BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c92921_g1_i1 len=816 path=[794:0-815]

Length=816
                                                                      Score     E

ref|XP_009796470.1|  PREDICTED: uncharacterized protein LOC104243042  85.1    1e-16   
ref|XP_009620475.1|  PREDICTED: uncharacterized protein LOC104112301  84.0    2e-16   
ref|XP_006383503.1|  hypothetical protein POPTR_0005s17370g           81.6    1e-15   
ref|XP_010266951.1|  PREDICTED: uncharacterized protein LOC104604347  80.9    3e-15   
ref|XP_002284055.3|  PREDICTED: uncharacterized protein LOC100245494  79.7    1e-14   Vitis vinifera
emb|CAN82663.1|  hypothetical protein VITISV_004929                   79.3    1e-14   Vitis vinifera
ref|XP_011009568.1|  PREDICTED: uncharacterized protein LOC105114649  79.0    2e-14   
ref|XP_010320186.1|  PREDICTED: uncharacterized protein LOC104647148  78.2    3e-14   
ref|XP_009774907.1|  PREDICTED: uncharacterized protein LOC104224886  76.3    1e-13   
ref|XP_010272981.1|  PREDICTED: uncharacterized protein LOC104608638  75.9    1e-13   
ref|XP_011085886.1|  PREDICTED: uncharacterized protein DDB_G0287...  75.9    2e-13   
ref|XP_009618697.1|  PREDICTED: uncharacterized protein LOC104110843  74.3    5e-13   
ref|XP_002302313.1|  hypothetical protein POPTR_0002s10060g           72.8    2e-12   Populus trichocarpa [western balsam poplar]
emb|CDP01106.1|  unnamed protein product                              71.6    6e-12   
ref|XP_006433924.1|  hypothetical protein CICLE_v10002675mg           70.9    1e-11   
gb|KDO37338.1|  hypothetical protein CISIN_1g036032mg                 70.5    2e-11   
gb|KDP41420.1|  hypothetical protein JCGZ_15827                       69.7    3e-11   
ref|XP_006472556.1|  PREDICTED: uncharacterized protein LOC102618680  68.9    5e-11   
ref|XP_006363294.1|  PREDICTED: uncharacterized protein LOC102586560  68.6    6e-11   
ref|XP_006360263.1|  PREDICTED: uncharacterized protein LOC102579809  65.1    9e-10   
ref|XP_006353202.1|  PREDICTED: uncharacterized protein LOC102586963  65.1    9e-10   
ref|XP_004250117.1|  PREDICTED: uncharacterized protein LOC101262884  63.9    3e-09   
ref|XP_009589374.1|  PREDICTED: uncharacterized protein LOC104086750  63.5    3e-09   
ref|XP_002513964.1|  conserved hypothetical protein                   64.3    3e-09   Ricinus communis
ref|XP_009787285.1|  PREDICTED: uncharacterized protein LOC104235261  62.0    9e-09   
ref|XP_007018706.1|  Uncharacterized protein TCM_034853               61.6    2e-08   
ref|XP_004501689.1|  PREDICTED: cullin-3-like                         59.3    7e-08   
ref|XP_002534524.1|  conserved hypothetical protein                   59.3    1e-07   Ricinus communis
ref|XP_010098634.1|  hypothetical protein L484_012747                 59.7    1e-07   
ref|XP_009793703.1|  PREDICTED: uncharacterized protein LOC104240541  59.3    1e-07   
ref|XP_009787284.1|  PREDICTED: uncharacterized protein LOC104235260  58.5    2e-07   
ref|XP_009586595.1|  PREDICTED: uncharacterized protein LOC104084449  58.5    2e-07   
ref|XP_009374122.1|  PREDICTED: uncharacterized protein LOC103963068  55.8    2e-06   
ref|XP_004490386.1|  PREDICTED: uncharacterized protein LOC101507869  55.5    3e-06   
ref|XP_008372991.1|  PREDICTED: uncharacterized protein LOC103436349  55.5    3e-06   
ref|XP_003531335.1|  PREDICTED: uncharacterized protein LOC100806374  55.1    3e-06   
gb|EYU30875.1|  hypothetical protein MIMGU_mgv1a015686mg              55.1    4e-06   
emb|CDX73319.1|  BnaC05g27870D                                        55.1    5e-06   
ref|XP_007163669.1|  hypothetical protein PHAVU_001G253900g           54.3    7e-06   
ref|XP_003525042.1|  PREDICTED: uncharacterized protein LOC100787601  53.1    1e-05   
ref|XP_011023085.1|  PREDICTED: uncharacterized protein LOC105124676  53.1    2e-05   
ref|XP_008364449.1|  PREDICTED: uncharacterized protein LOC103428127  52.8    3e-05   
ref|XP_009348037.1|  PREDICTED: uncharacterized protein LOC103939655  52.8    3e-05   
gb|KHN27380.1|  hypothetical protein glysoja_041754                   52.8    4e-05   
ref|XP_003522783.2|  PREDICTED: uncharacterized protein LOC100808609  52.8    5e-05   
ref|XP_009589377.1|  PREDICTED: uncharacterized protein LOC104086751  50.8    9e-05   
gb|ACU24010.1|  unknown                                               50.1    2e-04   Glycine max [soybeans]
ref|XP_003519180.1|  PREDICTED: uncharacterized protein LOC100800567  50.4    3e-04   
gb|KGN60231.1|  hypothetical protein Csa_3G889870                     50.1    3e-04   
ref|XP_006416196.1|  hypothetical protein EUTSA_v10009293mg           49.3    4e-04   
emb|CDY28412.1|  BnaA05g18280D                                        48.9    7e-04   
ref|XP_004240024.1|  PREDICTED: uncharacterized protein LOC101257471  47.8    0.001   



>ref|XP_009796470.1| PREDICTED: uncharacterized protein LOC104243042 [Nicotiana sylvestris]
Length=161

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 109/155 (70%), Gaps = 11/155 (7%)
 Frame = +1

Query  34   QTQMEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAss  213
            + Q +I + +P     ++C+KH  H QSPGVCS+CL EKLS+L  +  S SNTTT  +S 
Sbjct  9    KNQQQINKAKPCT---MLCKKHSKHQQSPGVCSLCLSEKLSKL--SKTSRSNTTTITSSC  63

Query  214  csssslsplssssevsscsspsHRRVQDI----RGDKNNGLMMKSRSVAFITRRRRVD-Q  378
             SSSSLS LSSSS+VSSCSSPS+RR + I     G+K+N ++ KSRS+ F+ RR   + +
Sbjct  64   SSSSSLSSLSSSSDVSSCSSPSYRRTKTIAILRSGNKSNNVLTKSRSLIFVPRREEGEME  123

Query  379  DDGKGKAAGFWSKLLRRRKNDRVNERLMHSKTTRE  483
            D+GK K  GF SKLLR RKN + +E L+HSKTTRE
Sbjct  124  DNGKKKKRGFLSKLLRPRKNKK-DEHLVHSKTTRE  157



>ref|XP_009620475.1| PREDICTED: uncharacterized protein LOC104112301 [Nicotiana tomentosiformis]
Length=161

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 104/139 (75%), Gaps = 8/139 (6%)
 Frame = +1

Query  82   LICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevs  261
            ++C+KH  H QSPGVCS+CL EKLS+L  +  S SNTTT  +S  SSS+LS LSSSS+VS
Sbjct  22   MLCKKHSKHQQSPGVCSICLSEKLSKL--SKTSRSNTTTVTSSFSSSSTLSSLSSSSDVS  79

Query  262  scsspsHRRVQDI----RGDKNNGLMMKSRSVAFITRRRRVD-QDDGKGKAAGFWSKLLR  426
            SCSSPS+RR++ +     G+K+N ++ KSRS+ F+TRR   + +++GK K  GF SKLL 
Sbjct  80   SCSSPSYRRMKTMAILRSGNKSNNMLTKSRSLVFVTRRGEGEMENNGKKKKRGFLSKLLH  139

Query  427  RRKNDRVNERLMHSKTTRE  483
             RKN + +ERL+HSKTTRE
Sbjct  140  PRKNKK-DERLVHSKTTRE  157



>ref|XP_006383503.1| hypothetical protein POPTR_0005s17370g [Populus trichocarpa]
 gb|ERP61300.1| hypothetical protein POPTR_0005s17370g [Populus trichocarpa]
Length=161

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 82/141 (58%), Gaps = 7/141 (5%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTAS----VSGSNTTTGVAsscsssslsplsssse  255
            C+KHP H Q PGVCSVCL EKLSQL T++    ++  NT    +S   SS  S  S SS 
Sbjct  20   CKKHPKHEQPPGVCSVCLSEKLSQLPTSATTSRIASLNTMDCSSSCSLSSYSSFSSYSSP  79

Query  256  vsscsspsHRRVQ-DIRGDKNNGLMMKSRSVAFITRRRRVDQDDGKGKAAGFWSKLLRRR  432
            +     P+H +    +  +  N  + KSRS+AF+ RR   ++D  + K  GFWSKLLR  
Sbjct  80   MHHFQYPTHGKGSFPLFFNGKNMFLTKSRSLAFVPRRG--NKDCHEKKKGGFWSKLLRLP  137

Query  433  KNDRVNERLMHSKTTREGVAV  495
            K  +V E L+HS+T RE V +
Sbjct  138  KGKKVEEGLVHSRTMRERVII  158



>ref|XP_010266951.1| PREDICTED: uncharacterized protein LOC104604347 [Nelumbo nucifera]
Length=148

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 82/143 (57%), Gaps = 12/143 (8%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevssc  267
            CRKHPNH QSPGVCS CL E+LSQL+    S +  +T  ASSC SS  S   SS   S  
Sbjct  10   CRKHPNHRQSPGVCSSCLSERLSQLF----STAPRSTTAASSCFSSLSSSPYSSGSSSCS  65

Query  268  sspsHRRVQDIRG------DKNNGLMMKSRSVAFITRRRRVDQDDGKGKAAGFWSKLLRR  429
            S    R   +++G        N+GL ++SRS+AF+TR R  +  DGK K  GFWS+ LR 
Sbjct  66   SPIPQRNGSELKGRICFVVSGNDGL-VRSRSMAFVTRNRIAEATDGK-KKGGFWSRFLRS  123

Query  430  RKNDRVNERLMHSKTTREGVAVI  498
                  +  +MHS+T RE V  +
Sbjct  124  TGKRTKDVVMMHSRTMRERVTSV  146



>ref|XP_002284055.3| PREDICTED: uncharacterized protein LOC100245494 [Vitis vinifera]
 emb|CBI19200.3| unnamed protein product [Vitis vinifera]
Length=187

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 90/150 (60%), Gaps = 9/150 (6%)
 Frame = +1

Query  67   RPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplss  246
            R   E++CRKHP H QSPGVCS+CL E+LSQL T+S S S T    +SS S SS S   S
Sbjct  34   RSKSEVLCRKHPKHRQSPGVCSICLRERLSQLSTSSRSASTTVASASSSSSLSSYSSHYS  93

Query  247  ssevsscs--spsHRRVQDIRGD-----KNNGLMMKSRSVAFITRRRRVDQDDGKGKAAG  405
            SSE SSCS     +R   D +G          ++ KSRSVAF+TR R  D    + K +G
Sbjct  94   SSEASSCSSPMQRYRFDSDAKGSFSFLLSGKNMLTKSRSVAFVTRMRAGDASQ-RNKKSG  152

Query  406  FWSKLLRRRKNDRVNERLMHSKTTREGVAV  495
            FWSKLLR R   R  E L++S+T RE V +
Sbjct  153  FWSKLLRPRAK-RTEEVLVYSRTVRERVGI  181



>emb|CAN82663.1| hypothetical protein VITISV_004929 [Vitis vinifera]
Length=167

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 90/150 (60%), Gaps = 9/150 (6%)
 Frame = +1

Query  67   RPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplss  246
            R   E++CRKHP H QSPGVCS+CL E+LSQL T+S S S T    +SS S SS S   S
Sbjct  14   RSKSEVLCRKHPKHRQSPGVCSICLRERLSQLSTSSRSASTTVASASSSSSLSSYSSHYS  73

Query  247  ssevsscs--spsHRRVQDIRGD-----KNNGLMMKSRSVAFITRRRRVDQDDGKGKAAG  405
            SSE SSCS     +R   D +G          ++ KSRSVAF+TR R  D    + K +G
Sbjct  74   SSEASSCSSPMQRYRFDSDAKGSFSFLLSGKNMLTKSRSVAFVTRMRXGDAXQ-RNKKSG  132

Query  406  FWSKLLRRRKNDRVNERLMHSKTTREGVAV  495
            FWSKLLR R   R  E L++S+T RE V +
Sbjct  133  FWSKLLRPRAK-RTEEVLVYSRTVRERVGI  161



>ref|XP_011009568.1| PREDICTED: uncharacterized protein LOC105114649 [Populus euphratica]
Length=161

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 80/141 (57%), Gaps = 7/141 (5%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTAS----VSGSNTTTGVAsscsssslsplsssse  255
            C+KHP H Q PGVCSVCL EKLSQL T +    ++  NT    +S   SS  S  S SS 
Sbjct  20   CKKHPKHEQPPGVCSVCLSEKLSQLPTGATTSRIASLNTMDCSSSCSLSSYSSFSSYSSP  79

Query  256  vsscsspsHRRVQ-DIRGDKNNGLMMKSRSVAFITRRRRVDQDDGKGKAAGFWSKLLRRR  432
            +     P+H +    +  +  N L+ KSRS+AF+ RR   ++D  + K  GFWSKLLR  
Sbjct  80   MHHFQIPTHGKGSFPLFFNGKNMLLTKSRSLAFVPRRG--NKDCHEKKKGGFWSKLLRLP  137

Query  433  KNDRVNERLMHSKTTREGVAV  495
            K   V E  +HS+T RE V +
Sbjct  138  KGKEVEEGRVHSRTMRERVII  158



>ref|XP_010320186.1| PREDICTED: uncharacterized protein LOC104647148 [Solanum lycopersicum]
Length=165

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 83/165 (50%), Gaps = 19/165 (12%)
 Frame = +1

Query  10   REFAPPNKQTQMEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSN  189
            R F    +  QM+I + + +    + C+KHP H Q+PGVCSVCL EKLS L   S S + 
Sbjct  6    RRFFKNFRDHQMQINKSKSKSKSIIFCKKHPKHKQNPGVCSVCLSEKLSLLSKTSTSNTT  65

Query  190  TTTGVAsscsssslsplssssevsscsspsHRRVQDIRGDKNNGLMMKSRSVAFITRRRR  369
              T    S SSS  S  SSS   S                 N  ++MKSRS+A I RR+ 
Sbjct  66   IVTSSCCSSSSSLSSLSSSSDVSSC-------------SSPNTNVLMKSRSLALIMRRKE  112

Query  370  -----VDQDDGKGKAAGFWSKLLRRRKNDRVNERLMHSKTTREGV  489
                  D   GK K  GF SKLL  ++N R +E L HS+T RE V
Sbjct  113  GGIILEDNSIGKKKKEGFLSKLLNPKRN-RKDEVLAHSRTMRERV  156



>ref|XP_009774907.1| PREDICTED: uncharacterized protein LOC104224886 [Nicotiana sylvestris]
Length=159

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 87/152 (57%), Gaps = 16/152 (11%)
 Frame = +1

Query  34   QTQMEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAss  213
            + QM+I++ + +    +IC+KHP H Q+PGVCSVCL EKLS L           + ++ S
Sbjct  9    KNQMQISKSKAKS-NSIICKKHPKHKQNPGVCSVCLSEKLSLL-----------SKISRS  56

Query  214  csssslsplssssevsscsspsHRRVQDIRGDKNNGLMMKSRSVAFITRRRR---VDQDD  384
             +++  +  SSS    S SS        +R   +N +++KSRS+A I RRR    +++ +
Sbjct  57   NTTTITTTSSSSLSSLSSSSDVSSCSSPLRYRMDNNVLIKSRSLALIMRRREGGILEESN  116

Query  385  GKGKAAGFWSKLLRRRKNDRVNERLMHSKTTR  480
            G  K  GF SKLL  R+N R +E L HS+T R
Sbjct  117  GNKKKGGFLSKLLNSRRN-RKDEGLTHSRTMR  147



>ref|XP_010272981.1| PREDICTED: uncharacterized protein LOC104608638 [Nelumbo nucifera]
Length=150

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 78/139 (56%), Gaps = 12/139 (9%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevssc  267
            C+KHP H QSPGVCS CL E+LSQL +A+    +  T  ASSCSSS  S   SS   S  
Sbjct  10   CKKHPKHRQSPGVCSSCLRERLSQLSSAT----SRRTTAASSCSSSLSSSPYSSDSSSCS  65

Query  268  sspsHRRVQDIRG------DKNNGLMMKSRSVAFITRRRRVDQDDGKGKAAGFWSKLLRR  429
            S  S      ++G        N+GLM +SRS+AF+TR R   +   + K  GFWSKLLR 
Sbjct  66   SPLSQPNASQVKGPVCFLKSGNDGLM-RSRSIAFVTRNRIAAEITDEKKKGGFWSKLLRS  124

Query  430  RKND-RVNERLMHSKTTRE  483
                 R    +MHS+T RE
Sbjct  125  TSTSKRTKGAMMHSRTVRE  143



>ref|XP_011085886.1| PREDICTED: uncharacterized protein DDB_G0287625-like [Sesamum 
indicum]
Length=182

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 83/145 (57%), Gaps = 16/145 (11%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevssc  267
            C+KHP H QSPGVCS+CL EKL  L     +  + +   A+    SS S   SS   S+ 
Sbjct  36   CKKHPKHRQSPGVCSICLGEKLLHLTNNPTTSCSRSKPAAAHSPYSSSSSYLSSLSSSNA  95

Query  268  sspsH--RRVQDIRGDKN-------NGLMMKSRSVAFITRRRRVDQDDGKGKA--AGFWS  414
            SS S   RR   ++  K+       + ++ KSRS+AF+ +RR+   ++GK     +GFWS
Sbjct  96   SSYSSPIRRFDSVQARKSTRVFKNVDNVLKKSRSMAFVLQRRKEGDENGKSSESKSGFWS  155

Query  415  KLLRRRKNDRVNERLMHSKTTREGV  489
            KLL+RR     N+ LMHS+TTRE V
Sbjct  156  KLLQRR-----NKGLMHSRTTRERV  175



>ref|XP_009618697.1| PREDICTED: uncharacterized protein LOC104110843 [Nicotiana tomentosiformis]
Length=162

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 96/153 (63%), Gaps = 16/153 (10%)
 Frame = +1

Query  40   QMEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscs  219
            QM+I++ + +    +IC+KHP H Q+PGVCSVCL EKLS L   +   + TT   +    
Sbjct  14   QMQISKSKAKS-NSIICKKHPKHKQNPGVCSVCLSEKLSMLSKTTSRSNTTTITSS----  68

Query  220  ssslsplssssevsscsspsHRRVQDIRGDKNNGLMMKSRSVAFITRRRR---VDQDDGK  390
            SSSLS LSSSS+VSSCSSP H R        +N ++ KSRS+A I RRR    +++ +G 
Sbjct  69   SSSLSSLSSSSDVSSCSSPPHYRT-------DNNVLTKSRSLALIMRRREGGILEESNGN  121

Query  391  GKAAGFWSKLLRRRKNDRVNERLMHSKTTREGV  489
             K  GF SKLL  R+N + +E L HS+T RE V
Sbjct  122  KKKGGFLSKLLNLRRNIK-DEGLAHSRTMRERV  153



>ref|XP_002302313.1| hypothetical protein POPTR_0002s10060g [Populus trichocarpa]
 gb|EEE81586.1| hypothetical protein POPTR_0002s10060g [Populus trichocarpa]
Length=165

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 85/145 (59%), Gaps = 10/145 (7%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevssc  267
            C+KHP H QSPGVCSVCL EKLSQL T++ +  +++T      SSSSLS   SSS   S 
Sbjct  20   CKKHPKHKQSPGVCSVCLSEKLSQLSTSASNSRSSSTNTMDCSSSSSLSSYYSSSSSCSY  79

Query  268  sspsHRRVQDIRG---------DKNNGLMMKSRSVAFITRRRRVDQDDGKGKAAGFWSKL  420
            SSP HR     +G         +  +  + KSRS+A ++     D  + K K  G WSKL
Sbjct  80   SSPMHRFQYPPQGKGYSLPSLFNGKSNFLTKSRSLALVSIIGNKDCHEIK-KKGGLWSKL  138

Query  421  LRRRKNDRVNERLMHSKTTREGVAV  495
            LRR K+ +V E L+HS+T RE + +
Sbjct  139  LRRPKDKKVEEGLVHSRTMRERIVI  163



>emb|CDP01106.1| unnamed protein product [Coffea canephora]
Length=170

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 91/173 (53%), Gaps = 26/173 (15%)
 Frame = +1

Query  13   EFAPPNKQTQMEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNT  192
            EF  P  Q     TRP        +C KHP H QSPGVCS+CL EKLSQL ++S   + T
Sbjct  2    EFRRPRHQQTARSTRPNG------MCNKHPKHQQSPGVCSICLTEKLSQLSSSSSRSNTT  55

Query  193  TTGV-------AsscsssslsplssssevsscsspsHRRVQDIRG-------DKNNGLMM  330
             T V       + S  SSS    S+SS  S   S  +R   D RG            ++ 
Sbjct  56   ATTVDSSCSSSSLSSLSSSHYSASASSCSSPVHSHHYRMTSDGRGLSSLSFFRSGRNVLT  115

Query  331  KSRSVAFITRRRR----VDQDDGKGKAAGFWSKLLRRRKNDRVNERLMHSKTT  477
            KSRSVAFITRRR     +  D GK K +GFWSKLLR R + R +E L+HS+T 
Sbjct  116  KSRSVAFITRRRDAGEVIAMDHGK-KKSGFWSKLLRPR-SKRTDEGLVHSRTV  166



>ref|XP_006433924.1| hypothetical protein CICLE_v10002675mg [Citrus clementina]
 gb|ESR47164.1| hypothetical protein CICLE_v10002675mg [Citrus clementina]
Length=172

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 72/150 (48%), Gaps = 14/150 (9%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslspl---------  240
            CRKHP H QSPGVCS+CL +KLSQL   S S S  T       SSSSLS           
Sbjct  22   CRKHPKHKQSPGVCSLCLRDKLSQLAAISSSSSRNTLDSCCYSSSSSLSSYYSSSEASSC  81

Query  241  -----ssssevsscsspsHRRVQDIRGDKNNGLMMKSRSVAFITRRRRVDQDDGKGKAAG  405
                 +  S  ++     H     + G + N ++ KSRS+     R R  + + K K  G
Sbjct  82   SSPVFNKYSVTTTDHQGKHSLSTLLFGSRKNNVLTKSRSLVSFVPRVRNQEGESKKKKNG  141

Query  406  FWSKLLRRRKNDRVNERLMHSKTTREGVAV  495
             +SKL R R     ++ L+HS+T RE V  
Sbjct  142  LFSKLFRPRNKKNADQGLVHSRTMREVVTT  171



>gb|KDO37338.1| hypothetical protein CISIN_1g036032mg, partial [Citrus sinensis]
Length=187

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 71/146 (49%), Gaps = 14/146 (10%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslspl---------  240
            CRKHP H QSPGVCS+CL +KLSQL   S S S  T       SSSSLS           
Sbjct  37   CRKHPKHKQSPGVCSLCLRDKLSQLAAISSSSSRNTLDSCCYSSSSSLSSYYSSSEASSC  96

Query  241  -----ssssevsscsspsHRRVQDIRGDKNNGLMMKSRSVAFITRRRRVDQDDGKGKAAG  405
                 +  S  ++     H     + G + N ++ KSRS+     R R  + + K K  G
Sbjct  97   SSPVFNKYSVTTTDHQGKHSLSTLLFGSRKNNVLTKSRSLVSFVPRVRNQEGESKKKKNG  156

Query  406  FWSKLLRRRKNDRVNERLMHSKTTRE  483
             +SKL R R     ++ L+HS+T RE
Sbjct  157  LFSKLFRPRNKKNADQGLVHSRTMRE  182



>gb|KDP41420.1| hypothetical protein JCGZ_15827 [Jatropha curcas]
Length=174

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 97/172 (56%), Gaps = 22/172 (13%)
 Frame = +1

Query  31   KQTQMEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAs  210
            K+++ E T  + +P  +  C+KHP H QSPGVCSVCL EKLS L ++S   S T     +
Sbjct  5    KRSKQEATATKSKPDGK--CKKHPKHKQSPGVCSVCLNEKLSMLSSSS---SRTAVMDYA  59

Query  211  scsssslsplssssevsscsspsHRRVQDIRGDKNNG-----------LMMKSRSVAFIT  357
            S SS+S     S++  SSCSSP HR      G+ + G           ++ KSRS+AF+ 
Sbjct  60   SSSSASSLSAYSTTSCSSCSSPMHRFRFTTEGNNHKGSLSFLLISGKNVLTKSRSLAFVP  119

Query  358  RRR----RVDQDDGKGKAAGFWSKLLRR-RKNDRVNERLMHSKTTREGVAVI  498
            R R    R   DD K K  GF+SKLLRR R N R  + LMHS++ RE V  I
Sbjct  120  RNRGNKERASHDDDK-KKGGFFSKLLRRPRTNKRAEQGLMHSRSMRERVMSI  170



>ref|XP_006472556.1| PREDICTED: uncharacterized protein LOC102618680 [Citrus sinensis]
Length=172

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 70/146 (48%), Gaps = 14/146 (10%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscssssls-----------  234
            CRKHP H QSPGVCS+CL +KLSQL   S S S  T       SSSSLS           
Sbjct  22   CRKHPKHKQSPGVCSLCLRDKLSQLAAISSSSSRNTLDSCCYSSSSSLSSYYSSSEASSC  81

Query  235  ---plssssevsscsspsHRRVQDIRGDKNNGLMMKSRSVAFITRRRRVDQDDGKGKAAG  405
                 +     ++     H     + G + N ++ KSRS+     R R  + + K K  G
Sbjct  82   SSPVYNKYRVTTTDHQGKHFLSTLLFGSRKNNVLTKSRSLVSFVPRVRNQEGESKKKKNG  141

Query  406  FWSKLLRRRKNDRVNERLMHSKTTRE  483
             +SKL R R     ++ L+HS+T RE
Sbjct  142  LFSKLFRPRNKKNADQGLVHSRTMRE  167



>ref|XP_006363294.1| PREDICTED: uncharacterized protein LOC102586560 [Solanum tuberosum]
Length=168

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 86/168 (51%), Gaps = 22/168 (13%)
 Frame = +1

Query  10   REFAPPNKQTQMEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSN  189
            R F    +  QM+I + + +    ++C+KHP H Q+PGVCSVCL EKLS L   S S + 
Sbjct  6    RRFFKNFRDNQMQINKSKSKSNSIILCKKHPKHKQNPGVCSVCLSEKLSLLSKTSRSNTT  65

Query  190  TTTGVAsscsssslsplssssevsscsspsHRRVQDIRGDKNNGLMMKSRSVAFITRRRR  369
            T T   SS SS S    SS     S                N  ++MKSRS+A I RR+ 
Sbjct  66   TITSSCSSSSSLSSLSSSSDVSSCSSP--------------NTNVLMKSRSLALIMRRKE  111

Query  370  ----VDQDDGKG----KAAGFWSKLLRRRKNDRVNERLMHSKTTREGV  489
                ++ ++  G    K  GF +KLL  ++N + +E L HS+T RE V
Sbjct  112  GGIILEDNNSIGKKKKKKEGFLTKLLNPKRNRKDHEVLTHSRTMRERV  159



>ref|XP_006360263.1| PREDICTED: uncharacterized protein LOC102579809 [Solanum tuberosum]
Length=150

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 87/139 (63%), Gaps = 9/139 (6%)
 Frame = +1

Query  40   QMEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscs  219
            Q +I + + +P   +IC+KH  H QSPGVCS+CL EKLS+L  +  S    TT   SS S
Sbjct  13   QQQINKAK-KPKTIIICKKHSKHQQSPGVCSICLSEKLSKL--SKTSRIINTTSSCSSSS  69

Query  220  ssslsplssssevsscsspsHRRVQ---DIRGDKNNGLMMKSRSVAFITRRRRVD-QDDG  387
            S S    SSS +VSSCSSP++RR++    +RG  N  ++ KSRS+ F+T R+  + +++G
Sbjct  70   SLSSLSSSSSYDVSSCSSPAYRRMKTMATLRGGGNINVLTKSRSLVFVTTRKDGEFEENG  129

Query  388  KGKAA--GFWSKLLRRRKN  438
            K K    G  SKLL  RKN
Sbjct  130  KNKDKKRGLLSKLLHPRKN  148



>ref|XP_006353202.1| PREDICTED: uncharacterized protein LOC102586963 [Solanum tuberosum]
Length=140

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 74/141 (52%), Gaps = 21/141 (15%)
 Frame = +1

Query  82   LICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevs  261
            +IC+KHP H Q PGVCS CL EKLS++         TT    SS  SS  S  SSS+  S
Sbjct  8    VICKKHPQHKQQPGVCSCCLREKLSKI------NGTTTIAKISSIPSSISSSASSSNCAS  61

Query  262  scsspsHRRV-QDIRGDKNNGLMM------------KSRSVAFITRRRRVDQDDGKGKAA  402
              ++  HRR+  D+ G   + + +            KSRS+AF+ R  RV   +GK K  
Sbjct  62   PRAAIGHRRITSDVAGGHYSFVTLAAANGGGGGGLKKSRSIAFVARGGRVG-INGKKKKE  120

Query  403  GFWSKLLRRRKNDRVNERLMH  465
            GFWSKL+ R    R N  ++H
Sbjct  121  GFWSKLI-RSTGKRTNRVVVH  140



>ref|XP_004250117.1| PREDICTED: uncharacterized protein LOC101262884 [Solanum lycopersicum]
Length=141

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 73/144 (51%), Gaps = 26/144 (18%)
 Frame = +1

Query  82   LICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevs  261
            +IC+KHP H Q PGVCS CL EKLS++        N TT +A   S  S    S SS   
Sbjct  8    VICKKHPQHKQQPGVCSCCLREKLSKI--------NGTTTIAKISSIPSSISSSVSSSNC  59

Query  262  sc--sspsHRRV-QDIRGDKNNGLMM-------------KSRSVAFITRRRRVDQDDGKG  393
            +   ++  HRR+  D+ G   + + +             KSRS+AF+ R  RV   +GK 
Sbjct  60   NSPRAAIGHRRITSDVAGGHYSFVALAAANAGGGGGGLKKSRSIAFVARGGRVG-INGKK  118

Query  394  KAAGFWSKLLRRRKNDRVNERLMH  465
            K  GFWSKL+ R    R N  ++H
Sbjct  119  KKEGFWSKLI-RSTGKRTNRVVVH  141



>ref|XP_009589374.1| PREDICTED: uncharacterized protein LOC104086750 [Nicotiana tomentosiformis]
Length=133

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 73/141 (52%), Gaps = 26/141 (18%)
 Frame = +1

Query  79   ELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssev  258
            E+IC+KHPNH Q PGVCS CL E+L++L T+      TTT        S     +SSS  
Sbjct  7    EMICKKHPNHKQQPGVCSSCLRERLNKLSTS------TTT----IMPLSLALSSTSSSTF  56

Query  259  sscsspsHRRV-QDIRGD-----------KNNGLMMKSRSVAFITRRRRVDQDDGKGKAA  402
             S  S  HRR+  D+ G               G + KSRS+AF+ R   +   +G+ K  
Sbjct  57   DSPRSGGHRRITSDVVGSFSFVSIIGAGAGAGGGLKKSRSIAFVARSGGL---NGQKKKE  113

Query  403  GFWSKLLRRRKNDRVNERLMH  465
            GFWSKL+R R   R N  L+H
Sbjct  114  GFWSKLIRSR-GKRSNRVLVH  133



>ref|XP_002513964.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48547.1| conserved hypothetical protein [Ricinus communis]
Length=174

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 84/153 (55%), Gaps = 14/153 (9%)
 Frame = +1

Query  58   PRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsp  237
            PR +P     C+KHP H QSPGVCS+CL EKLSQL T S S   T++  + S SSS  S 
Sbjct  14   PRTKPDGR--CKKHPKHKQSPGVCSICLSEKLSQLSTTSSSSRATSSMDSLSSSSSLSSY  71

Query  238  lssssevsscsspsHRRVQDIRGD-----KNNGLMMKSRSVAFITR------RRRVDQDD  384
             SSS    S     +R   + +G          ++ +SRS+ FI+R      + +VD +D
Sbjct  72   SSSSCSSCSSPMHRYRPGHEGKGSFSFLLSGKNVLTRSRSLVFISRTKIRGNKEKVD-ND  130

Query  385  GKGKAAGFWSKLLRRRKNDRVNERLMHSKTTRE  483
             K K  GFWSKL  R KN  + E L+HS+T  E
Sbjct  131  HKIKKTGFWSKLRLRPKNKGMEEGLVHSRTIEE  163



>ref|XP_009787285.1| PREDICTED: uncharacterized protein LOC104235261 [Nicotiana sylvestris]
Length=137

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 72/142 (51%), Gaps = 24/142 (17%)
 Frame = +1

Query  79   ELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssev  258
            E+IC+KHPNH Q PGVCS CL EKL++L T+      TTT        S  S  +SSS  
Sbjct  7    EIICKKHPNHKQQPGVCSSCLREKLNKLSTS------TTT----IMPLSLSSSSTSSSNF  56

Query  259  sscsspsHRRV-QDIRG-----------DKNNGLMMKSRSVAFITRRR-RVDQDDGKGKA  399
             S     HRR+  D+ G               G + KSRS+AF+ R   R    +G+ K 
Sbjct  57   DSPRGGGHRRITSDVVGPFSFVSIIGAGAGAGGGLKKSRSIAFVARSGCRSGGLNGQKKK  116

Query  400  AGFWSKLLRRRKNDRVNERLMH  465
             GFWSKL+R     R N  L+H
Sbjct  117  EGFWSKLIRSTA-KRSNTVLVH  137



>ref|XP_007018706.1| Uncharacterized protein TCM_034853 [Theobroma cacao]
 gb|EOY15931.1| Uncharacterized protein TCM_034853 [Theobroma cacao]
Length=175

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 86/143 (60%), Gaps = 12/143 (8%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevssc  267
            CR+HP H QSPGVCS+CL EKLSQL   + S S TTT  +SS SSSSLS   SSS  SSC
Sbjct  27   CRRHPKHRQSPGVCSLCLGEKLSQLSAHTSSRSITTTVSSSSSSSSSLSSYHSSSSASSC  86

Query  268  sspsHRRVQDIRGDKNN---------GLMMKSRSVAFITRRRRVDQDDGKGKAAGFWSKL  420
            SSP HR      G   +          ++ KSRS+AF +R RR  + D K K  GF SKL
Sbjct  87   SSPMHRYRFTTEGKGTSLSLLLFSGKNILTKSRSLAFASRMRR-KEGDDKKKKDGFLSKL  145

Query  421  LRRRKNDRVNER--LMHSKTTRE  483
            L  R + ++ E   LMHS+T RE
Sbjct  146  LHPRSSKKMEEAAGLMHSRTMRE  168



>ref|XP_004501689.1| PREDICTED: cullin-3-like [Cicer arietinum]
Length=117

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 63/112 (56%), Gaps = 0/112 (0%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevssc  267
            CRKHP H QSPGVCS+CL +KL QL + S +   TTT V SS  SS+ S  S  S  S  
Sbjct  5    CRKHPKHVQSPGVCSLCLKDKLVQLSSCSTTSQRTTTTVDSSSCSSTSSLSSCDSSSSCS  64

Query  268  sspsHRRVQDIRGDKNNGLMMKSRSVAFITRRRRVDQDDGKGKAAGFWSKLL  423
            S         I   + NG ++KSRS+A + RRR+ D      K +GFW KL 
Sbjct  65   SPMHSFSSVSIFLFQKNGGLVKSRSMAVVPRRRKRDNQTNDRKKSGFWFKLF  116



>ref|XP_002534524.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27860.1| conserved hypothetical protein [Ricinus communis]
Length=146

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 59/135 (44%), Gaps = 12/135 (9%)
 Frame = +1

Query  79   ELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssev  258
            E  C  HP H Q  GVC  CL E+LS+LY  + +         S  SS       SS   
Sbjct  2    EKACMDHPYHNQKQGVCPCCLRERLSKLYAVAATAPMAAAAELSYSSSVMSCSSVSSFNH  61

Query  259  sscsspsHRR-VQDIRGD----------KNNGLMMKSRSVAFITRRRRVDQDDGKGKAAG  405
             S     H+R   DI G            N GL  KSRS+AF+TR    D   GK K  G
Sbjct  62   ISPLRHRHQRTASDIMGSMSFKVSSALGSNYGLK-KSRSIAFVTRSLVGDVTHGKNKKKG  120

Query  406  FWSKLLRRRKNDRVN  450
            FWSKLL  +    VN
Sbjct  121  FWSKLLHLKGKKEVN  135



>ref|XP_010098634.1| hypothetical protein L484_012747 [Morus notabilis]
 gb|EXB75373.1| hypothetical protein L484_012747 [Morus notabilis]
Length=165

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 82/162 (51%), Gaps = 32/162 (20%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVS-GSNTTTGVAsscsssslsplssssevss  264
            C+KHP H QSPGVCSVCL EKL QL  AS+  GS  T  ++++  S   S  SS S   S
Sbjct  7    CKKHPKHRQSPGVCSVCLREKLCQL--ASIHPGSRRTNNISTTTRSPGSSTTSSLSSYYS  64

Query  265  csspsHR--------RVQDIRGDK--------------NNGLMMKSRSVAFI---TRRRR  369
             SS S          R  +I   +              N  ++ KSRS+AF    + R  
Sbjct  65   SSSCSSCSSPMQYRCRTYNINNAREGKGLSMSSFLLSGNINVLKKSRSMAFAIPRSTRSG  124

Query  370  VDQD--DGKGKAAGFWSKLLRRRKNDRVNERLMHSKTTREGV  489
             D+D  D + + +GFWSKLL  + N R  E  MHS+T RE V
Sbjct  125  ADKDGSDDQKRKSGFWSKLLIPQGNKR--ETFMHSRTVRERV  164



>ref|XP_009793703.1| PREDICTED: uncharacterized protein LOC104240541 [Nicotiana sylvestris]
Length=139

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 72/127 (57%), Gaps = 17/127 (13%)
 Frame = +1

Query  79   ELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssev  258
            E+IC+KHP H Q PGVCS CL EKLS+     ++G++T     +S SSS  S  +SS+ V
Sbjct  7    EVICKKHPQHKQQPGVCSCCLREKLSK-----INGTSTIMAALASISSSLSSSTTSSNCV  61

Query  259  sscsspsHRRV-QDIRGDKNNGLM----------MKSRSVAFITRRRRVDQDDGKGKAAG  405
            S   +  HRR+  D+ G   + +            KSRS+A + R  RV   +GK K  G
Sbjct  62   SPRGAIGHRRITSDVTGGHYSFVTLASGGAGGGLKKSRSIAIVARGGRVG-INGKKKKEG  120

Query  406  FWSKLLR  426
            FWSKL++
Sbjct  121  FWSKLIK  127



>ref|XP_009787284.1| PREDICTED: uncharacterized protein LOC104235260 [Nicotiana sylvestris]
Length=142

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 71/138 (51%), Gaps = 20/138 (14%)
 Frame = +1

Query  79   ELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssev  258
            E+IC+KHP+H Q PGVCS CL E+LS+L T     S  T  V SS +SS  S  SSS+  
Sbjct  7    EIICKKHPDHKQQPGVCSCCLRERLSKLST-----STATIAVISSSTSSLFSSTSSSTCN  61

Query  259  sscsspsHRRVQDIRG-----------DKNNGLMMKSRSVAFITRR--RRVDQDDGKGKA  399
            S       R + D+ G               G + KS+S AF+ R   R     +G+ K 
Sbjct  62   SPRVGGHRRIISDVVGPFTFVSIIGTGAGAGGGLKKSKSQAFVARTGCRSGGLLNGQKKK  121

Query  400  AGFWSKLLRR--RKNDRV  447
             GFWSKL+R   +K  RV
Sbjct  122  EGFWSKLIRSTGKKTKRV  139



>ref|XP_009586595.1| PREDICTED: uncharacterized protein LOC104084449 [Nicotiana tomentosiformis]
 gb|AAG43558.1|AF211540_1 Avr9/Cf-9 rapidly elicited protein 75 [Nicotiana tabacum]
Length=139

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 71/127 (56%), Gaps = 17/127 (13%)
 Frame = +1

Query  79   ELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssev  258
            E+IC+KHP H Q PGVCS CL EKLS+     ++G++T     +S SSS  S  +SS+ V
Sbjct  7    EVICKKHPQHKQQPGVCSCCLREKLSK-----INGTSTIMAALASISSSLSSSTTSSNCV  61

Query  259  sscsspsHRRV-QDIRGDKNNGLM----------MKSRSVAFITRRRRVDQDDGKGKAAG  405
            S   +  HRR+  D+     + +            KSRS+A + R  RV   +GK K  G
Sbjct  62   SPRGAIGHRRITSDVTSGHYSFVTLAGGGAGGGLKKSRSIAIVARGGRVG-INGKKKKEG  120

Query  406  FWSKLLR  426
            FWSKL++
Sbjct  121  FWSKLIK  127



>ref|XP_009374122.1| PREDICTED: uncharacterized protein LOC103963068 [Pyrus x bretschneideri]
Length=161

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 82/157 (52%), Gaps = 14/157 (9%)
 Frame = +1

Query  43   MEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLS----QLYTASVSGSNTTTGVAs  210
            ME  R   +   ++ C++HP H QSPGVCS+CL EKL     +L T SV   + T   + 
Sbjct  1    MEKLRRSSKNKTDVACKRHPKHQQSPGVCSLCLKEKLERVAHKLSTYSVPYLHRTFSASP  60

Query  211  scsssslsplssssevsscsspsHRRVQDIRGDKN------NGLMMKSRSVAFITRRRRV  372
            S +SS  S  SSSS  SS S        D +G  +      N ++ KSRS+     RR+ 
Sbjct  61   STTSSLSSYYSSSSASSSSSPAPG---YDQKGSISWLLSGENNVLSKSRSLVNYFPRRKR  117

Query  373  DQDDGKGKAAGFWSKLLRRRKNDRVNERLMHSKTTRE  483
            +    + K + FW+KLL R  + R  E LMHS+T RE
Sbjct  118  EMGSEEKKKSRFWTKLL-RPISKRREEGLMHSRTVRE  153



>ref|XP_004490386.1| PREDICTED: uncharacterized protein LOC101507869 [Cicer arietinum]
Length=158

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVA  207
            C+KHP H QSPGVCS+CL EKLSQL  +S S +NTT  VA
Sbjct  26   CKKHPKHNQSPGVCSLCLREKLSQL--SSFSSNNTTFFVA  63



>ref|XP_008372991.1| PREDICTED: uncharacterized protein LOC103436349 [Malus domestica]
Length=161

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 83/155 (54%), Gaps = 10/155 (6%)
 Frame = +1

Query  43   MEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQL------YTASVSGSNTTTGV  204
            ME  R   +   ++ C++HP H QSPGVCS+CL EKL ++      Y+      N +   
Sbjct  1    MEKLRRSSKNKTDIACKRHPKHQQSPGVCSLCLKEKLERVAHKLSTYSIPYLHRNLSASP  60

Query  205  AsscsssslsplssssevsscsspsHRR--VQDIRGDKNNGLMMKSRSVAFITRRRRVDQ  378
            +++ S SS    SS+S  SS +    ++  +  +   +NN ++ KSRS+     RR+ + 
Sbjct  61   STTSSLSSYYSSSSASSSSSPAPGYEQKGSISWLLSGENN-VLSKSRSLVNYFPRRKREM  119

Query  379  DDGKGKAAGFWSKLLRRRKNDRVNERLMHSKTTRE  483
               + K + FW+KLL R  + R  E LMHS+T RE
Sbjct  120  GSEEKKKSRFWTKLL-RPISKRREEGLMHSRTVRE  153



>ref|XP_003531335.1| PREDICTED: uncharacterized protein LOC100806374 [Glycine max]
Length=139

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 64/144 (44%), Gaps = 30/144 (21%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevssc  267
            C+ HPN+ Q PGVC  CL +KL +LY +    SN T  +                     
Sbjct  10   CKYHPNNKQLPGVCPSCLRDKLLKLYDS----SNPTYPLP--------------CPPRPY  51

Query  268  sspsHRRVQDIRGDKNNGLMM-------KSRSVAFITR----RRRVDQDDGKGKAAGFWS  414
             S  HRR   +  D  +  M+       KS S+AF +R     R V+ ++   K  G WS
Sbjct  52   VSRGHRRHSSLVMDSASSTMVSFNYGLKKSNSIAFASRSQAINREVNGNNKGSKKRGIWS  111

Query  415  KLLRRRKNDRVNERLMHSKTTREG  486
            KLL+  K +   E  MHS++  EG
Sbjct  112  KLLKLTKKN-TKEAFMHSRSVSEG  134



>gb|EYU30875.1| hypothetical protein MIMGU_mgv1a015686mg [Erythranthe guttata]
Length=149

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 77/146 (53%), Gaps = 25/146 (17%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVS-----GSNTTTGVAsscsssslsplssss  252
            C+KH  H QS GVCS+CL EKLSQL +  ++      S   +  +SS   SSLS  S+ S
Sbjct  10   CKKHKRHIQSHGVCSICLSEKLSQLISTPITNNNNSLSPPPSSSSSSYDLSSLSSSSNPS  69

Query  253  evsscsspsHRRVQDIRGDKN--------NGLMMKSRSVAFITRRRRVDQDDGKGKAAGF  408
              SS  +  + R + +   K+        N ++ KSRS+AFI+       ++GK    GF
Sbjct  70   SCSSPMAIEYSRQRLMESSKSRRSTRVFKNVVLNKSRSMAFIS------DENGKNIKRGF  123

Query  409  WSKLL-RRRKNDRVNERLMHSKTTRE  483
            WSK L + RK       LMHSKT RE
Sbjct  124  WSKFLPKTRKG-----LLMHSKTMRE  144



>emb|CDX73319.1| BnaC05g27870D [Brassica napus]
Length=156

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  49   ITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNT  192
            +++P+ +    ++C+KHP H QSPGVCS+CL E+LS    A+ S +N+
Sbjct  14   MSKPQEKTKNTMLCKKHPKHRQSPGVCSLCLNERLSMFIKATSSSTNS  61



>ref|XP_007163669.1| hypothetical protein PHAVU_001G253900g [Phaseolus vulgaris]
 gb|ESW35663.1| hypothetical protein PHAVU_001G253900g [Phaseolus vulgaris]
Length=145

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 64/131 (49%), Gaps = 3/131 (2%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevssc  267
            CR+HP+  QSPGVCS CL EKLSQLY+ +          AS  S       S        
Sbjct  16   CREHPHDKQSPGVCSSCLREKLSQLYSTNPVIDPLCFSPASPASPHQSFSSSRGGHRRPR  75

Query  268  sspsHRRVQDIRGD-KNNGL-MMKSRSVAFITRRRRVDQDDGKGKAAGFWSKLLRRRKND  441
               +   V    G     GL + KS+S+AF ++ R  ++D    K  GFWSK+L+ ++ D
Sbjct  76   FRRNASLVAAESGSCAAQGLNLKKSKSLAFGSKSRGRERDVSGRKKDGFWSKVLKLKRRD  135

Query  442  RVNERLMHSKT  474
               + +  SKT
Sbjct  136  -TRDSMATSKT  145



>ref|XP_003525042.1| PREDICTED: uncharacterized protein LOC100787601 [Glycine max]
Length=141

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 64/142 (45%), Gaps = 26/142 (18%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevssc  267
            C+ HPN+ Q PGVC  CL +KL +LY  S               + +             
Sbjct  10   CKYHPNNKQLPGVCPSCLRDKLLKLYDNS---------------NPTYPLPCPPPPPPPY  54

Query  268  sspsHRRVQDIRGDKNNGL------MMKSRSVAFITRRRRVDQD-DGKGKAA---GFWSK  417
                HRR   +  D  + +      + KS S+AF +R + +D++ +G  + +   G WSK
Sbjct  55   LFRGHRRHSSLVMDSASSMVSFNYGLEKSNSIAFASRSQAIDREVNGSNRGSKKRGIWSK  114

Query  418  LLRRRKNDRVNERLMHSKTTRE  483
            LL+  K +   E  MHS+T RE
Sbjct  115  LLKLTKKN-TKETFMHSRTMRE  135



>ref|XP_011023085.1| PREDICTED: uncharacterized protein LOC105124676 [Populus euphratica]
Length=152

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 67/138 (49%), Gaps = 18/138 (13%)
 Frame = +1

Query  73   PKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssss  252
            P++ +CR HP + Q  GVC+ CL E+L QL        NT+     + +S S SP    S
Sbjct  6    PEKQVCRIHPYNDQKQGVCASCLRERLKQLIYV-----NTSQAAIMAPASCSSSPGDPYS  60

Query  253  evsscsspsHRRVQDIRGDKNNGL------------MMKSRSVAFITRRRRVDQDDGKGK  396
              SS    S RR      D NN +            + KSRS+AF++R    +  +GK  
Sbjct  61   PASSSDHVSRRRHHRNISDNNNSMGSISFRVSIGDRLKKSRSLAFVSRNHVGEVKNGKKN  120

Query  397  AAGFWSKLLRRR-KNDRV  447
              GFW+KLL  + K D+V
Sbjct  121  NRGFWTKLLHLKGKKDQV  138



>ref|XP_008364449.1| PREDICTED: uncharacterized protein LOC103428127 [Malus domestica]
Length=162

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 79/157 (50%), Gaps = 13/157 (8%)
 Frame = +1

Query  43   MEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLS----QLYTASV------SGSNT  192
            ME  R   +   ++ C+KHP H QSPGVCS+CL EKL     +L T SV        ++ 
Sbjct  1    MEKLRRSSKKKSDIACKKHPKHQQSPGVCSLCLKEKLERVAQKLSTYSVPYLRRTFSASP  60

Query  193  TTGVAsscsssslsplssssevsscsspsHRRVQDIRGDKNNGLMMKSRSVAFITRRRRV  372
            +T  + S   SS S  S+SS               + G+ N  ++ KSRS+     RR+ 
Sbjct  61   STTSSLSSHYSSSSGSSASSPAPGYEQKGSTITWLLSGESN--VLSKSRSLVNYFPRRKR  118

Query  373  DQDDGKGKAAGFWSKLLRRRKNDRVNERLMHSKTTRE  483
            +    + K + FW+KLL R  + R  E L+HS+T RE
Sbjct  119  ELSSEEKKKSRFWTKLL-RPISKRREEGLVHSRTVRE  154



>ref|XP_009348037.1| PREDICTED: uncharacterized protein LOC103939655 [Pyrus x bretschneideri]
Length=161

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 83/161 (52%), Gaps = 22/161 (14%)
 Frame = +1

Query  43   MEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLS----QLYTASVSGSNTTTGVAs  210
            ME  R   +   ++ C++HP H QSPGVCS+CL EKL     +L T SV   + T   + 
Sbjct  1    MEKLRRSSKNKTDVACKRHPKHQQSPGVCSLCLKEKLERVAHKLSTYSVPYLHRTFSASP  60

Query  211  scsssslsplssssevsscsspsHRRVQDIRGDKN------NGLMMKSRSVAFITRRRRV  372
            S +SS  S  SSSS  SS S        D +G  +      N ++ KSRS+     RR+ 
Sbjct  61   STTSSLSSYYSSSSASSSSSPAPG---YDQKGSISWLLSGENNVLSKSRSLVNYFPRRKR  117

Query  373  DQDDGKGKAAGFWSKLL----RRRKNDRVNERLMHSKTTRE  483
            +    + K + FW+KLL    +RR+     E LMHS+T RE
Sbjct  118  EMGSEEKKKSRFWTKLLCPISKRRE-----EGLMHSRTVRE  153



>gb|KHN27380.1| hypothetical protein glysoja_041754 [Glycine soja]
Length=198

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 90/190 (47%), Gaps = 37/190 (19%)
 Frame = +1

Query  25   PNKQTQMEITRP--RPRPP---KELI---------CRKHPNHGQSPGVCSVCLMEKLSQL  162
            PN      I     R RPP   K++I         C+KHPNH QSPGVCS+CL  KLSQL
Sbjct  5    PNDNVAFNIIMANLRIRPPSKDKDIIGRFMPNNGCCKKHPNHRQSPGVCSLCLRHKLSQL  64

Query  163  YTASVSGSNTTTGVAsscsssslsplssssev-----------sscsspsHRRVQDIRGD  309
             +AS+  +   +   SS +SSSLS   SSS                S      V      
Sbjct  65   SSASMRKTTLISSCRSSSTSSSLSSYCSSSSSSCASPTLPFPFHKDSKSGSNSVSIFLLS  124

Query  310  KNNGLMMKSRSVAFITRRRRVDQDDGKG-------KAAGFWSKLLR-RRKNDRVNE----  453
              +G ++K+ S++ +  RRR     G G       K  GFWSKLL  + K+ R++E    
Sbjct  125  AKHGGVLKTGSMSVLATRRRTKGGGGDGDGDDRNKKKTGFWSKLLHPKTKSKRMDEIKGT  184

Query  454  RLMHSKTTRE  483
            +L+HS++  E
Sbjct  185  KLVHSRSLIE  194



>ref|XP_003522783.2| PREDICTED: uncharacterized protein LOC100808609 [Glycine max]
Length=199

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  73   PKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASV  177
            P    C+KHPNH QSPGVCS+CL  KLSQL +AS+
Sbjct  35   PNNGCCKKHPNHRQSPGVCSLCLRHKLSQLSSASM  69



>ref|XP_009589377.1| PREDICTED: uncharacterized protein LOC104086751 [Nicotiana tomentosiformis]
Length=134

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 68/141 (48%), Gaps = 34/141 (24%)
 Frame = +1

Query  79   ELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssev  258
            E+IC+KHP+H Q PGVCS CL E+L +L T++   S++T+                SS  
Sbjct  7    EIICKKHPDHKQQPGVCSCCLRERLYKLSTSTAVISSSTS----------------SSTC  50

Query  259  sscsspsHRRV-QDIRG-------------DKNNGLMMKSRSVAFITRR--RRVDQDDGK  390
             S     HRR+  D+ G                 G + KSRS+AF+ R   R     +G 
Sbjct  51   DSPRGGGHRRITSDVVGPFSFVSIIGSGAGAGAGGALKKSRSIAFVARSGCRSGGLLNGL  110

Query  391  GKAAGFWSKLLRR--RKNDRV  447
             K  GFWSKL+R   +K  RV
Sbjct  111  KKKEGFWSKLIRSTGKKTKRV  131



>gb|ACU24010.1| unknown [Glycine max]
Length=141

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 63/142 (44%), Gaps = 26/142 (18%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssevssc  267
            C+ HPN+ Q PGVC  CL +KL + Y  S               + +             
Sbjct  10   CKYHPNNKQLPGVCPSCLRDKLLKPYDNS---------------NPTYPLPCPPPPPPPY  54

Query  268  sspsHRRVQDIRGDKNNGL------MMKSRSVAFITRRRRVDQD-DGKGKAA---GFWSK  417
                HRR   +  D  + +      + KS S+AF +R + +D++ +G  + +   G WSK
Sbjct  55   LFRGHRRHSSLVMDSASSMVSFNYGLEKSNSIAFASRSQAIDREVNGSNRGSKKRGIWSK  114

Query  418  LLRRRKNDRVNERLMHSKTTRE  483
            LL+  K +   E  MHS+T RE
Sbjct  115  LLKLTKKN-TKETFMHSRTMRE  135



>ref|XP_003519180.1| PREDICTED: uncharacterized protein LOC100800567 [Glycine max]
 gb|KHN26099.1| hypothetical protein glysoja_019423 [Glycine soja]
Length=194

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 4/54 (7%)
 Frame = +1

Query  10   REFAPPNKQTQMEITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTA  171
            R F+   K T   I R +        C+KHP H QSPGVCS+CL EKLSQL ++
Sbjct  6    RHFSKKKKDTYCVIGRVKHNG----YCKKHPKHHQSPGVCSLCLREKLSQLSSS  55



>gb|KGN60231.1| hypothetical protein Csa_3G889870 [Cucumis sativus]
Length=177

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  88   CRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSN  189
            C++HPNH QSPGVCS+CL EKLS++   + S  N
Sbjct  24   CQRHPNHHQSPGVCSLCLTEKLSRIIAPAASSRN  57



>ref|XP_006416196.1| hypothetical protein EUTSA_v10009293mg [Eutrema salsugineum]
 gb|ESQ34549.1| hypothetical protein EUTSA_v10009293mg [Eutrema salsugineum]
Length=151

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 6/42 (14%)
 Frame = +1

Query  85   ICRKHPNHGQSPGVCSVCLMEKLSQL------YTASVSGSNT  192
            IC+KHP H QSPG+CS+CL E LS+L      YT S+S S +
Sbjct  42   ICKKHPKHRQSPGICSLCLNESLSKLSLDFHDYTPSMSSSTS  83



>emb|CDY28412.1| BnaA05g18280D [Brassica napus]
Length=157

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  49   ITRPRPRPPKELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGS  186
            +++ + +    ++C+KHP H QSPGVCS+CL E+LS    A+ S +
Sbjct  14   MSKAQEKTKNTVLCKKHPKHRQSPGVCSLCLNERLSMFIKATSSST  59



>ref|XP_004240024.1| PREDICTED: uncharacterized protein LOC101257471 [Solanum lycopersicum]
Length=131

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (56%), Gaps = 11/126 (9%)
 Frame = +1

Query  79   ELICRKHPNHGQSPGVCSVCLMEKLSQLYTASVSGSNTTTGVAsscsssslsplssssev  258
            E+IC KH NH Q+PGVCS CL E+L  L T S + +  ++       + S S  SSS + 
Sbjct  8    EIICEKHFNHKQNPGVCSCCLRERLINLSTNSTTSTIPSS-----SCTYSSSFSSSSCDH  62

Query  259  sscsspsHRRVQ-DIRGDKNNGLMM---KSRSVAFITRRRRVDQDDGKGKAAGFWSKLLR  426
            S C    HRR+  D+ G  +   ++   KSRS+AF+  R +  ++  K +  GFWSKL++
Sbjct  63   SPCGDGGHRRINSDVVGPFSFVSIISLKKSRSIAFVATREKKKKNKKKNE--GFWSKLIK  120

Query  427  RRKNDR  444
               N R
Sbjct  121  STGNKR  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1565612170625