPLLWASTY  200

Query  542  HAGEHLDPL  568
            HAGE LDP+
Sbjct  201  HAGECLDPV  209



>ref|NP_001130408.1| hypothetical protein [Zea mays]
 gb|ACF78607.1| unknown [Zea mays]
 tpg|DAA39583.1| TPA: hypothetical protein ZEAMMB73_980413 [Zea mays]
Length=705

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 137/189 (72%), Gaps = 14/189 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
             STLQLMGCK RHAF+ISRRVF+ IR    G             D   + + + Y    A
Sbjct  27   HSTLQLMGCKPRHAFEISRRVFDVIRGDHQGHG-----------DTATSARVQRYEVAEA  75

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            +        +   FELYK+RTTV++ R  FLD++ DALA Y YV  NQRADL +ACR+RE
Sbjct  76   TPTAS---PRQFQFELYKRRTTVLLPRDLFLDLVLDALALYKYVAPNQRADLMLACRIRE  132

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ESITVLLCGTSGCGKSTLS LLGSRLGITTV+STDSIRHMMRSFV+EKENPLLWASTY
Sbjct  133  RKESITVLLCGTSGCGKSTLSTLLGSRLGITTVVSTDSIRHMMRSFVEEKENPLLWASTY  192

Query  542  HAGEHLDPL  568
            HAGE LDP+
Sbjct  193  HAGECLDPV  201



>ref|XP_002459870.1| hypothetical protein SORBIDRAFT_02g012650 [Sorghum bicolor]
 gb|EER96391.1| hypothetical protein SORBIDRAFT_02g012650 [Sorghum bicolor]
Length=704

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 137/189 (72%), Gaps = 14/189 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
             STLQLMGCK RHAF+ISRRVF+ IR    G             D   + + + Y    A
Sbjct  27   HSTLQLMGCKPRHAFEISRRVFDVIRGDHQGHG-----------DTAASARVQRYEVAEA  75

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            +        +   FELYK+RTTV++ R  FLD++ DALA Y YV  NQRADL +ACR+RE
Sbjct  76   TPTTS---PRQFQFELYKRRTTVLLPRDLFLDLVLDALALYKYVAPNQRADLKLACRIRE  132

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R+ESITVLLCGTSGCGKSTLS LLGSRLGITTV+STDSIRHMMRSFV+EKENPLLWASTY
Sbjct  133  RKESITVLLCGTSGCGKSTLSTLLGSRLGITTVVSTDSIRHMMRSFVEEKENPLLWASTY  192

Query  542  HAGEHLDPL  568
            HAGE LDP+
Sbjct  193  HAGECLDPV  201



>ref|XP_010653592.1| PREDICTED: uncharacterized protein LOC100260167 isoform X3 [Vitis 
vinifera]
 ref|XP_010653593.1| PREDICTED: uncharacterized protein LOC100260167 isoform X3 [Vitis 
vinifera]
Length=634

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 134/190 (71%), Gaps = 21/190 (11%)
 Frame = +2

Query  47   KISRRVFEKIRNV------------CAGESSVSVCTETLEQDN----LNTFQEEDYNYFA  178
            +ISRRVFE +R+              +G      C E  E++N    ++  + E  + FA
Sbjct  5    QISRRVFEVLRSESFVDAWRPTGMEASGVGDAEGCCE--EENNCCTGVSVSEGEVGDLFA  62

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
            +   ++DD   + PFELYK+ TTVVV R TF D +C  L EY Y+G NQRADL +ACR+R
Sbjct  63   S---QKDDECYAKPFELYKRLTTVVVGRETFFDFVCCVLTEYKYIGPNQRADLALACRIR  119

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ER ES+TVLLCGTSGCGKSTLS LL  RLGITTVISTDSIRHMMRSFVDEK+NPLLWAST
Sbjct  120  EREESVTVLLCGTSGCGKSTLSTLLAGRLGITTVISTDSIRHMMRSFVDEKQNPLLWAST  179

Query  539  YHAGEHLDPL  568
            YHAGE+LDP+
Sbjct  180  YHAGEYLDPM  189



>gb|EMS65521.1| hypothetical protein TRIUR3_04088 [Triticum urartu]
Length=574

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 142/192 (74%), Gaps = 8/192 (4%)
 Frame = +2

Query  158  EDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
            ED N  +  +   D  S S+PFELYK +TT+++ R  FL+++CDAL+ Y YVG NQ+ADL
Sbjct  27   EDANMLSTEI--PDASSSSMPFELYKTQTTILISREKFLNIVCDALSSYKYVGANQKADL  84

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKEN  517
             +ACR++E++ES+TVLLCGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMRSF DEK+N
Sbjct  85   LLACRIKEKKESVTVLLCGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRSFADEKQN  144

Query  518  PLLWASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNAS  697
            PLL+ASTYHAGE+LDP+AVA++KAK+ A             D  ++H +    P+     
Sbjct  145  PLLYASTYHAGEYLDPVAVAKSKAKKLATVSHTNGGKDGTSDVKSHHGSSDLPPR-----  199

Query  698  TFKLISPKQMAI  733
              +LI  KQMAI
Sbjct  200  -TELIGNKQMAI  210



>gb|EMT16535.1| hypothetical protein F775_08208 [Aegilops tauschii]
Length=678

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 134/180 (74%), Gaps = 8/180 (4%)
 Frame = +2

Query  35   RHAFKISRRVFEKIRN--VCAGESSVSVCTETLEQDNLNTFQEEDYNYFAASLDKQDDRS  208
            R +  IS+RVF  +R+  + A  S  +V  E +    +     ED       +   D  S
Sbjct  43   RFSLDISKRVFSVMRSEFLDASRSDRAVKEENVSSMGIG----EDAEMLNTEI--PDASS  96

Query  209  KSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLL  388
             S+PFELYK +TT++V R  FL+++CDAL+ Y YVG NQ+ADL +ACR++E++ES+TVLL
Sbjct  97   SSLPFELYKTQTTILVSRERFLNIVCDALSSYKYVGPNQKADLLLACRIKEKKESVTVLL  156

Query  389  CGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPL  568
            CGTSGCGKSTLS+LLGSRLGITTV+STDSIRHMMRSF DEK+NPLL+ASTYHAGE+LDP+
Sbjct  157  CGTSGCGKSTLSSLLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLYASTYHAGEYLDPV  216



>ref|XP_001754753.1| predicted protein [Physcomitrella patens]
 gb|EDQ80207.1| predicted protein [Physcomitrella patens]
Length=629

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 133/193 (69%), Gaps = 21/193 (11%)
 Frame = +2

Query  5    STLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAAS  184
            STLQLMGCK RHA KIS RVFE IR+         +  +  ++D              A 
Sbjct  36   STLQLMGCKPRHAIKISNRVFEVIRS--------EMPPKQPKRDRFLGLAP------LAD  81

Query  185  LDKQDDRS------KSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIA  346
            +DK+D +       K  P  L KKR+TV V R  FL+V+C+ L++Y Y+G  QR DL +A
Sbjct  82   IDKKDSKEHDSNGFKVNPKPL-KKRSTVTVSREKFLNVVCEGLSQYQYLGPKQRTDLMVA  140

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
            CR+RER+ S+TVLLCGTSGCGKSTL++LLG RLG+TTV+STDS+RHMMR FV E+ENPLL
Sbjct  141  CRIRERKTSVTVLLCGTSGCGKSTLASLLGHRLGVTTVVSTDSVRHMMRGFVSEEENPLL  200

Query  527  WASTYHAGEHLDP  565
            W+STYHAGE LDP
Sbjct  201  WSSTYHAGEFLDP  213



>ref|XP_001766862.1| predicted protein [Physcomitrella patens]
 gb|EDQ68264.1| predicted protein [Physcomitrella patens]
Length=515

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 130/188 (69%), Gaps = 11/188 (6%)
 Frame = +2

Query  5    STLQLMGCKSRHAFKISRRVFEKIRN-VCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            STLQLMGCK RH+ KIS RVFE IR+ +   +S            +++  + E++     
Sbjct  36   STLQLMGCKPRHSIKISDRVFEVIRSQMPPKQSKRDQFVGLAPLADMDNKETEEHITNGL  95

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             +D +            KKR+T  V R  FLDV+C+ LA++ Y+G  QR DL +ACR+RE
Sbjct  96   KVDPKP----------LKKRSTFTVSREKFLDVVCEGLAQHQYLGPKQRTDLMVACRIRE  145

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            +R S+TVLLCGTSGCGKSTL++LLG RLG+TTV+STDS+RHMMR FV E+ENPLLW+STY
Sbjct  146  KRTSVTVLLCGTSGCGKSTLASLLGHRLGVTTVVSTDSVRHMMRGFVSEEENPLLWSSTY  205

Query  542  HAGEHLDP  565
            HAGE LDP
Sbjct  206  HAGEFLDP  213



>ref|XP_001753199.1| predicted protein [Physcomitrella patens]
 gb|EDQ82240.1| predicted protein [Physcomitrella patens]
Length=571

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 125/187 (67%), Gaps = 10/187 (5%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQ MGCK+RHA KIS +VFE I +    +         L  D +    E+   Y   
Sbjct  48   QSTLQFMGCKARHATKISDQVFEVIMSQMPPKKPKRARFPGL--DEVPKKDEKPTLY---  102

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                 D +   +  +  KKR+T  V R  FLDV+CD L +Y Y G+ QR DL +ACR+RE
Sbjct  103  -----DPKGFVVSPKPLKKRSTATVPREKFLDVVCDGLKKYKYHGVKQRMDLMVACRIRE  157

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            +R S+TVLLCGTSGCGKSTL+ LLG RLG+TTV+STDS+RHMMR F+ E+ENPLLWASTY
Sbjct  158  KRSSVTVLLCGTSGCGKSTLATLLGQRLGVTTVVSTDSVRHMMRGFISEQENPLLWASTY  217

Query  542  HAGEHLD  562
            HAGE LD
Sbjct  218  HAGEFLD  224



>gb|EMS58315.1| hypothetical protein TRIUR3_08412 [Triticum urartu]
Length=664

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  197  DDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESI  376
            D  S S+PFELYK +TT++V R  FL+++CDAL+ Y YVG NQ+AD  +ACR++E++ES+
Sbjct  38   DASSSSLPFELYKTQTTILVSRERFLNIVCDALSSYKYVGPNQKADFLLACRIKEKKESV  97

Query  377  TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEH  556
            TVLLCGTSGCGKSTLS+LLGSRLG+TTV+STDSIRHMMRSF DEK+NPLL+ASTYHAGE+
Sbjct  98   TVLLCGTSGCGKSTLSSLLGSRLGMTTVVSTDSIRHMMRSFADEKQNPLLYASTYHAGEY  157

Query  557  LDPL  568
            LDP+
Sbjct  158  LDPV  161



>ref|XP_002968571.1| hypothetical protein SELMODRAFT_89331, partial [Selaginella moellendorffii]
 gb|EFJ30825.1| hypothetical protein SELMODRAFT_89331, partial [Selaginella moellendorffii]
Length=615

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  218  PFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGT  397
            P    KKR+ VV+ R  FLDV+CDALA+Y YVG NQRADL +ACR RER+ S+TVLLCGT
Sbjct  1    PASRSKKRSMVVIGREKFLDVVCDALAQYQYVGPNQRADLMLACRYRERKSSVTVLLCGT  60

Query  398  SGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPL  568
            SGCGKSTLS+LL SRLGITTV+STDSIRHMMRSF DEK NPLLWASTYHAGE LDP+
Sbjct  61   SGCGKSTLSSLLASRLGITTVVSTDSIRHMMRSFADEKSNPLLWASTYHAGEFLDPV  117



>ref|XP_006661579.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like 
[Oryza brachyantha]
Length=647

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  221  FELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTS  400
            FELYK+RTTV+V R  FL ++C ALA Y YV  +QRADL  ACR+RER+ES+T+LLCGTS
Sbjct  24   FELYKRRTTVLVPRPLFLRLVCQALALYKYVAPDQRADLHRACRIRERKESVTILLCGTS  83

Query  401  GCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPL  568
            GCGKSTLS LLGSRLGITTV+STDSIRHMMRSFV+EK+NPLLWASTYHAGE LDP+
Sbjct  84   GCGKSTLSTLLGSRLGITTVVSTDSIRHMMRSFVEEKQNPLLWASTYHAGECLDPV  139



>tpg|DAA60668.1| TPA: hypothetical protein ZEAMMB73_042132 [Zea mays]
 tpg|DAA60669.1| TPA: hypothetical protein ZEAMMB73_042132 [Zea mays]
Length=261

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 127/246 (52%), Positives = 157/246 (64%), Gaps = 27/246 (11%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
             STLQLMGCK RHAF++  +VF+ IR    G             D   + +   Y    A
Sbjct  27   HSTLQLMGCKRRHAFEVRCKVFDVIRGDQQGLG-----------DTATSARVRRYEVAEA  75

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAE--YNYVGLNQRADLTIACRL  355
            +       S+   FELYK+RTTV++ R  FLD++ D  A   Y +V  NQR DL +ACR+
Sbjct  76   T---PTTSSRQFQFELYKRRTTVLLPRDLFLDLVLDLDALALYKFVAPNQRTDLMLACRI  132

Query  356  RERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAS  535
            RER+ESITVL CGTSG  KSTLS LLGSRLGITTV+STDSIRHMMRSFV+E +NPLL AS
Sbjct  133  RERKESITVL-CGTSG--KSTLSMLLGSRLGITTVVSTDSIRHMMRSFVEENKNPLLSAS  189

Query  536  TYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFKLIS  715
            TYHAGE LDP+AVAEAKA+ K KK +G S+     +S  ++   G   ++ +    K I 
Sbjct  190  TYHAGECLDPVAVAEAKARSKVKKRSGVSS-----NSNIDYAKSGALTEKVDG---KSIG  241

Query  716  PKQMAI  733
             KQMAI
Sbjct  242  KKQMAI  247



>ref|XP_008789557.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565 
isoform X2 [Phoenix dactylifera]
Length=538

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 106/152 (70%), Gaps = 11/152 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIR-------NVCAGESSVSVCTETLEQDNLNTFQEE  160
            QSTLQLMGCK+RHAFKISRRVFE +R       + C   SS     +  E        +E
Sbjct  37   QSTLQLMGCKARHAFKISRRVFEVMRSENISKSDACERPSSKGNGCKKNEHCQAGCLSQE  96

Query  161  DYNYFAASLDKQD-DRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADL  337
            +    ++ L ++  D S +I FELYK+ TTVVV R  FLDV+CDAL+ Y YVG NQRADL
Sbjct  97   E---VSSHLTREGIDTSSTILFELYKRLTTVVVTRENFLDVVCDALSMYKYVGPNQRADL  153

Query  338  TIACRLRERRESITVLLCGTSGCGKSTLSALL  433
             +ACR+RER+ES+TVLLCGTSGCGKSTLSALL
Sbjct  154  LLACRIRERKESVTVLLCGTSGCGKSTLSALL  185



>ref|XP_008464657.1| PREDICTED: uncharacterized protein LOC103502490, partial [Cucumis 
melo]
Length=594

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 110/134 (82%), Gaps = 6/134 (4%)
 Frame = +2

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
            CR+RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK+NPLL
Sbjct  50   CRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLL  109

Query  527  WASTYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTI--GKYPQEGNA--  694
            W+STYHAGE LDP+AVAE+KA++KAKKLAG S     KD  AN +       P  G+A  
Sbjct  110  WSSTYHAGEFLDPVAVAESKARKKAKKLAGISHK-HLKDETANGLISRNSDNPLTGSAKV  168

Query  695  -STFKLISPKQMAI  733
             +  +LISPKQMAI
Sbjct  169  TNNLELISPKQMAI  182



>ref|XP_003638065.1| Mutant low phytic acid protein, partial [Medicago truncatula]
Length=111

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMR F +EKENPLLWA
Sbjct  25   IRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRGFANEKENPLLWA  84

Query  533  STYHAGEHLDPL  568
            STYHAGE LDP+
Sbjct  85   STYHAGECLDPV  96



>ref|XP_003638077.1| 2-phosphoglycerate kinase [Medicago truncatula]
Length=601

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 106/131 (81%), Gaps = 6/131 (5%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +RER+ES+TVLLCGTSGCGKSTLSALLGSRLGITTV+STDSIRHMMR F +EKENPLLWA
Sbjct  25   IRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRGFANEKENPLLWA  84

Query  533  STYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYP----QEGNAST  700
            STYHAGE LDP+AVAEAKAKR+AKK+AG S  +P+ +    H T  K+     + G  +T
Sbjct  85   STYHAGECLDPVAVAEAKAKRRAKKMAGVSQSLPKDEVTEGH-TSSKFDIHTLEAGCGAT  143

Query  701  FKLISPKQMAI  733
             +L S KQMA+
Sbjct  144  ERLNS-KQMAV  153



>ref|XP_008363522.1| PREDICTED: uncharacterized protein LOC103427234 [Malus domestica]
Length=297

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 86/116 (74%), Gaps = 8/116 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QS+LQLMGCK RHAFKIS+RVFE IRN    ESS +V       +N+   ++E  N+  +
Sbjct  84   QSSLQLMGCKPRHAFKISQRVFELIRN----ESSSNVLLPE-GTENVPPSKDEAGNHLGS  138

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIAC  349
                +DDRSKS+PFELYK RTTVVVRR TFLDV+CDALAEY YVG NQRADL +AC
Sbjct  139  G---KDDRSKSVPFELYKARTTVVVRRKTFLDVVCDALAEYKYVGPNQRADLALAC  191



>ref|XP_005644750.1| hypothetical protein COCSUDRAFT_67534 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20206.1| hypothetical protein COCSUDRAFT_67534 [Coccomyxa subellipsoidea 
C-169]
Length=584

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 90/246 (37%), Positives = 127/246 (52%), Gaps = 26/246 (11%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFE----KIRNVCA--GESSVSVCTETLEQDNL--NTFQE  157
            +STL LMGCK R A K S+ +FE    K+R   A  G  +  +  +     N   +    
Sbjct  77   KSTLLLMGCKPRVAHKASKSLFESMAKKLRGAAADDGYDTTKLTIDATAGSNGTNDMLHS  136

Query  158  EDYNYFAASLD--KQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRA  331
            +D   +  +L     D R   +P     ++ TV + R  +  ++ + + EY    L    
Sbjct  137  KDGLIWTHALQILNLDGRVGVLP----GRKATVSLYREEWERLVMEQIREYTDKLLASE-  191

Query  332  DLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK  511
            D ++AC +RE+R S+TVLL GTSG GKSTL+ LL +RLGI+T++STDS+R+MMRSF  ++
Sbjct  192  DFSLACSIREQRRSVTVLLAGTSGTGKSTLAGLLAARLGISTIVSTDSVRNMMRSFTPQE  251

Query  512  ENPLLWASTYH--------AGEHLDPLavaeakakrkakklaGYSTPVPQKDS---AANH  658
             NPLLWASTY         AG+H+  L      A          STP P+  S   A   
Sbjct  252  ANPLLWASTYEARPTQHGSAGQHVGELEEVRPAAAAPVDLPGKASTPPPRSSSLNQAVKQ  311

Query  659  MTIGKY  676
             TI  Y
Sbjct  312  RTIKGY  317



>ref|XP_002649184.1| hypothetical protein DDB_G0273453 [Dictyostelium discoideum AX4]
 ref|XP_002649187.1| hypothetical protein DDB_G0273565 [Dictyostelium discoideum AX4]
 sp|Q8T1P1.2|Y3453_DICDI RecName: Full=Uncharacterized protein DDB_G0273453/DDB_G0273565 
[Dictyostelium discoideum]
 gb|EEU04132.1| hypothetical protein DDB_G0273453 [Dictyostelium discoideum AX4]
 gb|EEU04135.1| hypothetical protein DDB_G0273565 [Dictyostelium discoideum AX4]
Length=839

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 109/190 (57%), Gaps = 16/190 (8%)
 Frame = +2

Query  8    TLQLMGCKSRHAFKISRRVFEKI--------RNVCAGESSVSVCTETLEQDNLNTFQEED  163
            TL+ MGCKS HA +IS  VFE++        + + A  ++  V T+++ +    T Q   
Sbjct  133  TLKFMGCKSIHARQISNTVFEQLEKCRIEQNKQLTATNNNAIVTTDSITK----TEQSTT  188

Query  164  YNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTI  343
                  +       + +    +Y     V ++R+ F  +I   L+ Y Y       D  +
Sbjct  189  TTTTTTTTTTTTTATTTTQPPIY----CVSIQRNIFYYIIGHILSCYQYSKPQYIIDFPV  244

Query  344  ACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPL  523
            +C +++++ S T+LL GTSGCGKSTL+ALL SR+G T VISTD+IR ++R F+  +E+P+
Sbjct  245  SCEVQDKKHSFTILLGGTSGCGKSTLTALLASRIGFTAVISTDNIRQLLRKFISRQESPI  304

Query  524  LWASTYHAGE  553
            LWASTYHAGE
Sbjct  305  LWASTYHAGE  314



>ref|XP_008466869.1| PREDICTED: uncharacterized protein LOC103504181 [Cucumis melo]
Length=209

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 79/126 (63%), Gaps = 9/126 (7%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            QSTLQLMGCK RHAFKIS+ VFE IR   + E+ +      L   +L    E D N +  
Sbjct  74   QSTLQLMGCKPRHAFKISKWVFELIRKEASTENFLPEEWNVLGSISLGGNTESDGNQYYN  133

Query  182  SLD---------KQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
             LD         ++ D S +IPFELYK+  T VV R +FLDVICD+LA+Y YVG NQRAD
Sbjct  134  CLDGKETFNQGSREGDNSNNIPFELYKRSRTAVVGRESFLDVICDSLAKYKYVGPNQRAD  193

Query  335  LTIACR  352
            L +ACR
Sbjct  194  LILACR  199



>ref|XP_003293690.1| hypothetical protein DICPUDRAFT_158593 [Dictyostelium purpureum]
 gb|EGC29782.1| hypothetical protein DICPUDRAFT_158593 [Dictyostelium purpureum]
Length=590

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 102/182 (56%), Gaps = 16/182 (9%)
 Frame = +2

Query  8    TLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAASL  187
            TL+ MGCKS HA +IS  VFE+    C  E + +                        + 
Sbjct  142  TLKFMGCKSIHARQISNAVFEQFEK-CRTEVNNNNSNNNNN---------------NNNS  185

Query  188  DKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERR  367
            +   + + +     Y+    + ++R+ F  +I   LA + Y     + D  ++C +++++
Sbjct  186  NNNSNNNNNNNNNSYRPIYCLSIQRNIFYYIIGHILACFQYSKPQYQVDFPVSCEVQDKK  245

Query  368  ESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHA  547
             S T+LL GTSGCGKSTL+ALL SR+G T VISTD+IR ++R F+  +E+P+LWASTYHA
Sbjct  246  HSFTILLGGTSGCGKSTLTALLASRIGFTAVISTDNIRQLLRKFISRQESPILWASTYHA  305

Query  548  GE  553
            GE
Sbjct  306  GE  307



>ref|XP_003638078.1| hypothetical protein MTR_117s0049 [Medicago truncatula]
Length=168

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 86/134 (64%), Gaps = 20/134 (15%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFK----ISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQ---EE  160
            QSTLQLMGCK+RHAFK    ISRRVFE  R   +G S+ +  +E +     +  +   ++
Sbjct  26   QSTLQLMGCKARHAFKMIGEISRRVFELTR---SGSSTDAFKSEGIVLSGFDASKGNVKK  82

Query  161  DYNYFAAS----------LDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNY  310
            D    +A           L  +D+ SKS+PFELYK+RTTV VRR TFLD++CD LAEY Y
Sbjct  83   DCQEASACSRKTDVGNHLLSGKDNGSKSVPFELYKRRTTVFVRRETFLDIVCDVLAEYKY  142

Query  311  VGLNQRADLTIACR  352
            VG NQRADL +ACR
Sbjct  143  VGPNQRADLMLACR  156



>ref|XP_004360330.1| hypothetical protein DFA_04607 [Dictyostelium fasciculatum]
 gb|EGG22479.1| hypothetical protein DFA_04607 [Dictyostelium fasciculatum]
Length=620

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 102/182 (56%), Gaps = 8/182 (4%)
 Frame = +2

Query  8    TLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAASL  187
            TL+ MGCKS HA +I+  +F+++ N            +  +   L     +  + F ++ 
Sbjct  176  TLKFMGCKSLHARQITSSIFDQLENCRVEVEQQQQNQQNQQGHPLPPAPPQ--HNFNSNN  233

Query  188  DKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERR  367
                  + ++P         V + R TF  ++   L+ Y Y      +D  +AC ++E++
Sbjct  234  YNNFSNADNLPV------YCVSLLRSTFYYIVGHILSTYQYSKPQYISDFPVACDVQEKK  287

Query  368  ESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHA  547
             S T+LL GTSGCGKSTL+ALL SR+G   VISTD+IR ++R F+   E+P+LWASTYHA
Sbjct  288  HSFTILLGGTSGCGKSTLTALLASRIGFAAVISTDNIRQILRKFISRTESPILWASTYHA  347

Query  548  GE  553
            GE
Sbjct  348  GE  349



>dbj|GAM23845.1| hypothetical protein SAMD00019534_070200 [Acytostelium subglobosum 
LB1]
Length=559

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 103/191 (54%), Gaps = 28/191 (15%)
 Frame = +2

Query  8    TLQLMGCKSRHAFKISRRVFEKIRNV--CAGESSVSVCTETLEQDNLNTFQEEDYN--YF  175
            TL+ M CKS HA +I+  VF+++      A  S      +     N N+ +E+  N   F
Sbjct  139  TLKFMCCKSVHARQITSVVFDQMEKCRKLAYSSGWEFRRKKTTTTNNNSSEEDITNGPIF  198

Query  176  AASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRL  355
              SL                        R TF  ++   ++ Y Y   +  +D  +AC +
Sbjct  199  CVSL-----------------------LRSTFYHIVRHVISTYQYSKPHHISDFPVACEV  235

Query  356  RERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAS  535
            +E++ S T+LL GTSGCGKSTL+ALL SR+G   VISTD+IR ++R F+   E+P+LWAS
Sbjct  236  QEKKHSFTILLGGTSGCGKSTLTALLASRIGFAAVISTDNIRQILRKFISRAESPILWAS  295

Query  536  TYHAGEHL-DP  565
            TYHAGE + DP
Sbjct  296  TYHAGEIISDP  306



>ref|XP_002952613.1| hypothetical protein VOLCADRAFT_105596 [Volvox carteri f. nagariensis]
 gb|EFJ46166.1| hypothetical protein VOLCADRAFT_105596 [Volvox carteri f. nagariensis]
Length=1502

 Score =   122 bits (306),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 58/100 (58%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +2

Query  260  RHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGS  439
            R  F +++C  L EYNY       ++  AC L+ERR  I VLLCGTSG GKSTL+++L S
Sbjct  3    RSEFYELVCSTLTEYNYKYAPSSDEIKAACSLKERRRHIIVLLCGTSGSGKSTLASILAS  62

Query  440  RLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHL  559
            RLGI TV+STDS+RHMMR F   +E PLL+ASTY AGE L
Sbjct  63   RLGICTVLSTDSVRHMMRGFTTAEETPLLFASTYEAGEAL  102



>gb|EFA85558.1| hypothetical protein PPL_01517 [Polysphondylium pallidum PN500]
Length=446

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 100/195 (51%), Gaps = 33/195 (17%)
 Frame = +2

Query  8    TLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSV----CTETLEQDNLNTFQEEDYNYF  175
            TL+ MGCKS HA  I+  +FE++        S S+    C  T                 
Sbjct  138  TLKFMGCKSIHARHITSAIFEQLEKCRVAAHSQSLQFKRCPMT-----------------  180

Query  176  AASLDKQDDRSKSIPFELYKKRTTVV----VRRHTFLDVICDALAEYNYVGLNQRADLTI  343
                      S S    L    T  +    + + TF  ++   ++ Y Y      +D  +
Sbjct  181  -------PPTSTSTVVALNSNATDTIYCVGMLKSTFFYIVGYIISTYQYSKPQYISDFPV  233

Query  344  ACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPL  523
            AC ++E++ S T+LL GTSGCGKSTL+ALL SR+G   VISTD+IR ++R F+   E+P+
Sbjct  234  ACDVQEKKHSFTILLGGTSGCGKSTLTALLASRIGFAAVISTDNIRQILRKFISRTESPI  293

Query  524  LWASTYHAGEHL-DP  565
            LWASTYHAGE + DP
Sbjct  294  LWASTYHAGEIISDP  308



>gb|EJY87786.1| hypothetical protein OXYTRI_23647 [Oxytricha trifallax]
Length=1429

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 107/189 (57%), Gaps = 23/189 (12%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAG-------ESSVSVCTET--LEQDNLNTFQ  154
            ++T Q++GCK  +A +I+  VF++I  +          E    + TET  +E  N N   
Sbjct  285  KATCQVIGCKPINANQIAEGVFDEINLILNNLSQSIDFEMHFDIKTETVPIEIQNEN---  341

Query  155  EEDYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRAD  334
                       D ++   +S     Y++ TT+      F  V+   L +Y Y       D
Sbjct  342  -----------DPENTNRQSQKGVRYQQITTITTSAPLFKYVLSKHLEKYKYSRPEYLKD  390

Query  335  LTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKE  514
              IAC L + + +I VLL GTSG GKSTL++LLGSRLGI+TV+STD+IRH+MR+FV ++E
Sbjct  391  FYIACDLVQSKRNILVLLAGTSGTGKSTLASLLGSRLGISTVLSTDTIRHVMRNFVSKEE  450

Query  515  NPLLWASTY  541
            NP+L+ASTY
Sbjct  451  NPVLFASTY  459



>ref|XP_009533694.1| hypothetical protein PHYSODRAFT_287138 [Phytophthora sojae]
 gb|EGZ10949.1| hypothetical protein PHYSODRAFT_287138 [Phytophthora sojae]
Length=729

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 102/189 (54%), Gaps = 16/189 (8%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKI-RNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFA  178
            Q TL LMGC+ + A  +++ VF    ++V +G+  V +   +    N N   EE      
Sbjct  34   QETLMLMGCRPKDAVTVTQEVFAVFAKHVASGDGHVIIIISSSNSGNGNNSDEE------  87

Query  179  ASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
                    R K    E  +++  V +  H     I  +LA  +YV  +   D  +A  + 
Sbjct  88   --------REKQQQLE-EERKLPVALPWHLLHQCIYSSLARLDYVKPHHLLDFEVAKEIT  138

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            +R +S  VLL GTSG GKSTL++LL +RL +TTV+ TDS+RH++RSF  ++ENP  + ST
Sbjct  139  QRNQSFAVLLGGTSGTGKSTLASLLAARLRLTTVLPTDSVRHVLRSFTSKEENPCAFVST  198

Query  539  YHAGEHLDP  565
            Y AG+ L P
Sbjct  199  YQAGDALSP  207



>ref|XP_001429197.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK61799.1| unnamed protein product [Paramecium tetraurelia]
Length=384

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 103/189 (54%), Gaps = 33/189 (17%)
 Frame = +2

Query  11   LQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAASLD  190
            LQ+ GCK+ H++ +  ++FE I                             ++    + D
Sbjct  42   LQISGCKAAHSYSLCEKIFEMI-----------------------------FSKLLENFD  72

Query  191  KQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQ---RADLTIACRLRE  361
            KQ +  + +  +  K+  +  +    F +++ +++ E  Y+   +   + D  IA  L E
Sbjct  73   KQKNH-QPLNGQSNKQVNSATITEKHFKELVFNSVFEKKYIREKEDLYKEDFQIAWSLTE  131

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            +++ + +L  GTSG GKST S++L SR GI+TV+STDSIRH+MR+F+ ++ENP+L+ASTY
Sbjct  132  KKQPLIILFGGTSGTGKSTASSILASRFGISTVLSTDSIRHIMRNFLSKEENPVLFASTY  191

Query  542  HAGEHLDPL  568
             AG+ L  L
Sbjct  192  EAGKTLPDL  200



>ref|XP_005845927.1| hypothetical protein CHLNCDRAFT_136554 [Chlorella variabilis]
 gb|EFN53825.1| hypothetical protein CHLNCDRAFT_136554 [Chlorella variabilis]
Length=707

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
             D  IAC LRE+R S+ VLLCGTSG GKSTL+ALL +RLGI+TV+STDSIRHMMRSF  E
Sbjct  184  GDFRIACALREQRASVAVLLCGTSGTGKSTLAALLAARLGISTVVSTDSIRHMMRSFSSE  243

Query  509  KENPLLWASTYHAGEHL  559
             E+PLLWASTY AG HL
Sbjct  244  AEDPLLWASTYEAGLHL  260



>ref|XP_005824437.1| hypothetical protein GUITHDRAFT_58146, partial [Guillardia theta 
CCMP2712]
 gb|EKX37457.1| hypothetical protein GUITHDRAFT_58146, partial [Guillardia theta 
CCMP2712]
Length=256

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  332  DLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK  511
            D  ++C +RERR S+ +L  GTSGCGKSTL++L  SRLGITTV+STD IRHM+R  V ++
Sbjct  1    DFIMSCSIRERRSSMIILFGGTSGCGKSTLASLTASRLGITTVLSTDFIRHMLRREVSKE  60

Query  512  ENPLLWASTYHAGEHLD  562
            ++P+L+ASTY+AGE L+
Sbjct  61   DSPILYASTYNAGESLE  77



>ref|XP_008344879.1| PREDICTED: uncharacterized protein LOC103407782, partial [Malus 
domestica]
Length=560

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 81/105 (77%), Gaps = 4/105 (4%)
 Frame = +2

Query  428  LLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPLavaeakakrkakk  607
            L GSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE LDP+AVAEAKAK+KAKK
Sbjct  19   LQGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGECLDPVAVAEAKAKKKAKK  78

Query  608  laGYSTPVPQKDSAANHMTIGKYP---QEGNASTFKLISPKQMAI  733
            LAG    +  KD   +    GK      +  +ST +LISPKQMA+
Sbjct  79   LAGTPHSL-SKDGMPDGSAFGKSDTRLSDVGSSTAELISPKQMAV  122



>ref|XP_004337685.1| hypothetical protein ACA1_377870 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR15672.1| hypothetical protein ACA1_377870 [Acanthamoeba castellanii str. 
Neff]
Length=544

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
            ++ +IA  +  R++S T+LL GTSGCGKSTL++ L SR+G TTVISTD+IRHMMRSF+  
Sbjct  206  SNFSIAADVTFRQQSFTILLGGTSGCGKSTLASFLASRIGFTTVISTDNIRHMMRSFIPA  265

Query  509  KENPLLWASTYHAGEHLD  562
             + P+L+ASTYHAGE ++
Sbjct  266  DQAPVLFASTYHAGEVMN  283



>ref|XP_001433077.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK65680.1| unnamed protein product [Paramecium tetraurelia]
Length=745

 Score =   102 bits (253),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 60/189 (32%), Positives = 103/189 (54%), Gaps = 33/189 (17%)
 Frame = +2

Query  11   LQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAASLD  190
            LQ+ GCK+ H++ +  ++FE I                             ++    + D
Sbjct  42   LQISGCKAAHSYSLCEKIFEMI-----------------------------FSKLLENFD  72

Query  191  KQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQ---RADLTIACRLRE  361
            KQ +  + +  +  K+  +  +    F +++ +++ E  Y+   +   + D  IA  L E
Sbjct  73   KQKNH-QPLNGQSNKQVNSATITEKHFKEIVFNSVFEKKYIREKEDLYKEDFQIAWSLTE  131

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            +++ + +L  GTSG GKST S++L SR GI+TV+STDSIRH+MR+F+ ++ENP+L+ASTY
Sbjct  132  KKQPLIILFGGTSGTGKSTASSILASRFGISTVLSTDSIRHIMRNFLSKEENPVLFASTY  191

Query  542  HAGEHLDPL  568
             AG+ L  L
Sbjct  192  EAGKTLPDL  200



>gb|ETK71656.1| hypothetical protein L915_21130 [Phytophthora parasitica]
Length=731

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 95/188 (51%), Gaps = 25/188 (13%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            Q TL LMGC+ + A  +++ VF       + ES+ S  +      + +  +EE       
Sbjct  34   QETLMLMGCRPKDAVIVTKEVFAVFNKHLSRESNSSSGSLYSNNSDEDKGEEE-------  86

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                   +   IP              H     I  +LA  +YV  +   D  +A  + +
Sbjct  87   -------QKPPIPLPW-----------HLLHQCIYSSLARLDYVKPHHLLDFEVAKEITQ  128

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R +S  VLL GTSG GKSTL++LL +RL +TTV+ TDS+RH++RSF  ++ENP  + STY
Sbjct  129  RNQSFAVLLGGTSGTGKSTLASLLAARLRLTTVLPTDSVRHVLRSFTSKEENPCAFVSTY  188

Query  542  HAGEHLDP  565
             AG+ L P
Sbjct  189  QAGDALSP  196



>ref|XP_008898612.1| hypothetical protein PPTG_06444 [Phytophthora parasitica INRA-310]
 gb|ETI31242.1| hypothetical protein F443_21730 [Phytophthora parasitica P1569]
 gb|ETL25078.1| hypothetical protein L916_21006 [Phytophthora parasitica]
 gb|ETL78308.1| hypothetical protein L917_20863 [Phytophthora parasitica]
 gb|ETM31569.1| hypothetical protein L914_20876 [Phytophthora parasitica]
 gb|ETN16267.1| hypothetical protein PPTG_06444 [Phytophthora parasitica INRA-310]
 gb|ETO59974.1| hypothetical protein F444_21759 [Phytophthora parasitica P1976]
 gb|ETP01073.1| hypothetical protein F441_21617 [Phytophthora parasitica CJ01A1]
 gb|ETP29218.1| hypothetical protein F442_21591 [Phytophthora parasitica P10297]
Length=731

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 95/188 (51%), Gaps = 25/188 (13%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            Q TL LMGC+ + A  +++ VF       + ES+ S  +      + +  +EE       
Sbjct  34   QETLMLMGCRPKDAVIVTKEVFAVFNKHLSRESNSSSGSLYSNNSDEDKGEEE-------  86

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                   +   IP              H     I  +LA  +YV  +   D  +A  + +
Sbjct  87   -------QKPPIPLPW-----------HLLHQCIYSSLARLDYVKPHHLLDFEVAKEITQ  128

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R +S  VLL GTSG GKSTL++LL +RL +TTV+ TDS+RH++RSF  ++ENP  + STY
Sbjct  129  RNQSFAVLLGGTSGTGKSTLASLLAARLRLTTVLPTDSVRHVLRSFTSKEENPCAFVSTY  188

Query  542  HAGEHLDP  565
             AG+ L P
Sbjct  189  QAGDALSP  196



>ref|XP_001452064.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK84667.1| unnamed protein product [Paramecium tetraurelia]
Length=738

 Score =   100 bits (248),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 67/190 (35%), Positives = 102/190 (54%), Gaps = 35/190 (18%)
 Frame = +2

Query  11   LQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLE-QDNLNTFQEEDYNYFAASL  187
            LQ+ GCK+ H++ +  ++F +I         +S  +E +E Q N   F +     F    
Sbjct  40   LQISGCKASHSYHLCEKIFVQI---------LSKLSENIEKQKNAILFDQISNPQF----  86

Query  188  DKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYV---GLNQRADLTIACRLR  358
             KQ                 + +    F + +  +L E  Y+   G   R D  IA  L 
Sbjct  87   -KQ-----------------ITITEKEFKEHVFSSLLEKKYIQVKGELYREDFEIAWNLT  128

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            E+++ + +LL GTSG GKST S++L SR GI+TV+STDSIRH+MR+F+ + +NP+L+AST
Sbjct  129  EKKQPLIILLGGTSGTGKSTASSILASRFGISTVLSTDSIRHIMRNFLSKDDNPVLFAST  188

Query  539  YHAGEHLDPL  568
            Y AG+ L  L
Sbjct  189  YEAGKTLPDL  198



>emb|CDS04634.1| hypothetical protein LRAMOSA07220 [Absidia idahoensis var. thermophila]
Length=373

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 77/127 (61%), Gaps = 13/127 (10%)
 Frame = +2

Query  170  YFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIAC  349
            Y+   +  +D  S+  P +L           +TFL  +   +A   Y   N   DL IA 
Sbjct  5    YWIGFIRDEDVYSEDEPIDL-----------NTFLLQLQTLIARLRYT--NPLMDLEIAW  51

Query  350  RLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLW  529
             +  + ES+ +LL GTSGCGKSTL++LL  R+GITTV+STD +R ++RSF  +K++ +LW
Sbjct  52   DIVNKNESVCILLGGTSGCGKSTLASLLAHRIGITTVLSTDHVRSLLRSFDPKKKSAILW  111

Query  530  ASTYHAG  550
            AS+YHAG
Sbjct  112  ASSYHAG  118



>ref|XP_002902823.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY55993.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=794

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 100/189 (53%), Gaps = 25/189 (13%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            Q TL LMGC+ + A  +++ VF             +V ++ L +++ ++      N    
Sbjct  93   QETLMLMGCRPKDAVTVTKEVF-------------AVFSKHLSRESNSSSGSLYSNNSDD  139

Query  182  SLDKQDDRSK-SIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLR  358
              DK+ +  K S+P              H     I  +LA  +YV  +   D  +A  + 
Sbjct  140  EEDKEREEQKLSMPLPW-----------HLLHQCIYSSLARLDYVKPHHLLDFEVAKEIT  188

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            +R +S  VLL GTSG GKSTL++LL +RL +TTV+ TDS+RH++RSF  ++ENP  + ST
Sbjct  189  QRNQSFAVLLGGTSGTGKSTLASLLAARLRLTTVLPTDSVRHVLRSFTSKEENPCAFVST  248

Query  539  YHAGEHLDP  565
            Y AG+ L P
Sbjct  249  YQAGDALSP  257



>emb|CDW78661.1| UNKNOWN [Stylonychia lemnae]
Length=1404

 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 104/188 (55%), Gaps = 34/188 (18%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            ++T Q++GCK  +A +I+  VF++I  +      ++  +++++ D     + +    F +
Sbjct  301  KATCQVIGCKPINANQIAEGVFDEINQI------LNNLSQSIDFDMHFDIKAKSNEIFES  354

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
            S  +Q  +S                 +++ +  I  +   + YV             L+ 
Sbjct  355  SEQEQARQSSK--------------NKYSQITTITTSAPFFKYV-------------LKS  387

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            +R +I VLL GTSG GKSTL++LLGSRLGI+TV+STD+IRH+MR+FV ++ENP+L+ASTY
Sbjct  388  KR-NILVLLAGTSGTGKSTLASLLGSRLGISTVLSTDTIRHVMRNFVSKEENPILFASTY  446

Query  542  HAGEHLDP  565
                   P
Sbjct  447  ETAAFAPP  454



>gb|KDD75878.1| hypothetical protein H632_c458p0 [Helicosporidium sp. ATCC 50920]
Length=657

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 110/199 (55%), Gaps = 31/199 (16%)
 Frame = +2

Query  23   GCKSRHAFKISRRVFEKIRNVCAGESS--VSVCTETLEQDNLNTFQEEDYNYFAASLDKQ  196
            GCK RHA + + RVF  ++     ++S  +SV  E + Q++ +  ++       AS+D+Q
Sbjct  50   GCKPRHAERATERVFLTLQQRAGLDASHPLSVKVEHVLQESHHGSEQGR-----ASVDEQ  104

Query  197  DDRSKSIPFELYKKRTTVVVRRHTFLDVI------------CDALAEYNYV---------  313
            D  S            TV V+R    +++             DA+A    +         
Sbjct  105  DVSSS---VNRPPAHVTVCVKRDALEELLTRCLLSCKSDAPSDAVAAGTLLEEEPGMPPS  161

Query  314  GLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMR  493
            G   RAD+ +AC L ERR    VLLCGTSG GKSTL+ALL +RLG+ +VISTDSIRH++R
Sbjct  162  GSLLRADIRVACLLSERRLCAIVLLCGTSGTGKSTLAALLAARLGLASVISTDSIRHVVR  221

Query  494  SFVDEKENPLLWASTYHAG  550
            +F   +++PLLWASTY AG
Sbjct  222  AFSLREQHPLLWASTYEAG  240



>gb|KDO27640.1| hypothetical protein SPRG_06911 [Saprolegnia parasitica CBS 223.65]
Length=677

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 87/188 (46%), Gaps = 49/188 (26%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            Q TL LMGC+++ A  ++  +FE       G +S                          
Sbjct  36   QETLALMGCRTKDAVDVTASIFEAYHAFGVGATS--------------------------  69

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                        PFE  +               +   LA+ +Y   +Q  D  IA  + +
Sbjct  70   ----------HWPFESLQHE-------------VYAQLAKLDYTKTSQLLDFDIAKEITQ  106

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R +S  VLL GTSG GKSTL++LL SRL +TTV+ TDS+RH+ R+F+ ++ +P  + STY
Sbjct  107  RNKSFVVLLGGTSGTGKSTLASLLASRLRLTTVLPTDSVRHISRAFLTKESHPCAFMSTY  166

Query  542  HAGEHLDP  565
             AGE L P
Sbjct  167  QAGEALTP  174



>ref|XP_008617667.1| hypothetical protein SDRG_13362 [Saprolegnia diclina VS20]
 gb|EQC28850.1| hypothetical protein SDRG_13362 [Saprolegnia diclina VS20]
Length=669

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 87/188 (46%), Gaps = 49/188 (26%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            Q TL LMGC+++ A  ++  +F+       G +S                          
Sbjct  36   QETLALMGCRTKDAVDVTGSIFQAYHAFGVGATS--------------------------  69

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
                        PFE  +               +   LA+ +Y   +Q  D  IA  + +
Sbjct  70   ----------HWPFESLQHE-------------VYAQLAKLDYTKTSQLLDFDIAKEITQ  106

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R +S  VLL GTSG GKSTL++LL SRL +TTV+ TDS+RH+ R+F+ ++ +P  + STY
Sbjct  107  RNKSFVVLLGGTSGTGKSTLASLLASRLRLTTVLPTDSVRHISRAFLTKESHPCAFMSTY  166

Query  542  HAGEHLDP  565
             AGE L P
Sbjct  167  QAGEALTP  174



>gb|KDO16266.1| hypothetical protein SPRG_18200 [Saprolegnia parasitica CBS 223.65]
Length=634

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +2

Query  293  LAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTD  472
            LA+ +Y   +Q  D  IA  + +R +S  VLL GTSG GKSTL++LL SRL +TTV+ TD
Sbjct  43   LAKLDYTKTSQLLDFDIAKEITQRNKSFVVLLGGTSGTGKSTLASLLASRLRLTTVLPTD  102

Query  473  SIRHMMRSFVDEKENPLLWASTYHAGEHLDP  565
            S+RH+ R+F+ ++ +P  + STY AGE L P
Sbjct  103  SVRHISRAFLTKESHPCAFMSTYQAGEALTP  133



>emb|CCA28030.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=808

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 93/195 (48%), Gaps = 20/195 (10%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVF-------EKIRNVCAGESSVSVCTETLEQDNLNTFQEE  160
            Q TL LMGC+ + A  +++  F       +K +NV +  S+ S      E    +     
Sbjct  35   QETLMLMGCRQKDAVIVTKEAFGVFKQYTQKQQNVNSLNSAQSASGTKEEASCADGSTCT  94

Query  161  DYNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLT  340
            +    +   D     +  +P+    +              I   LA  NY       D  
Sbjct  95   NKTVQSVGKDPSQATTHHLPWNYLHQ-------------CIYSTLARLNYTKPQDLLDFE  141

Query  341  IACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENP  520
            IA  +  R ++  VLL GTSG GKSTL++LL +RL +TTV+ TDSIRH++RS   +++NP
Sbjct  142  IAKEVTHRNQAFIVLLGGTSGTGKSTLASLLAARLRLTTVLPTDSIRHVLRSVTCKEQNP  201

Query  521  LLWASTYHAGEHLDP  565
              + STY AG+ L P
Sbjct  202  CAFVSTYQAGDALPP  216



>emb|CCI45713.1| unnamed protein product [Albugo candida]
Length=803

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 95/191 (50%), Gaps = 12/191 (6%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFA-  178
            Q TL LMGC+ + A  +++  F   +       +          +  N  Q    N    
Sbjct  35   QETLMLMGCRQKDAVIVTKEAFGVFKQYTQKHQNA---------NPHNPVQSASGNKEGL  85

Query  179  ASLDKQDDRSKSIPFELYKKRTTVV--VRRHTFLDVICDALAEYNYVGLNQRADLTIACR  352
            AS+D      K++  +  +   TV   +  +     I   LA  NY   +   D  IA  
Sbjct  86   ASVDVSRCTDKTVHSDAQEPGETVEHNLPWNYLHQCIYSTLARLNYTKPHDLLDFEIAKE  145

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +  R+++  VLL GTSG GKSTL++LL +RL +TTV+ TDSIRH++RS   +++NP  + 
Sbjct  146  VTHRKQAFIVLLGGTSGTGKSTLASLLAARLRLTTVLPTDSIRHVLRSVTCKEKNPCAFV  205

Query  533  STYHAGEHLDP  565
            STY AG+ L P
Sbjct  206  STYQAGDALPP  216



>ref|XP_008880874.1| hypothetical protein H310_14729 [Aphanomyces invadans]
 gb|ETV90486.1| hypothetical protein H310_14729 [Aphanomyces invadans]
Length=504

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 90/188 (48%), Gaps = 48/188 (26%)
 Frame = +2

Query  2    QSTLQLMGCKSRHAFKISRRVFEKIRNVCAGESSVSVCTETLEQDNLNTFQEEDYNYFAA  181
            Q TL LMGC+   A  ++R +FE+                                 + A
Sbjct  41   QETLTLMGCRRNDAIIVTRLMFEQ---------------------------------YHA  67

Query  182  SLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRE  361
             +D    R+ +  F++ ++R             +   LA   Y       D  +A  + +
Sbjct  68   HVDGPSPRAWT--FQMLQQR-------------VYAELAHLEYNKPTHLLDFDLAKEITQ  112

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            R +S  VLL GTSG GKSTL++LL SRL +TTV+ TDS+RH+ R+F+ +++NP  + STY
Sbjct  113  RNKSFVVLLGGTSGTGKSTLASLLASRLRLTTVLPTDSVRHISRAFMTKEQNPCAFTSTY  172

Query  542  HAGEHLDP  565
             AG+ L P
Sbjct  173  QAGDALTP  180



>gb|EAR99658.2| AAA domain protein [Tetrahymena thermophila SB210]
Length=1296

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +2

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
             ++ +++  + +LL GTSG GKSTLS++L SR  I TV+STDSIRH+MR+F++E E PLL
Sbjct  220  MQILQKKYPLIILLGGTSGTGKSTLSSILASRFQIPTVLSTDSIRHIMRNFMEESEEPLL  279

Query  527  WASTYHAGEHL  559
            ++STY AG+ L
Sbjct  280  FSSTYEAGKIL  290



>ref|XP_001019903.1| hypothetical protein TTHERM_00589950 [Tetrahymena thermophila]
Length=1399

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +2

Query  347  CRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLL  526
             ++ +++  + +LL GTSG GKSTLS++L SR  I TV+STDSIRH+MR+F++E E PLL
Sbjct  220  MQILQKKYPLIILLGGTSGTGKSTLSSILASRFQIPTVLSTDSIRHIMRNFMEESEEPLL  279

Query  527  WASTYHAGEHL  559
            ++STY AG+ L
Sbjct  280  FSSTYEAGKIL  290



>ref|NP_001048534.1| Os02g0819400 [Oryza sativa Japonica Group]
 dbj|BAF10448.1| Os02g0819400, partial [Oryza sativa Japonica Group]
Length=522

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 74/106 (70%), Gaps = 12/106 (11%)
 Frame = +2

Query  434  GSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDPLavaeakakrkakkla  613
            GSRLGITTV+STDSIRHMMR F DEK+NPLL+ASTYHAGE LDP+AVA+AKAKRKA+KL 
Sbjct  11   GSRLGITTVVSTDSIRHMMRGFTDEKQNPLLYASTYHAGECLDPVAVAQAKAKRKAQKLD  70

Query  614  GYSTPVPQK------DSAANHMTIGKYPQEGNASTFKLISPKQMAI  733
              S P   +      D  A+H +    P+       +LI  KQMAI
Sbjct  71   IVSHPNTNEGRDDTSDDKAHHGSSELPPRT------ELIGSKQMAI  110



>ref|XP_001304249.1| hypothetical protein [Trichomonas vaginalis G3]
 gb|EAX91319.1| conserved hypothetical protein [Trichomonas vaginalis G3]
Length=251

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 69/124 (56%), Gaps = 8/124 (6%)
 Frame = +2

Query  194  QDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRES  373
            QD RS S  F        +++ R+ F  ++C +L  + +  +    D  +A    E R  
Sbjct  92   QDKRSCSHQF--------IILTRNEFHRLVCASLYVHQFRKIRYSVDFRLALDFIEERRF  143

Query  374  ITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE  553
              +LL G  G GKST+++LL SR+ ++ +ISTDSIRH MR+   + + P+L  STY  G+
Sbjct  144  FIILLSGAPGTGKSTIASLLASRMSVSHIISTDSIRHAMRTIYPKDKYPILHYSTYECGD  203

Query  554  HLDP  565
             +DP
Sbjct  204  IVDP  207



>ref|XP_004027216.1| hypothetical protein IMG5_187150 [Ichthyophthirius multifiliis]
 gb|EGR27871.1| hypothetical protein IMG5_187150 [Ichthyophthirius multifiliis]
Length=402

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  332  DLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK  511
            D  +  ++  R+  + +LL GTSG GKST+S++L SR  I T ISTDSIRH+MR+F+DEK
Sbjct  64   DFQMCLQILRRQFPLIILLGGTSGTGKSTVSSILASRFQIPTCISTDSIRHIMRNFMDEK  123

Query  512  ENPLLWASTYHAG  550
            +  +L+ASTY AG
Sbjct  124  QLQILFASTYEAG  136



>ref|XP_009840892.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV69676.1| hypothetical protein, variant [Aphanomyces astaci]
Length=636

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = +2

Query  293  LAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTD  472
            LA+  Y       D  +A  + +R  S  VLL GTSG GKSTL++LL SRL +TTV+ TD
Sbjct  92   LAKLEYTKPTHLLDFDLAKEITQRNTSFVVLLGGTSGTGKSTLASLLASRLRLTTVLPTD  151

Query  473  SIRHMMRSFVDEKENPLLWASTYHAGEHLDP  565
            S+RH+ R+F+ ++++P  + STY AG+ L P
Sbjct  152  SVRHISRAFMTKEQHPCAFTSTYQAGDALTP  182



>ref|XP_009840891.1| hypothetical protein H257_14695 [Aphanomyces astaci]
 gb|ETV69675.1| hypothetical protein H257_14695 [Aphanomyces astaci]
Length=674

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = +2

Query  293  LAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTD  472
            LA+  Y       D  +A  + +R  S  VLL GTSG GKSTL++LL SRL +TTV+ TD
Sbjct  92   LAKLEYTKPTHLLDFDLAKEITQRNTSFVVLLGGTSGTGKSTLASLLASRLRLTTVLPTD  151

Query  473  SIRHMMRSFVDEKENPLLWASTYHAGEHLDP  565
            S+RH+ R+F+ ++++P  + STY AG+ L P
Sbjct  152  SVRHISRAFMTKEQHPCAFTSTYQAGDALTP  182



>ref|WP_019009042.1| 2-phosphoglycerate kinase [Deinococcus aquatilis]
Length=485

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 59/105 (56%), Gaps = 2/105 (2%)
 Frame = +2

Query  251  VVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSAL  430
            VVRRH   + +   L   + VG +  A   +   +R+    + VLL G SG GKS L+A 
Sbjct  204  VVRRHAIREKVEGLL--RDEVGPDVSARYRLLRVIRQPPRPLVVLLGGVSGTGKSFLAAE  261

Query  431  LGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHLDP  565
            +  RLGI  V+STDSIR +MR+ V     P L AST++A E L P
Sbjct  262  IAYRLGIARVVSTDSIRQVMRAMVSPALLPTLHASTFNAWEALVP  306



>ref|WP_011019236.1| 2-phosphoglycerate kinase [Methanopyrus kandleri]
 ref|NP_614151.1| 2-phosphoglycerate kinase [Methanopyrus kandleri AV19]
 sp|Q8TGY9.1|PGK2_METKA RecName: Full=2-phosphoglycerate kinase; Short=2PGK [Methanopyrus 
kandleri AV19]
 gb|AAM02081.1| 2-Phosphoglycerate kinase [Methanopyrus kandleri AV19]
Length=327

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 59/95 (62%), Gaps = 3/95 (3%)
 Frame = +2

Query  275  DVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGIT  454
            D+I   L E +   L +R +L    R+++R E I VL+ G SG G ST+++ +G RLGIT
Sbjct  83   DIIRTKLEEIDET-LAERYELW--RRIKKREEPIIVLIGGASGVGTSTIASEVGHRLGIT  139

Query  455  TVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHL  559
             VI TD+IR +MR  + E+  P L+ S+Y A + L
Sbjct  140  NVIGTDAIREVMRRVLAEELYPTLYESSYTAWKRL  174



>ref|WP_012692638.1| 2-phosphoglycerate kinase [Deinococcus deserti]
 ref|YP_002785269.1| 2-phosphoglycerate kinase [Deinococcus deserti VCD115]
 gb|ACO45515.1| putative phosphoglycerate kinase [Deinococcus deserti VCD115]
Length=502

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  374  ITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE  553
            + VLL G SG GKS L+A +  RLGIT V+STDSIR +MR+ V     P L AST++A E
Sbjct  264  LVVLLGGVSGTGKSVLAAEIAYRLGITRVVSTDSIREVMRAMVSPALVPTLHASTFNAWE  323

Query  554  HLDP  565
             L P
Sbjct  324  ALVP  327



>ref|WP_017869259.1| MULTISPECIES: 2-phosphoglycerate kinase [Deinococcus]
Length=472

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 61/111 (55%), Gaps = 1/111 (1%)
 Frame = +2

Query  374  ITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE  553
            + VLL G SG GKS L+A +  RLGI+ V+STDSIR +MR+ V     P L AST++A E
Sbjct  242  LIVLLGGVSGTGKSLLAAEIAYRLGISRVVSTDSIREVMRAMVPPALLPTLHASTFNAWE  301

Query  554  HLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNASTFK  706
             L P          + + LAG+   V Q+ S      +G+  QEG +   +
Sbjct  302  ALVPPGQTMPPHPTREELLAGFRDQV-QQVSVGLSAVVGRSIQEGTSLVLE  351



>ref|WP_014684312.1| 2-phosphoglycerate kinase [Deinococcus gobiensis]
 ref|YP_006260287.1| 2-phosphoglycerate kinase [Deinococcus gobiensis I-0]
 gb|AFD24829.1| 2-phosphoglycerate kinase, putative [Deinococcus gobiensis I-0]
Length=498

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +R+    + VLL G SG GKS L+A +  RLGI  V+STDSIR +MR+ V     P L A
Sbjct  256  IRQPPRPLIVLLGGVSGTGKSFLAAEIAYRLGIARVVSTDSIREVMRAMVSPALLPTLHA  315

Query  533  STYHAGEHLDPLavaeakakrkakklaGYSTPVPQKDSAANHMTIGKYPQEGNA  694
            ST+ A E L P      +   KA  LAG+   V Q+ S      +G+  QEG +
Sbjct  316  STFSAWEALIPPGQPRPEHPDKADLLAGFREQV-QQVSVGLGAVVGRSVQEGTS  368



>ref|WP_019586341.1| 2-phosphoglycerate kinase [Deinococcus apachensis]
Length=494

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +R     + VLL G SG GKS L+A +  RLGIT VI TDSIR +MR+ V  +  P L A
Sbjct  256  IRRPPRPLVVLLGGVSGTGKSYLAAEVAYRLGITRVIGTDSIRQVMRAMVSPELVPGLHA  315

Query  533  STYHAGEHLDP  565
            ST++A E L P
Sbjct  316  STFNAWEALLP  326



>gb|ESL10801.1| hypothetical protein TRSC58_01459 [Trypanosoma rangeli SC58]
Length=766

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 68/134 (51%), Gaps = 13/134 (10%)
 Frame = +2

Query  164  YNYFAASLDKQDDRSKSIPFELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLT-  340
            +  FAA++       K  P      R T+VV RHTF   I   L+        QR  +T 
Sbjct  165  FAEFAAAVASLPGTQKPAP----PARYTLVVTRHTFDRCIAGLLSRELR---GQRLTVTP  217

Query  341  -----IACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVD  505
                 +A  + + R  + V   GTSGCGKSTLS+L+ + L + T++STD+IR  +R  + 
Sbjct  218  LPRWGVAQAIVQNRRPLVVFCGGTSGCGKSTLSSLITAHLCLHTLLSTDTIRQSLRRTLR  277

Query  506  EKENPLLWASTYHA  547
             +E P L  STY A
Sbjct  278  PEEYPELLVSTYEA  291



>ref|WP_029479082.1| 2-phosphoglycerate kinase [Deinococcus frigens]
Length=494

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +R     + VLL G SG GKS L+A +  RLGI  V+STDSIR +MR+ V     P L A
Sbjct  256  IRRPPRPVIVLLGGVSGTGKSFLAAEIAYRLGIARVVSTDSIREVMRAMVSPALLPTLHA  315

Query  533  STYHAGEHLDP  565
            ST++A E L P
Sbjct  316  STFNAWEALLP  326



>ref|WP_039683178.1| 2-phosphoglycerate kinase [Deinococcus swuensis]
 gb|AIZ44819.1| 2-phosphoglycerate kinase [Deinococcus swuensis]
Length=501

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +R     + VLL G SG GKS L+A +  RLGI  V+STDSIR +MR+ V     P L A
Sbjct  256  IRRPPRPVIVLLGGVSGTGKSFLAAEIAYRLGIARVVSTDSIREVMRAMVSPALLPTLHA  315

Query  533  STYHAGEHLDP  565
            ST++A E L P
Sbjct  316  STFNAWEALLP  326



>ref|WP_034356182.1| 2-phosphoglycerate kinase [Deinococcus phoenicis]
 gb|EYB68459.1| 2-phosphoglycerate kinase [Deinococcus phoenicis]
Length=494

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +R     + VLL G SG GKS L+A +  RLGIT VI TD+IR +MR+ V  +  P L A
Sbjct  256  IRRPPRPLVVLLGGVSGTGKSYLAAEVAYRLGITRVIGTDAIRQVMRAMVSPELVPGLHA  315

Query  533  STYHAGEHLDP  565
            ST++A E L P
Sbjct  316  STFNAWEALLP  326



>ref|WP_034385411.1| 2-phosphoglycerate kinase [Deinococcus sp. YIM 77859]
Length=490

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  374  ITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE  553
            + VLL G SG GKS L+A +  RLGIT VI TD+IR +MR+ V  +  P L AST++A E
Sbjct  263  LVVLLGGVSGTGKSYLAAEVAYRLGITRVIGTDAIREVMRAMVSRELVPGLHASTFNAWE  322

Query  554  HLDP  565
             L P
Sbjct  323  ALLP  326



>gb|EPZ31831.1| hypothetical protein O9G_000310 [Rozella allomycis CSF55]
Length=319

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            LR  R S  +++ GTSG GKST+S+LL SR+ I+TV+STD IR++ +S + + ++P+L  
Sbjct  70   LRHSR-SFCIIIGGTSGTGKSTISSLLASRMNISTVLSTDHIRNIQKSCISKADDPILHK  128

Query  533  STYHA  547
            S+Y A
Sbjct  129  SSYEA  133



>ref|WP_034413103.1| 2-phosphoglycerate kinase [Deinococcus marmoris]
Length=501

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +R     + VLL G SG GKS L+A +  RLGI  V+STDSIR +MR+ V     P L A
Sbjct  256  IRRPPRPVIVLLGGVSGTGKSFLAAEIAYRLGIARVVSTDSIREVMRAMVSPALLPTLHA  315

Query  533  STYHAGEHLDP  565
            ST+ A E L P
Sbjct  316  STFSAWEALLP  326



>ref|WP_034350737.1| 2-phosphoglycerate kinase [Deinococcus radiodurans]
Length=493

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  374  ITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE  553
            + VLL G SG GKS L+A +  RLGI+ V STDSIR +MR+ V     P L AST++A E
Sbjct  263  LIVLLGGVSGTGKSLLAAEIAYRLGISRVASTDSIREVMRAMVSPALLPTLHASTFNAWE  322

Query  554  HLDP  565
             L P
Sbjct  323  ALVP  326



>ref|WP_010888153.1| 2-phosphoglycerate kinase [Deinococcus radiodurans]
 ref|NP_295237.1| 2-phosphoglycerate kinase [Deinococcus radiodurans R1]
 gb|AAF11081.1|AE001995_6 2-phosphoglycerate kinase, putative [Deinococcus radiodurans 
R1]
Length=540

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  374  ITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE  553
            + VLL G SG GKS L+A +  RLGI+ V STDSIR +MR+ V     P L AST++A E
Sbjct  310  LIVLLGGVSGTGKSLLAAEIAYRLGISRVASTDSIREVMRAMVSPALLPTLHASTFNAWE  369

Query  554  HLDP  565
             L P
Sbjct  370  ALVP  373



>ref|WP_034341469.1| hypothetical protein [Deinococcus misasensis]
Length=479

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +R     + VL+ G SG GKS ++A +  RLGIT V+STDSIR +MR+ +  +  P L A
Sbjct  254  IRNPERPLVVLVGGVSGTGKSYIAAEIAYRLGITRVVSTDSIREVMRAMISPQLTPTLHA  313

Query  533  STYHAGEHL  559
            ST+ A + L
Sbjct  314  STFEAWQSL  322



>ref|WP_013180873.1| 2-phosphoglycerate kinase [Methanococcus voltae]
 ref|YP_003708118.1| ATP-cone domain-containing protein [Methanococcus voltae A3]
 gb|ADI37145.1| ATP-cone domain protein [Methanococcus voltae A3]
Length=311

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  329  ADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDE  508
            AD  +  R   ++ S+ +L+ G+SG G ST++  L SRLGI++VI TDSIR +MR  + +
Sbjct  81   ADKYLIWRRILKKHSVIILVGGSSGVGTSTIAFELASRLGISSVIGTDSIREVMRRSISK  140

Query  509  KENPLLWASTYHAGEHL  559
               P+L+ S+Y A   L
Sbjct  141  DVVPMLYESSYTAWRAL  157



>ref|XP_829328.1| hypothetical protein [Trypanosoma brucei brucei TREU927]
 gb|EAN80216.1| hypothetical protein, conserved [Trypanosoma brucei brucei TREU927]
Length=786

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +2

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ++R ++ V   GTSGCGKSTLS+L+ + L I+T ISTD+IR  +R  +   E P L+ ST
Sbjct  292  QQRRALVVFCGGTSGCGKSTLSSLISTHLSISTTISTDTIRQALRRTLPGGEFPELFTST  351

Query  539  YHAGEHLDPL  568
            Y A  H +P+
Sbjct  352  YAA--HSNPV  359



>gb|KFM28644.1| Uncharacterized protein F751_0801 [Auxenochlorella protothecoides]
Length=419

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  332  DLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDS  475
            DL  A  L ERR S+T+LLCGTSG GKSTL++LL  RLGI  ++STD+
Sbjct  111  DLRSAMSLSERRTSVTILLCGTSGTGKSTLASLLAGRLGIPALLSTDA  158



>ref|XP_005707760.1| 2-phosphoglycerate kinase [Galdieria sulphuraria]
 gb|EME31240.1| 2-phosphoglycerate kinase [Galdieria sulphuraria]
Length=491

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = +2

Query  332  DLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEK  511
            D+ +A      R  I +LL GTSGCGKSTL+ +L  +LG+  VISTD+IR  +R+     
Sbjct  161  DIMVALHWIGHRLPIVILLGGTSGCGKSTLAYMLARKLGVNKVISTDTIRACLRTLSTPN  220

Query  512  EN--PLLWASTYHAGEHLDP  565
            +    +L +S+Y    HL P
Sbjct  221  DTFYGVLHSSSYEIDSHLPP  240



>ref|WP_027460050.1| 2-phosphoglycerate kinase [Deinococcus murrayi]
Length=497

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  374  ITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE  553
            + VLL G SG GKS L+A +  RLGIT VI TD++R +MR+ V  +  P L AST++A E
Sbjct  263  LVVLLGGVSGTGKSYLAAEIAYRLGITRVIGTDAVREVMRAMVSRELVPGLHASTFNAWE  322

Query  554  HL  559
             L
Sbjct  323  AL  324



>ref|WP_034407008.1| 2-phosphoglycerate kinase [Deinococcus sp. RL]
 gb|KEF33415.1| 2-phosphoglycerate kinase [Deinococcus sp. RL]
Length=497

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  374  ITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE  553
            + VLL G SG GKS L+A +  RLGIT VI TD++R +MR+ V  +  P L AST++A E
Sbjct  263  LVVLLGGVSGTGKSYLAAEIAYRLGITRVIGTDAVREVMRAMVSRELVPGLHASTFNAWE  322

Query  554  HL  559
             L
Sbjct  323  AL  324



>ref|WP_004593510.1| 2-phosphoglycerate kinase [Methanocaldococcus villosus]
 gb|ENN95688.1| 2-phosphoglycerate kinase [Methanocaldococcus villosus KIN24-T80]
Length=310

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = +2

Query  293  LAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTD  472
            L  +NY   ++ A+  +  R+   ++ +T+L+ G SG G ST++  + SRLGI++VI TD
Sbjct  66   LISHNY---DEIAERYLLWRVFLEKKPLTILIGGASGVGTSTIAFEIASRLGISSVIGTD  122

Query  473  SIRHMMRSFVDEKENPLLWASTYHAGEHL  559
            SIR +MR  + +   P L+ S+Y A + L
Sbjct  123  SIREVMRKIISKDLVPTLYESSYTAWKVL  151



>ref|WP_015791993.1| 2-phosphoglycerate kinase [Methanocaldococcus fervens]
 ref|YP_003128760.1| 2-phosphoglycerate kinase [Methanocaldococcus fervens AG86]
 gb|ACV25260.1| ATP-cone domain protein [Methanocaldococcus fervens AG86]
Length=310

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 59/113 (52%), Gaps = 3/113 (3%)
 Frame = +2

Query  221  FELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTS  400
            +E+ KK    V+ +      +   L   NY   ++ A   +  R+   R  I +L+ G S
Sbjct  45   YEMLKKENIKVIDKSDLRRRVYYYLISKNY---DEVAKKYLLWRMVLGRRPIVILIGGAS  101

Query  401  GCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHL  559
            G G ST++  + SRLGI +VI TDSIR +MR  +  +  P L+ S+Y A + L
Sbjct  102  GVGTSTIAFEIASRLGIPSVIGTDSIREVMRKVISRELIPTLYESSYTAWKVL  154



>ref|WP_014121222.1| 2-phosphoglycerate kinase [Thermococcus sp. AM4]
 ref|YP_002583129.1| 2-phosphoglycerate kinase [Thermococcus sp. AM4]
 gb|EEB74944.1| 2-phosphoglycerate kinase [Thermococcus sp. AM4]
Length=289

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 59/109 (54%), Gaps = 12/109 (11%)
 Frame = +2

Query  278  VICDALAEYNYV-----GLNQRADLTIACR-LRERRESITVLLCGTSGCGKSTLSALLGS  439
            V  D + E  Y      GL + A+  +  R LR R+  +T+LL G +G GKST++  L  
Sbjct  53   VTTDEIRELTYSTLLERGLKEEAERYLFWRNLRRRKVRLTILLGGATGVGKSTIATELAF  112

Query  440  RLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAG------EHLDPL  568
            RLGI ++I TD+IR ++R  +  +  P +  S++ AG        +DPL
Sbjct  113  RLGIRSIIGTDTIREVLRKVIARELLPDIHVSSFMAGNVVNAPRGVDPL  161



>ref|WP_015733331.1| 2-phosphoglycerate kinase [Methanocaldococcus vulcanius]
 ref|YP_003247593.1| 2-phosphoglycerate kinase [Methanocaldococcus vulcanius M7]
 gb|ACX73111.1| ATP-cone domain protein [Methanocaldococcus vulcanius M7]
Length=309

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 58/109 (53%), Gaps = 3/109 (3%)
 Frame = +2

Query  221  FELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTS  400
            +E+ KK    V+ +      +   L   NY   ++ A   +  R+   R  I +L+ G S
Sbjct  45   YEMLKKENVKVIDKTDLRRRVYYYLISKNY---DEVAKKYLLWRMVLGRRPIVILIGGAS  101

Query  401  GCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHA  547
            G G ST++  + SRLGI++VI TDSIR +MR  +  +  P L+ S+Y A
Sbjct  102  GVGTSTIAFEIASRLGISSVIGTDSIREVMRKVISRELIPTLYESSYTA  150



>ref|WP_013100499.1| 2-phosphoglycerate kinase [Methanocaldococcus infernus]
 ref|YP_003616718.1| ATP-cone domain protein [Methanocaldococcus infernus ME]
 gb|ADG13754.1| ATP-cone domain protein [Methanocaldococcus infernus ME]
Length=311

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 61/113 (54%), Gaps = 3/113 (3%)
 Frame = +2

Query  221  FELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTS  400
            +E+ KK     + +      +   L E NY  + +R  L  A      ++ I++L+ G S
Sbjct  44   YEMLKKENIKEIDKDELRRRVYYFLIEKNYEEIAKRYLLWRAIL---NKKPISILIGGAS  100

Query  401  GCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHL  559
            G G ST++  L SRLGI++VI TDSIR +MR  +  +  P L+ S+Y A + L
Sbjct  101  GVGTSTIAFELASRLGISSVIGTDSIREVMRKVISRELVPTLYESSYTAWKVL  153



>emb|CBH18293.1| hypothetical protein, conserved [Trypanosoma brucei gambiense 
DAL972]
Length=786

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +2

Query  359  ERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWAST  538
            ++R ++ V   GTSGCGKSTLS+L+ + L I+T ISTD+IR  +R  +   E P L+ ST
Sbjct  292  QQRRALVVFCGGTSGCGKSTLSSLISTHLSISTTISTDTIRQALRRTLPGGEFPELFTST  351

Query  539  YHAGEHLDPL  568
            Y    H +P+
Sbjct  352  Y--AVHSNPV  359



>ref|WP_011171375.1| 2-phosphoglycerate kinase [Methanococcus maripaludis]
 ref|NP_988551.1| 2-phosphoglycerate kinase [Methanococcus maripaludis S2]
 ref|YP_004743195.1| 2-phosphoglycerate kinase [Methanococcus maripaludis X1]
 sp|Q6LXC1.1|PGK2_METMP RecName: Full=2-phosphoglycerate kinase; Short=2PGK [Methanococcus 
maripaludis S2]
 emb|CAF30987.1| 2-phosphoglycerate kinase [Methanococcus maripaludis S2]
 gb|AEK20452.1| 2-phosphoglycerate kinase [Methanococcus maripaludis X1]
 dbj|BAP63624.1| 2-phosphoglycerate kinase [Methanococcus maripaludis OS7]
Length=312

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            ++ SI +L+ G+SG G ST++  L SRLGI +VI TDSIR +MR  + +   P+L+ S+Y
Sbjct  91   KKHSIIILVGGSSGVGTSTIAFELASRLGIPSVIGTDSIREVMRRSISKDLVPMLYESSY  150

Query  542  HA  547
             A
Sbjct  151  TA  152



>dbj|BAP61772.1| 2-phosphoglycerate kinase [Methanococcus maripaludis KA1]
Length=313

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            ++ SI +L+ G+SG G ST++  L SRLGI +VI TDSIR +MR  + +   P+L+ S+Y
Sbjct  92   KKHSIIILVGGSSGVGTSTIAFELASRLGIPSVIGTDSIREVMRRSISKDLVPMLYESSY  151

Query  542  HA  547
             A
Sbjct  152  TA  153



>ref|WP_011972550.1| 2-phosphoglycerate kinase [Methanococcus vannielii]
 ref|YP_001323260.1| 2-phosphoglycerate kinase [Methanococcus vannielii SB]
 sp|A6UQ76.1|PGK2_METVS RecName: Full=2-phosphoglycerate kinase; Short=2PGK [Methanococcus 
vannielii SB]
 gb|ABR54648.1| ATP-cone domain protein [Methanococcus vannielii SB]
Length=313

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +2

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            ++ SI +L+ G SG G ST++  L SRLGI +VI TDSIR +MR  + +   P+L+ S+Y
Sbjct  92   KKHSIIILVGGASGVGTSTIAFELASRLGIPSVIGTDSIREVMRRSISKDLVPMLYESSY  151

Query  542  HAGEHL  559
             A + L
Sbjct  152  TAWKAL  157



>ref|WP_011867924.1| 2-phosphoglycerate kinase [Methanococcus maripaludis]
 ref|YP_001096679.1| 2-phosphoglycerate kinase [Methanococcus maripaludis C5]
 sp|A4FW93.1|PGK2_METM5 RecName: Full=2-phosphoglycerate kinase; Short=2PGK [Methanococcus 
maripaludis C5]
 gb|ABO34464.1| 2-phosphoglycerate kinase [Methanococcus maripaludis C5]
Length=313

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            ++ SI +L+ G+SG G ST++  L SRLGI +VI TDSIR +MR  + +   P+L+ S+Y
Sbjct  92   KKHSIIILVGGSSGVGTSTIAFELASRLGIPSVIGTDSIREVMRRSISKDLVPMLYESSY  151

Query  542  HA  547
             A
Sbjct  152  TA  153



>gb|AIJ06342.1| 2-phosphoglycerate kinase [Methanocaldococcus sp. JH146]
Length=309

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 59/113 (52%), Gaps = 3/113 (3%)
 Frame = +2

Query  221  FELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTS  400
            +E+ KK    V+ +      +   L   NY   ++ A   +  R+   R  I +L+ G S
Sbjct  45   YEMLKKENIRVIDKADLRRRVYYYLISKNY---DEVAKKYLLWRMVLGRRPIVILIGGAS  101

Query  401  GCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHL  559
            G G ST++  + SRLGI +VI TDSIR +MR  +  +  P L+ S+Y A + L
Sbjct  102  GVGTSTIAFEIASRLGIPSVIGTDSIREVMRKVISRELIPTLYESSYTAWKVL  154



>ref|WP_013557932.1| 2-phosphoglycerate kinase [Deinococcus maricopensis]
 ref|YP_004172093.1| 2-phosphoglycerate kinase [Deinococcus maricopensis DSM 21211]
 gb|ADV68428.1| 2-phosphoglycerate kinase [Deinococcus maricopensis DSM 21211]
Length=485

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +2

Query  374  ITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE  553
            + +LL G SG GKS L+A L  RLGIT +ISTDS+R +MR+ V     P L  S++ A E
Sbjct  263  LAILLGGVSGTGKSFLAAELAYRLGITRIISTDSVREVMRAMVSPALVPTLHMSSFDAWE  322

Query  554  H-LDP  565
              LDP
Sbjct  323  ALLDP  327



>ref|WP_011977065.1| 2-phosphoglycerate kinase [Methanococcus maripaludis]
 ref|YP_001329894.1| 2-phosphoglycerate kinase [Methanococcus maripaludis C7]
 sp|A6VH17.1|PGK2_METM7 RecName: Full=2-phosphoglycerate kinase; Short=2PGK [Methanococcus 
maripaludis C7]
 gb|ABR65743.1| ATP-cone domain protein [Methanococcus maripaludis C7]
Length=312

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            ++ SI +L+ G+SG G ST++  L SRLGI +VI TDSIR +MR  + +   P+L+ S+Y
Sbjct  92   KKHSIIILVGGSSGVGTSTIAFELASRLGIPSVIGTDSIREVMRRSISKDLVPMLYESSY  151

Query  542  HA  547
             A
Sbjct  152  TA  153



>ref|WP_012193993.1| 2-phosphoglycerate kinase [Methanococcus maripaludis]
 ref|YP_001549287.1| 2-phosphoglycerate kinase [Methanococcus maripaludis C6]
 sp|A9A9N2.1|PGK2_METM6 RecName: Full=2-phosphoglycerate kinase; Short=2PGK [Methanococcus 
maripaludis C6]
 gb|ABX02055.1| ATP-cone domain protein [Methanococcus maripaludis C6]
Length=313

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            ++ SI +L+ G+SG G ST++  L SRLGI +VI TDSIR +MR  + +   P+L+ S+Y
Sbjct  92   KKHSIIILVGGSSGVGTSTIAFELASRLGIPSVIGTDSIREVMRRSISKDLVPMLYESSY  151

Query  542  HA  547
             A
Sbjct  152  TA  153



>ref|WP_012980571.1| 2-phosphoglycerate kinase [Methanocaldococcus sp. FS406-22]
 ref|YP_003458398.1| ATP-cone domain protein [Methanocaldococcus sp. FS406-22]
 gb|ADC69662.1| ATP-cone domain protein [Methanocaldococcus sp. FS406-22]
Length=309

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 58/113 (51%), Gaps = 3/113 (3%)
 Frame = +2

Query  221  FELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTS  400
            +E+ KK    V+ +      +   L   NY   ++ A   +  R+   R  I +L+ G S
Sbjct  45   YEMLKKENIRVIDKADLRRRVYYYLISKNY---DEVAKKYLLWRMVLDRRPIVILIGGAS  101

Query  401  GCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHL  559
            G G ST++  + SRLGI +VI TDSIR +MR  +     P L+ S+Y A + L
Sbjct  102  GVGTSTIAFEIASRLGIPSVIGTDSIREIMRKVISRDLIPTLYESSYTAWKVL  154



>ref|WP_027482695.1| 2-phosphoglycerate kinase [Deinococcus pimensis]
Length=480

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +2

Query  374  ITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE  553
            I VLL G SG GKS L++ +  RLGI  ++STDS+R +MR+ V     P L AST++A E
Sbjct  263  IVVLLGGVSGTGKSFLASEIAYRLGIPRIVSTDSVREVMRAMVSPALLPTLHASTFNAWE  322

Query  554  HL  559
             L
Sbjct  323  AL  324



>ref|WP_013614490.1| 2-phosphoglycerate kinase [Deinococcus proteolyticus]
 ref|YP_004255498.1| 2-phosphoglycerate kinase [Deinococcus proteolyticus MRP]
 gb|ADY25881.1| 2-phosphoglycerate kinase [Deinococcus proteolyticus MRP]
Length=540

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  374  ITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGE  553
            + VL+ G SG GKS L++ +  RLGI  +I+TDS+R +MR+ V  +  P L  ST+ A +
Sbjct  282  LLVLIGGVSGTGKSHLASEVAYRLGIPRIINTDSVREVMRAMVSPQLMPTLHTSTFQAWK  341

Query  554  HLDP  565
            HL P
Sbjct  342  HLLP  345



>ref|WP_010871004.1| 2-phosphoglycerate kinase [Methanocaldococcus jannaschii]
 ref|NP_248488.1| 2-phosphoglycerate kinase [Methanocaldococcus jannaschii DSM 
2661]
 sp|Q58877.1|PGK2_METJA RecName: Full=2-phosphoglycerate kinase; Short=2PGK [Methanocaldococcus 
jannaschii DSM 2661]
 gb|AAB99494.1| 2-phosphoglycerate kinase (2pgk) [Methanocaldococcus jannaschii 
DSM 2661]
Length=309

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 58/113 (51%), Gaps = 3/113 (3%)
 Frame = +2

Query  221  FELYKKRTTVVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTS  400
            +E+ KK    V+ +      +   L   NY   ++ A   +  R+   R  I +L+ G S
Sbjct  45   YEMLKKENIRVIDKADLRRRVYYYLISKNY---DEVAKKYLLWRMVLGRRPIVILIGGAS  101

Query  401  GCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHAGEHL  559
            G G ST++  + SRLGI +VI TDSIR +MR  +     P L+ S+Y A + L
Sbjct  102  GVGTSTIAFEIASRLGIPSVIGTDSIREVMRKVISRDLIPTLYESSYTAWKVL  154



>ref|WP_013866430.1| 2-phosphoglycerate kinase [Methanothermococcus okinawensis]
 ref|YP_004576022.1| 2-phosphoglycerate kinase [Methanothermococcus okinawensis IH1]
 gb|AEH06244.1| 2-phosphoglycerate kinase [Methanothermococcus okinawensis IH1]
Length=317

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +2

Query  362  RRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTY  541
            ++  I +L+ G SG G ST++  L SRLGI +VI TDSIR +MR  + +   P+L+ S+Y
Sbjct  94   KKHPIIILIGGASGVGTSTIAFELASRLGIPSVIGTDSIREVMRRSISKDLVPMLYESSY  153

Query  542  HAGEHL  559
             A + L
Sbjct  154  TAWKSL  159



>ref|XP_009310045.1| hypothetical protein DQ04_02341040 [Trypanosoma grayi]
 gb|KEG11719.1| hypothetical protein DQ04_02341040 [Trypanosoma grayi]
Length=898

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 3/104 (3%)
 Frame = +2

Query  245  TVVVRRHTFLDVICDALAEY---NYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKS  415
            T+VV +HTF   I   L        + ++      +A  + + R  + +   GTSGCGKS
Sbjct  266  TLVVAKHTFDRCIAKLLGHELRGQRITVSPLPRWNVAQGIVQNRRPLVIFCGGTSGCGKS  325

Query  416  TLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHA  547
            TLS+L+ + L I  ++STD+IR  +R  +   E P L+ STY A
Sbjct  326  TLSSLITTHLCIDALLSTDTIRQALRRTLRRDEFPELFLSTYEA  369



>ref|WP_011249989.1| 2-phosphoglycerate kinase [Thermococcus kodakarensis]
 ref|YP_183451.1| 2-phosphoglycerate kinase [Thermococcus kodakarensis KOD1]
 sp|Q5JDW9.1|PGK2_THEKO RecName: Full=2-phosphoglycerate kinase; Short=2PGK [Thermococcus 
kodakarensis KOD1]
 dbj|BAD85227.1| 2-phosphoglycerate kinase [Thermococcus kodakarensis KOD1]
Length=290

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +2

Query  314  GLNQRADLTIACR-LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMM  490
            GL + A   +  R LR R+  +TVLL G +G GKST++  L  RLGI ++I TD+IR +M
Sbjct  70   GLREEAKRYLFWRELRRRKVRLTVLLGGATGVGKSTIATELAFRLGIRSIIGTDTIREVM  129

Query  491  RSFVDEKENPLLWASTYHA  547
            R  + ++  P +  S++ A
Sbjct  130  RKIIAKELLPDIHVSSFLA  148



>ref|WP_018154587.1| 2-phosphoglycerate kinase [Methanothermococcus thermolithotrophicus]
Length=313

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  365  RESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYH  544
            + SI +L+ G SG G ST++  L SRLGI +VI TDSIR +MR  +     P+L+ S+Y 
Sbjct  93   KHSIIILIGGASGAGTSTIAFELASRLGIPSVIGTDSIREVMRRSISRDLVPMLYESSYT  152

Query  545  AGEHL  559
            A + L
Sbjct  153  AWKAL  157



>ref|WP_015858344.1| 2-phosphoglycerate kinase [Thermococcus gammatolerans]
 ref|YP_002959090.1| 2-phosphoglycerate kinase [Thermococcus gammatolerans EJ3]
 gb|ACS33226.1| 2-phosphoglycerate kinase, containing ATP cone domain [Thermococcus 
gammatolerans EJ3]
Length=290

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 59/109 (54%), Gaps = 12/109 (11%)
 Frame = +2

Query  278  VICDALAEYNYV-----GLNQRADLTIACR-LRERRESITVLLCGTSGCGKSTLSALLGS  439
            V  D + E  Y      GL + A+  +  R LR R+  +TVLL G +G GKST++  L  
Sbjct  53   VTTDEIRELTYSTLIERGLREEAERYLFWRTLRRRKVRLTVLLGGATGVGKSTIATELAF  112

Query  440  RLGITTVISTDSIRHMMRSFVDEKENPLLWASTY------HAGEHLDPL  568
            RLGI ++I TD+IR ++R  +  +  P +  S++      +A   +DPL
Sbjct  113  RLGILSIIGTDTIREVLRKVIARELLPDIHVSSFLASNVVNAPRGIDPL  161



>gb|ESS67550.1| hypothetical protein TCDM_03829 [Trypanosoma cruzi Dm28c]
Length=772

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = +2

Query  239  RTTVVVRRHTFLDVICDALAEY---NYVGLNQRADLTIACRLRERRESITVLLCGTSGCG  409
            R T+V  +HTF   I   L        + +       +A  + + R S+ V   GTSGCG
Sbjct  198  RYTLVTAKHTFDRCIARLLINELRGQRITVIPLPRWNVAQAIVQNRRSLIVFCGGTSGCG  257

Query  410  KSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHA  547
            KSTLS+L+ + +   T++STD+IR  +R  +  +E P L+ STY A
Sbjct  258  KSTLSSLITTNICFNTLLSTDTIRQSLRRTLRREEFPELFLSTYEA  303



>gb|EKG02454.1| hypothetical protein TCSYLVIO_006517 [Trypanosoma cruzi]
Length=838

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = +2

Query  239  RTTVVVRRHTFLDVICDALAEY---NYVGLNQRADLTIACRLRERRESITVLLCGTSGCG  409
            R T+V  +HTF   I   L        + +       +A  + + R S+ V   GTSGCG
Sbjct  260  RYTLVTAKHTFDRCIARLLINELRGQRITVIPLPRWNVAQAIVQNRRSLIVFCGGTSGCG  319

Query  410  KSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHA  547
            KSTLS+L+ + +   T++STD+IR  +R  +  +E P L+ STY A
Sbjct  320  KSTLSSLITTNICFNTLLSTDTIRQSLRRTLRREEFPELFLSTYEA  365



>emb|CDO65879.1| conserved Plasmodium protein, unknown function [Plasmodium reichenowi]
Length=360

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 14/89 (16%)
 Frame = +2

Query  281  ICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTV  460
            + D +   N++ LN++              ++ +LL G SGCGKSTLS LL   L I  +
Sbjct  97   VVDKMKRNNFIDLNEK-------------RNVIILLSGCSGCGKSTLSCLLAMFLNIRRI  143

Query  461  ISTDSIRHMMRSFVDEKENPLLWASTYHA  547
            ISTD IR ++R F  +KE  L + STY +
Sbjct  144  ISTDIIREVLRKFKIKKEKYLRF-STYES  171



>ref|WP_019264682.1| 2-phosphoglycerate kinase [Methanobrevibacter smithii]
Length=310

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +R+ +E + +L+ G SG G S+++  L SRLG+  +ISTD IR +MR  V ++ +P++  
Sbjct  86   VRKSKEPLIILIGGASGVGTSSMAFELASRLGLKNLISTDMIREVMRKIVSQELSPVIHK  145

Query  533  STYHAGEHL  559
            S+++A E +
Sbjct  146  SSFNAYESI  154



>ref|WP_019266572.1| 2-phosphoglycerate kinase [Methanobrevibacter smithii]
Length=310

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  353  LRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWA  532
            +R+ +E + +L+ G SG G S+++  L SRLG+  +ISTD IR +MR  V ++ +P++  
Sbjct  86   VRKSKEPLIILIGGASGVGTSSMAFELASRLGLKNLISTDMIREVMRKIVSKELSPVIHK  145

Query  533  STYHAGEHL  559
            S+++A E +
Sbjct  146  SSFNAYESI  154



>ref|WP_013704281.1| 2-phosphoglycerate kinase [Marinithermus hydrothermalis]
 ref|YP_004368344.1| ATP-cone domain-containing protein [Marinithermus hydrothermalis 
DSM 14884]
 gb|AEB12234.1| ATP-cone domain protein [Marinithermus hydrothermalis DSM 14884]
Length=482

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 56/100 (56%), Gaps = 2/100 (2%)
 Frame = +2

Query  248  VVVRRHTFLDVICDALAEYNYVGLNQRADLTIACRLRERRESITVLLCGTSGCGKSTLSA  427
            VV+ R+   + + + L E     +  R  +  A R  ER   + +L+ G SG GKS L++
Sbjct  222  VVIDRNALRERVAEILQEEAGEEVATRYLMLRAVRRLER--PVHILIGGVSGVGKSVLAS  279

Query  428  LLGSRLGITTVISTDSIRHMMRSFVDEKENPLLWASTYHA  547
             L  RLGIT +ISTD++R ++R+ V +   P L  ST+ A
Sbjct  280  ALAYRLGITRMISTDAVREILRATVPQPLVPTLHTSTFDA  319



>ref|WP_012955624.1| 2-phosphoglycerate kinase [Methanobrevibacter ruminantium]
 ref|YP_003423565.1| 2-phosphoglycerate kinase Pgk2B [Methanobrevibacter ruminantium 
M1]
 gb|ADC46673.1| 2-phosphoglycerate kinase Pgk2B [Methanobrevibacter ruminantium 
M1]
Length=304

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  350  RLRERRESITVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKENPLLW  529
            ++RE ++ + +L+ G SG G S+++  + +RLGI T+ISTD IR +MR  V E  +P++ 
Sbjct  85   KVREAKDPLIILIGGASGVGTSSMAFEISNRLGIKTMISTDMIREVMRKIVSEDLSPVIH  144

Query  530  ASTYHA  547
             S++ A
Sbjct  145  ESSFLA  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1222808918166