BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c92727_g1_i1 len=1019 path=[997:0-1018]

Length=1019
                                                                      Score     E

emb|CAA11862.1|  shaggy kinase 7                                        324   8e-104   Petunia x hybrida [garden petunia]
emb|CDP08875.1|  unnamed protein product                                323   3e-103   
emb|CAA05328.1|  shaggy-like kinase 111                                 322   1e-102   Nicotiana tabacum [American tobacco]
ref|XP_009773710.1|  PREDICTED: shaggy-related protein kinase eps...    320   5e-102   
emb|CAA05329.1|  shaggy-like kinase 59                                  320   5e-102   Nicotiana tabacum [American tobacco]
dbj|BAO02525.1|  predicted Shaggy-like kinase ortholog                  317   1e-101   
ref|XP_009610982.1|  PREDICTED: shaggy-related protein kinase eps...    318   2e-101   
ref|XP_004240041.1|  PREDICTED: shaggy-related protein kinase eps...    318   2e-101   
ref|XP_006345509.1|  PREDICTED: shaggy-related protein kinase the...    317   1e-100   
ref|XP_009602858.1|  PREDICTED: shaggy-related protein kinase eps...    316   3e-100   
ref|XP_010278583.1|  PREDICTED: shaggy-related protein kinase eps...    315   4e-100   
emb|CAA11860.1|  shaggy-like kinase 91                                  315   5e-100   Nicotiana tabacum [American tobacco]
ref|XP_009790920.1|  PREDICTED: shaggy-related protein kinase eps...    314   8e-100   
ref|XP_006339456.1|  PREDICTED: shaggy-related protein kinase the...    314   1e-99    
ref|XP_002272112.1|  PREDICTED: shaggy-related protein kinase theta     313   2e-99    Vitis vinifera
ref|XP_004229833.1|  PREDICTED: shaggy-related protein kinase eps...    313   2e-99    
ref|XP_006375323.1|  hypothetical protein POPTR_0014s07120g             310   5e-99    
ref|XP_011091732.1|  PREDICTED: shaggy-related protein kinase alp...    311   1e-98    
gb|KDO86034.1|  hypothetical protein CISIN_1g011138mg                   304   2e-98    
gb|KDO86033.1|  hypothetical protein CISIN_1g011138mg                   306   2e-98    
ref|XP_002320754.2|  hypothetical protein POPTR_0014s07120g             309   9e-98    Populus trichocarpa [western balsam poplar]
ref|XP_011093165.1|  PREDICTED: shaggy-related protein kinase alpha     309   9e-98    
emb|CAA11861.1|  shaggy kinase 6                                        309   9e-98    Petunia x hybrida [garden petunia]
gb|AAT81407.1|  shaggy-related protein kinase 6                         308   2e-97    Solanum peruvianum [Peruvian tomato]
ref|XP_011035087.1|  PREDICTED: shaggy-related protein kinase theta     308   2e-97    
gb|EYU32069.1|  hypothetical protein MIMGU_mgv1a006024mg                307   3e-97    
emb|CAA58595.1|  Petunia Shaggy kinase 6                                304   1e-96    Petunia x hybrida [garden petunia]
ref|XP_010255498.1|  PREDICTED: shaggy-related protein kinase eps...    305   2e-96    
ref|XP_007134960.1|  hypothetical protein PHAVU_010G090200g             305   2e-96    
ref|XP_007051909.1|  Shaggy-like protein kinase 32 isoform 2            304   3e-96    
ref|XP_006445137.1|  hypothetical protein CICLE_v10020026mg             305   4e-96    
ref|XP_007051910.1|  Shaggy-like protein kinase 32 isoform 3            304   5e-96    
gb|KDO86031.1|  hypothetical protein CISIN_1g011138mg                   305   9e-96    
ref|XP_007051908.1|  Shaggy-like protein kinase 32 isoform 1            305   2e-95    
ref|XP_010255499.1|  PREDICTED: shaggy-related protein kinase eps...    302   3e-95    
ref|XP_006375322.1|  shaggy-related protein kinase theta                301   5e-95    
ref|XP_011023409.1|  PREDICTED: shaggy-related protein kinase the...    300   6e-95    
sp|O04160.2|KSGT_BRANA  RecName: Full=Shaggy-related protein kina...    301   9e-95    Brassica napus [oilseed rape]
ref|XP_003528879.1|  PREDICTED: shaggy-related protein kinase the...    300   2e-94    
ref|XP_011023410.1|  PREDICTED: shaggy-related protein kinase the...    300   3e-94    
ref|XP_008460173.1|  PREDICTED: shaggy-related protein kinase theta     300   4e-94    
emb|CDX91895.1|  BnaC03g31970D                                          299   7e-94    
ref|XP_009340624.1|  PREDICTED: shaggy-related protein kinase the...    299   8e-94    
ref|XP_002511803.1|  Glycogen synthase kinase-3 beta, putative          299   8e-94    Ricinus communis
ref|XP_011023408.1|  PREDICTED: shaggy-related protein kinase NtK...    298   1e-93    
ref|XP_006840718.1|  hypothetical protein AMTR_s00096p00102520          295   1e-93    
ref|XP_002301334.1|  hypothetical protein POPTR_0002s15640g             296   2e-93    Populus trichocarpa [western balsam poplar]
ref|XP_010419626.1|  PREDICTED: shaggy-related protein kinase the...    292   2e-93    
ref|XP_008232743.1|  PREDICTED: shaggy-related protein kinase the...    298   2e-93    
ref|XP_004144981.1|  PREDICTED: shaggy-related protein kinase the...    298   3e-93    
emb|CDX74346.1|  BnaA03g27010D                                          297   4e-93    
ref|XP_010540275.1|  PREDICTED: shaggy-related protein kinase the...    296   6e-93    
dbj|BAD95891.1|  Ser/Thr protein kinase                                 296   6e-93    Lotus japonicus
ref|XP_008344049.1|  PREDICTED: shaggy-related protein kinase eps...    296   6e-93    
ref|XP_008383272.1|  PREDICTED: shaggy-related protein kinase theta     296   7e-93    
ref|XP_004148581.1|  PREDICTED: glycogen synthase kinase-3 homolo...    294   9e-93    
ref|XP_009134534.1|  PREDICTED: shaggy-related protein kinase theta     296   1e-92    
ref|XP_004168158.1|  PREDICTED: shaggy-related protein kinase the...    296   1e-92    
gb|KCW78018.1|  hypothetical protein EUGRSUZ_D02249                     293   2e-92    
ref|XP_010919259.1|  PREDICTED: shaggy-related protein kinase eps...    295   2e-92    
ref|XP_006289072.1|  hypothetical protein CARUB_v10002475mg             295   2e-92    
ref|XP_010038314.1|  PREDICTED: shaggy-related protein kinase alp...    293   2e-92    
ref|XP_010255500.1|  PREDICTED: shaggy-related protein kinase the...    292   2e-92    
ref|XP_006396267.1|  hypothetical protein EUTSA_v10028631mg             295   2e-92    
gb|KDO66112.1|  hypothetical protein CISIN_1g0141741mg                  287   2e-92    
ref|NP_191981.1|  Shaggy-related protein kinase theta                   295   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007139956.1|  hypothetical protein PHAVU_008G072800g             295   2e-92    
gb|KDO66115.1|  hypothetical protein CISIN_1g0141741mg                  287   2e-92    
gb|KHG20282.1|  Shaggy-related protein kinase theta                     292   4e-92    
ref|XP_002872933.1|  hypothetical protein ARALYDRAFT_490498             295   4e-92    
ref|XP_007218957.1|  hypothetical protein PRUPE_ppa003552mg             297   5e-92    
ref|XP_010671733.1|  PREDICTED: shaggy-related protein kinase eps...    294   5e-92    
ref|XP_009111468.1|  PREDICTED: shaggy-related protein kinase theta     294   6e-92    
ref|XP_010660897.1|  PREDICTED: shaggy-related protein kinase eps...    291   6e-92    
ref|XP_010053665.1|  PREDICTED: shaggy-related protein kinase eps...    294   7e-92    
ref|XP_008385705.1|  PREDICTED: shaggy-related protein kinase the...    294   7e-92    
ref|XP_010919260.1|  PREDICTED: shaggy-related protein kinase NtK...    291   8e-92    
ref|XP_009334099.1|  PREDICTED: shaggy-related protein kinase eps...    292   8e-92    
gb|KDP28680.1|  hypothetical protein JCGZ_14451                         294   9e-92    
ref|XP_010660896.1|  PREDICTED: shaggy-related protein kinase eps...    292   9e-92    
gb|KFK30649.1|  hypothetical protein AALP_AA6G009500                    293   2e-91    
ref|XP_001763270.1|  predicted protein                                  291   2e-91    
ref|XP_009111716.1|  PREDICTED: shaggy-related protein kinase alp...    291   2e-91    
gb|KDO86865.1|  hypothetical protein CISIN_1g015632mg                   287   2e-91    
gb|AAQ23111.1|  shaggy-related protein kinase 1                         291   2e-91    Physcomitrella patens
ref|XP_003623822.1|  Shaggy-related protein kinase                      293   2e-91    
ref|XP_010492276.1|  PREDICTED: shaggy-related protein kinase eps...    291   2e-91    
ref|XP_010550142.1|  PREDICTED: shaggy-related protein kinase eps...    291   2e-91    
ref|XP_006399977.1|  hypothetical protein EUTSA_v10013689mg             291   2e-91    
ref|XP_010420109.1|  PREDICTED: shaggy-related protein kinase eps...    290   2e-91    
ref|XP_008381452.1|  PREDICTED: glycogen synthase kinase-3 homolo...    290   3e-91    
gb|ABK24355.1|  unknown                                                 289   3e-91    Picea sitchensis
ref|XP_010453592.1|  PREDICTED: shaggy-related protein kinase eps...    290   3e-91    
ref|XP_003521276.1|  PREDICTED: shaggy-related protein kinase theta     292   3e-91    
emb|CAB87631.1|  protein kinase MSK-3-like                              290   3e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KHN27286.1|  Shaggy-related protein kinase theta                     292   3e-91    
ref|XP_010251221.1|  PREDICTED: shaggy-related protein kinase eps...    288   3e-91    
ref|NP_196968.2|  Shaggy-related protein kinase 13                      290   4e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873682.1|  kinase family protein                              290   4e-91    
ref|XP_010671741.1|  PREDICTED: shaggy-related protein kinase the...    289   5e-91    
gb|AEQ94156.1|  shaggy-related protein kinase                           283   6e-91    
ref|XP_008357735.1|  PREDICTED: shaggy-related protein kinase eps...    290   6e-91    
gb|AEQ94143.1|  putative Glycogen synthase kinase 3                     283   6e-91    
emb|CDX78587.1|  BnaA03g04990D                                          289   8e-91    
emb|CDX87033.1|  BnaC09g03480D                                          289   8e-91    
ref|XP_010523040.1|  PREDICTED: shaggy-related protein kinase theta     291   8e-91    
emb|CDY19757.1|  BnaA09g04100D                                          289   8e-91    
gb|AES82237.2|  glycogen synthase kinase                                288   9e-91    
ref|XP_010674528.1|  PREDICTED: shaggy-related protein kinase alpha     289   9e-91    
ref|XP_001781586.1|  predicted protein                                  290   9e-91    
ref|XP_002987888.1|  GSK3/shaggy-like protein kinase                    290   1e-90    
ref|XP_007215466.1|  hypothetical protein PRUPE_ppa006497mg             289   1e-90    
ref|XP_002302794.1|  Glycogen synthase kinase-3 MsK-3 family protein    289   1e-90    Populus trichocarpa [western balsam poplar]
ref|XP_010251218.1|  PREDICTED: shaggy-related protein kinase eps...    288   1e-90    
ref|XP_010456251.1|  PREDICTED: shaggy-related protein kinase theta     291   1e-90    
ref|XP_010427333.1|  PREDICTED: shaggy-related protein kinase the...    291   1e-90    
ref|XP_009363099.1|  PREDICTED: glycogen synthase kinase-3 homolo...    288   1e-90    
ref|XP_004494455.1|  PREDICTED: glycogen synthase kinase-3 homolo...    288   1e-90    
ref|XP_001781582.1|  predicted protein                                  289   1e-90    
ref|NP_001042602.1|  Os01g0252100                                       288   1e-90    Oryza sativa Japonica Group [Japonica rice]
gb|AAQ23107.1|  shaggy-related protein kinase 2                         289   1e-90    Physcomitrella patens
ref|XP_010091400.1|  Glycogen synthase kinase-3-MsK-3-like protein      288   2e-90    
gb|AAQ23108.1|  shaggy-related protein kinase 3                         289   2e-90    Physcomitrella patens
ref|XP_001763265.1|  predicted protein                                  289   2e-90    
ref|XP_010251217.1|  PREDICTED: shaggy-related protein kinase eps...    288   2e-90    
emb|CDY07202.1|  BnaCnng02170D                                          290   2e-90    
ref|XP_006287860.1|  hypothetical protein CARUB_v10001087mg             288   2e-90    
ref|XP_009131419.1|  PREDICTED: shaggy-related protein kinase eps...    288   2e-90    
emb|CDX70574.1|  BnaC03g06580D                                          288   2e-90    
ref|XP_006289925.1|  hypothetical protein CARUB_v10003541mg             288   2e-90    
ref|XP_004510856.1|  PREDICTED: shaggy-related protein kinase the...    290   2e-90    
ref|XP_006444574.1|  hypothetical protein CICLE_v10020852mg             286   3e-90    
ref|XP_008227813.1|  PREDICTED: glycogen synthase kinase-3 homolo...    288   3e-90    
gb|ACJ85178.1|  unknown                                                 287   3e-90    Medicago truncatula
ref|XP_008799541.1|  PREDICTED: shaggy-related protein kinase alp...    290   3e-90    
ref|XP_008799540.1|  PREDICTED: shaggy-related protein kinase alp...    290   3e-90    
gb|KDO86864.1|  hypothetical protein CISIN_1g015632mg                   286   3e-90    
ref|XP_004306833.1|  PREDICTED: shaggy-related protein kinase the...    290   3e-90    
ref|XP_009131508.1|  PREDICTED: shaggy-related protein kinase eps...    285   3e-90    
emb|CDY51144.1|  BnaA09g51790D                                          290   3e-90    
ref|XP_004492676.1|  PREDICTED: shaggy-related protein kinase the...    290   3e-90    
gb|ABY60447.1|  serine/threonine protein kinase                         288   4e-90    Adonis aestivalis var. palaestina
ref|XP_003518657.1|  PREDICTED: glycogen synthase kinase-3 homolo...    287   4e-90    
ref|XP_010524830.1|  PREDICTED: shaggy-related protein kinase alp...    287   4e-90    
ref|XP_008230580.1|  PREDICTED: shaggy-related protein kinase eps...    287   4e-90    
ref|XP_006643997.1|  PREDICTED: shaggy-related protein kinase alp...    287   4e-90    
ref|XP_006470301.1|  PREDICTED: shaggy-related protein kinase eps...    288   4e-90    
ref|XP_009383704.1|  PREDICTED: shaggy-related protein kinase alpha     287   4e-90    
gb|AFK38277.1|  unknown                                                 287   4e-90    
ref|XP_003626019.1|  Protein kinase, putative                           287   5e-90    
ref|XP_010276519.1|  PREDICTED: shaggy-related protein kinase alpha     287   5e-90    
ref|XP_002991115.1|  hypothetical protein SELMODRAFT_451471             289   5e-90    
ref|XP_006394905.1|  hypothetical protein EUTSA_v10004319mg             287   5e-90    
ref|XP_006446534.1|  hypothetical protein CICLE_v10015323mg             288   5e-90    
emb|CAA48472.1|  protein kinase                                         287   5e-90    Medicago sativa [alfalfa]
ref|XP_004495878.1|  PREDICTED: glycogen synthase kinase-3 homolo...    287   5e-90    
gb|EYU46859.1|  hypothetical protein MIMGU_mgv1a007395mg                287   7e-90    
sp|P51139.2|MSK3_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    287   7e-90    Medicago sativa [alfalfa]
ref|XP_007221484.1|  hypothetical protein PRUPE_ppa006462mg             287   7e-90    
ref|XP_007051226.1|  Shaggy-related kinase 11, 11 isoform 1             286   8e-90    
ref|XP_003534597.1|  PREDICTED: shaggy-related protein kinase theta     288   8e-90    
ref|XP_011003165.1|  PREDICTED: shaggy-related protein kinase alp...    286   9e-90    
gb|KHG00969.1|  Glycogen synthase kinase-3 MsK-3                        286   9e-90    
ref|XP_011040636.1|  PREDICTED: shaggy-related protein kinase alp...    286   1e-89    
gb|KHN29413.1|  Shaggy-related protein kinase theta                     288   1e-89    
ref|XP_007031504.1|  Shaggy-like kinase 13 isoform 1                    286   1e-89    
ref|XP_010248490.1|  PREDICTED: shaggy-related protein kinase eps...    286   1e-89    
ref|XP_007031506.1|  Shaggy-like kinase 13 isoform 3                    286   1e-89    
ref|XP_004304635.1|  PREDICTED: shaggy-related protein kinase eps...    286   1e-89    
ref|XP_003566380.1|  PREDICTED: shaggy-related protein kinase alpha     286   1e-89    
ref|XP_003626020.1|  Protein kinase, putative                           287   2e-89    
ref|XP_008343189.1|  PREDICTED: glycogen synthase kinase-3 homolo...    285   2e-89    
ref|XP_006588497.1|  PREDICTED: uncharacterized protein LOC100817...    286   2e-89    
ref|XP_003552357.1|  PREDICTED: shaggy-related protein kinase the...    287   2e-89    
ref|XP_006841582.1|  hypothetical protein AMTR_s00003p00196730          286   2e-89    
ref|XP_006444573.1|  hypothetical protein CICLE_v10020852mg             285   2e-89    
ref|XP_010933863.1|  PREDICTED: shaggy-related protein kinase eps...    287   3e-89    
ref|XP_002279596.1|  PREDICTED: shaggy-related protein kinase alp...    285   3e-89    Vitis vinifera
gb|KDO45354.1|  hypothetical protein CISIN_1g015298mg                   283   3e-89    
tpg|DAA53953.1|  TPA: putative glycogen synthase kinase family pr...    282   3e-89    
ref|XP_008812956.1|  PREDICTED: shaggy-related protein kinase alp...    285   3e-89    
ref|XP_009384446.1|  PREDICTED: shaggy-related protein kinase alp...    285   4e-89    
ref|XP_002882438.1|  hypothetical protein ARALYDRAFT_477878             285   5e-89    
ref|XP_006382290.1|  hypothetical protein POPTR_0005s00710g             285   5e-89    
gb|KHN00323.1|  Glycogen synthase kinase-3 like MsK-2                   283   5e-89    
ref|XP_008353866.1|  PREDICTED: glycogen synthase kinase-3 homolo...    285   5e-89    
dbj|BAF36565.1|  Shaggy-like kinase                                     285   5e-89    Triticum aestivum [Canadian hard winter wheat]
emb|CDM82575.1|  unnamed protein product                                285   5e-89    
ref|XP_011039006.1|  PREDICTED: shaggy-related protein kinase alpha     285   5e-89    
gb|KDO45355.1|  hypothetical protein CISIN_1g015298mg                   283   6e-89    
gb|KCW84977.1|  hypothetical protein EUGRSUZ_B01797                     280   6e-89    
ref|XP_006588498.1|  PREDICTED: uncharacterized protein LOC100817...    283   6e-89    
gb|KEH18946.1|  shaggy-like kinase                                      286   6e-89    
ref|XP_010270906.1|  PREDICTED: shaggy-related protein kinase alp...    284   6e-89    
gb|KHN00229.1|  Glycogen synthase kinase-3 like MsK-3                   290   6e-89    
gb|AFN42826.1|  GSK3-like protein                                       284   7e-89    
ref|XP_008781189.1|  PREDICTED: shaggy-related protein kinase alp...    284   7e-89    
ref|XP_002515218.1|  Glycogen synthase kinase-3 beta, putative          284   7e-89    Ricinus communis
ref|XP_008793304.1|  PREDICTED: shaggy-related protein kinase alp...    284   7e-89    
gb|KHG02936.1|  Shaggy-related protein kinase alpha                     284   7e-89    
ref|XP_004495628.1|  PREDICTED: glycogen synthase kinase-3 homolo...    284   9e-89    
emb|CBI37005.3|  unnamed protein product                                283   1e-88    
ref|XP_010940878.1|  PREDICTED: shaggy-related protein kinase eps...    286   1e-88    
ref|XP_010455024.1|  PREDICTED: shaggy-related protein kinase alp...    284   1e-88    
ref|XP_010251219.1|  PREDICTED: shaggy-related protein kinase eps...    283   1e-88    
ref|XP_003591238.1|  Glycogen synthase kinase                           284   1e-88    
gb|EMT32435.1|  Glycogen synthase kinase-3-MsK-3-like protein           285   1e-88    
gb|AAT85177.1|  putative glycogen synthase kinase                       282   1e-88    Oryza sativa Japonica Group [Japonica rice]
sp|P51137.1|MSK1_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    283   1e-88    Medicago sativa [alfalfa]
ref|XP_010493927.1|  PREDICTED: shaggy-related protein kinase alp...    283   1e-88    
ref|XP_008778092.1|  PREDICTED: shaggy-related protein kinase alp...    283   2e-88    
gb|AAM62970.1|  shaggy related protein kinase ASK-GAMMA                 283   2e-88    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA53950.1|  TPA: putative glycogen synthase kinase family pr...    282   2e-88    
ref|XP_010270905.1|  PREDICTED: shaggy-related protein kinase alp...    284   2e-88    
ref|XP_008795404.1|  PREDICTED: shaggy-related protein kinase the...    282   2e-88    
ref|NP_001148880.1|  glycogen synthase kinase-3 MsK-3                   283   2e-88    Zea mays [maize]
ref|XP_011079505.1|  PREDICTED: shaggy-related protein kinase alp...    283   2e-88    
gb|KDO45353.1|  hypothetical protein CISIN_1g015298mg                   283   2e-88    
ref|XP_007205270.1|  hypothetical protein PRUPE_ppa006473mg             283   2e-88    
gb|ACJ85100.1|  unknown                                                 278   2e-88    Medicago truncatula
ref|XP_008246288.1|  PREDICTED: shaggy-related protein kinase alpha     283   2e-88    
ref|XP_006480288.1|  PREDICTED: shaggy-related protein kinase alp...    283   2e-88    
ref|XP_007031229.1|  Shaggy-related kinase 11, 11 isoform 1             283   2e-88    
ref|XP_001762052.1|  predicted protein                                  283   2e-88    
ref|XP_002512564.1|  Glycogen synthase kinase-3 beta, putative          282   3e-88    Ricinus communis
ref|XP_006299606.1|  hypothetical protein CARUB_v10015785mg             283   3e-88    
gb|AAQ23109.1|  shaggy-related protein kinase 4                         283   3e-88    Physcomitrella patens
ref|XP_004967857.1|  PREDICTED: shaggy-related protein kinase alp...    283   3e-88    
ref|XP_002455378.1|  hypothetical protein SORBIDRAFT_03g009580          283   3e-88    Sorghum bicolor [broomcorn]
ref|XP_010486058.1|  PREDICTED: shaggy-related protein kinase gam...    283   3e-88    
ref|XP_004960405.1|  PREDICTED: shaggy-related protein kinase alp...    283   3e-88    
emb|CDP17018.1|  unnamed protein product                                282   3e-88    
ref|XP_002874323.1|  hypothetical protein ARALYDRAFT_489503             282   3e-88    
gb|AFW79696.1|  putative glycogen synthase kinase family protein        282   3e-88    
ref|XP_001765207.1|  predicted protein                                  283   4e-88    
ref|XP_011023844.1|  PREDICTED: shaggy-related protein kinase alpha     282   4e-88    
ref|NP_001242506.1|  uncharacterized protein LOC100817819               281   4e-88    
ref|XP_009384996.1|  PREDICTED: shaggy-related protein kinase alp...    282   4e-88    
ref|XP_002280673.1|  PREDICTED: shaggy-related protein kinase alpha     282   4e-88    Vitis vinifera
sp|P51138.1|MSK2_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    282   4e-88    Medicago sativa [alfalfa]
ref|XP_003555781.1|  PREDICTED: glycogen synthase kinase-3 homolo...    283   4e-88    
ref|XP_010941497.1|  PREDICTED: shaggy-related protein kinase alpha     282   5e-88    
ref|XP_010432712.1|  PREDICTED: shaggy-related protein kinase gam...    282   5e-88    
ref|XP_003574217.1|  PREDICTED: shaggy-related protein kinase alp...    284   5e-88    
gb|EAY96448.1|  hypothetical protein OsI_18343                          282   5e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_008803034.1|  PREDICTED: shaggy-related protein kinase eps...    284   5e-88    
ref|XP_009629200.1|  PREDICTED: shaggy-related protein kinase NtK...    282   5e-88    
ref|XP_006428242.1|  hypothetical protein CICLE_v10013624mg             283   5e-88    
gb|AEN14336.1|  hypothetical protein rf1-C1-g7                          282   5e-88    
ref|XP_006408021.1|  hypothetical protein EUTSA_v10020835mg             282   5e-88    
emb|CAA53181.1|  shaggy related kinase                                  282   5e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421531.1|  PREDICTED: shaggy-related protein kinase alp...    282   5e-88    
ref|XP_006408022.1|  hypothetical protein EUTSA_v10020835mg             282   5e-88    
ref|NP_568486.1|  Shaggy-related protein kinase alpha                   281   6e-88    Arabidopsis thaliana [mouse-ear cress]
gb|ABK24513.1|  unknown                                                 282   6e-88    Picea sitchensis
gb|EYU34726.1|  hypothetical protein MIMGU_mgv1a007335mg                281   6e-88    
ref|XP_004230343.1|  PREDICTED: shaggy-related protein kinase NtK-1     282   6e-88    
ref|XP_010910596.1|  PREDICTED: shaggy-related protein kinase alp...    281   7e-88    
ref|NP_001274855.1|  Shaggy-like protein kinase NtK-1                   281   8e-88    
emb|CAA04265.1|  shaggy-like kinase alpha                               281   8e-88    Arabidopsis thaliana [mouse-ear cress]
gb|KDP23349.1|  hypothetical protein JCGZ_23182                         281   8e-88    
ref|XP_007140965.1|  hypothetical protein PHAVU_008G156000g             281   8e-88    
ref|NP_187235.1|  Shaggy-related protein kinase gamma                   281   8e-88    Arabidopsis thaliana [mouse-ear cress]
gb|EMS49677.1|  Glycogen synthase kinase-3-like protein MsK-3           283   8e-88    
gb|ABK93098.1|  unknown                                                 281   8e-88    Populus trichocarpa [western balsam poplar]
ref|XP_010921357.1|  PREDICTED: shaggy-related protein kinase alpha     281   9e-88    
ref|XP_009412822.1|  PREDICTED: shaggy-related protein kinase alp...    283   9e-88    
ref|NP_001150105.1|  LOC100283734                                       281   9e-88    Zea mays [maize]
ref|NP_001054564.1|  Os05g0134000                                       281   9e-88    Oryza sativa Japonica Group [Japonica rice]
gb|KDO86866.1|  hypothetical protein CISIN_1g015632mg                   280   1e-87    
gb|KEH23337.1|  shaggy-like kinase                                      280   1e-87    
ref|XP_002319468.1|  Glycogen synthase kinase-3 MsK-1 family protein    281   1e-87    Populus trichocarpa [western balsam poplar]
tpg|DAA53951.1|  TPA: putative glycogen synthase kinase family pr...    281   1e-87    
gb|AAY98510.1|  glycogen synthase kinase                                281   1e-87    Oryza sativa Japonica Group [Japonica rice]
gb|EPS67477.1|  shaggy kinase 7                                         281   1e-87    
ref|XP_009382471.1|  PREDICTED: shaggy-related protein kinase alp...    281   1e-87    
gb|ABB55385.1|  Ser/Thr protein kinase-like                             281   1e-87    Solanum tuberosum [potatoes]
ref|XP_006858581.1|  hypothetical protein AMTR_s00071p00186380          283   1e-87    
emb|CDX78658.1|  BnaA03g05700D                                          286   1e-87    
emb|CAC08564.1|  wound-induced GSK-3-like protein                       283   1e-87    
ref|XP_004288335.1|  PREDICTED: glycogen synthase kinase-3 homolo...    281   1e-87    
ref|XP_009382470.1|  PREDICTED: shaggy-related protein kinase alp...    281   1e-87    
ref|XP_010652295.1|  PREDICTED: shaggy-related protein kinase alp...    280   1e-87    
emb|CDP15204.1|  unnamed protein product                                281   1e-87    
ref|XP_010097328.1|  Shaggy-related protein kinase alpha                284   2e-87    
ref|XP_008803035.1|  PREDICTED: shaggy-related protein kinase eps...    282   2e-87    
emb|CBI39647.3|  unnamed protein product                                280   2e-87    
gb|KDP28311.1|  hypothetical protein JCGZ_14082                         280   2e-87    
ref|XP_006588432.1|  PREDICTED: glycogen synthase kinase-3 isofor...    280   2e-87    
gb|EPS63877.1|  hypothetical protein M569_10905                         280   2e-87    
ref|NP_001242406.1|  uncharacterized protein LOC100788612               280   2e-87    
gb|KHN16033.1|  Glycogen synthase kinase-3 like MsK-1                   280   2e-87    
ref|XP_003554602.1|  PREDICTED: shaggy-related protein kinase alp...    280   2e-87    
gb|AFW57486.1|  putative glycogen synthase kinase family protein        278   2e-87    
ref|XP_007145031.1|  hypothetical protein PHAVU_007G204000g             280   2e-87    
emb|CDX80585.1|  BnaC07g28590D                                          280   2e-87    
ref|XP_006576226.1|  PREDICTED: uncharacterized protein LOC100788...    280   2e-87    
ref|XP_009151155.1|  PREDICTED: shaggy-related protein kinase alpha     280   2e-87    
dbj|BAJ93751.1|  predicted protein                                      282   2e-87    
ref|XP_010938176.1|  PREDICTED: shaggy-related protein kinase alp...    280   3e-87    
ref|XP_009393923.1|  PREDICTED: shaggy-related protein kinase eps...    282   3e-87    
ref|XP_009393922.1|  PREDICTED: shaggy-related protein kinase eps...    282   3e-87    
ref|XP_002465046.1|  hypothetical protein SORBIDRAFT_01g031220          282   3e-87    
ref|XP_010070089.1|  PREDICTED: shaggy-related protein kinase alp...    280   4e-87    
ref|XP_010070081.1|  PREDICTED: shaggy-related protein kinase alp...    280   4e-87    
ref|XP_008443540.1|  PREDICTED: shaggy-related protein kinase eps...    280   4e-87    
gb|EYU34725.1|  hypothetical protein MIMGU_mgv1a007335mg                280   4e-87    
gb|ACQ91102.1|  glycogen synthase kinase                                280   4e-87    
ref|XP_010546768.1|  PREDICTED: shaggy-related protein kinase alpha     279   4e-87    
tpg|DAA53952.1|  TPA: putative glycogen synthase kinase family pr...    281   5e-87    
ref|XP_007031230.1|  Shaggy-related kinase 11, 11 isoform 2             279   5e-87    
ref|XP_006382289.1|  hypothetical protein POPTR_0005s00710g             279   6e-87    
gb|ABR68632.1|  RIM11-like protein                                      279   7e-87    
ref|XP_002440537.1|  hypothetical protein SORBIDRAFT_09g002710          279   7e-87    
emb|CDY05202.1|  BnaC05g46010D                                          279   8e-87    
ref|XP_010042192.1|  PREDICTED: shaggy-related protein kinase alpha     279   8e-87    
ref|XP_006654010.1|  PREDICTED: shaggy-related protein kinase alp...    279   9e-87    
ref|XP_009775930.1|  PREDICTED: shaggy-related protein kinase NtK...    279   9e-87    
ref|XP_009147201.1|  PREDICTED: shaggy-related protein kinase gamma     279   1e-86    
dbj|BAJ34573.1|  unnamed protein product                                278   1e-86    
ref|XP_003591341.1|  Glycogen synthase kinase-3-like protein            278   1e-86    
ref|XP_008660602.1|  PREDICTED: shaggy-related protein kinase alp...    280   1e-86    
gb|KHG02099.1|  Shaggy-related protein kinase theta                     280   1e-86    
ref|XP_004141099.1|  PREDICTED: shaggy-related protein kinase eps...    278   1e-86    
ref|XP_011097427.1|  PREDICTED: shaggy-related protein kinase eps...    278   1e-86    
gb|EPS68300.1|  hypothetical protein M569_06467                         278   1e-86    
ref|XP_010464137.1|  PREDICTED: shaggy-related protein kinase gamma     278   1e-86    
gb|KGN59685.1|  hypothetical protein Csa_3G838640                       278   1e-86    
emb|CDP02094.1|  unnamed protein product                                278   1e-86    
ref|XP_009403747.1|  PREDICTED: shaggy-related protein kinase alp...    278   1e-86    
gb|ABG29424.1|  GSK-like kinase 1D                                      278   1e-86    
ref|XP_008366455.1|  PREDICTED: shaggy-related protein kinase kap...    273   1e-86    
gb|AES61591.2|  glycogen synthase kinase                                278   1e-86    
ref|XP_003591340.1|  Glycogen synthase kinase-3-like protein            278   1e-86    
ref|XP_008672929.1|  PREDICTED: LOC100283734 isoform X1                 279   2e-86    
ref|NP_001269276.1|  glycogen synthase kinase-3 homolog MsK-1-like      278   2e-86    
gb|ADE76936.1|  unknown                                                 277   2e-86    
sp|Q40518.1|MSK1_TOBAC  RecName: Full=Shaggy-related protein kina...    278   2e-86    
ref|XP_008363964.1|  PREDICTED: shaggy-related protein kinase alpha     278   2e-86    
ref|XP_011047893.1|  PREDICTED: shaggy-related protein kinase kappa     271   2e-86    
ref|XP_009335521.1|  PREDICTED: shaggy-related protein kinase alpha     278   2e-86    
ref|XP_008388444.1|  PREDICTED: shaggy-related protein kinase alpha     278   2e-86    
ref|XP_008662920.1|  PREDICTED: shaggy-related protein kinase alp...    278   2e-86    
ref|NP_001065093.1|  Os10g0521700                                       280   3e-86    
ref|NP_001242661.1|  glycogen synthase kinase-3                         278   3e-86    
ref|NP_001288361.1|  uncharacterized protein LOC103641344               277   3e-86    
ref|XP_004135570.1|  PREDICTED: shaggy-related protein kinase alp...    277   3e-86    
ref|XP_004163362.1|  PREDICTED: shaggy-related protein kinase alp...    277   3e-86    
ref|XP_008450520.1|  PREDICTED: shaggy-related protein kinase NtK-1     277   3e-86    
gb|ABG74911.1|  AtSK12-like protein                                     277   3e-86    
ref|XP_006338576.1|  PREDICTED: shaggy-related protein kinase eps...    277   3e-86    
gb|EMT29598.1|  Shaggy-related protein kinase theta                     280   3e-86    
gb|EYU38392.1|  hypothetical protein MIMGU_mgv1a007572mg                277   3e-86    
ref|XP_010493929.1|  PREDICTED: shaggy-related protein kinase alp...    276   4e-86    
ref|XP_003569078.1|  PREDICTED: shaggy-related protein kinase alp...    277   4e-86    
ref|XP_006338577.1|  PREDICTED: shaggy-related protein kinase eps...    277   4e-86    
ref|XP_011092192.1|  PREDICTED: shaggy-related protein kinase alpha     277   4e-86    
ref|XP_009134851.1|  PREDICTED: shaggy-related protein kinase gamma     277   4e-86    
ref|XP_006661970.1|  PREDICTED: shaggy-related protein kinase the...    278   6e-86    
dbj|BAJ99594.1|  predicted protein                                      276   6e-86    
ref|XP_004164819.1|  PREDICTED: shaggy-related protein kinase eps...    276   6e-86    
emb|CDY49981.1|  BnaC03g34380D                                          276   6e-86    
ref|XP_009366055.1|  PREDICTED: shaggy-related protein kinase alp...    276   7e-86    
gb|KCW84976.1|  hypothetical protein EUGRSUZ_B01797                     275   8e-86    
ref|XP_004232308.1|  PREDICTED: shaggy-related protein kinase eps...    276   8e-86    
ref|XP_009401663.1|  PREDICTED: shaggy-related protein kinase gamma     276   9e-86    
gb|KHN26183.1|  Glycogen synthase kinase-3 like MsK-1                   275   1e-85    
ref|XP_003591339.1|  Glycogen synthase kinase-3-like protein            275   1e-85    
emb|CDY27737.1|  BnaA05g31460D                                          279   1e-85    
gb|ABG29426.1|  GSK-like kinase 1                                       276   1e-85    
ref|XP_010245514.1|  PREDICTED: shaggy-related protein kinase kap...    275   1e-85    
ref|XP_010245511.1|  PREDICTED: shaggy-related protein kinase kap...    276   1e-85    
emb|CAA58594.1|  Petunia Shaggy kinase 4                                276   1e-85    
ref|XP_004252662.1|  PREDICTED: shaggy-related protein kinase eps...    275   1e-85    
ref|XP_010245513.1|  PREDICTED: shaggy-related protein kinase kap...    276   2e-85    
gb|AFH00876.1|  glycogen synthase kinase-3                              275   2e-85    
ref|XP_009759533.1|  PREDICTED: shaggy-related protein kinase eps...    275   2e-85    
ref|XP_006364003.1|  PREDICTED: shaggy-related protein kinase eps...    275   2e-85    
ref|XP_009598967.1|  PREDICTED: shaggy-related protein kinase eps...    275   2e-85    
ref|XP_004252661.1|  PREDICTED: shaggy-related protein kinase eps...    275   3e-85    
ref|XP_010679446.1|  PREDICTED: shaggy-related protein kinase NtK-1     275   3e-85    
ref|XP_001784146.1|  predicted protein                                  275   3e-85    
ref|XP_009757512.1|  PREDICTED: shaggy-related protein kinase NtK-1     275   4e-85    
ref|XP_009617298.1|  PREDICTED: shaggy-related protein kinase NtK-1     275   4e-85    
ref|XP_011028359.1|  PREDICTED: shaggy-related protein kinase kappa     275   4e-85    
ref|XP_003567575.1|  PREDICTED: shaggy-related protein kinase alp...    275   4e-85    
ref|XP_009412821.1|  PREDICTED: shaggy-related protein kinase alp...    276   4e-85    
ref|XP_009386339.1|  PREDICTED: shaggy-related protein kinase alp...    274   4e-85    
gb|EPS73818.1|  hypothetical protein M569_00937                         274   7e-85    
gb|KDP42457.1|  hypothetical protein JCGZ_00254                         274   7e-85    
gb|ABC94949.1|  GSK-like kinase                                         273   9e-85    
dbj|BAD95892.1|  Ser/Thr protein kinase                                 274   1e-84    
ref|XP_008657609.1|  PREDICTED: shaggy-related protein kinase alp...    275   1e-84    
gb|ABR16348.1|  unknown                                                 274   1e-84    
ref|XP_004495625.1|  PREDICTED: glycogen synthase kinase-3 homolo...    274   1e-84    
ref|XP_006650852.1|  PREDICTED: shaggy-related protein kinase alp...    273   1e-84    
ref|XP_004147888.1|  PREDICTED: shaggy-related protein kinase kap...    274   1e-84    
ref|XP_007041206.1|  Shaggy-like protein kinase 41 isoform 3            270   2e-84    
gb|ABG29422.1|  GSK-like kinase 1A                                      272   3e-84    
gb|ABC94947.1|  GSK-like kinase                                         272   3e-84    
gb|ABC94948.1|  GSK-like kinase                                         271   4e-84    
ref|XP_010096433.1|  Shaggy-related protein kinase kappa                273   4e-84    
gb|KDO39709.1|  hypothetical protein CISIN_1g014595mg                   271   5e-84    
gb|EMT09676.1|  Shaggy-related protein kinase alpha                     272   6e-84    
ref|XP_004303195.1|  PREDICTED: shaggy-related protein kinase zet...    271   7e-84    
gb|AAM77397.1|  GSK-like kinase                                         270   8e-84    
ref|XP_006431595.1|  hypothetical protein CICLE_v10001277mg             271   9e-84    
ref|XP_004168206.1|  PREDICTED: uncharacterized protein LOC101227928    279   9e-84    
gb|ABD97992.1|  glycogen synthase kinase                                269   1e-83    
ref|XP_007222549.1|  hypothetical protein PRUPE_ppa006218mg             271   1e-83    
ref|XP_004300628.1|  PREDICTED: shaggy-related protein kinase kap...    271   1e-83    
ref|XP_010682019.1|  PREDICTED: shaggy-related protein kinase kap...    271   1e-83    
ref|XP_009365288.1|  PREDICTED: shaggy-related protein kinase eta...    271   2e-83    
ref|XP_006349315.1|  PREDICTED: shaggy-related protein kinase kap...    271   2e-83    
ref|XP_004230443.1|  PREDICTED: shaggy-related protein kinase kappa     271   2e-83    
gb|KCW57138.1|  hypothetical protein EUGRSUZ_I02776                     270   2e-83    
gb|ABG29423.1|  GSK-like kinase 1B                                      270   2e-83    
gb|EMS62368.1|  Shaggy-related protein kinase alpha                     271   2e-83    
ref|XP_004983886.1|  PREDICTED: LOW QUALITY PROTEIN: shaggy-relat...    272   2e-83    
gb|AAB61055.1|  Similar to shaggy related protein kinase. Belongs...    271   3e-83    
ref|NP_001241073.1|  uncharacterized protein LOC100799387               270   3e-83    
ref|XP_008228934.1|  PREDICTED: shaggy-related protein kinase eta...    270   3e-83    
gb|EMT00762.1|  Glycogen synthase kinase-3-MsK-3-like protein           269   4e-83    
gb|KDO39706.1|  hypothetical protein CISIN_1g014595mg                   269   4e-83    
gb|EMS50777.1|  Glycogen synthase kinase-3-like protein MsK-3           269   4e-83    
ref|XP_002876597.1|  hypothetical protein ARALYDRAFT_486587             270   4e-83    
gb|KDO63405.1|  hypothetical protein CISIN_1g014750mg                   267   4e-83    
ref|XP_007215447.1|  hypothetical protein PRUPE_ppa006349mg             270   4e-83    
ref|XP_007041204.1|  Shaggy-like protein kinase 41 isoform 1            270   5e-83    
ref|XP_010910153.1|  PREDICTED: shaggy-related protein kinase kap...    270   5e-83    
ref|XP_010030186.1|  PREDICTED: shaggy-related protein kinase kappa     269   6e-83    
ref|XP_010475837.1|  PREDICTED: shaggy-related protein kinase kap...    269   7e-83    
ref|XP_010458292.1|  PREDICTED: shaggy-related protein kinase kappa     269   7e-83    
ref|NP_974471.1|  shaggy-related protein kinase beta                    270   7e-83    
ref|XP_009775075.1|  PREDICTED: shaggy-related protein kinase kappa     269   8e-83    
gb|ABR17316.1|  unknown                                                 270   8e-83    
ref|XP_006307622.1|  hypothetical protein CARUB_v10009250mg             269   8e-83    
ref|XP_010104417.1|  Shaggy-related protein kinase zeta                 270   8e-83    
ref|XP_006417527.1|  hypothetical protein EUTSA_v10007729mg             269   8e-83    
ref|XP_009355333.1|  PREDICTED: shaggy-related protein kinase kappa     269   9e-83    
ref|XP_010245515.1|  PREDICTED: shaggy-related protein kinase kap...    268   9e-83    
ref|XP_008365741.1|  PREDICTED: shaggy-related protein kinase eta...    268   1e-82    
ref|XP_009378929.1|  PREDICTED: shaggy-related protein kinase eta...    268   1e-82    
ref|XP_006598764.1|  PREDICTED: uncharacterized protein LOC100820...    268   1e-82    
ref|NP_001240918.1|  uncharacterized protein LOC100820098               268   1e-82    
ref|NP_191675.1|  shaggy-related protein kinase beta                    268   2e-82    
ref|XP_006385048.1|  hypothetical protein POPTR_0004s23430g             268   2e-82    
ref|XP_010108792.1|  Shaggy-related protein kinase epsilon              285   2e-82    
ref|XP_009598595.1|  PREDICTED: shaggy-related protein kinase kappa     268   2e-82    
gb|KFK35315.1|  hypothetical protein AALP_AA5G268300                    268   3e-82    
gb|KDO63404.1|  hypothetical protein CISIN_1g014750mg                   266   4e-82    
ref|NP_001190762.1|  Shaggy-related protein kinase eta                  262   4e-82    
gb|KDO63402.1|  hypothetical protein CISIN_1g014750mg                   267   5e-82    
ref|XP_008802921.1|  PREDICTED: shaggy-related protein kinase kap...    267   5e-82    
ref|XP_006468992.1|  PREDICTED: shaggy-related protein kinase zet...    267   6e-82    
ref|XP_010544097.1|  PREDICTED: shaggy-related protein kinase kappa     266   9e-82    
ref|XP_008802919.1|  PREDICTED: shaggy-related protein kinase kap...    267   9e-82    
ref|XP_010523730.1|  PREDICTED: shaggy-related protein kinase bet...    267   1e-81    
ref|XP_002892530.1|  hypothetical protein ARALYDRAFT_471093             266   1e-81    
dbj|BAJ89558.1|  predicted protein                                      266   2e-81    
ref|NP_176096.1|  shaggy-related protein kinase delta                   265   2e-81    
ref|XP_006307671.1|  hypothetical protein CARUB_v10009298mg             265   2e-81    
ref|XP_011087528.1|  PREDICTED: shaggy-related protein kinase alp...    265   2e-81    
ref|XP_010682020.1|  PREDICTED: shaggy-related protein kinase kap...    265   2e-81    
gb|KDO39711.1|  hypothetical protein CISIN_1g014595mg                   264   2e-81    
ref|XP_011087526.1|  PREDICTED: shaggy-related protein kinase NtK...    265   2e-81    
ref|XP_009801781.1|  PREDICTED: shaggy-related protein kinase eta...    265   2e-81    
ref|XP_009148291.1|  PREDICTED: shaggy-related protein kinase kappa     265   2e-81    
gb|EAY96932.1|  hypothetical protein OsI_18850                          258   2e-81    
ref|XP_007148571.1|  hypothetical protein PHAVU_006G219700g             265   2e-81    
ref|XP_011092295.1|  PREDICTED: shaggy-related protein kinase del...    264   3e-81    
ref|XP_002263398.1|  PREDICTED: shaggy-related protein kinase kappa     265   3e-81    
ref|XP_009593779.1|  PREDICTED: shaggy-related protein kinase eta...    265   3e-81    
ref|XP_006446814.1|  hypothetical protein CICLE_v10015375mg             265   3e-81    
ref|XP_004485442.1|  PREDICTED: shaggy-related protein kinase kap...    265   3e-81    
ref|XP_009400715.1|  PREDICTED: shaggy-related protein kinase eta...    266   4e-81    
ref|XP_008343093.1|  PREDICTED: shaggy-related protein kinase eta...    265   4e-81    
emb|CAA55866.1|  K-1                                                    265   4e-81    
gb|KGN65982.1|  hypothetical protein Csa_1G560660                       263   4e-81    
ref|NP_172455.1|  Shaggy-related protein kinase kappa                   265   4e-81    
ref|XP_010490391.1|  PREDICTED: shaggy-related protein kinase kap...    265   4e-81    
ref|XP_010689734.1|  PREDICTED: shaggy-related protein kinase eta       264   4e-81    
dbj|BAJ33892.1|  unnamed protein product                                261   4e-81    
ref|NP_001185256.1|  shaggy-related protein kinase delta                265   5e-81    
ref|XP_006402514.1|  hypothetical protein EUTSA_v10005969mg             265   5e-81    
ref|XP_010469039.1|  PREDICTED: shaggy-related protein kinase bet...    265   5e-81    
ref|XP_004243275.1|  PREDICTED: shaggy-related protein kinase eta...    265   5e-81    
ref|XP_006348884.1|  PREDICTED: shaggy-related protein kinase zet...    265   5e-81    
ref|XP_002886726.1|  hypothetical protein ARALYDRAFT_475455             264   5e-81    
ref|XP_011092292.1|  PREDICTED: shaggy-related protein kinase kap...    264   5e-81    
ref|XP_010522087.1|  PREDICTED: shaggy-related protein kinase iota      264   5e-81    
ref|XP_010486052.1|  PREDICTED: shaggy-related protein kinase iot...    264   6e-81    
ref|XP_010475366.1|  PREDICTED: shaggy-related protein kinase iot...    264   7e-81    
ref|XP_006302308.1|  hypothetical protein CARUB_v10020358mg             264   7e-81    
ref|XP_010457765.1|  PREDICTED: shaggy-related protein kinase iota      264   7e-81    
ref|XP_007048726.1|  GSK3/SHAGGY-like protein kinase 1 isoform 2        262   9e-81    
ref|XP_006833052.1|  hypothetical protein AMTR_s00170p00028260          261   1e-80    
ref|XP_009396814.1|  PREDICTED: shaggy-related protein kinase kap...    263   1e-80    
ref|XP_003540001.1|  PREDICTED: shaggy-related protein kinase zet...    263   1e-80    
gb|KHF99018.1|  Shaggy-related protein kinase delta                     265   1e-80    



>emb|CAA11862.1| shaggy kinase 7 [Petunia x hybrida]
Length=459

 Score =   324 bits (831),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 206/266 (77%), Gaps = 28/266 (11%)
 Frame = +3

Query  300   VVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEE-------QD------  440
             ++RR KSIAS  SS SDPGGD  +++ K EQ VD  V GE   EE       QD      
Sbjct  1     MMRRIKSIASGRSSVSDPGGDLNLKRAKVEQDVDNMVDGETQSEERCSIANKQDVSSKSK  60

Query  441   -NTASTSNV------------ARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVG  581
              +TAST NV             R EKSGD+  +D+ KDMEP+VVSG GTE GQIIVTT+ 
Sbjct  61    RSTASTLNVDNELPKELNEMKIRDEKSGDH--EDDTKDMEPAVVSGNGTETGQIIVTTMS  118

Query  582   GSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMF  761
             G NGQ K+ LSYMAER VG+GSFGVVFQAKCLETGE+VAIKKVLQD+RYKNRELQ+MRM 
Sbjct  119   GRNGQKKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKNRELQMMRML  178

Query  762   DHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQI  941
             +HPNVV+ +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSR+NHHMP +YVQLY YQ+
Sbjct  179   EHPNVVKLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRVNHHMPIIYVQLYTYQL  238

Query  942   CRALSYIHNVIGVCHRDIKPQNLLVN  1019
             CRAL+Y+HNV+GVCHRDIKPQNLLVN
Sbjct  239   CRALNYMHNVVGVCHRDIKPQNLLVN  264



>emb|CDP08875.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   323 bits (828),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 177/274 (65%), Positives = 200/274 (73%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQDNTASTSN----  461
             M+V+RR KSIAS  SS SDP GD  I++ K EQ  D  V  E    E+  TAS  N    
Sbjct  1     MNVMRRLKSIASGRSSVSDPSGDSGIKRVKIEQEADWRVGLESESVEKCTTASEQNMAST  60

Query  462   -----------VARPEKSG-----------------DNNEQDNNKDMEPSVVSGKGTEPG  557
                        VARP KSG                  +  +D  KD+EP++VSG GTE G
Sbjct  61    SAEPAASTSKVVARPVKSGYDELPREMHDMKIRDDKSDTHEDTMKDLEPAIVSGNGTETG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QIIVTT GG NG+ K+ LSYMAER VG+GSFGVVFQAKCLETG +VAIKKVLQD+RYKNR
Sbjct  121   QIIVTTAGGRNGEEKQTLSYMAERVVGTGSFGVVFQAKCLETGHSVAIKKVLQDRRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIMR+ D+PNVVQ KH FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSRMNHHMPT+Y
Sbjct  181   ELQIMRLLDNPNVVQMKHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRMNHHMPTIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICRAL+Y+H+VIGVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQICRALNYLHSVIGVCHRDIKPQNLLVN  274



>emb|CAA05328.1| shaggy-like kinase 111 [Nicotiana tabacum]
Length=469

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 178/274 (65%), Positives = 204/274 (74%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQ------------  437
             M+V+RR KSIAS  SS SDPGGD +++K   EQ VD  V GE  LEEQ            
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDFSLKKVTVEQEVDHRVDGETQLEEQCTIAPKQDVTST  60

Query  438   --DNTASTSNV-ARPEKS-----------------GDNNEQDNNKDMEPSVVSGKGTEPG  557
               ++T  T NV  RPEKS                   N  +D+ KDMEP+VVSG GTE G
Sbjct  61    SEESTVCTLNVDTRPEKSRYEELPKEMNEMKIRDEKTNGHEDDIKDMEPAVVSGNGTETG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QIIVTT+ G NG+ K+ LSYMAER VG+GSFGVVFQAKCLETGE+VAIKKVLQD+RYKNR
Sbjct  121   QIIVTTLSGRNGRQKKTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQI+RM DHPNVV  +H FYSTT+KNEVYLNLV+EY+ ETVYRVSRHYSR+NHHMP +Y
Sbjct  181   ELQIVRMLDHPNVVHLRHCFYSTTEKNEVYLNLVLEYMSETVYRVSRHYSRVNHHMPIIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQ+CRAL+Y+HNV GVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQLCRALNYMHNVTGVCHRDIKPQNLLVN  274



>ref|XP_009773710.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nicotiana 
sylvestris]
Length=469

 Score =   320 bits (820),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 176/274 (64%), Positives = 202/274 (74%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQDNTASTSNV---  464
             M+V+RR KSIAS  SS SDPGGD ++++ K EQ VD  V GE   EEQ   A   +V   
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDFSLKRVKVEQEVDHRVDGETQSEEQCTIAPKQDVIST  60

Query  465   ------------ARPEKSG-----------------DNNEQDNNKDMEPSVVSGKGTEPG  557
                          RPEKSG                  N  +D+ KDMEP+VVSG GTE G
Sbjct  61    SSESTTTTLNVDTRPEKSGYEELPKEMNEMKIRDDKTNGREDDIKDMEPAVVSGNGTETG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QIIVTT+ G NGQ K+ LSYMAER VG+GSFGVVFQAKCLETG++VAIKKVLQD+RYKNR
Sbjct  121   QIIVTTLSGRNGQQKKTLSYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDRRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQI+R+ DHPNVV  +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSR+NHHMP +Y
Sbjct  181   ELQIVRILDHPNVVHLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRVNHHMPIIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQ+CRAL+Y+HNV GVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQLCRALNYMHNVTGVCHRDIKPQNLLVN  274



>emb|CAA05329.1| shaggy-like kinase 59 [Nicotiana tabacum]
Length=469

 Score =   320 bits (820),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 176/274 (64%), Positives = 202/274 (74%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQDNTASTSNV---  464
             M+V+RR KSIAS  SS SDPGGD ++++ K EQ VD  V GE   EEQ   A   +V   
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDFSLKRVKVEQEVDHRVDGETQSEEQCTIAPKQDVTST  60

Query  465   ------------ARPEKSG-----------------DNNEQDNNKDMEPSVVSGKGTEPG  557
                          RPEKSG                  N  +D+ KDMEP+VVSG GTE G
Sbjct  61    SSESTTTTLNVDTRPEKSGYEELPKEMNEMKIRDDKTNGREDDIKDMEPAVVSGNGTETG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QIIVTT+ G NGQ K+ LSYMAER VG+GSFGVVFQAKCLETG++VAIKKVLQD+RYKNR
Sbjct  121   QIIVTTLSGRNGQQKKTLSYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDRRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQI+R+ DHPNVV  +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSR+NHHMP +Y
Sbjct  181   ELQIVRILDHPNVVHLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRVNHHMPIIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQ+CRAL+Y+HNV GVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQLCRALNYMHNVTGVCHRDIKPQNLLVN  274



>dbj|BAO02525.1| predicted Shaggy-like kinase ortholog, partial [Nicotiana alata]
Length=415

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 179/277 (65%), Positives = 203/277 (73%), Gaps = 36/277 (13%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQ-DNTASTSNVA-  467
             M+V+RR KSIAS  SS SDPGGD +I++ K EQ VDQ V GE  +EE+   T    ++A 
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDSSIKRVKVEQEVDQRVVGETQMEERCTTTVPKEDMAS  60

Query  468   ---------------RPEKS------------------GDNNEQDNNKDMEPSVVSGKGT  548
                            RPE S                   D++E DN KDMEP+VVSG GT
Sbjct  61    TSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKADSHE-DNLKDMEPAVVSGNGT  119

Query  549   EPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRY  728
             E GQIIVTTV G NGQ K+ LSYMAER VG+GSFG VFQAKCLETGE+VAIKKVLQD+RY
Sbjct  120   ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTVFQAKCLETGESVAIKKVLQDRRY  179

Query  729   KNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMP  908
             KNRELQIMR  DHPNVV+ +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSRMN HMP
Sbjct  180   KNRELQIMRTLDHPNVVKLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRMNQHMP  239

Query  909   TLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
              +YVQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  240   IIYVQLYTYQICRALNYMHGVLGVCHRDIKPQNLLVN  276



>ref|XP_009610982.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nicotiana 
tomentosiformis]
Length=469

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 178/274 (65%), Positives = 203/274 (74%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQ------------  437
             M+V+RR KSIAS  SS SDPGGD +++K   EQ VD  V GE  LEEQ            
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDFSLKKVTVEQEVDHRVDGETQLEEQCTIAPKQDVTST  60

Query  438   --DNTASTSNV-ARPEKS-----------------GDNNEQDNNKDMEPSVVSGKGTEPG  557
               ++T  T NV  RPEKS                   N  +D+ KDMEP+VVSG GTE G
Sbjct  61    SEESTVCTLNVDTRPEKSRYEELPKEMNEMKIRDEKTNGHEDDIKDMEPAVVSGNGTETG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QIIVTT+ G NG+ K+ LSYMAER VG+GSFGVVFQAKCLETGE+VAIKKVLQD+RYKNR
Sbjct  121   QIIVTTLSGRNGRQKKTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQI+RM DHPNVV  +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSR+NHHMP +Y
Sbjct  181   ELQIVRMLDHPNVVHLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRVNHHMPIIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQ+ RAL+Y+HNV GVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQLFRALNYMHNVTGVCHRDIKPQNLLVN  274



>ref|XP_004240041.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
Length=466

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 174/271 (64%), Positives = 202/271 (75%), Gaps = 29/271 (11%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQDNTASTSNVA--  467
             M+V+RR KSIAS  SS SDPG D ++++ K+EQ VD  V  E  +EE+   AS  +V   
Sbjct  1     MNVMRRLKSIASGRSSISDPGVDISLKRLKNEQEVDHRVDIEFQMEERCTIASKDDVTST  60

Query  468   -------------RPEKSGDN--------------NEQDNNKDMEPSVVSGKGTEPGQII  566
                          R EKSG                + +D+ KDMEP+VVSG GTE GQII
Sbjct  61    SEGSDASTLTVDTRQEKSGKEELPNEMRIREKSSYDHEDDLKDMEPTVVSGNGTETGQII  120

Query  567   VTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ  746
             VTT+   NGQ K+ LSYMAER VG+GSFGVVFQAKCLETGE+VAIKKVLQD+RYKNRELQ
Sbjct  121   VTTLSDRNGQKKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKNRELQ  180

Query  747   IMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQL  926
             IMRM DH NVV  +H FYS+T+KNEVYLNLV+EYV ETVYRVSRHYSR+NHHMP +YVQL
Sbjct  181   IMRMLDHTNVVHLRHCFYSSTEKNEVYLNLVLEYVSETVYRVSRHYSRVNHHMPIIYVQL  240

Query  927   YIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             Y+YQICRAL+Y+HNVIGVCHRDIKPQNLLVN
Sbjct  241   YMYQICRALNYMHNVIGVCHRDIKPQNLLVN  271



>ref|XP_006345509.1| PREDICTED: shaggy-related protein kinase theta-like [Solanum 
tuberosum]
Length=465

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 178/271 (66%), Positives = 204/271 (75%), Gaps = 30/271 (11%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEE------QDNTAST  455
             M+V+RR KSIAS  SS SDPGGD ++++ K EQ VD  V  E  +EE      +D+  ST
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDISLKRLKIEQKVDHRVDIEIQMEERCTIAPKDDVTST  60

Query  456   SNVA---------RPEKSGDN--------------NEQDNNKDMEPSVVSGKGTEPGQII  566
             S  +         R EKSG                + +D+ KDMEP+VVSG GTE GQII
Sbjct  61    SEGSDASTLTVDTRQEKSGKKELPNEMRIREKNSYDHEDDLKDMEPTVVSGNGTETGQII  120

Query  567   VTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ  746
             VTT+ G NGQ K+ LSYMAER VG+GSFGVVFQAKCLETGE+VAIKKVLQD+RYKNRELQ
Sbjct  121   VTTLSGRNGQ-KQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKNRELQ  179

Query  747   IMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQL  926
             IMRM DHPN V  +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSR+NHHMP +YVQL
Sbjct  180   IMRMLDHPNAVHLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRVNHHMPIIYVQL  239

Query  927   YIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             Y YQICRAL+Y+HNVIGVCHRDIKPQNLLVN
Sbjct  240   YTYQICRALNYMHNVIGVCHRDIKPQNLLVN  270



>ref|XP_009602858.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana tomentosiformis]
 emb|CAA69899.1| NSK6 [Nicotiana tabacum]
Length=471

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 179/277 (65%), Positives = 203/277 (73%), Gaps = 36/277 (13%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQDNT-ASTSNVA-  467
             M+V+RR KSIAS  SS SDPGGD +I++ K EQ VDQ V GE  +EE+  T     ++A 
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDSSIKRVKVEQEVDQRVVGETQMEERCTTIVPKEDMAS  60

Query  468   ---------------RPEKS------------------GDNNEQDNNKDMEPSVVSGKGT  548
                            RPE S                   D++E DN KDMEP+VVSG GT
Sbjct  61    TSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKADSHE-DNLKDMEPAVVSGNGT  119

Query  549   EPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRY  728
             E GQIIVTTV G NGQ K+ LSYMAER VG+GSFG VFQAKCLETGE+VAIKKVLQD+RY
Sbjct  120   ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTVFQAKCLETGESVAIKKVLQDRRY  179

Query  729   KNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMP  908
             KNRELQIMR  DHPNVV+ +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSRMN HMP
Sbjct  180   KNRELQIMRTLDHPNVVKLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRMNQHMP  239

Query  909   TLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
              +YVQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  240   IIYVQLYTYQICRALNYMHGVLGVCHRDIKPQNLLVN  276



>ref|XP_010278583.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nelumbo 
nucifera]
Length=469

 Score =   315 bits (807),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 169/274 (62%), Positives = 203/274 (74%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGE-----------------P  422
             M V+RR KSIAS  SS SDPGGD   ++ K +Q  +Q V+GE                  
Sbjct  1     MHVMRRLKSIASGRSSISDPGGDSGSKRAKVDQETEQNVTGETQSVEKTTVGLEQHISSA  60

Query  423   VLEEQDNTASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPG  557
              LE   +T++ S+ ++ EKSG               D  E  ++KDME +V++G GTE G
Sbjct  61    SLEADASTSTISSNSKTEKSGFDQLPKEMHEMKIRDDKTESHDDKDMEAAVINGNGTETG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QII TT+GG NGQPK+ +SYMAER VG+GSFGVVFQAKC+ETGE VAIKKVLQDKRYKNR
Sbjct  121   QIISTTIGGKNGQPKQTISYMAERVVGTGSFGVVFQAKCVETGEAVAIKKVLQDKRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIMR+FDHPNVVQ KH F+STTDK+E+YLNLV+EYV ETVYRV+RHY++MN HMP +Y
Sbjct  181   ELQIMRLFDHPNVVQLKHCFFSTTDKDELYLNLVLEYVSETVYRVTRHYTKMNQHMPLIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             V+LY YQICRAL+YIH+VIGVCHRDIKPQNLLVN
Sbjct  241   VELYTYQICRALNYIHSVIGVCHRDIKPQNLLVN  274



>emb|CAA11860.1| shaggy-like kinase 91 [Nicotiana tabacum]
Length=471

 Score =   315 bits (807),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 175/276 (63%), Positives = 203/276 (74%), Gaps = 34/276 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQDNTA--------  449
             M+V+RR KSIAS  SS SDPGGD +I++ K EQ VDQ + GE  +EE+  T         
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDSSIKRVKVEQEVDQRLVGETQMEERCTTTFPKEDMPS  60

Query  450   ---------STSNVARPEKS-----------------GDNNEQDNNKDMEPSVVSGKGTE  551
                      +++   RPE S                   ++ +DN KDMEP+VVSG GTE
Sbjct  61    TSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKTDSHEDNLKDMEPAVVSGNGTE  120

Query  552   PGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYK  731
              GQIIVTTV G NGQ K+ LSYMAER VG+GSFG VFQAKCLETGE+VAIKKVLQD+RYK
Sbjct  121   TGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTVFQAKCLETGESVAIKKVLQDRRYK  180

Query  732   NRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPT  911
             NRELQIMR FDHPNVV+ +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSR+N HMP 
Sbjct  181   NRELQIMRTFDHPNVVKLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRINQHMPI  240

Query  912   LYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +YVQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  241   IYVQLYTYQICRALNYMHGVLGVCHRDIKPQNLLVN  276



>ref|XP_009790920.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nicotiana 
sylvestris]
Length=471

 Score =   314 bits (805),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 175/276 (63%), Positives = 202/276 (73%), Gaps = 34/276 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQDNTA--------  449
             M+V+RR KSIAS  SS SDPGGD +I++ K EQ VDQ + GE  +EE+  T         
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDSSIKRVKVEQEVDQRLVGETQMEERCTTTFPKEDMPS  60

Query  450   ---------STSNVARPEKS-----------------GDNNEQDNNKDMEPSVVSGKGTE  551
                      +++   RPE S                   ++ +DN KDMEP+VVSG GTE
Sbjct  61    TSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKTDSHEDNLKDMEPAVVSGNGTE  120

Query  552   PGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYK  731
              GQIIVTTV G NGQ K+ LSYMAER VG+GSFG VFQAKCLETGE+VAIKKVLQD+RYK
Sbjct  121   TGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTVFQAKCLETGESVAIKKVLQDRRYK  180

Query  732   NRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPT  911
             NRELQIMR  DHPNVV+ +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSRMN HMP 
Sbjct  181   NRELQIMRTLDHPNVVKLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRMNQHMPI  240

Query  912   LYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +YVQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  241   IYVQLYTYQICRALNYMHGVLGVCHRDIKPQNLLVN  276



>ref|XP_006339456.1| PREDICTED: shaggy-related protein kinase theta-like [Solanum 
tuberosum]
Length=475

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 178/280 (64%), Positives = 203/280 (73%), Gaps = 38/280 (14%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQDNT--------A  449
             M+V+RR KSIAS  SS SDPGGD +I++ K E+ VDQ V GE  +EE+  T        A
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDSSIKRVKVEKEVDQRVVGETQMEERCTTTTVPKEDMA  60

Query  450   STSNVA----------RPEKS--------------------GDNNEQDNNKDMEPSVVSG  539
             STS             RPE S                      ++ +DN KDMEP+VVSG
Sbjct  61    STSKETTARSTSAMDTRPENSELDELPKEMHEMKIKDEKADKADSLEDNLKDMEPAVVSG  120

Query  540   KGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQD  719
              GTE GQIIVTTV G NG  K+ LSYMAER VG+GSFGVVFQAKCLETGE+VAIKKVLQD
Sbjct  121   NGTETGQIIVTTVSGRNGLEKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQD  180

Query  720   KRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH  899
             +RYKNRELQIMR  DHPNVV+ +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYS+MN 
Sbjct  181   RRYKNRELQIMRTLDHPNVVKLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSKMNQ  240

Query  900   HMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             HMP +YVQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  241   HMPNIYVQLYTYQICRALNYMHGVLGVCHRDIKPQNLLVN  280



>ref|XP_002272112.1| PREDICTED: shaggy-related protein kinase theta [Vitis vinifera]
 emb|CBI38764.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 174/273 (64%), Positives = 205/273 (75%), Gaps = 31/273 (11%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEP-------VLEE------  434
             M+V+RR KSIAS  SS SDPGGD + ++ K +Q  +Q V+ E         LE+      
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDSSTKRAKVDQEAEQKVADETHSVEKSTSLEQHMASTS  60

Query  435   QDNTASTSNV---ARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQ  560
             Q+  ASTSNV   AR E+SG               +  +  ++KD EP+VVSG GTE GQ
Sbjct  61    QETAASTSNVSSIARTEQSGYDQLPKEMHDMKIRDEKVDPHDDKDAEPTVVSGSGTETGQ  120

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             II TT+GG NGQPK+ +SYMAER VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRE
Sbjct  121   IIATTIGGRNGQPKQTVSYMAERVVGTGSFGVVFQAKCLETGEAVAIKKVLQDKRYKNRE  180

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYV  920
             LQIMR+ DHPNVVQ KH F+ST++K+ VYLNLV+EYV ETVYRVSRH+SRMN HMP +YV
Sbjct  181   LQIMRVLDHPNVVQLKHCFFSTSEKDVVYLNLVLEYVSETVYRVSRHHSRMNQHMPIIYV  240

Query  921   QLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             QLY YQICRAL+Y+H+VIGVCHRDIKPQNLLVN
Sbjct  241   QLYAYQICRALNYMHSVIGVCHRDIKPQNLLVN  273



>ref|XP_004229833.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
Length=475

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/280 (63%), Positives = 205/280 (73%), Gaps = 38/280 (14%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEE--------QDNTA  449
             M+V+RR KSIAS  SS SDPGGD +I++ K E+ VDQ V GE  +EE        +++ A
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDSSIKRVKVEKEVDQRVVGETQMEEGCTTTTVPKEDMA  60

Query  450   STS------NVARPEKSGDNNE------------------------QDNNKDMEPSVVSG  539
             STS      + +  +   +N+E                         DN KDMEP+VVSG
Sbjct  61    STSMETTAGSTSTMDIRLENSELDELPKEMHEMKIKDEKDDKADSLDDNLKDMEPAVVSG  120

Query  540   KGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQD  719
              GTE GQIIVTTV G NGQ K+ LSYMAER VG+GSFGVVFQAKCLETGE+VAIKKVLQD
Sbjct  121   NGTETGQIIVTTVSGRNGQEKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQD  180

Query  720   KRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH  899
             +RYKNRELQIMR  DHPNVV+ +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSRMN 
Sbjct  181   RRYKNRELQIMRTLDHPNVVKLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRMNQ  240

Query  900   HMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             HMP +YVQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  241   HMPNIYVQLYTYQICRALNYMHGVLGVCHRDIKPQNLLVN  280



>ref|XP_006375323.1| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
 gb|ERP53120.1| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
Length=391

 Score =   310 bits (793),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 168/276 (61%), Positives = 199/276 (72%), Gaps = 34/276 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaI-RKGKDEQGVDQPVSGEPVLEE------------  434
             M+V+RR KSIAS  +S S   G  A+ ++ K +Q ++Q + GE  L E            
Sbjct  1     MNVMRRLKSIASGRTSISSDPGGDAVTKRAKVDQEMEQKIDGESYLVERSVTEQEQHMAS  60

Query  435   --QDNTASTSNVA---RPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEP  554
               Q+N AS SNV    R EK G               D N   + KDME ++VSG GTE 
Sbjct  61    TSQENAASASNVTSVTRTEKPGYDQLPKEMHEMKIRDDKNTNHDEKDMEAAIVSGNGTET  120

Query  555   GQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  734
             GQII TTVGG NGQPK+ +SYMAER VG+GSFGVV+QAKCLETGE VAIKKVLQDKRYKN
Sbjct  121   GQIIATTVGGRNGQPKQIISYMAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKN  180

Query  735   RELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMN-HHMPT  911
             RELQIMR+ DHPNVVQ KH FYSTT+K+E+YLNLV+EY+ ETV+RVSRH++RMN  H P 
Sbjct  181   RELQIMRLLDHPNVVQLKHCFYSTTEKDELYLNLVLEYISETVHRVSRHFNRMNQQHTPI  240

Query  912   LYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             LYVQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  241   LYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  276



>ref|XP_011091732.1| PREDICTED: shaggy-related protein kinase alpha-like [Sesamum 
indicum]
Length=460

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 172/267 (64%), Positives = 204/267 (76%), Gaps = 27/267 (10%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGE----------PVLEEQDN  443
             M+++RR KSIAS  SS SDPGGD +I++ K EQ +DQ V  E          PV+  +  
Sbjct  1     MNMMRRLKSIASGRSSVSDPGGDSSIKRVKVEQEIDQKVDCEVDTGEKCVRVPVVHMEAK  60

Query  444   T----ASTSNV-----------ARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTV  578
             +    ASTS+V            R +K+ D++  D  KDMEP+VVSG GTE GQIIVT++
Sbjct  61    SMGAVASTSDVHVLPKEMHEMKIREDKTDDHD--DIGKDMEPTVVSGNGTETGQIIVTSI  118

Query  579   GGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRM  758
             GG NGQPK+ +SYMAER VG+GSFGVV+QAKCLETGE+VAIKKVLQD+RYKNRELQIMR+
Sbjct  119   GGRNGQPKQTMSYMAERVVGTGSFGVVYQAKCLETGESVAIKKVLQDRRYKNRELQIMRL  178

Query  759   FDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQ  938
              +HPNVVQ KH FYSTT+KNEVYLNLV+EYV ETVYR SRHYS++  HMP LYVQLY YQ
Sbjct  179   LNHPNVVQLKHYFYSTTEKNEVYLNLVLEYVSETVYRASRHYSKVKQHMPVLYVQLYTYQ  238

Query  939   ICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             ICR L+Y+H VIGVCHRDIKPQNLLVN
Sbjct  239   ICRGLNYMHRVIGVCHRDIKPQNLLVN  265



>gb|KDO86034.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=272

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 172/212 (81%), Gaps = 15/212 (7%)
 Frame = +3

Query  426   LEEQDNTASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQ  560
             LE   +T+  + VAR E+SG               + N   ++KD+EPS+V+G GTE GQ
Sbjct  61    LEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQ  120

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             +I TTVGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLETG++VAIKKVLQDKRYKNRE
Sbjct  121   VIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNRE  180

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYV  920
             LQIMR+ +HPNVV  KH F+STT+K+E+YLNLV+EY+ ETVYRVS+HY+RMN H+P LYV
Sbjct  181   LQIMRLLNHPNVVSLKHCFFSTTEKDELYLNLVLEYISETVYRVSKHYTRMNQHVPILYV  240

Query  921   QLYIYQICRALSYIHNVIGVCHRDIKPQNLLV  1016
             QLY YQICRAL+Y+H+V+GVCHRDIKPQNLL+
Sbjct  241   QLYTYQICRALNYLHHVVGVCHRDIKPQNLLM  272



>gb|KDO86033.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=349

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 173/213 (81%), Gaps = 15/213 (7%)
 Frame = +3

Query  426   LEEQDNTASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQ  560
             LE   +T+  + VAR E+SG               + N   ++KD+EPS+V+G GTE GQ
Sbjct  61    LEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQ  120

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             +I TTVGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLETG++VAIKKVLQDKRYKNRE
Sbjct  121   VIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNRE  180

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYV  920
             LQIMR+ +HPNVV  KH F+STT+K+E+YLNLV+EY+ ETVYRVS+HY+RMN H+P LYV
Sbjct  181   LQIMRLLNHPNVVSLKHCFFSTTEKDELYLNLVLEYISETVYRVSKHYTRMNQHVPILYV  240

Query  921   QLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             QLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  241   QLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  273



>ref|XP_002320754.2| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
 gb|EEE99069.2| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
Length=473

 Score =   309 bits (792),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 168/276 (61%), Positives = 199/276 (72%), Gaps = 34/276 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaI-RKGKDEQGVDQPVSGEPVLEE------------  434
             M+V+RR KSIAS  +S S   G  A+ ++ K +Q ++Q + GE  L E            
Sbjct  1     MNVMRRLKSIASGRTSISSDPGGDAVTKRAKVDQEMEQKIDGESYLVERSVTEQEQHMAS  60

Query  435   --QDNTASTSNVA---RPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEP  554
               Q+N AS SNV    R EK G               D N   + KDME ++VSG GTE 
Sbjct  61    TSQENAASASNVTSVTRTEKPGYDQLPKEMHEMKIRDDKNTNHDEKDMEAAIVSGNGTET  120

Query  555   GQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  734
             GQII TTVGG NGQPK+ +SYMAER VG+GSFGVV+QAKCLETGE VAIKKVLQDKRYKN
Sbjct  121   GQIIATTVGGRNGQPKQIISYMAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKN  180

Query  735   RELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMN-HHMPT  911
             RELQIMR+ DHPNVVQ KH FYSTT+K+E+YLNLV+EY+ ETV+RVSRH++RMN  H P 
Sbjct  181   RELQIMRLLDHPNVVQLKHCFYSTTEKDELYLNLVLEYISETVHRVSRHFNRMNQQHTPI  240

Query  912   LYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             LYVQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  241   LYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  276



>ref|XP_011093165.1| PREDICTED: shaggy-related protein kinase alpha [Sesamum indicum]
Length=469

 Score =   309 bits (791),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 203/274 (74%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVS-----GEPVLEEQDN-----  443
             M+++RR KSIAS  SS SDP GD +I++ K EQ +D   S     GE  L+  +      
Sbjct  1     MNMMRRLKSIASGRSSVSDPVGDSSIKRVKVEQELDHRDSCDVETGENCLQAPEQHMESN  60

Query  444   ----TASTSNV-ARPEKSG-----------------DNNEQDNNKDMEPSVVSGKGTEPG  557
                  ASTSNV  +PEKSG                  +N + N KDME ++VSG GTE G
Sbjct  61    SLEAVASTSNVHGKPEKSGYDELPKEMHEMKIRDDKTDNHEANVKDMESTIVSGNGTEAG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QIIVT++GG NGQPK+ +SYMAER VG+GSFGVV+QAK LETGE+VAIKKVLQD+RYKNR
Sbjct  121   QIIVTSIGGHNGQPKQTMSYMAERVVGTGSFGVVYQAKWLETGESVAIKKVLQDRRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIMRM +HPNVVQ KHSFYSTT+KNEVYLNLV+EYV ETVYR SRHYSR+N +MP L+
Sbjct  181   ELQIMRMLNHPNVVQLKHSFYSTTEKNEVYLNLVLEYVSETVYRASRHYSRVNQYMPMLF  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICRAL+Y H ++GVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQICRALNYTHRIVGVCHRDIKPQNLLVN  274



>emb|CAA11861.1| shaggy kinase 6 [Petunia x hybrida]
Length=470

 Score =   309 bits (791),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 172/276 (62%), Positives = 203/276 (74%), Gaps = 35/276 (13%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQ------------  437
             M+V+RR KSI S  SS SDPGGD +I++ K EQ +++ V G+  ++++            
Sbjct  1     MNVMRRLKSITSGRSSISDPGGDSSIKRVKVEQEIER-VVGDTQMDDRCTTTAPKEDMAS  59

Query  438   ----DNTASTSNV-ARPEKSG-----------------DNNEQDNNKDMEPSVVSGKGTE  551
                   TASTS +  RPE S                   ++ +DN KDMEP+VVSG G E
Sbjct  60    TSKDTTTASTSTMDTRPENSEVDELPKELHEMKIKDERTDSHEDNLKDMEPAVVSGNGAE  119

Query  552   PGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYK  731
              GQIIVTTV G NGQ K+ LSYMAER VG+GSFGVVFQAKCLETGE+VAIKKVLQD+RYK
Sbjct  120   TGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYK  179

Query  732   NRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPT  911
             NRELQIMR  DHPNVV+ +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSRMN HMP 
Sbjct  180   NRELQIMRTLDHPNVVKLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRMNQHMPI  239

Query  912   LYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +YVQLY YQICRAL+Y+H+V+ VCHRDIKPQNLLVN
Sbjct  240   IYVQLYTYQICRALNYMHSVLHVCHRDIKPQNLLVN  275



>gb|AAT81407.1| shaggy-related protein kinase 6 [Solanum peruvianum]
Length=475

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 175/280 (63%), Positives = 205/280 (73%), Gaps = 38/280 (14%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEE--------QDNTA  449
             M+V+RR KSIAS  SS SDPGGD +I++ K E+ VDQ V GE  +EE        +++ A
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDSSIKRVKVEKEVDQRVVGETQMEEGCTTTTVPKEDMA  60

Query  450   STSNVA----------RPEKS---------------GDNNEQ-----DNNKDMEPSVVSG  539
             STS             R E S               G+ +++     DN KDMEP+VVSG
Sbjct  61    STSKETTAGSTSTMDTRLENSELDELPKEMHEMKIKGEKDDKADSLDDNLKDMEPAVVSG  120

Query  540   KGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQD  719
              GTE GQIIVTTV G NGQ K+ LSYMAER VG+GSFGVVFQAKCLETGE+VAIKKVLQD
Sbjct  121   NGTETGQIIVTTVSGRNGQEKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQD  180

Query  720   KRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH  899
             +RYKNRELQIMR  DHPNVV+ +H FYSTT+KN+VYLNLV+EYV +TVYRVSRHYSR+  
Sbjct  181   RRYKNRELQIMRTLDHPNVVKLRHCFYSTTEKNDVYLNLVLEYVSDTVYRVSRHYSRLTQ  240

Query  900   HMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             HMP +YVQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  241   HMPIIYVQLYTYQICRALNYMHGVLGVCHRDIKPQNLLVN  280



>ref|XP_011035087.1| PREDICTED: shaggy-related protein kinase theta [Populus euphratica]
Length=473

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 200/276 (72%), Gaps = 34/276 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaI-RKGKDEQGVDQPVSGEPVLEE------------  434
             M+V+RR KSIAS  +S S   G  A+ ++ K +Q ++  + GE  L E            
Sbjct  1     MNVMRRLKSIASGRTSISSDPGGDAVTKRAKVDQEMEPKIDGESYLVERSVTDQEQHMAS  60

Query  435   --QDNTASTSNVA---RPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEP  554
               Q+N AS SNV    R EKSG               D N   + KDME ++VSG GTE 
Sbjct  61    TSQENAASASNVTSVTRTEKSGYDQLPKEMHEMKIRDDKNTNHDEKDMEAAIVSGNGTET  120

Query  555   GQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  734
             GQII TTVGG NGQPK+ +SYMAER VG+GSFGVV+QAKCLETGE VAIKKVLQDKRYKN
Sbjct  121   GQIIATTVGGRNGQPKQIISYMAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKN  180

Query  735   RELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH-HMPT  911
             RELQ+MR+ DHPNVVQ KH FYSTT+K+E+YLNLV+EY+ ETV+RVSRH++RMN+ H P 
Sbjct  181   RELQVMRILDHPNVVQLKHCFYSTTEKDELYLNLVLEYISETVHRVSRHFNRMNYQHTPI  240

Query  912   LYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             LYVQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  241   LYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  276



>gb|EYU32069.1| hypothetical protein MIMGU_mgv1a006024mg [Erythranthe guttata]
Length=461

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 173/269 (64%), Positives = 204/269 (76%), Gaps = 30/269 (11%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPV-------------SGEPVLEE  434
             M+++RR KSIAS  SS SDPGGD  +++ K EQ +D  V               EP  E 
Sbjct  1     MNMMRRLKSIASGRSSVSDPGGDSDMKRVKVEQEIDHMVVCEVDNAGERYTRQTEPHFE-  59

Query  435   QDNT---ASTSNV-----------ARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVT  572
              D+T   ASTS+V            R +K+ D++E  N K+MEP+VVSG GTE GQIIVT
Sbjct  60    SDSTGAIASTSDVQELPKEMHEMKIREDKTDDSDE--NGKEMEPTVVSGSGTETGQIIVT  117

Query  573   TVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIM  752
             ++GG NGQPK+ +SYMAER VG+GSFGVV+QAKCLETGE+VAIKKVLQD+RYKNRELQIM
Sbjct  118   SIGGRNGQPKQTMSYMAERVVGTGSFGVVYQAKCLETGESVAIKKVLQDRRYKNRELQIM  177

Query  753   RMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYI  932
             ++ +HPNVVQ KH FYSTT+KNEVYLNLV+EYV ETVYR SRHYSR+N  MP LYVQLY 
Sbjct  178   QLLNHPNVVQLKHYFYSTTEKNEVYLNLVLEYVSETVYRASRHYSRVNQCMPVLYVQLYT  237

Query  933   YQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YQICRAL+Y+H VIGVCHRDIKPQNLLVN
Sbjct  238   YQICRALNYMHRVIGVCHRDIKPQNLLVN  266



>emb|CAA58595.1| Petunia Shaggy kinase 6 [Petunia x hybrida]
Length=414

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 168/211 (80%), Gaps = 18/211 (9%)
 Frame = +3

Query  441   NTASTSNV-ARPEKSG-----------------DNNEQDNNKDMEPSVVSGKGTEPGQII  566
              TASTS +  RPE S                   ++ +DN KDMEP+VVSG G E GQII
Sbjct  9     TTASTSTMDTRPENSEVDELPKELHEMKIKDERTDSHEDNLKDMEPAVVSGNGAETGQII  68

Query  567   VTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ  746
             VTTV G NGQ K+ LSYMAER VG+GSFGVVFQAKCLETGE+VAIKKVLQD+RYKNRELQ
Sbjct  69    VTTVSGRNGQQKQTLSYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKNRELQ  128

Query  747   IMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQL  926
             IMR  DHPNVV+ +H FYSTT+KNEVYLNLV+EYV ETVYRVSRHYSRMN HMP +YVQL
Sbjct  129   IMRTLDHPNVVKLRHCFYSTTEKNEVYLNLVLEYVSETVYRVSRHYSRMNQHMPIIYVQL  188

Query  927   YIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             Y YQICRAL+Y+H+V+ VCHRDIKPQNLLVN
Sbjct  189   YTYQICRALNYMHSVLHVCHRDIKPQNLLVN  219



>ref|XP_010255498.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Nelumbo 
nucifera]
Length=469

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/274 (61%), Positives = 199/274 (73%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQ------------  437
             M V+RR KSIAS  SS SDPGGD   ++ K +Q ++Q  + E  L E+            
Sbjct  1     MHVMRRLKSIASGRSSVSDPGGDSGSKRAKVDQEMEQNATNETHLMEKTSIGLEQHVAST  60

Query  438   --DNTASTSNVA---RPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPG  557
               +   STSN++   + EKSG               D  E  ++KD E ++V+G GTE G
Sbjct  61    SIETDVSTSNISITSKTEKSGYDQLPKEMHEMKIRDDKTENHDDKDAEATIVNGNGTEAG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QII TT+GG NGQPK+ +SYMAER VG+GSFGVVFQAKC+ETGE VAIKKVLQDKRYKNR
Sbjct  121   QIIATTIGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCVETGEAVAIKKVLQDKRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIMR+ DHPNVVQ KH F+STTDK+E+YLNLV+EYV ETVYRV+RHYSRMN  MP +Y
Sbjct  181   ELQIMRLLDHPNVVQLKHCFFSTTDKDELYLNLVLEYVSETVYRVTRHYSRMNQQMPLIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             V+LY YQICRAL+YIH V+GVCHRDIKPQNLLVN
Sbjct  241   VKLYTYQICRALNYIHGVVGVCHRDIKPQNLLVN  274



>ref|XP_007134960.1| hypothetical protein PHAVU_010G090200g [Phaseolus vulgaris]
 gb|ESW06954.1| hypothetical protein PHAVU_010G090200g [Phaseolus vulgaris]
Length=469

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 172/222 (77%), Gaps = 17/222 (8%)
 Frame = +3

Query  399   DQPVSGEPVLEEQDNTASTSNVARPEKSG---------------DNNEQDNNKDMEPSVV  533
             DQPV    + E    T+  S  AR EKSG               + ++ +N KDME +VV
Sbjct  55    DQPVDA--LKETTVGTSDVSTAARTEKSGYDELPKELNEMKIRDEKSKNNNEKDMEATVV  112

Query  534   SGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVL  713
             SG GTE GQII T +GG +GQPK+ +SYMAER VG+GSFGVVFQAKCLETGE VAIKKVL
Sbjct  113   SGNGTETGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGVVFQAKCLETGEAVAIKKVL  172

Query  714   QDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRM  893
             QDKRYKNRELQ+MR  DHPNVV+ KH F+STTDK+E+YLNLV+EYVPETVY+VS+HY RM
Sbjct  173   QDKRYKNRELQVMRTVDHPNVVKLKHCFFSTTDKDELYLNLVLEYVPETVYKVSKHYVRM  232

Query  894   NHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             + HMP +YVQLY YQICRAL+Y+H VIGVCHRDIKPQNLLVN
Sbjct  233   HQHMPMIYVQLYTYQICRALNYLHQVIGVCHRDIKPQNLLVN  274



>ref|XP_007051909.1| Shaggy-like protein kinase 32 isoform 2 [Theobroma cacao]
 gb|EOX96066.1| Shaggy-like protein kinase 32 isoform 2 [Theobroma cacao]
Length=436

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 172/213 (81%), Gaps = 15/213 (7%)
 Frame = +3

Query  426   LEEQDNTASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQ  560
             LE   +T++ ++VAR EKSG               +     + KD+E +V++G GTE GQ
Sbjct  60    LETVASTSNVTSVARMEKSGVDQLPNEMHEMRIRDEKTANHDEKDVEATVINGNGTETGQ  119

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             II T VGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLE GE+VAIKKVLQDKRYKNRE
Sbjct  120   IISTVVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLERGESVAIKKVLQDKRYKNRE  179

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYV  920
             LQIMR+ +HPNVVQ KH F+STTDK+E+YLNLV+EYVPETVYRVS+HYSRMN HMP +YV
Sbjct  180   LQIMRILNHPNVVQLKHCFFSTTDKDELYLNLVLEYVPETVYRVSKHYSRMNQHMPIIYV  239

Query  921   QLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             QLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  240   QLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  272



>ref|XP_006445137.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 ref|XP_006445138.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 ref|XP_006491022.1| PREDICTED: shaggy-related protein kinase theta-like [Citrus sinensis]
 gb|ESR58377.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 gb|ESR58378.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 gb|KDO86032.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=468

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 173/213 (81%), Gaps = 15/213 (7%)
 Frame = +3

Query  426   LEEQDNTASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQ  560
             LE   +T+  + VAR E+SG               + N   ++KD+EPS+V+G GTE GQ
Sbjct  61    LEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQ  120

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             +I TTVGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLETG++VAIKKVLQDKRYKNRE
Sbjct  121   VIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNRE  180

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYV  920
             LQIMR+ +HPNVV  KH F+STT+K+E+YLNLV+EY+ ETVYRVS+HY+RMN H+P LYV
Sbjct  181   LQIMRLLNHPNVVSLKHCFFSTTEKDELYLNLVLEYISETVYRVSKHYTRMNQHVPILYV  240

Query  921   QLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             QLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  241   QLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  273



>ref|XP_007051910.1| Shaggy-like protein kinase 32 isoform 3, partial [Theobroma cacao]
 gb|EOX96067.1| Shaggy-like protein kinase 32 isoform 3, partial [Theobroma cacao]
Length=454

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 172/213 (81%), Gaps = 15/213 (7%)
 Frame = +3

Query  426   LEEQDNTASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQ  560
             LE   +T++ ++VAR EKSG               +     + KD+E +V++G GTE GQ
Sbjct  86    LETVASTSNVTSVARMEKSGVDQLPNEMHEMRIRDEKTANHDEKDVEATVINGNGTETGQ  145

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             II T VGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLE GE+VAIKKVLQDKRYKNRE
Sbjct  146   IISTVVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLERGESVAIKKVLQDKRYKNRE  205

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYV  920
             LQIMR+ +HPNVVQ KH F+STTDK+E+YLNLV+EYVPETVYRVS+HYSRMN HMP +YV
Sbjct  206   LQIMRILNHPNVVQLKHCFFSTTDKDELYLNLVLEYVPETVYRVSKHYSRMNQHMPIIYV  265

Query  921   QLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             QLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  266   QLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  298



>gb|KDO86031.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=492

 Score =   305 bits (780),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 173/213 (81%), Gaps = 15/213 (7%)
 Frame = +3

Query  426   LEEQDNTASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQ  560
             LE   +T+  + VAR E+SG               + N   ++KD+EPS+V+G GTE GQ
Sbjct  61    LEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQ  120

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             +I TTVGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLETG++VAIKKVLQDKRYKNRE
Sbjct  121   VIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNRE  180

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYV  920
             LQIMR+ +HPNVV  KH F+STT+K+E+YLNLV+EY+ ETVYRVS+HY+RMN H+P LYV
Sbjct  181   LQIMRLLNHPNVVSLKHCFFSTTEKDELYLNLVLEYISETVYRVSKHYTRMNQHVPILYV  240

Query  921   QLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             QLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  241   QLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  273



>ref|XP_007051908.1| Shaggy-like protein kinase 32 isoform 1 [Theobroma cacao]
 gb|EOX96065.1| Shaggy-like protein kinase 32 isoform 1 [Theobroma cacao]
Length=532

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 171/281 (61%), Positives = 201/281 (72%), Gaps = 34/281 (12%)
 Frame = +3

Query  279   SVGSK-MDVVRRFKSIassgssasdpggdpa-IRKGKDEQGVDQPVSGEPVLEEQDNT--  446
             SV SK M+V+RR KSIAS  SS S   G  +  ++ K +Q  +  V  E  L E+  T  
Sbjct  57    SVKSKTMNVMRRLKSIASGRSSISSDPGGDSGTKRAKVDQQAECKVHEESNLVERSTTGL  116

Query  447   ------------ASTSNV---ARPEKSG---------------DNNEQDNNKDMEPSVVS  536
                         ASTSNV   AR EKSG               +     + KD+E +V++
Sbjct  117   EQHMASTSLETVASTSNVTSVARMEKSGVDQLPNEMHEMRIRDEKTANHDEKDVEATVIN  176

Query  537   GKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQ  716
             G GTE GQII T VGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLE GE+VAIKKVLQ
Sbjct  177   GNGTETGQIISTVVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLERGESVAIKKVLQ  236

Query  717   DKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMN  896
             DKRYKNRELQIMR+ +HPNVVQ KH F+STTDK+E+YLNLV+EYVPETVYRVS+HYSRMN
Sbjct  237   DKRYKNRELQIMRILNHPNVVQLKHCFFSTTDKDELYLNLVLEYVPETVYRVSKHYSRMN  296

Query  897   HHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
              HMP +YVQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  297   QHMPIIYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  337



>ref|XP_010255499.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Nelumbo 
nucifera]
Length=460

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 176/228 (77%), Gaps = 16/228 (7%)
 Frame = +3

Query  381   KDEQGVDQPVSGEPVLEEQDNTASTSNVARPEKSG---------------DNNEQDNNKD  515
             K   G++Q V+   + E   +T++ S  ++ EKSG               D  E  ++KD
Sbjct  39    KTSIGLEQHVASTSI-ETDVSTSNISITSKTEKSGYDQLPKEMHEMKIRDDKTENHDDKD  97

Query  516   MEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETV  695
              E ++V+G GTE GQII TT+GG NGQPK+ +SYMAER VG+GSFGVVFQAKC+ETGE V
Sbjct  98    AEATIVNGNGTEAGQIIATTIGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCVETGEAV  157

Query  696   AIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVS  875
             AIKKVLQDKRYKNRELQIMR+ DHPNVVQ KH F+STTDK+E+YLNLV+EYV ETVYRV+
Sbjct  158   AIKKVLQDKRYKNRELQIMRLLDHPNVVQLKHCFFSTTDKDELYLNLVLEYVSETVYRVT  217

Query  876   RHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             RHYSRMN  MP +YV+LY YQICRAL+YIH V+GVCHRDIKPQNLLVN
Sbjct  218   RHYSRMNQQMPLIYVKLYTYQICRALNYIHGVVGVCHRDIKPQNLLVN  265



>ref|XP_006375322.1| shaggy-related protein kinase theta [Populus trichocarpa]
 gb|ERP53119.1| shaggy-related protein kinase theta [Populus trichocarpa]
Length=438

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 169/214 (79%), Gaps = 19/214 (9%)
 Frame = +3

Query  435   QDNTASTSNVA---RPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQ  560
             Q+N AS SNV    R EK G               D N   + KDME ++VSG GTE GQ
Sbjct  28    QENAASASNVTSVTRTEKPGYDQLPKEMHEMKIRDDKNTNHDEKDMEAAIVSGNGTETGQ  87

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             II TTVGG NGQPK+ +SYMAER VG+GSFGVV+QAKCLETGE VAIKKVLQDKRYKNRE
Sbjct  88    IIATTVGGRNGQPKQIISYMAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKNRE  147

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMN-HHMPTLY  917
             LQIMR+ DHPNVVQ KH FYSTT+K+E+YLNLV+EY+ ETV+RVSRH++RMN  H P LY
Sbjct  148   LQIMRLLDHPNVVQLKHCFYSTTEKDELYLNLVLEYISETVHRVSRHFNRMNQQHTPILY  207

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  208   VQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  241



>ref|XP_011023409.1| PREDICTED: shaggy-related protein kinase theta-like isoform X2 
[Populus euphratica]
Length=419

 Score =   300 bits (768),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 198/276 (72%), Gaps = 34/276 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpa-IRKGKDEQGVDQPVSGEPVLEE------------  434
             M+V+RR KS+AS  +S S   G     ++ K +Q +++ V  E  L E            
Sbjct  1     MNVMRRLKSMASGRTSISSDPGGDVGTKRAKVDQEIERKVDQESYLVERSVTDQEQHMAS  60

Query  435   --QDNTASTSN---VARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEP  554
               Q+N ASTSN   VAR EKSG               +     + K++E  +VSG GTE 
Sbjct  61    TSQENAASTSNITSVARTEKSGYDQLPKEMHQMKIRDEKTTFHDEKEVEAVIVSGNGTET  120

Query  555   GQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  734
             GQII TTVGG NGQPK+ +SYMAE  VG+GSFGVV+QAKCLETGE VAIKKVLQDKRYKN
Sbjct  121   GQIIATTVGGRNGQPKQTISYMAEHMVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKN  180

Query  735   RELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH-HMPT  911
             RELQ+MR+ DHPNVVQ KH FYSTT+K+E+YLNLV+EY+ ETV+RVSRH++RMNH HMP 
Sbjct  181   RELQVMRILDHPNVVQLKHCFYSTTEKDELYLNLVLEYISETVHRVSRHFNRMNHQHMPI  240

Query  912   LYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +YVQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  241   IYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  276



>sp|O04160.2|KSGT_BRANA RecName: Full=Shaggy-related protein kinase theta; AltName: Full=ASK-theta 
[Brassica napus]
 emb|CAA73214.1| shaggy-like protein kinase tetha [Brassica napus]
Length=468

 Score =   301 bits (771),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 175/229 (76%), Gaps = 16/229 (7%)
 Frame = +3

Query  375   KGKDEQGVDQPVSGEPVLEEQDNTASTSNVARP--------------EKSGDNNEQDNNK  512
             +G D   VDQ  S + V+  QD  A TSNV  P              E     N  + +K
Sbjct  42    RGDDPMQVDQ--STDMVVVSQDTVAGTSNVPPPPDQLPEVMNDMRLREDEPHANRGEEDK  99

Query  513   DMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGET  692
             DMEP +V+G GTE GQ+I TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE 
Sbjct  100   DMEPPIVNGCGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQ  159

Query  693   VAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRV  872
             VAIKKVLQDKRYKNRELQIMR+ DHPNVV+ +HSF+STTDK+E+YLNLV+E+VPETVYR 
Sbjct  160   VAIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEFVPETVYRA  219

Query  873   SRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
              +HY++MN HMP + VQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  220   LKHYTKMNQHMPIILVQLYTYQICRALNYLHRVVGVCHRDIKPQNLLVN  268



>ref|XP_003528879.1| PREDICTED: shaggy-related protein kinase theta-like [Glycine 
max]
 gb|KHN04626.1| Shaggy-related protein kinase theta [Glycine soja]
Length=470

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 168/207 (81%), Gaps = 15/207 (7%)
 Frame = +3

Query  444   TASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTV  578
             T+  S VAR EKSG               + ++ +N KD+E +VVSG GTE GQII T +
Sbjct  69    TSDVSTVARTEKSGFDELPKELNEMKIRDEKSKNNNEKDIEATVVSGNGTETGQIITTAI  128

Query  579   GGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRM  758
             GG +GQPK+ +SYMAER VG+GSFGVVFQAKCLETGE+VAIKKVLQD+RYKNRELQ+MR 
Sbjct  129   GGRDGQPKQTISYMAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDRRYKNRELQVMRT  188

Query  759   FDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQ  938
              DHPNVV+ KH F+STTDK+E+YLNLV+EYVPETVY+VS+HY RM+ HMP +YVQLY YQ
Sbjct  189   VDHPNVVKLKHYFFSTTDKDELYLNLVLEYVPETVYKVSKHYVRMHQHMPIIYVQLYTYQ  248

Query  939   ICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             ICRAL+Y+H VIGVCHRDIKPQNLLVN
Sbjct  249   ICRALNYLHQVIGVCHRDIKPQNLLVN  275



>ref|XP_011023410.1| PREDICTED: shaggy-related protein kinase theta-like isoform X3 
[Populus euphratica]
Length=468

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 198/276 (72%), Gaps = 34/276 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpa-IRKGKDEQGVDQPVSGEPVLEE------------  434
             M+V+RR KS+AS  +S S   G     ++ K +Q +++ V  E  L E            
Sbjct  1     MNVMRRLKSMASGRTSISSDPGGDVGTKRAKVDQEIERKVDQESYLVERSVTDQEQHMAS  60

Query  435   --QDNTASTSN---VARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEP  554
               Q+N ASTSN   VAR EKSG               +     + K++E  +VSG GTE 
Sbjct  61    TSQENAASTSNITSVARTEKSGYDQLPKEMHQMKIRDEKTTFHDEKEVEAVIVSGNGTET  120

Query  555   GQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  734
             GQII TTVGG NGQPK+ +SYMAE  VG+GSFGVV+QAKCLETGE VAIKKVLQDKRYKN
Sbjct  121   GQIIATTVGGRNGQPKQTISYMAEHMVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKN  180

Query  735   RELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH-HMPT  911
             RELQ+MR+ DHPNVVQ KH FYSTT+K+E+YLNLV+EY+ ETV+RVSRH++RMNH HMP 
Sbjct  181   RELQVMRILDHPNVVQLKHCFYSTTEKDELYLNLVLEYISETVHRVSRHFNRMNHQHMPI  240

Query  912   LYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +YVQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  241   IYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  276



>ref|XP_008460173.1| PREDICTED: shaggy-related protein kinase theta [Cucumis melo]
Length=469

 Score =   300 bits (767),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 167/211 (79%), Gaps = 17/211 (8%)
 Frame = +3

Query  438   DNTASTSNV---ARPEKSG--------------DNNEQDNNKDMEPSVVSGKGTEPGQII  566
             DN ASTSN+   A  EKSG              D     + KD+EP+VV+G GTE GQII
Sbjct  64    DNAASTSNISSIAGAEKSGFDHLPREMREMRIRDEKSNHDEKDLEPAVVNGNGTEAGQII  123

Query  567   VTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ  746
              TTVGG NG+PK+ +SYMAER VG+GSFGVVFQAKCLET E VAIKKVLQDKRYKNRELQ
Sbjct  124   ATTVGGRNGKPKQTISYMAERVVGTGSFGVVFQAKCLETNEAVAIKKVLQDKRYKNRELQ  183

Query  747   IMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQL  926
             IMRM DH N+VQ KH F+STTDK+E+YLNLV+EY+ ETVY+VS+HY RMN  MP +YVQL
Sbjct  184   IMRMLDHSNIVQLKHCFFSTTDKDELYLNLVLEYISETVYKVSKHYIRMNRSMPIVYVQL  243

Query  927   YIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             Y YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  244   YTYQICRALNYLHHVVGVCHRDIKPQNLLVN  274



>emb|CDX91895.1| BnaC03g31970D [Brassica napus]
Length=466

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 174/229 (76%), Gaps = 18/229 (8%)
 Frame = +3

Query  375   KGKDEQGVDQPVSGEPVLEEQDNTASTSNVARP--------------EKSGDNNEQDNNK  512
             +G D   VDQ       +  QD+ A TSNV  P              E+    N  + +K
Sbjct  42    RGDDPMQVDQSTD----MVSQDSVAGTSNVPPPADQLPEVMNDMRLREEEPHANRGEEDK  97

Query  513   DMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGET  692
             DMEP +V+G GTE GQ+I TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE 
Sbjct  98    DMEPPIVNGCGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQ  157

Query  693   VAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRV  872
             VAIKKVLQDKRYKNRELQIMR+ DHPNVV+ +HSF+STTDK+E+YLNLV+E+VPETVYR 
Sbjct  158   VAIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEFVPETVYRA  217

Query  873   SRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
              +HY++MN HMP + VQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  218   LKHYTKMNQHMPIILVQLYTYQICRALNYLHRVVGVCHRDIKPQNLLVN  266



>ref|XP_009340624.1| PREDICTED: shaggy-related protein kinase theta-like [Pyrus x 
bretschneideri]
Length=474

 Score =   299 bits (766),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 168/217 (77%), Gaps = 19/217 (9%)
 Frame = +3

Query  426   LEEQDNTASTSNVARPEKSGDNNEQD-------------------NNKDMEPSVVSGKGT  548
             LE   +T+S S+V + E   D +  D                   ++KDME ++++G GT
Sbjct  63    LETGASTSSVSSVGKTETKEDKSSNDQLPKEMHEMKIRDEKANHHDDKDMEETIINGNGT  122

Query  549   EPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRY  728
             E G II TTVGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLETGE VAIKKVLQDKRY
Sbjct  123   ETGHIIATTVGGRNGQPKQTISYMAERIVGTGSFGVVFQAKCLETGEAVAIKKVLQDKRY  182

Query  729   KNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMP  908
             KNRELQIMR  DHPNVVQ KH F+STTDK+E+YLNLV+EY+ ETVYRVS+HY RMN H+P
Sbjct  183   KNRELQIMRFLDHPNVVQLKHCFFSTTDKDELYLNLVLEYISETVYRVSKHYIRMNQHIP  242

Query  909   TLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
              +YVQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  243   IIYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  279



>ref|XP_002511803.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF50472.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=474

 Score =   299 bits (765),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 161/276 (58%), Positives = 197/276 (71%), Gaps = 34/276 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKG-KDEQGVDQPVSGEPVLEEQ-----------  437
             M+++RR KSIAS  +S S   G  ++ K  K +Q  +Q + GE   +E+           
Sbjct  1     MNMMRRLKSIASGRTSISSDPGGDSLTKRVKVDQETEQKIDGEVYSDERNATGLEQHMAS  60

Query  438   ---DNTASTSN---VARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEP  554
                +N ASTSN   V + EKSG               D     + KDME ++VSG GTE 
Sbjct  61    TSLENPASTSNSASVVKTEKSGFDQLPKEMHEMRIKDDKTTSHDEKDMEAAIVSGTGTET  120

Query  555   GQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  734
             G II TT+GG NGQPK+ +S+MAER VG+GSFGVV+QAKCLETGE VAIKKVLQD+RYKN
Sbjct  121   GHIIATTLGGRNGQPKQTISFMAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDRRYKN  180

Query  735   RELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH-HMPT  911
             RELQIMR+  HPNVV+ KH F STT+K+E+YLNLV+EY+PETVYRVSRHY++MNH HMP 
Sbjct  181   RELQIMRLLGHPNVVELKHCFISTTEKDELYLNLVLEYIPETVYRVSRHYNKMNHQHMPI  240

Query  912   LYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +YVQLY YQICR LSY+H+V+GVCHRDIKPQNLLVN
Sbjct  241   IYVQLYAYQICRGLSYLHHVVGVCHRDIKPQNLLVN  276



>ref|XP_011023408.1| PREDICTED: shaggy-related protein kinase NtK-1-like isoform X1 
[Populus euphratica]
Length=454

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 171/214 (80%), Gaps = 19/214 (9%)
 Frame = +3

Query  435   QDNTASTSN---VARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQ  560
             Q+N ASTSN   VAR EKSG               +     + K++E  +VSG GTE GQ
Sbjct  49    QENAASTSNITSVARTEKSGYDQLPKEMHQMKIRDEKTTFHDEKEVEAVIVSGNGTETGQ  108

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             II TTVGG NGQPK+ +SYMAE  VG+GSFGVV+QAKCLETGE VAIKKVLQDKRYKNRE
Sbjct  109   IIATTVGGRNGQPKQTISYMAEHMVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKNRE  168

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH-HMPTLY  917
             LQ+MR+ DHPNVVQ KH FYSTT+K+E+YLNLV+EY+ ETV+RVSRH++RMNH HMP +Y
Sbjct  169   LQVMRILDHPNVVQLKHCFYSTTEKDELYLNLVLEYISETVHRVSRHFNRMNHQHMPIIY  228

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  229   VQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  262



>ref|XP_006840718.1| hypothetical protein AMTR_s00096p00102520 [Amborella trichopoda]
 gb|ERN02393.1| hypothetical protein AMTR_s00096p00102520 [Amborella trichopoda]
Length=356

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 158/183 (86%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  +   +D+ K+ME +VV G GTE GQIIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEINEMKIKDD-KEMEANVVDGNGTETGQIIVTTIGGRNGQPKQNISYMAERVVGHGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             G+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPN+V  KH F+STTDK+E+YL
Sbjct  85    GIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNIVSLKHCFFSTTDKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLVMEYVPETVYRV++HYSRMN  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNL
Sbjct  145   NLVMEYVPETVYRVAKHYSRMNQRMPFIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|XP_002301334.1| hypothetical protein POPTR_0002s15640g [Populus trichocarpa]
 gb|EEE80607.1| hypothetical protein POPTR_0002s15640g [Populus trichocarpa]
Length=412

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 171/214 (80%), Gaps = 19/214 (9%)
 Frame = +3

Query  435   QDNTASTSN---VARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQ  560
             Q+N ASTSN   V R EKSG               +     + K++E ++VSG GTE GQ
Sbjct  6     QENAASTSNITSVTRTEKSGYDQLPKEMHQMKIRDEKTTSHDEKEVEAAIVSGNGTETGQ  65

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             II TTVGG +GQPK+ +SY+AER VG+GSFGVV+QAKCLETGE VAIKKVLQDKRYKNRE
Sbjct  66    IIATTVGGQDGQPKQTISYVAERMVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRYKNRE  125

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH-HMPTLY  917
             LQ+MR+ DHPNVVQ KH FYSTT+K+E+YLNLV+EY+ ETV+RVSRH++RMNH HMP +Y
Sbjct  126   LQVMRLLDHPNVVQLKHCFYSTTEKDELYLNLVLEYISETVHRVSRHFNRMNHQHMPIIY  185

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICRAL+Y+H+V+GVCHRDIKP NLLVN
Sbjct  186   VQLYTYQICRALNYLHHVLGVCHRDIKPHNLLVN  219



>ref|XP_010419626.1| PREDICTED: shaggy-related protein kinase theta-like [Camelina 
sativa]
Length=305

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = +3

Query  402   QPVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVG  581
              P+S +PV +            R     D N   ++K+ME ++V+G GTE GQ+I TTVG
Sbjct  74    HPLSDKPVDDHHHQLPEVMTDMRIRD--DRNAHRDDKEMETTIVNGSGTETGQVITTTVG  131

Query  582   GSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMF  761
             G +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQIMR+ 
Sbjct  132   GRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQIMRLQ  191

Query  762   DHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQI  941
             DHPNVV+ +HSF+STTDK+E+YLNLV+EYVPETVYR S+HY+++N HMP ++VQLY YQI
Sbjct  192   DHPNVVRLRHSFFSTTDKDELYLNLVLEYVPETVYRASKHYTKINQHMPIIFVQLYTYQI  251

Query  942   CRALSYIHNVIGVCHRDIKPQNLLVN  1019
             CRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  252   CRALNYLHRVVGVCHRDIKPQNLLVN  277



>ref|XP_008232743.1| PREDICTED: shaggy-related protein kinase theta-like [Prunus mume]
Length=474

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 170/220 (77%), Gaps = 15/220 (7%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDN------------NEQDNN---KDMEPSVVSG  539
             P S E V    D ++     A+ EKS  +            +E+ NN   KDME +V++G
Sbjct  60    PTSLETVASTSDVSSIAKTEAKEEKSSYDQLPKEMNEMKIRDEKANNHDEKDMEETVING  119

Query  540   KGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQD  719
              GTE G II TTVGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLET + VAIKKVLQD
Sbjct  120   NGTETGHIIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETSDAVAIKKVLQD  179

Query  720   KRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH  899
             KRYKNRELQIMR+ DHPNVVQ KH F+STTDK+E+YLNLV+EY+ ETVYRVS+HY RMN 
Sbjct  180   KRYKNRELQIMRLLDHPNVVQLKHCFFSTTDKDELYLNLVLEYISETVYRVSKHYIRMNQ  239

Query  900   HMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             H+P +YVQLY YQICRAL+Y+H+VIGVCHRDIKPQNLLVN
Sbjct  240   HIPIIYVQLYTYQICRALNYLHHVIGVCHRDIKPQNLLVN  279



>ref|XP_004144981.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis 
sativus]
 ref|XP_004153803.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis 
sativus]
 gb|KGN46198.1| hypothetical protein Csa_6G074020 [Cucumis sativus]
Length=469

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 162/274 (59%), Positives = 193/274 (70%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpa-IRKGKDEQGVDQPVSG--------------EPVL  428
             M+++RR KSIAS  +S S   G    I++ K +Q  +Q V G              +   
Sbjct  1     MNMMRRLKSIASGRTSISSDPGGDFGIKRAKVDQETEQKVGGVSDDVGRAASGLGLDSSS  60

Query  429   EEQDNTASTSNV---ARPEKSG--------------DNNEQDNNKDMEPSVVSGKGTEPG  557
                DN ASTSN+   A  EKSG              D     + KD+EP+VV+G GTE G
Sbjct  61    SSLDNVASTSNISSIAGAEKSGFDHLPREMREMRIKDEKSNHDEKDLEPAVVNGNGTEAG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QII TTVGG NG+PK+ +SYMAER VG+GSFGVVFQAKCLET E VAIKKVLQDKRYKNR
Sbjct  121   QIIATTVGGRNGKPKQTISYMAERVVGTGSFGVVFQAKCLETNEAVAIKKVLQDKRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIMRM DH N+VQ KH F+STTDK+E+YLNLV+EY+ ETVY+VS+HY RMN  MP +Y
Sbjct  181   ELQIMRMLDHSNIVQLKHCFFSTTDKDELYLNLVLEYISETVYKVSKHYIRMNRSMPIIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  274



>emb|CDX74346.1| BnaA03g27010D [Brassica napus]
Length=468

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 157/268 (59%), Positives = 195/268 (73%), Gaps = 26/268 (10%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpg-gdpaIRKGKDEQGVDQPVSG--EPV-------LEEQDN  443
             M+V+RR KSIAS  +S S     D ++++ K +Q  D   SG  +P+       +  QD+
Sbjct  1     MNVMRRLKSIASGRTSISSDPGVDSSLKRPKLDQDNDYLSSGGDDPMQVDQTTDMVSQDS  60

Query  444   TASTSNVARP----------------EKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTT  575
              A TSNV  P                E    N   + +KDMEP +V+G GTE GQ+I TT
Sbjct  61    VAGTSNVPPPADQLPEVMNDMRLREEEPPHANRRGEEDKDMEPPIVNGCGTETGQVITTT  120

Query  576   VGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMR  755
             VGG +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQIMR
Sbjct  121   VGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQIMR  180

Query  756   MFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIY  935
             + DHPNVV+ +HSF+STTDK+E+YLNLV+E+VPETVYR  +HY++MN HMP + VQLY Y
Sbjct  181   LQDHPNVVRLRHSFFSTTDKDELYLNLVLEFVPETVYRALKHYTKMNQHMPIILVQLYTY  240

Query  936   QICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             QICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  241   QICRALNYLHRVVGVCHRDIKPQNLLVN  268



>ref|XP_010540275.1| PREDICTED: shaggy-related protein kinase theta-like [Tarenaya 
hassleriana]
Length=467

 Score =   296 bits (759),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 161/273 (59%), Positives = 202/273 (74%), Gaps = 32/273 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpa-IRKGKDEQGVDQPVSGEPV--------LEE----  434
             M+V+RR KSIAS  +S S   G    +++ K +Q ++Q + GEP+        LE+    
Sbjct  1     MNVMRRLKSIASGRTSISSXQGGDYGLKRVKVDQEIEQ-ICGEPMQVDQNDTDLEQNPAG  59

Query  435   --QDNTASTSN-VARPEKSG------------DNNEQDNN---KDMEPSVVSGKGTEPGQ  560
               Q+N A TSN  A  EKS               +E+ NN   KDME ++++G GTE GQ
Sbjct  60    TLQENVAGTSNDPAAAEKSTYEQLPDAMQETRTRDERHNNHDEKDMETTIINGSGTETGQ  119

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             +I TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRE
Sbjct  120   VITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRE  179

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYV  920
             LQIMR+ DHPNVV+ +HSF STT+K+E+YLNLV+EYVPETVYR S+HY++MN HMP +YV
Sbjct  180   LQIMRVLDHPNVVRLRHSFLSTTEKDELYLNLVLEYVPETVYRASKHYTKMNQHMPIIYV  239

Query  921   QLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             QLY YQICRAL+Y+H V+GVCHRDIKPQNLLV+
Sbjct  240   QLYTYQICRALNYLHRVVGVCHRDIKPQNLLVS  272



>dbj|BAD95891.1| Ser/Thr protein kinase [Lotus japonicus]
Length=467

 Score =   296 bits (759),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 177/230 (77%), Gaps = 22/230 (10%)
 Frame = +3

Query  378   GKD-EQGVDQPVSGEPVLEEQDNTASTSNVARPEKSG---------------DNNEQDNN  509
             GKD EQ VD   S E  +     T+  S VA+ EKSG               + ++ +N 
Sbjct  49    GKDQEQHVD--ASKESTV----GTSDVSTVAKTEKSGFDELPKELHEMKIKDEKSKNNNE  102

Query  510   KDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGE  689
             KD+E S+VSG GTE GQII T +GG +GQPK+ +SYMAER VG+GSFGVVFQAKCLETGE
Sbjct  103   KDIEASIVSGNGTETGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGVVFQAKCLETGE  162

Query  690   TVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYR  869
              VAIKKVLQDKRYKNRELQ+MR  DHPN+V+ KH F+STTDK+E+YLNLV+E+VPETVY+
Sbjct  163   AVAIKKVLQDKRYKNRELQVMRTVDHPNIVKLKHCFFSTTDKDELYLNLVLEFVPETVYK  222

Query  870   VSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VS+ Y R++ HMP +YVQLYIYQICRAL+Y+H VIGVCHRDIKPQNLLVN
Sbjct  223   VSKQYIRVHQHMPIIYVQLYIYQICRALNYLHQVIGVCHRDIKPQNLLVN  272



>ref|XP_008344049.1| PREDICTED: shaggy-related protein kinase epsilon-like [Malus 
domestica]
Length=460

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++KDME ++++G GTE G II TTVGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLE+
Sbjct  94    DDKDMEETIINGNGTETGHIIATTVGGQNGQPKQTISYMAERVVGTGSFGVVFQAKCLES  153

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GE VAIKKVLQDKRYKNRELQIMR+ DHPNVVQ KH F+STTDK+E+YLNLV+EY+ ETV
Sbjct  154   GEAVAIKKVLQDKRYKNRELQIMRLLDHPNVVQLKHCFFSTTDKDELYLNLVLEYISETV  213

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRVS+HY RMN H+P +YVQLY YQICRAL+Y+H+VIGVCHRDIKPQNLLVN
Sbjct  214   YRVSKHYIRMNQHIPIIYVQLYTYQICRALNYLHHVIGVCHRDIKPQNLLVN  265



>ref|XP_008383272.1| PREDICTED: shaggy-related protein kinase theta [Malus domestica]
Length=474

 Score =   296 bits (759),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++KDME ++++G GTE G II TTVGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLE+
Sbjct  108   DDKDMEETIINGNGTETGHIIATTVGGQNGQPKQTISYMAERVVGTGSFGVVFQAKCLES  167

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GE VAIKKVLQDKRYKNRELQIMR+ DHPNVVQ KH F+STTDK+E+YLNLV+EY+ ETV
Sbjct  168   GEAVAIKKVLQDKRYKNRELQIMRLLDHPNVVQLKHCFFSTTDKDELYLNLVLEYISETV  227

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRVS+HY RMN H+P +YVQLY YQICRAL+Y+H+VIGVCHRDIKPQNLLVN
Sbjct  228   YRVSKHYIRMNQHIPIIYVQLYTYQICRALNYLHHVIGVCHRDIKPQNLLVN  279



>ref|XP_004148581.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Cucumis 
sativus]
 ref|XP_004163975.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Cucumis 
sativus]
Length=409

 Score =   294 bits (753),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             VS  P    +D+  ST  V R P++  D   +D+ K++E +VV G GTE G IIVTT+GG
Sbjct  4     VSVAPASMIRDHGGSTIGVDRLPDEMNDMKIRDD-KEIEATVVDGNGTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAERAVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    KNGQPKQTISYMAERAVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY YQIC
Sbjct  123   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKMNQRMPLIYVKLYFYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RALSYIHN IGVCHRDIKPQNLLVN
Sbjct  183   RALSYIHNSIGVCHRDIKPQNLLVN  207



>ref|XP_009134534.1| PREDICTED: shaggy-related protein kinase theta [Brassica rapa]
Length=468

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/268 (59%), Positives = 194/268 (72%), Gaps = 26/268 (10%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpg-gdpaIRKGKDEQGVDQPVSG--EPV-------LEEQDN  443
             M+V+RR KSIAS  +S S     D ++++ K +Q  D   SG  +P+       +  QD+
Sbjct  1     MNVMRRLKSIASGRTSISSDPGVDSSLKRPKLDQDNDYLSSGGDDPMQVDQTTDMVSQDS  60

Query  444   TASTSNVARP----------------EKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTT  575
              A TSNV  P                E    N     +KDMEP +V+G GTE GQ+I TT
Sbjct  61    VAGTSNVPPPADQLPEVMNDMRLREEEPPHANRRGHEDKDMEPPIVNGCGTETGQVITTT  120

Query  576   VGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMR  755
             VGG +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQIMR
Sbjct  121   VGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQIMR  180

Query  756   MFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIY  935
             + DHPNVV+ +HSF+STTDK+E+YLNLV+E+VPETVYR  +HY++MN HMP + VQLY Y
Sbjct  181   LQDHPNVVRLRHSFFSTTDKDELYLNLVLEFVPETVYRALKHYTKMNQHMPIILVQLYTY  240

Query  936   QICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             QICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  241   QICRALNYLHRVVGVCHRDIKPQNLLVN  268



>ref|XP_004168158.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis 
sativus]
Length=469

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/274 (59%), Positives = 193/274 (70%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpa-IRKGKDEQGVDQPVSG--------------EPVL  428
             M+++RR KSIAS  +S S   G    I++ K +Q  +Q V G              +   
Sbjct  1     MNMMRRLKSIASGRTSISSDPGGDFGIKRAKVDQETEQKVGGVSDDVGRAASGLGLDSSS  60

Query  429   EEQDNTASTSNV---ARPEKSG--------------DNNEQDNNKDMEPSVVSGKGTEPG  557
                DN ASTSN+   A  EKSG              D     + KD+EP+VV+G GTE G
Sbjct  61    SSLDNVASTSNISSIAGAEKSGFDHLPREMREMRIKDEKSNHDEKDLEPAVVNGNGTEAG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QII TTVGG NG+PK+ +SYMAER VG+GSFGVVFQAKCLET E VAIKKVLQDKRYKNR
Sbjct  121   QIIATTVGGRNGKPKQTISYMAERVVGTGSFGVVFQAKCLETNEAVAIKKVLQDKRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIMRM +H N+VQ KH F+STTDK+E+YLNLV+EY+ ETVY+VS+HY RMN  MP +Y
Sbjct  181   ELQIMRMLEHSNIVQLKHCFFSTTDKDELYLNLVLEYISETVYKVSKHYIRMNRSMPIIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  274



>gb|KCW78018.1| hypothetical protein EUGRSUZ_D02249 [Eucalyptus grandis]
Length=409

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D+    ++KD EP+V++G GTE G II TTVGG +GQPK+ +SYMAER VG+GSFGVVFQ
Sbjct  37    DDKAFHDDKDCEPAVINGHGTETGHIITTTVGGRDGQPKQTISYMAERVVGTGSFGVVFQ  96

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKCLETGETVAIKKVLQDKRYKNRELQIMR+ DHPNVV  KH F+STT+K+EVYLNLV+E
Sbjct  97    AKCLETGETVAIKKVLQDKRYKNRELQIMRILDHPNVVLLKHCFFSTTEKDEVYLNLVLE  156

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             Y+ ETVYR S+HY RMN H+P ++VQLY YQICRAL+Y+HNV+GVCHRDIKPQNLLVN
Sbjct  157   YISETVYRASKHYVRMNQHVPIIFVQLYAYQICRALNYLHNVVGVCHRDIKPQNLLVN  214



>ref|XP_010919259.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Elaeis 
guineensis]
Length=469

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 166/274 (61%), Positives = 196/274 (72%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEE-------QDNT--  446
             M ++RR KSIAS  SS SDPGGDP  ++ K +Q     VS EP L E       Q+ T  
Sbjct  1     MHMMRRLKSIASGRSSISDPGGDPGTKRAKFDQDGAGEVSSEPHLVEDKAVGLDQNMTST  60

Query  447   -----ASTSNVARPEKSGDNN------------------EQDNNKDMEPSVVSGKGTEPG  557
                  ASTSN+  P ++ D                    E  N KD E ++VSG GTE G
Sbjct  61    HLHLDASTSNMDPPARTEDAAVDQLPKEMHEMTIKDDKVEDHNEKDTEGTMVSGNGTERG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QII TT+GG NGQPK+ +SYMAER VG+GSFG+VFQAKC+ETGETVAIKKVLQDKRYKNR
Sbjct  121   QIIATTIGGRNGQPKQTISYMAERVVGTGSFGIVFQAKCVETGETVAIKKVLQDKRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIM + DHPNVVQ KH F+STTD +EVYLNLV+EYV ETVYR+ ++Y+RMN  MP +Y
Sbjct  181   ELQIMHLLDHPNVVQLKHYFFSTTDNDEVYLNLVLEYVSETVYRICKYYTRMNQRMPLIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +QLY YQICRALSYIH+V+G+CHRDIKPQNLLVN
Sbjct  241   IQLYTYQICRALSYIHHVVGICHRDIKPQNLLVN  274



>ref|XP_006289072.1| hypothetical protein CARUB_v10002475mg [Capsella rubella]
 gb|EOA21970.1| hypothetical protein CARUB_v10002475mg [Capsella rubella]
Length=469

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 178/228 (78%), Gaps = 16/228 (7%)
 Frame = +3

Query  384   DEQGVDQPVSGEPVLEEQDNTASTSNVARPEKSGDN-------------NEQDNN---KD  515
             D   VDQ  S   +L ++    +++  A  EK+ D+             +E++ N   KD
Sbjct  42    DPMQVDQTSSSFDILPKESVAGTSNGHAVSEKTVDDHQLPEVMTDMRIRDERNANREEKD  101

Query  516   MEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETV  695
             ME ++V+G GTE GQ+I TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE V
Sbjct  102   METTIVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQV  161

Query  696   AIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVS  875
             AIKKVLQDKRYKNRELQIMR+ DHPNVV+ +HSF+STTDK+E+YLNLV+EYVPETVYR S
Sbjct  162   AIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEYVPETVYRAS  221

Query  876   RHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +HY++MN HMP +YVQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  222   KHYTKMNQHMPIIYVQLYTYQICRALNYLHRVVGVCHRDIKPQNLLVN  269



>ref|XP_010038314.1| PREDICTED: shaggy-related protein kinase alpha-like [Eucalyptus 
grandis]
 ref|XP_010038315.1| PREDICTED: shaggy-related protein kinase alpha-like [Eucalyptus 
grandis]
 gb|KCW50138.1| hypothetical protein EUGRSUZ_K03568 [Eucalyptus grandis]
Length=409

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             VS  PV   +D T +T    R P++  D   +D  KDME +VV+G G E G IIVTT+GG
Sbjct  4     VSMVPVSGLRDPTGNTVAFDRLPDEMNDMKIRDE-KDMEAAVVNGNGAEAGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAERAVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ +
Sbjct  63    KNGQPKQTISYMAERAVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLE  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY YQIC
Sbjct  123   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKMNQRMPLIYVKLYFYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIHN IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHNCIGVCHRDIKPQNLLVN  207



>ref|XP_010255500.1| PREDICTED: shaggy-related protein kinase theta isoform X3 [Nelumbo 
nucifera]
Length=384

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++ D E ++V+G GTE GQII TT+GG NGQPK+ +SYMAER VG+GSFGVVFQAKC+ET
Sbjct  18    SDPDAEATIVNGNGTEAGQIIATTIGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCVET  77

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GE VAIKKVLQDKRYKNRELQIMR+ DHPNVVQ KH F+STTDK+E+YLNLV+EYV ETV
Sbjct  78    GEAVAIKKVLQDKRYKNRELQIMRLLDHPNVVQLKHCFFSTTDKDELYLNLVLEYVSETV  137

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRV+RHYSRMN  MP +YV+LY YQICRAL+YIH V+GVCHRDIKPQNLLVN
Sbjct  138   YRVTRHYSRMNQQMPLIYVKLYTYQICRALNYIHGVVGVCHRDIKPQNLLVN  189



>ref|XP_006396267.1| hypothetical protein EUTSA_v10028631mg [Eutrema salsugineum]
 gb|ESQ37720.1| hypothetical protein EUTSA_v10028631mg [Eutrema salsugineum]
Length=473

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 170/211 (81%), Gaps = 16/211 (8%)
 Frame = +3

Query  435   QDNTASTSNV-ARPEKSGDN---------------NEQDNNKDMEPSVVSGKGTEPGQII  566
             Q++ A TSNV A  EKS D+               N     KDME ++V+G GTE GQ+I
Sbjct  63    QESVAGTSNVPAVTEKSVDDQLPEVMIEMRIRDERNANREEKDMETTIVNGSGTETGQVI  122

Query  567   VTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ  746
              TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQ
Sbjct  123   TTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQ  182

Query  747   IMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQL  926
             IMR+ DHPNVV+ +HSF+STTDK+E+YLNLV+EYVPETVYR S+HY++MN HMP ++VQL
Sbjct  183   IMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEYVPETVYRASKHYTKMNQHMPIIFVQL  242

Query  927   YIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             Y YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  243   YTYQICRALNYLHRVVGVCHRDIKPQNLLVN  273



>gb|KDO66112.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66113.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66114.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=244

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  510   KDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGE  689
             K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFG+VFQAKCLETGE
Sbjct  58    KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGE  117

Query  690   TVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYR  869
             TVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YLNLV+E+VPETVYR
Sbjct  118   TVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEFVPETVYR  177

Query  870   VSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             V++HYSR +  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  178   VAKHYSRASQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVN  227



>ref|NP_191981.1| Shaggy-related protein kinase theta [Arabidopsis thaliana]
 sp|Q96287.3|KSG8_ARATH RecName: Full=Shaggy-related protein kinase theta; AltName: Full=ASK-theta 
[Arabidopsis thaliana]
 emb|CAA69156.1| Shaggy-like kinase tetha [Arabidopsis thaliana]
 gb|AAC13616.1| protein kinase [Arabidopsis thaliana]
 emb|CAB80881.1| Shaggy related protein kinase tetha [Arabidopsis thaliana]
 gb|AAL32976.1| AT4g00720/F6N23_11 [Arabidopsis thaliana]
 gb|AAM70590.1| AT4g00720/F6N23_11 [Arabidopsis thaliana]
 dbj|BAE98364.1| Shaggy related protein kinase theta [Arabidopsis thaliana]
 gb|AEE81925.1| Shaggy-related protein kinase theta [Arabidopsis thaliana]
Length=472

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 170/211 (81%), Gaps = 16/211 (8%)
 Frame = +3

Query  435   QDNTASTSNV-ARPEKSGDN---------------NEQDNNKDMEPSVVSGKGTEPGQII  566
             Q++ A TSNV A  EK  D+               N    +KDME +VV+G GTE GQ+I
Sbjct  62    QESVAGTSNVPAVSEKPVDDQLPDVMIEMKIRDERNANREDKDMETTVVNGSGTETGQVI  121

Query  567   VTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ  746
              TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQ
Sbjct  122   TTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQ  181

Query  747   IMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQL  926
             IMR+ DHPNVV+ +HSF+STTDK+E+YLNLV+EYVPETVYR S+HY++MN HMP ++VQL
Sbjct  182   IMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEYVPETVYRASKHYTKMNQHMPIIFVQL  241

Query  927   YIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             Y YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  242   YTYQICRALNYLHRVVGVCHRDIKPQNLLVN  272



>ref|XP_007139956.1| hypothetical protein PHAVU_008G072800g [Phaseolus vulgaris]
 gb|ESW11950.1| hypothetical protein PHAVU_008G072800g [Phaseolus vulgaris]
Length=466

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/271 (59%), Positives = 196/271 (72%), Gaps = 29/271 (11%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpg-gdpaIRKGKDEQGVDQPVSGEPVL-------EEQDNTA  449
             M+++RR KSIAS  +S S     D   ++ K +QG ++ V+ E          +EQ   A
Sbjct  1     MNMMRRLKSIASGRTSVSSDPGSDFTTKRPKFDQGTEEKVNEETYSNEKCGKDQEQYGDA  60

Query  450   ST----SNVA--RPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQII  566
             ST    SNVA  R EKSG               D  + +N KDME ++V+G GTE GQII
Sbjct  61    STESDHSNVATARSEKSGYDQLPKELNEMKIGDDKGKNNNEKDMEATIVNGNGTETGQII  120

Query  567   VTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ  746
              T +GG +GQPKR +SYMAER VG+GSFGVV+QAKC+ETGE VAIKKVLQDKRYKNRELQ
Sbjct  121   TTAIGGRDGQPKRTISYMAERVVGTGSFGVVYQAKCIETGEAVAIKKVLQDKRYKNRELQ  180

Query  747   IMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQL  926
             +MR+ DH NV++ KH FYS  +K+E+YLNLV+EYVPETVYRVS+HY RM+ HMP +YVQL
Sbjct  181   VMRILDHANVLRLKHCFYSAAEKDELYLNLVLEYVPETVYRVSKHYIRMHQHMPIIYVQL  240

Query  927   YIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             Y+YQICR L+Y+H+VIGVCHRDIKPQNLLVN
Sbjct  241   YLYQICRGLNYLHHVIGVCHRDIKPQNLLVN  271



>gb|KDO66115.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=243

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  510   KDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGE  689
             K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFG+VFQAKCLETGE
Sbjct  58    KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGE  117

Query  690   TVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYR  869
             TVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YLNLV+E+VPETVYR
Sbjct  118   TVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEFVPETVYR  177

Query  870   VSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             V++HYSR +  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  178   VAKHYSRASQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVN  227



>gb|KHG20282.1| Shaggy-related protein kinase theta [Gossypium arboreum]
Length=395

 Score =   292 bits (748),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = +3

Query  435   QDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             Q+  ASTS V    +  +        +M+ +V++G GTE GQII TTVGG NGQPK+ +S
Sbjct  6     QETVASTSRVPSVARQQNLGVDQLPNEMQATVINGNGTETGQIISTTVGGQNGQPKQTMS  65

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             Y+AER VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQIMR+ DHPNVV+ KHS
Sbjct  66    YLAERVVGTGSFGVVFQAKCLETGEPVAIKKVLQDKRYKNRELQIMRVLDHPNVVRLKHS  125

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+S+T+K+E+YLNLV+EYVPETV+RVS+++SRMN HMP LYVQLY YQICRAL+Y+H+VI
Sbjct  126   FFSSTEKDELYLNLVLEYVPETVHRVSKYHSRMNQHMPILYVQLYTYQICRALNYLHHVI  185

Query  975   GVCHRDIKPQNLLV  1016
             GVCHRDIKPQNLLV
Sbjct  186   GVCHRDIKPQNLLV  199



>ref|XP_002872933.1| hypothetical protein ARALYDRAFT_490498 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49192.1| hypothetical protein ARALYDRAFT_490498 [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   295 bits (754),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 160/273 (59%), Positives = 200/273 (73%), Gaps = 32/273 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpgg-dpaIRKGKDEQGVDQPVSGEPVLEEQDNT--------  446
             M+V+RR KSIAS  +S S   G D A+++ K +Q  D  +  +P+  +Q+++        
Sbjct  1     MNVMRRLKSIASGRTSISSDPGGDYALKRAKLDQENDN-LCADPMQVDQNSSCFEMKADI  59

Query  447   ------ASTSNV-ARPEKSGDN---------------NEQDNNKDMEPSVVSGKGTEPGQ  560
                   A TSNV A  EK+ D+               N     KDME +VV+G GTE GQ
Sbjct  60    LSHESVAGTSNVPAASEKTVDDQLPEVMIDMRIRDERNANREEKDMETTVVNGSGTETGQ  119

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             +I TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRE
Sbjct  120   VITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRE  179

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYV  920
             LQIMR+ DHPNVV+ +HSF+STTDK+E+YLNLV+EYVPETVYR S+HY++MN HMP ++V
Sbjct  180   LQIMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEYVPETVYRASKHYTKMNQHMPIIFV  239

Query  921   QLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             QLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  240   QLYTYQICRALNYLHRVVGVCHRDIKPQNLLVN  272



>ref|XP_007218957.1| hypothetical protein PRUPE_ppa003552mg [Prunus persica]
 gb|EMJ20156.1| hypothetical protein PRUPE_ppa003552mg [Prunus persica]
Length=566

 Score =   297 bits (761),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 170/220 (77%), Gaps = 15/220 (7%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDN------------NEQDNN---KDMEPSVVSG  539
             P S E V    D ++     A+ EKS  +            +E+ NN   KDME +V++G
Sbjct  152   PTSLETVASTSDVSSIAKTEAKEEKSSYDQLPKEMNEMKIRDEKANNHDEKDMEETVING  211

Query  540   KGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQD  719
              GTE G II TTVGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLET + VAIKKVLQD
Sbjct  212   NGTETGHIIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETSDAVAIKKVLQD  271

Query  720   KRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH  899
             KRYKNRELQIMR+ DHPNVVQ KH F+STTDK+E+YLNLV+EY+ ETVYRVS+HY RMN 
Sbjct  272   KRYKNRELQIMRLLDHPNVVQLKHCFFSTTDKDELYLNLVLEYISETVYRVSKHYIRMNQ  331

Query  900   HMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             H+P +YVQLY YQICRAL+Y+H+VIGVCHRDIKPQNLLVN
Sbjct  332   HIPIIYVQLYTYQICRALNYLHHVIGVCHRDIKPQNLLVN  371



>ref|XP_010671733.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=469

 Score =   294 bits (753),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 197/274 (72%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEP-----------------  422
             M+V+RR KSIAS  +S SDPGGD + ++ K EQ  +   + E                  
Sbjct  1     MNVMRRLKSIASGRTSISDPGGDCSTKRAKVEQETEGSFTDESHPDERCTTEVEQHVAST  60

Query  423   VLEEQDNTASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPG  557
              +E+  +T+  S++ R +K+                +  ++ ++KDME + VSG GTE G
Sbjct  61    SMEQISSTSDVSSIDRTQKADYDKLPTEMHGMKIQENKADKGDDKDMEAAFVSGSGTEAG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QII TT+GG NGQPK+ +SYMAER VG+GSFGVVFQAKCLE GE VAIKKVLQDKRYKNR
Sbjct  121   QIITTTMGGRNGQPKQTVSYMAERVVGTGSFGVVFQAKCLENGEQVAIKKVLQDKRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             EL IMR+ +HPNVV  KH FYSTT+K+EVYLNLV+EYVPET+YRV + +SRMN HMPT+Y
Sbjct  181   ELSIMRLLEHPNVVLLKHCFYSTTEKDEVYLNLVLEYVPETIYRVLKQHSRMNQHMPTIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICR+L+Y+HNVIGVCHRDIKPQN+LVN
Sbjct  241   VQLYTYQICRSLNYLHNVIGVCHRDIKPQNILVN  274



>ref|XP_009111468.1| PREDICTED: shaggy-related protein kinase theta [Brassica rapa]
Length=476

 Score =   294 bits (753),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 173/234 (74%), Gaps = 20/234 (9%)
 Frame = +3

Query  378   GKDEQGVDQPVSGEPVLEEQDNT--------ASTSNVARPEKSGDN------------NE  497
             G D   VDQ  S      E  NT        A TSNV  P  +  N            N 
Sbjct  43    GDDPMQVDQTSSSSSSSREMRNTDMVSQECVAGTSNVPPPAAATVNDQLPEVMIRDERNA  102

Query  498   QDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCL  677
                +KDMEP+VV+G GTE GQ+I TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQAKCL
Sbjct  103   NREDKDMEPTVVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCL  162

Query  678   ETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPE  857
             ETGE VAIKKVLQDKRYKNRELQIMR+ DHPNVV+ +HSF+STT+K+E+YLNLV+E+VPE
Sbjct  163   ETGEQVAIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHSFFSTTEKDELYLNLVLEFVPE  222

Query  858   TVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             TVYR  +HY++MN HMP + VQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  223   TVYRALKHYTKMNQHMPIILVQLYTYQICRALNYLHRVVGVCHRDIKPQNLLVN  276



>ref|XP_010660897.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Vitis 
vinifera]
Length=393

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 157/185 (85%), Gaps = 2/185 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDN--NKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSG  644
             PE+  +   +D+   K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG G
Sbjct  7     PEEINEMKIRDDKVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQG  66

Query  645   SFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEV  824
             SFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPN+V  KH F+STTDK+E+
Sbjct  67    SFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNIVSLKHCFFSTTDKDEL  126

Query  825   YLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQ  1004
             YLNLV+EYVPETVYRV++HYSR N  MP +YV+LY YQICRAL+YIH V+GVCHRDIKPQ
Sbjct  127   YLNLVLEYVPETVYRVAKHYSRANQRMPLIYVKLYTYQICRALAYIHGVVGVCHRDIKPQ  186

Query  1005  NLLVN  1019
             NLLVN
Sbjct  187   NLLVN  191



>ref|XP_010053665.1| PREDICTED: shaggy-related protein kinase epsilon [Eucalyptus 
grandis]
 gb|KCW78017.1| hypothetical protein EUGRSUZ_D02249 [Eucalyptus grandis]
Length=468

 Score =   294 bits (752),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D+    ++KD EP+V++G GTE G II TTVGG +GQPK+ +SYMAER VG+GSFGVVFQ
Sbjct  96    DDKAFHDDKDCEPAVINGHGTETGHIITTTVGGRDGQPKQTISYMAERVVGTGSFGVVFQ  155

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKCLETGETVAIKKVLQDKRYKNRELQIMR+ DHPNVV  KH F+STT+K+EVYLNLV+E
Sbjct  156   AKCLETGETVAIKKVLQDKRYKNRELQIMRILDHPNVVLLKHCFFSTTEKDEVYLNLVLE  215

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             Y+ ETVYR S+HY RMN H+P ++VQLY YQICRAL+Y+HNV+GVCHRDIKPQNLLVN
Sbjct  216   YISETVYRASKHYVRMNQHVPIIFVQLYAYQICRALNYLHNVVGVCHRDIKPQNLLVN  273



>ref|XP_008385705.1| PREDICTED: shaggy-related protein kinase theta-like [Malus domestica]
Length=474

 Score =   294 bits (752),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++KDME ++++G GTE G II T VGG NGQPK+ +SYMAER VG+GSFGVVFQAKCLET
Sbjct  108   DDKDMEETIINGNGTETGHIIATKVGGQNGQPKQTISYMAERVVGTGSFGVVFQAKCLET  167

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GE VAIKKVLQDKRYKNRELQIMR  DHPNVVQ KH F+STTDK+E+YLNLV+EY+ ETV
Sbjct  168   GEAVAIKKVLQDKRYKNRELQIMRFLDHPNVVQLKHCFFSTTDKDELYLNLVLEYISETV  227

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRVS+HY RMN H+P +YVQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  228   YRVSKHYIRMNQHIPIIYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  279



>ref|XP_010919260.1| PREDICTED: shaggy-related protein kinase NtK-1 isoform X2 [Elaeis 
guineensis]
Length=403

 Score =   291 bits (746),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 194/272 (71%), Gaps = 32/272 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEE-------QDNT--  446
             M ++RR KSIAS  SS SDPGGDP  ++ K +Q     VS EP L E       Q+ T  
Sbjct  1     MHMMRRLKSIASGRSSISDPGGDPGTKRAKFDQDGAGEVSSEPHLVEDKAVGLDQNMTST  60

Query  447   -----ASTSNVARPEKSGDNN------------------EQDNNKDMEPSVVSGKGTEPG  557
                  ASTSN+  P ++ D                    E  N KD E ++VSG GTE G
Sbjct  61    HLHLDASTSNMDPPARTEDAAVDQLPKEMHEMTIKDDKVEDHNEKDTEGTMVSGNGTERG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QII TT+GG NGQPK+ +SYMAER VG+GSFG+VFQAKC+ETGETVAIKKVLQDKRYKNR
Sbjct  121   QIIATTIGGRNGQPKQTISYMAERVVGTGSFGIVFQAKCVETGETVAIKKVLQDKRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIM + DHPNVVQ KH F+STTD +EVYLNLV+EYV ETVYR+ ++Y+RMN  MP +Y
Sbjct  181   ELQIMHLLDHPNVVQLKHYFFSTTDNDEVYLNLVLEYVSETVYRICKYYTRMNQRMPLIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLL  1013
             +QLY YQICRALSYIH+V+G+CHRDIKPQNLL
Sbjct  241   IQLYTYQICRALSYIHHVVGICHRDIKPQNLL  272



>ref|XP_009334099.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
 ref|XP_009334100.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
 ref|XP_009334101.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
Length=410

 Score =   292 bits (747),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 156/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D  K++E +VV+G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  27    PEEINDMKIKDE-KEIEAAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSF  85

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             G+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YL
Sbjct  86    GIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYL  145

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETVYRVS+HYS+ N  MP LYV+LY YQICRAL+YIH  IGVCHRDIKPQNL
Sbjct  146   NLVLEYVPETVYRVSKHYSKANQRMPMLYVKLYTYQICRALAYIHGGIGVCHRDIKPQNL  205

Query  1011  LVN  1019
             LVN
Sbjct  206   LVN  208



>gb|KDP28680.1| hypothetical protein JCGZ_14451 [Jatropha curcas]
Length=474

 Score =   294 bits (752),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 157/276 (57%), Positives = 199/276 (72%), Gaps = 34/276 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKG-KDEQGVDQPVSGEPVLEEQ-----------  437
             M+V+RR KSIAS  +S S   G  ++ K  K +Q  D  + GE + +E+           
Sbjct  1     MNVMRRLKSIASGRTSISSDPGGDSLTKRVKVDQDTDHKIDGELIQDERSATGMEQHMAS  60

Query  438   ---DNTASTSN---VARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEP  554
                +N ASTS+   + R EKSG               + N   + KDME ++VSG GTE 
Sbjct  61    TSLENAASTSDATSMTRTEKSGYDQLPKEMREMKIRDEKNANHDEKDMEAAIVSGNGTET  120

Query  555   GQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKN  734
             GQII TTVGG NG+PK+ +S+MAER VG+GSFGVV+QAKCLE+GE VAIKKVLQD+RYKN
Sbjct  121   GQIIATTVGGRNGKPKQTISFMAERVVGTGSFGVVYQAKCLESGEAVAIKKVLQDRRYKN  180

Query  735   RELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNH-HMPT  911
             RELQIMR+ +HPNVV+ KH F+STT+K E+YLNLV+EY+PETV+RVSR Y++MNH +MP 
Sbjct  181   RELQIMRLLNHPNVVELKHCFFSTTEKEELYLNLVLEYIPETVHRVSRQYNKMNHQNMPF  240

Query  912   LYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +YVQLY YQICR L+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  241   IYVQLYTYQICRGLNYLHHVVGVCHRDIKPQNLLVN  276



>ref|XP_010660896.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Vitis 
vinifera]
 emb|CBI34900.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   292 bits (747),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 157/185 (85%), Gaps = 2/185 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDN--NKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSG  644
             PE+  +   +D+   K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG G
Sbjct  26    PEEINEMKIRDDKVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQG  85

Query  645   SFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEV  824
             SFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPN+V  KH F+STTDK+E+
Sbjct  86    SFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNIVSLKHCFFSTTDKDEL  145

Query  825   YLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQ  1004
             YLNLV+EYVPETVYRV++HYSR N  MP +YV+LY YQICRAL+YIH V+GVCHRDIKPQ
Sbjct  146   YLNLVLEYVPETVYRVAKHYSRANQRMPLIYVKLYTYQICRALAYIHGVVGVCHRDIKPQ  205

Query  1005  NLLVN  1019
             NLLVN
Sbjct  206   NLLVN  210



>gb|KFK30649.1| hypothetical protein AALP_AA6G009500 [Arabis alpina]
Length=471

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/270 (59%), Positives = 195/270 (72%), Gaps = 28/270 (10%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpa-IRKGKDEQGVDQPVSGEPV-----------LEEQ  437
             M+V+RR KSIAS  +S S   G    +++ K +Q  +   S +P+           +  Q
Sbjct  1     MNVMRRLKSIASGRTSISSDPGGDYGLKRAKLDQENESSSSSDPMQVDQNSEMKTEMVSQ  60

Query  438   DNTASTSNVA--------RPEKSGD-------NNEQDNNKDMEPS-VVSGKGTEPGQIIV  569
             ++ A TSNV          PE   D       NN     KDME + VV+G GTE GQ+I 
Sbjct  61    ESVAGTSNVPVVANVDDQLPEVMIDMRIRDERNNANREEKDMETTTVVNGSGTETGQVIT  120

Query  570   TTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQI  749
             TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQI
Sbjct  121   TTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQI  180

Query  750   MRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLY  929
             MR+ DHPNVV+ +HSF+STTDK+E+YLNLV+EYVPETVYR S+HY++MN HMP ++VQLY
Sbjct  181   MRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEYVPETVYRASKHYTKMNQHMPIIFVQLY  240

Query  930   IYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
              YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  241   TYQICRALNYLHRVVGVCHRDIKPQNLLVN  270



>ref|XP_001763270.1| predicted protein [Physcomitrella patens]
 gb|AAQ23106.1| shaggy-related protein kinase 1 [Physcomitrella patens]
 gb|EDQ71800.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +3

Query  495   EQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKC  674
             +  ++K++E SVV+G GTE G II TT+GG NGQPK+ +SY AER VG+GSFG+VFQAKC
Sbjct  46    DHSDDKEIEASVVAGNGTETGHIIATTIGGRNGQPKQTISYCAERVVGTGSFGIVFQAKC  105

Query  675   LETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVP  854
             +ET ETVAIKKVLQDKRYKNRELQIMR+FDHPN+V  KH F+STTDK+E+YLNLV+EYVP
Sbjct  106   IETAETVAIKKVLQDKRYKNRELQIMRLFDHPNIVALKHCFFSTTDKDELYLNLVLEYVP  165

Query  855   ETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             ETVYR+++HY+RMN  MP LYV+LY YQICR+L+YIHN IGVCHRDIKPQNLLVN
Sbjct  166   ETVYRIAKHYNRMNQRMPLLYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVN  220



>ref|XP_009111716.1| PREDICTED: shaggy-related protein kinase alpha-like [Brassica 
rapa]
Length=406

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGS  587
             V+  PV   +D+T S   +  PE+  D   +D+ K+MEP VV G GTE G IIVTT+GG 
Sbjct  4     VAIPPVHGARDSTTSLDKL--PEEMNDMKLRDD-KEMEPIVVDGNGTETGHIIVTTIGGR  60

Query  588   NGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDH  767
             NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+FDH
Sbjct  61    NGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLFDH  120

Query  768   PNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICR  947
             PNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI R
Sbjct  121   PNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFR  180

Query  948   ALSYIHNVIGVCHRDIKPQNLLVN  1019
             ALSYIH  IGVCHRDIKPQNLLVN
Sbjct  181   ALSYIHRCIGVCHRDIKPQNLLVN  204



>gb|KDO86865.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=296

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  20    PEEMNDMKIRDD-KEMEATVVDGNGTEAGHIIVTTIGGKNGQPKQTISYMAERVVGHGSF  78

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGE VAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  79    GVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  138

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +H+ +M+  MP +YV+LY YQICRAL+YIHN IGVCHRDIKPQNL
Sbjct  139   NLVLEYVPETVHRVIKHHYKMSQRMPLIYVKLYFYQICRALAYIHNTIGVCHRDIKPQNL  198

Query  1011  LVN  1019
             LVN
Sbjct  199   LVN  201



>gb|AAQ23111.1| shaggy-related protein kinase 1 [Physcomitrella patens]
Length=410

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +3

Query  495   EQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKC  674
             +  ++K++E SVV+G GTE G II TT+GG NGQPK+ +SY AER VG+GSFG+VFQAKC
Sbjct  34    DHSDDKEIEASVVAGNGTETGHIIATTIGGRNGQPKQTISYCAERVVGTGSFGIVFQAKC  93

Query  675   LETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVP  854
             +ET ETVAIKKVLQDKRYKNRELQIMR+FDHPN+V  KH F+STTDK+E+YLNLV+EYVP
Sbjct  94    IETAETVAIKKVLQDKRYKNRELQIMRLFDHPNIVALKHCFFSTTDKDELYLNLVLEYVP  153

Query  855   ETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             ETVYR+++HY+RMN  MP LYV+LY YQICR+L+YIHN IGVCHRDIKPQNLLVN
Sbjct  154   ETVYRIAKHYNRMNQRMPLLYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVN  208



>ref|XP_003623822.1| Shaggy-related protein kinase [Medicago truncatula]
 gb|AES80040.1| shaggy-like kinase [Medicago truncatula]
Length=470

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 168/206 (82%), Gaps = 15/206 (7%)
 Frame = +3

Query  447   ASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVG  581
             ++ S VA+ EKSG               D ++ +N KDME +VV+G GTE GQII T++G
Sbjct  70    SNVSAVAKTEKSGFDQLPKELHEMKIKDDKSKNNNEKDMEATVVNGNGTETGQIITTSIG  129

Query  582   GSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMF  761
             G +GQPKR +SYMAER VG+GSFGVV+QAKC+ETGE+VAIKKVLQDKRYKNRELQ+MRM 
Sbjct  130   GRDGQPKRIISYMAERVVGTGSFGVVYQAKCVETGESVAIKKVLQDKRYKNRELQVMRML  189

Query  762   DHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQI  941
             +H NV++ KH FYST +K+EVYLNLV+E+VPETVYRVS+HY RM+ HMP +YVQLY YQI
Sbjct  190   EHTNVLKLKHCFYSTAEKDEVYLNLVLEFVPETVYRVSKHYVRMHQHMPIIYVQLYTYQI  249

Query  942   CRALSYIHNVIGVCHRDIKPQNLLVN  1019
             CR L+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  250   CRGLNYLHHVVGVCHRDIKPQNLLVN  275



>ref|XP_010492276.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
 ref|XP_010492277.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
Length=411

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 160/196 (82%), Gaps = 1/196 (1%)
 Frame = +3

Query  432   EQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             +Q N +  +    PE   +   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +
Sbjct  15    KQSNASICAADKLPEGINEMKIKDD-KEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTI  73

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH
Sbjct  74    SYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKH  133

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+STT+K+E+YLNLV+EYVPETVYRVS+HYSR N  MP +YV+LY YQICRAL+YIH  
Sbjct  134   CFFSTTEKDELYLNLVLEYVPETVYRVSKHYSRANQRMPMIYVKLYTYQICRALAYIHGG  193

Query  972   IGVCHRDIKPQNLLVN  1019
             +GVCHRDIKPQNLLVN
Sbjct  194   VGVCHRDIKPQNLLVN  209



>ref|XP_010550142.1| PREDICTED: shaggy-related protein kinase epsilon [Tarenaya hassleriana]
Length=409

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 158/195 (81%), Gaps = 1/195 (1%)
 Frame = +3

Query  435   QDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             + N AS      PE   D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +S
Sbjct  14    KQNNASLIADKLPEGINDMKIKDD-KEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTIS  72

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFG+VFQAKCLETGE VAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  73    YMAERIVGQGSFGIVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHC  132

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STTDK+E+YLNLV+EYVPETVYRV++HYSR N  MP +YV+LY YQICRAL+YIH  +
Sbjct  133   FFSTTDKDELYLNLVLEYVPETVYRVAKHYSRANQRMPMIYVKLYTYQICRALAYIHGGV  192

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  193   GVCHRDIKPQNLLVN  207



>ref|XP_006399977.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
 gb|ESQ41430.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
Length=409

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 1/198 (1%)
 Frame = +3

Query  426   LEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKR  605
             +  + N AS      PE   +   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+
Sbjct  11    MTTKQNNASICADKLPEGINEMKIKDD-KEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQ  69

Query  606   KLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQK  785
              +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  
Sbjct  70    TISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSL  129

Query  786   KHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIH  965
             KH F+STT+K+E+YLNLV+EYVPETVYRVS+HYSR N  MP +YV+LY YQICRAL+YIH
Sbjct  130   KHCFFSTTEKDELYLNLVLEYVPETVYRVSKHYSRANQRMPMIYVKLYTYQICRALAYIH  189

Query  966   NVIGVCHRDIKPQNLLVN  1019
               +GVCHRDIKPQNLLVN
Sbjct  190   GGVGVCHRDIKPQNLLVN  207



>ref|XP_010420109.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 160/196 (82%), Gaps = 1/196 (1%)
 Frame = +3

Query  432   EQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             +Q N +  +    PE   +   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +
Sbjct  15    KQTNASVCAADKLPEGINEMKIKDD-KEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTI  73

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH
Sbjct  74    SYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKH  133

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+STT+K+E+YLNLV+EYVPETVYRVS+HYSR N  MP +YV+LY YQICRAL+YIH  
Sbjct  134   CFFSTTEKDELYLNLVLEYVPETVYRVSKHYSRANQRMPMIYVKLYTYQICRALAYIHGG  193

Query  972   IGVCHRDIKPQNLLVN  1019
             +GVCHRDIKPQNLLVN
Sbjct  194   VGVCHRDIKPQNLLVN  209



>ref|XP_008381452.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
Length=409

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 165/205 (80%), Gaps = 5/205 (2%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             P SG  + E   N A   N+  P +  D   +D+ K+ME +VV+G GTE G IIVTT+GG
Sbjct  8     PASG--LREPXGNAAGVDNL--PNEMNDMKIRDD-KEMEATVVNGNGTEAGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    KNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPN+V  +H F+STT+K+E+YLNLV+EYVPET +RV +HYS+MN  MP +YV+LY YQIC
Sbjct  123   HPNIVSLRHCFFSTTEKDELYLNLVLEYVPETAHRVIKHYSKMNQRMPHIYVKLYFYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIHN IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHNTIGVCHRDIKPQNLLVN  207



>gb|ABK24355.1| unknown [Picea sitchensis]
Length=370

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  516   MEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETV  695
             ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG+GSFG+VFQAKCLETGETV
Sbjct  1     MEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  696   AIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVS  875
             AIKKVLQDKRYKNRELQ MR+ DHPN+V  KH F+STTDK+E+YLNLV+EYVPETVYRV+
Sbjct  61    AIKKVLQDKRYKNRELQTMRLLDHPNIVCLKHCFFSTTDKDELYLNLVLEYVPETVYRVA  120

Query  876   RHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +HYSRMN  MP LYV+LY YQICRAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  121   KHYSRMNQRMPLLYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVN  168



>ref|XP_010453592.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  +  ++K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFG+VFQ
Sbjct  32    DEMKIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQ  91

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+E
Sbjct  92    AKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLE  151

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YVPETVYRVS+HYSR N  MP +YV+LY YQICRAL+YIH  +GVCHRDIKPQNLLVN
Sbjct  152   YVPETVYRVSKHYSRANQRMPMIYVKLYTYQICRALAYIHGGVGVCHRDIKPQNLLVN  209



>ref|XP_003521276.1| PREDICTED: shaggy-related protein kinase theta [Glycine max]
Length=470

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 167/207 (81%), Gaps = 15/207 (7%)
 Frame = +3

Query  444   TASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTV  578
             T+  S VAR EKSG               + ++ ++ KD+E +VVSG GTE GQII T +
Sbjct  69    TSDVSTVARTEKSGFEELPKELNEMKIRDEKSKNNSEKDIEATVVSGNGTETGQIITTAI  128

Query  579   GGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRM  758
             GG +GQPK+ +SYMAER VG+GSFG+VFQAKCLETGE+VAIKKVLQD+RYKNRELQ+MR 
Sbjct  129   GGRDGQPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYKNRELQVMRT  188

Query  759   FDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQ  938
              D+ NVV+ KH F+STTDK+E+YLNLV+EYVPETVY+VS+HY RM+ HMP +YVQLY YQ
Sbjct  189   VDNSNVVKLKHYFFSTTDKDELYLNLVLEYVPETVYKVSKHYVRMHQHMPIIYVQLYTYQ  248

Query  939   ICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             ICRAL+Y+H VIGVCHRDIKPQNLLVN
Sbjct  249   ICRALNYLHQVIGVCHRDIKPQNLLVN  275



>emb|CAB87631.1| protein kinase MSK-3-like [Arabidopsis thaliana]
Length=408

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 160/198 (81%), Gaps = 1/198 (1%)
 Frame = +3

Query  426   LEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKR  605
             +  + + AS      PE   +   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+
Sbjct  12    MATKQSNASICAEKLPEGINEMKIKDD-KEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQ  70

Query  606   KLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQK  785
              +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  
Sbjct  71    TISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSL  130

Query  786   KHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIH  965
             KH F+STT+K+E+YLNLV+EYVPETVYRVS+HYSR N  MP +YV+LY YQICRAL+YIH
Sbjct  131   KHCFFSTTEKDELYLNLVLEYVPETVYRVSKHYSRANQRMPIIYVKLYTYQICRALAYIH  190

Query  966   NVIGVCHRDIKPQNLLVN  1019
               +GVCHRDIKPQNLLVN
Sbjct  191   GGVGVCHRDIKPQNLLVN  208



>gb|KHN27286.1| Shaggy-related protein kinase theta [Glycine soja]
Length=470

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 167/207 (81%), Gaps = 15/207 (7%)
 Frame = +3

Query  444   TASTSNVARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTV  578
             T+  S VAR EKSG               + ++ ++ KD+E +VVSG GTE GQII T +
Sbjct  69    TSDVSTVARTEKSGFEELPKELNEMKIRDEKSKNNSEKDIEATVVSGNGTETGQIITTAI  128

Query  579   GGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRM  758
             GG +GQPK+ +SYMAER VG+GSFG+VFQAKCLETGE+VAIKKVLQD+RYKNRELQ+MR 
Sbjct  129   GGRDGQPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYKNRELQVMRT  188

Query  759   FDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQ  938
              D+ NVV+ KH F+STTDK+E+YLNLV+EYVPETVY+VS+HY RM+ HMP +YVQLY YQ
Sbjct  189   VDNSNVVKLKHYFFSTTDKDELYLNLVLEYVPETVYKVSKHYVRMHQHMPIIYVQLYTYQ  248

Query  939   ICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             ICRAL+Y+H VIGVCHRDIKPQNLLVN
Sbjct  249   ICRALNYLHQVIGVCHRDIKPQNLLVN  275



>ref|XP_010251221.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X4 [Nelumbo nucifera]
Length=350

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 159/194 (82%), Gaps = 3/194 (2%)
 Frame = +3

Query  438   DNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSY  617
             DN+ S   +  PE+  +   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SY
Sbjct  17    DNSMSVDKL--PEEINEMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISY  73

Query  618   MAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSF  797
             MAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F
Sbjct  74    MAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCF  133

Query  798   YSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIG  977
             +STT+K E+YLNLV+EYVPETVYRV++HYSR N  MP +YV+LY YQICRAL YIH  IG
Sbjct  134   FSTTEKEELYLNLVLEYVPETVYRVAKHYSRANQRMPMIYVKLYTYQICRALLYIHGGIG  193

Query  978   VCHRDIKPQNLLVN  1019
             VCHRDIKPQNLLVN
Sbjct  194   VCHRDIKPQNLLVN  207



>ref|NP_196968.2| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
 sp|Q8VZD5.1|KSG5_ARATH RecName: Full=Shaggy-related protein kinase epsilon; AltName: 
Full=ASK-epsilon [Arabidopsis thaliana]
 gb|AAL57679.1| AT5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AAQ65089.1| At5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AED92057.1| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
Length=410

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 160/198 (81%), Gaps = 1/198 (1%)
 Frame = +3

Query  426   LEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKR  605
             +  + + AS      PE   +   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+
Sbjct  12    MATKQSNASICAEKLPEGINEMKIKDD-KEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQ  70

Query  606   KLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQK  785
              +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  
Sbjct  71    TISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSL  130

Query  786   KHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIH  965
             KH F+STT+K+E+YLNLV+EYVPETVYRVS+HYSR N  MP +YV+LY YQICRAL+YIH
Sbjct  131   KHCFFSTTEKDELYLNLVLEYVPETVYRVSKHYSRANQRMPIIYVKLYTYQICRALAYIH  190

Query  966   NVIGVCHRDIKPQNLLVN  1019
               +GVCHRDIKPQNLLVN
Sbjct  191   GGVGVCHRDIKPQNLLVN  208



>ref|XP_002873682.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49941.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFG+VFQAKCLET
Sbjct  37    DDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLET  96

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV
Sbjct  97    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETV  156

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRVS+HYSR N  MP +YV+LY YQICRAL+YIH  +GVCHRDIKPQNLLVN
Sbjct  157   YRVSKHYSRANQRMPMIYVKLYTYQICRALAYIHGGVGVCHRDIKPQNLLVN  208



>ref|XP_010671741.1| PREDICTED: shaggy-related protein kinase theta isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=384

 Score =   289 bits (739),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 157/188 (84%), Gaps = 1/188 (1%)
 Frame = +3

Query  459   NVARPEKS-GDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAV  635
             NV R  KS        ++ DME + VSG GTE GQII TT+GG NGQPK+ +SYMAER V
Sbjct  2     NVMRRLKSIASGRTSISDPDMEAAFVSGSGTEAGQIITTTMGGRNGQPKQTVSYMAERVV  61

Query  636   GSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDK  815
             G+GSFGVVFQAKCLE GE VAIKKVLQDKRYKNREL IMR+ +HPNVV  KH FYSTT+K
Sbjct  62    GTGSFGVVFQAKCLENGEQVAIKKVLQDKRYKNRELSIMRLLEHPNVVLLKHCFYSTTEK  121

Query  816   NEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDI  995
             +EVYLNLV+EYVPET+YRV + +SRMN HMPT+YVQLY YQICR+L+Y+HNVIGVCHRDI
Sbjct  122   DEVYLNLVLEYVPETIYRVLKQHSRMNQHMPTIYVQLYTYQICRSLNYLHNVIGVCHRDI  181

Query  996   KPQNLLVN  1019
             KPQN+LVN
Sbjct  182   KPQNILVN  189



>gb|AEQ94156.1| shaggy-related protein kinase [Elaeis guineensis]
Length=216

 Score =   283 bits (723),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K++E +V+ G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFGVVFQAKCLET
Sbjct  36    DDKEVEATVIDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLET  95

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV
Sbjct  96    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETV  155

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +RV +HY++MN  +P +YV+LY+YQICRAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  156   HRVVKHYNKMNQRIPLIYVKLYMYQICRALAYIHGSIGVCHRDIKPQNLLVN  207



>ref|XP_008357735.1| PREDICTED: shaggy-related protein kinase epsilon [Malus domestica]
Length=410

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 156/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D  K++E +VV+G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  27    PEEINDMKIKDE-KEIEAAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSF  85

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             G+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YL
Sbjct  86    GIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYL  145

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETVYRVS+HYS+ N  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNL
Sbjct  146   NLVLEYVPETVYRVSKHYSKANQRMPMIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNL  205

Query  1011  LVN  1019
             LVN
Sbjct  206   LVN  208



>gb|AEQ94143.1| putative Glycogen synthase kinase 3 [Elaeis guineensis]
Length=231

 Score =   283 bits (725),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K++E +V+ G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFGVVFQAKCLET
Sbjct  36    DDKEVEATVIDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLET  95

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV
Sbjct  96    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETV  155

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +RV +HY++MN  +P +YV+LY+YQICRAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  156   HRVVKHYNKMNQRIPLIYVKLYMYQICRALAYIHGSIGVCHRDIKPQNLLVN  207



>emb|CDX78587.1| BnaA03g04990D [Brassica napus]
Length=410

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 160/198 (81%), Gaps = 1/198 (1%)
 Frame = +3

Query  426   LEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKR  605
             +  + N AS      PE   +   +D+ K+ME +VV G GTE G IIVTT+GG +GQPK+
Sbjct  12    MATKQNNASLCVDKLPEGINEMKIKDD-KEMEAAVVDGNGTETGHIIVTTIGGKDGQPKQ  70

Query  606   KLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQK  785
              +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  
Sbjct  71    TISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSL  130

Query  786   KHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIH  965
             KH F+STT+K+E+YLNLV+EYVPETVYRVS+HYSR N  MP +YV+LY YQICRAL+YIH
Sbjct  131   KHCFFSTTEKDELYLNLVLEYVPETVYRVSKHYSRANQRMPMIYVKLYTYQICRALAYIH  190

Query  966   NVIGVCHRDIKPQNLLVN  1019
               +GVCHRDIKPQNLLVN
Sbjct  191   GGVGVCHRDIKPQNLLVN  208



>emb|CDX87033.1| BnaC09g03480D [Brassica napus]
Length=406

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 165/204 (81%), Gaps = 3/204 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGS  587
             V+  PV   +D+T     +  PE+  D   +D+ K+MEP VV G GTE G IIVTT+GG 
Sbjct  4     VAIPPVPGARDSTTGLDKL--PEEMNDMKLRDD-KEMEPIVVDGNGTETGHIIVTTIGGR  60

Query  588   NGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDH  767
             NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+FDH
Sbjct  61    NGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLFDH  120

Query  768   PNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICR  947
             PNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI R
Sbjct  121   PNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFR  180

Query  948   ALSYIHNVIGVCHRDIKPQNLLVN  1019
             ALSYIH  IGVCHRDIKPQNLLVN
Sbjct  181   ALSYIHRCIGVCHRDIKPQNLLVN  204



>ref|XP_010523040.1| PREDICTED: shaggy-related protein kinase theta [Tarenaya hassleriana]
Length=467

 Score =   291 bits (745),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 193/273 (71%), Gaps = 32/273 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpa-IRKGKDEQGVDQPVSGEPV--------LEE----  434
             M+V+RR KSIAS  +S S   G    +++ K +Q  +Q + GEP+        LE+    
Sbjct  1     MNVMRRLKSIASGRTSISSDPGGDYGLKRAKVDQENEQ-ICGEPMQVDQNVSGLEQNAAI  59

Query  435   --QDNTASTSN-VARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPGQ  560
               Q++ A  SN  A  EK                 + N     KDME ++V+G GTE GQ
Sbjct  60    ILQESVAGASNDPAAAEKPAYEKLPDVMLEMRIRDERNANSEEKDMETTIVNGNGTETGQ  119

Query  561   IIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE  740
             +I TTVGG +G PK+ +SYMA+R VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRE
Sbjct  120   VITTTVGGRDGMPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRE  179

Query  741   LQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYV  920
             LQIMR+ DHPN V+ +HSF+STTDK+E+YLNLV+EYVPETVYR  +HY++MN HMP +YV
Sbjct  180   LQIMRLLDHPNAVRLRHSFFSTTDKDELYLNLVLEYVPETVYRALKHYTKMNQHMPIIYV  239

Query  921   QLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             QLY YQICRAL+Y+H  +GVCHRDIKPQNLLVN
Sbjct  240   QLYTYQICRALNYLHRAVGVCHRDIKPQNLLVN  272



>emb|CDY19757.1| BnaA09g04100D [Brassica napus]
Length=406

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 165/204 (81%), Gaps = 3/204 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGS  587
             V+  PV   +D+T     +  PE+  D   +D+ K+MEP VV G GTE G IIVTT+GG 
Sbjct  4     VAIPPVHGARDSTTGLDKL--PEEMNDMKLRDD-KEMEPVVVDGNGTETGHIIVTTIGGR  60

Query  588   NGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDH  767
             NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+FDH
Sbjct  61    NGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLFDH  120

Query  768   PNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICR  947
             PNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI R
Sbjct  121   PNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFR  180

Query  948   ALSYIHNVIGVCHRDIKPQNLLVN  1019
             ALSYIH  IGVCHRDIKPQNLLVN
Sbjct  181   ALSYIHRCIGVCHRDIKPQNLLVN  204



>gb|AES82237.2| glycogen synthase kinase [Medicago truncatula]
Length=373

 Score =   288 bits (737),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 159/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  438   DNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             D  AS+  V + PE+  D   +D+ +    ++V G GTE G IIVTT+GG NGQPK+ +S
Sbjct  15    DKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTTIGGKNGQPKQTIS  74

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  75    YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHC  134

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV RV RHY++MN  MP +YV+LY YQICRAL+YIHN I
Sbjct  135   FFSTTEKDELYLNLVLEYVPETVSRVIRHYNKMNQRMPMIYVKLYSYQICRALAYIHNSI  194

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  195   GVCHRDIKPQNLLVN  209



>ref|XP_010674528.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674529.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
Length=407

 Score =   289 bits (739),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ KDMEP+VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  24    PEEMNDMKIRDD-KDMEPTVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGQGSF  82

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR  DHPNVV  KH F+STTDK+E+YL
Sbjct  83    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRPLDHPNVVSLKHCFFSTTDKDELYL  142

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY++MN  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  143   NLVLEYVPETVHRVIKHYNKMNQRMPLIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNL  202

Query  1011  LVN  1019
             LVN
Sbjct  203   LVN  205



>ref|XP_001781586.1| predicted protein [Physcomitrella patens]
 gb|EDQ53637.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   290 bits (741),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  +  ++K++E SVV G GTE G II TT+GG NGQPK+ +SY AER VG+GSFG+VFQ
Sbjct  44    DKVDHSDDKEIEASVVDGNGTETGHIIATTIGGKNGQPKQTISYSAERVVGTGSFGIVFQ  103

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKC+ETGETVAIKKVLQDKRYKNRELQIMR+ DHPN+V  KH F+STTDK+E+YLNLV+E
Sbjct  104   AKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLE  163

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YVPETVYR+++HY+RMN  MP +YV+LY YQICR+L+YIHN IGVCHRDIKPQNLLVN
Sbjct  164   YVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVN  221



>ref|XP_002987888.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
 ref|XP_002994033.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ04915.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ10962.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
Length=423

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  +  ++K++E +VV G GTE G II TT+GG NGQPK+ +SY+AER VG+GSFG+VFQ
Sbjct  44    DKTDHSDDKELEATVVDGNGTETGHIIATTIGGRNGQPKQTISYVAERVVGTGSFGIVFQ  103

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKCLETGETVAIKKVLQDKRYKNRELQIMR+ DHPN+V  KH F+STTDK+E+YLNLV+E
Sbjct  104   AKCLETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLE  163

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YVPETVYR+++H++RMN  MP LYV+LY YQICR+L+YIH  IGVCHRDIKPQNLLVN
Sbjct  164   YVPETVYRIAKHHNRMNQRMPLLYVKLYTYQICRSLAYIHGGIGVCHRDIKPQNLLVN  221



>ref|XP_007215466.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
 gb|EMJ16665.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
Length=409

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 156/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  +   +D  K+ME +VV+G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEINEMKIKDE-KEMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             G+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YL
Sbjct  85    GIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETVYRVS+HYS+ N  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVYRVSKHYSKANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|XP_002302794.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
 gb|EEE82067.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
Length=409

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             VS  P    +D   +T+ V + PE+  D    D+ K+ME +VV G GTE G IIVTT+GG
Sbjct  4     VSVVPASGLRDTLGNTTGVDKLPEEMNDMKISDD-KEMEAAVVDGNGTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    KNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPET++RV +HY +M+  MP +YV+LY YQIC
Sbjct  123   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETIHRVIKHYYKMSQRMPLIYVKLYFYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIHN IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHNSIGVCHRDIKPQNLLVN  207



>ref|XP_010251218.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Nelumbo nucifera]
Length=392

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 159/194 (82%), Gaps = 3/194 (2%)
 Frame = +3

Query  438   DNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSY  617
             DN+ S   +  PE+  +   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SY
Sbjct  17    DNSMSVDKL--PEEINEMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISY  73

Query  618   MAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSF  797
             MAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F
Sbjct  74    MAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCF  133

Query  798   YSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIG  977
             +STT+K E+YLNLV+EYVPETVYRV++HYSR N  MP +YV+LY YQICRAL YIH  IG
Sbjct  134   FSTTEKEELYLNLVLEYVPETVYRVAKHYSRANQRMPMIYVKLYTYQICRALLYIHGGIG  193

Query  978   VCHRDIKPQNLLVN  1019
             VCHRDIKPQNLLVN
Sbjct  194   VCHRDIKPQNLLVN  207



>ref|XP_010456251.1| PREDICTED: shaggy-related protein kinase theta [Camelina sativa]
Length=479

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = +3

Query  402   QPVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVG  581
              P+S +PV +   +      +       D N   ++K+ME ++V+G GTE GQ+I TTVG
Sbjct  74    HPLSDKPVDDHHHHHQLPEVMTDMRIRDDRNAYRDDKEMETTIVNGSGTETGQVITTTVG  133

Query  582   GSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMF  761
             G +G+PK+ +SYMA+R VG+GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQIMR+ 
Sbjct  134   GRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQIMRLQ  193

Query  762   DHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQI  941
             DHPNVV+ +HSF+STTDK+E+YLNLV+EYVPETVYR S+HY+++N HMP ++VQLY YQI
Sbjct  194   DHPNVVRLRHSFFSTTDKDELYLNLVLEYVPETVYRASKHYTKINQHMPIIFVQLYTYQI  253

Query  942   CRALSYIHNVIGVCHRDIKPQNLLVN  1019
             CRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  254   CRALNYLHRVVGVCHRDIKPQNLLVN  279



>ref|XP_010427333.1| PREDICTED: shaggy-related protein kinase theta-like [Camelina 
sativa]
Length=483

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D N   + K+ME ++V+G GTE GQ+I TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQ
Sbjct  106   DRNANRDEKEMETTIVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQ  165

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKCLETGE VAIKKVLQDKRYKNRELQIMR+ DHPNVV+ +HSF+STTDK+E+YLNLV+E
Sbjct  166   AKCLETGEQVAIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLE  225

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YVPETVYR S+HY+++N HMP ++VQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  226   YVPETVYRASKHYTKINQHMPIIFVQLYTYQICRALNYLHRVVGVCHRDIKPQNLLVN  283



>ref|XP_009363099.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Pyrus x 
bretschneideri]
Length=409

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 164/205 (80%), Gaps = 5/205 (2%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             P SG  + E   N     N+  P +  D   +D+ K+ME +VV+G GTE G IIVTT+GG
Sbjct  8     PASG--LREPSGNAVGVDNL--PNEMNDMKIRDD-KEMEATVVNGNGTEAGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    KNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPN+V  +H F+STT+K+E+YLNLV+EYVPET +RV +HYS+MN  MP +YV+LY YQIC
Sbjct  123   HPNIVSLRHCFFSTTEKDELYLNLVLEYVPETAHRVIKHYSKMNQRMPHIYVKLYFYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIHN IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHNTIGVCHRDIKPQNLLVN  207



>ref|XP_004494455.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Cicer 
arietinum]
Length=385

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 164/210 (78%), Gaps = 6/210 (3%)
 Frame = +3

Query  393   GVDQPVSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIV  569
             GV  P +G       D  AS+  V + PE+  D   +D+ +    +VV G GTE G IIV
Sbjct  4     GVVVPATGF-----TDKNASSGGVEKLPEEMNDMKIRDDKEMEAATVVDGNGTETGHIIV  58

Query  570   TTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQI  749
             TT+GG NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ 
Sbjct  59    TTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  118

Query  750   MRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLY  929
             MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV RV RHY++MN  MP +YV+LY
Sbjct  119   MRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVSRVIRHYNKMNQRMPLIYVKLY  178

Query  930   IYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
              YQICRAL+YIHN IGVCHRDIKPQNLLVN
Sbjct  179   SYQICRALAYIHNSIGVCHRDIKPQNLLVN  208



>ref|XP_001781582.1| predicted protein [Physcomitrella patens]
 gb|EDQ53633.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  +  ++K++E S+V G GTE G II TT+GG NGQPK+ +SY AER VG+GSFG+VFQ
Sbjct  44    DKVDHSDDKEIEASIVDGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQ  103

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKC+ETGETVAIKKVLQDKRYKNRELQIMR+ DHPN+V  KH F+STTDK+E+YLNLV+E
Sbjct  104   AKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLE  163

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YVPETVYR+++HY+RMN  MP +YV+LY YQICR+L+YIHN IGVCHRDIKPQNLLVN
Sbjct  164   YVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVN  221



>ref|NP_001042602.1| Os01g0252100 [Oryza sativa Japonica Group]
 dbj|BAA92214.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAB40983.1| shaggy-related protein kinase gamma [Oryza sativa (japonica cultivar-group)]
 dbj|BAF04516.1| Os01g0252100 [Oryza sativa Japonica Group]
 dbj|BAG94276.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70327.1| hypothetical protein OsI_01196 [Oryza sativa Indica Group]
 gb|EEE54244.1| hypothetical protein OsJ_01119 [Oryza sativa Japonica Group]
Length=408

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 166/195 (85%), Gaps = 3/195 (2%)
 Frame = +3

Query  441   NTASTSNVAR--PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             N++STS  A   P++  D   +D+ K++E ++++GKGTE G IIVTT GG NGQPK+ +S
Sbjct  13    NSSSTSMGAEKLPDQMHDLKIRDD-KEVEATIINGKGTETGHIIVTTTGGRNGQPKQTVS  71

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  72    YMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHC  131

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY+YQICRAL+YIHN I
Sbjct  132   FFSTTEKDELYLNLVLEYVPETVHRVVKHYNKMNQRMPLIYVKLYMYQICRALAYIHNSI  191

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  192   GVCHRDIKPQNLLVN  206



>gb|AAQ23107.1| shaggy-related protein kinase 2 [Physcomitrella patens]
 gb|AAQ23112.1| shaggy-related protein kinase 2 [Physcomitrella patens]
Length=423

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  +  ++K++E SVV G GTE G II TT+GG NGQPK+ +SY AER VG+GSFG+VFQ
Sbjct  44    DKVDHSDDKEIEASVVDGNGTETGHIIATTIGGKNGQPKQTISYSAERVVGTGSFGIVFQ  103

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKC+ETGETVAIKKVLQDKRYKNRELQIMR+ DHPN+V  KH F+STTDK+E++LNLV+E
Sbjct  104   AKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELFLNLVLE  163

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YVPETVYR+++HY+RMN  MP LYV+LY YQICR+++YIHN IGVCHRDIKPQNLLVN
Sbjct  164   YVPETVYRIAKHYNRMNQRMPLLYVKLYTYQICRSMAYIHNGIGVCHRDIKPQNLLVN  221



>ref|XP_010091400.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
 gb|EXB44437.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
Length=412

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 164/205 (80%), Gaps = 4/205 (2%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             P SG  V E   N A    +  P++  D   +D  K++E ++V G GTE G IIVTT+GG
Sbjct  8     PASGV-VRESSGNAAGVDRL--PDEMNDMKIRDE-KEVEATIVDGNGTETGHIIVTTIGG  63

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  64    KNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  123

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HYS+MN  MP +YV+LY YQIC
Sbjct  124   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYSKMNQRMPLIYVKLYFYQIC  183

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIHN IGVCHRDIKPQNLLVN
Sbjct  184   RALNYIHNSIGVCHRDIKPQNLLVN  208



>gb|AAQ23108.1| shaggy-related protein kinase 3 [Physcomitrella patens]
 gb|AAQ23113.1| shaggy-related protein kinase 3 [Physcomitrella patens]
Length=423

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  +  ++K++E S+V G GTE G II TT+GG NGQPK+ +SY AER VG+GSFG+VFQ
Sbjct  44    DKVDHSDDKEIEASIVDGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQ  103

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKC+ETGETVAIKKVLQDKRYKNRELQIMR+ DHPN+V  KH F+STTDK+E+YLNLV+E
Sbjct  104   AKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLE  163

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YVPETVYR+++HY+RMN  MP +YV+LY YQICR+L+YIHN IGVCHRDIKPQNLLVN
Sbjct  164   YVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHNGIGVCHRDIKPQNLLVN  221



>ref|XP_001763265.1| predicted protein [Physcomitrella patens]
 gb|EDQ71795.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  +  ++K++E SVV G GTE G II TT+GG NGQPK+ +SY AER VG+GSFG+VFQ
Sbjct  44    DKVDHSDDKEIEASVVDGNGTETGHIIATTIGGKNGQPKQTISYSAERVVGTGSFGIVFQ  103

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKC+ETGETVAIKKVLQDKRYKNRELQIMR+ DHPN+V  KH F+STTDK+E++LNLV+E
Sbjct  104   AKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELFLNLVLE  163

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YVPETVYR+++HY+RMN  MP LYV+LY YQICR+++YIHN IGVCHRDIKPQNLLVN
Sbjct  164   YVPETVYRIAKHYNRMNQRMPLLYVKLYTYQICRSMAYIHNGIGVCHRDIKPQNLLVN  221



>ref|XP_010251217.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Nelumbo nucifera]
Length=409

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 159/194 (82%), Gaps = 3/194 (2%)
 Frame = +3

Query  438   DNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSY  617
             DN+ S   +  PE+  +   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SY
Sbjct  17    DNSMSVDKL--PEEINEMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISY  73

Query  618   MAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSF  797
             MAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F
Sbjct  74    MAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCF  133

Query  798   YSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIG  977
             +STT+K E+YLNLV+EYVPETVYRV++HYSR N  MP +YV+LY YQICRAL YIH  IG
Sbjct  134   FSTTEKEELYLNLVLEYVPETVYRVAKHYSRANQRMPMIYVKLYTYQICRALLYIHGGIG  193

Query  978   VCHRDIKPQNLLVN  1019
             VCHRDIKPQNLLVN
Sbjct  194   VCHRDIKPQNLLVN  207



>emb|CDY07202.1| BnaCnng02170D [Brassica napus]
Length=471

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             + N    +KDMEP+VV+G GTE GQ+I TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQ
Sbjct  94    ERNANREDKDMEPTVVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQ  153

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKCLETGE VAIKKVLQDKRYKNRELQIMR+ DHPNVV+ +HSF+STT+K+E+YLNLV+E
Sbjct  154   AKCLETGEQVAIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHSFFSTTEKDELYLNLVLE  213

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +VPETVYR  +HY++MN HMP + VQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  214   FVPETVYRALKHYTKMNQHMPIILVQLYTYQICRALNYLHRVVGVCHRDIKPQNLLVN  271



>ref|XP_006287860.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287861.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287862.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20758.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20759.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20760.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
Length=410

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFG+VFQAKCLET
Sbjct  37    DDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLET  96

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+++YLNLV+EYVPETV
Sbjct  97    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDDLYLNLVLEYVPETV  156

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRVS+HYSR N  MP +YV+LY YQICRAL+YIH  +GVCHRDIKPQNLLVN
Sbjct  157   YRVSKHYSRANQRMPMIYVKLYTYQICRALAYIHGGVGVCHRDIKPQNLLVN  208



>ref|XP_009131419.1| PREDICTED: shaggy-related protein kinase epsilon [Brassica rapa]
Length=410

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K+ME +VV G GTE G IIVTT+GG +GQPK+ +SYMAER VG GSFG+VFQAKCLET
Sbjct  37    DDKEMEAAVVDGNGTETGHIIVTTIGGKDGQPKQTISYMAERVVGQGSFGIVFQAKCLET  96

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV
Sbjct  97    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETV  156

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRVS+HYSR N  MP +YV+LY YQICRAL+YIH  +GVCHRDIKPQNLLVN
Sbjct  157   YRVSKHYSRANQRMPMIYVKLYTYQICRALAYIHGGVGVCHRDIKPQNLLVN  208



>emb|CDX70574.1| BnaC03g06580D [Brassica napus]
Length=409

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K+ME +VV G GTE G IIVTT+GG +GQPK+ +SYMAER VG GSFG+VFQAKCLET
Sbjct  36    DDKEMEAAVVDGNGTETGHIIVTTIGGKDGQPKQTISYMAERVVGQGSFGIVFQAKCLET  95

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV
Sbjct  96    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETV  155

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRVS+HYSR N  MP +YV+LY YQICRAL+YIH  +GVCHRDIKPQNLLVN
Sbjct  156   YRVSKHYSRANQRMPMIYVKLYTYQICRALAYIHGGVGVCHRDIKPQNLLVN  207



>ref|XP_006289925.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
 gb|EOA22823.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
Length=409

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = +3

Query  420   PVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQ  596
             P+   +D+TA  S V + PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQ
Sbjct  8     PIPGARDSTAHASGVDKLPEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQ  66

Query  597   PKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNV  776
             PK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+ DHPNV
Sbjct  67    PKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNV  126

Query  777   VQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALS  956
             V  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI RALS
Sbjct  127   VSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRALS  186

Query  957   YIHNVIGVCHRDIKPQNLLVN  1019
             YIH  IGVCHRDIKPQNLLVN
Sbjct  187   YIHRCIGVCHRDIKPQNLLVN  207



>ref|XP_004510856.1| PREDICTED: shaggy-related protein kinase theta-like [Cicer arietinum]
Length=467

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 160/184 (87%), Gaps = 4/184 (2%)
 Frame = +3

Query  468   RPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGS  647
             R EKS +NNE    KD+  + VSG GTE GQII TT+GG +GQPK+ +SYMAER VG+GS
Sbjct  93    RDEKSKNNNE----KDVAAATVSGNGTETGQIITTTIGGRDGQPKQTISYMAERVVGTGS  148

Query  648   FGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVY  827
             FGVVFQAKCLETGE VAIKKVLQDKRYKNRELQ+MRM +HPNVV+ KH FYSTT+K+E+Y
Sbjct  149   FGVVFQAKCLETGEAVAIKKVLQDKRYKNRELQVMRMVEHPNVVKLKHCFYSTTEKDELY  208

Query  828   LNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQN  1007
             LNLV+EYVPETVY+VS+++ RM+ HMP +YVQLY+YQICR ++Y+H V+GVCHRDIKPQN
Sbjct  209   LNLVLEYVPETVYKVSKNFIRMHQHMPIIYVQLYMYQICRGINYLHEVVGVCHRDIKPQN  268

Query  1008  LLVN  1019
             LLVN
Sbjct  269   LLVN  272



>ref|XP_006444574.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|ESR57814.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
Length=354

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  20    PEEMNDMKIRDD-KEMEATVVDGNGTEAGHIIVTTIGGKNGQPKQTISYMAERVVGHGSF  78

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGE VAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  79    GVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  138

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +H+ +M+  MP +YV+LY YQICRAL+YIHN IGVCHRDIKPQNL
Sbjct  139   NLVLEYVPETVHRVIKHHYKMSQRMPLIYVKLYFYQICRALAYIHNTIGVCHRDIKPQNL  198

Query  1011  LVN  1019
             LVN
Sbjct  199   LVN  201



>ref|XP_008227813.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Prunus mume]
Length=410

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 163/205 (80%), Gaps = 5/205 (2%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             P SG  + +   N A   ++  P    D   +D  K+ME ++V G GTE G IIVTT+GG
Sbjct  8     PASG--IRDPSGNVAGVDSL--PSGMNDMKIRDE-KEMEATIVDGNGTEAGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    KNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPN+V  KH F+STT+K+E+YLNLV+EYVPETV+RV +HYS+MN  MP +YV+LY YQIC
Sbjct  123   HPNIVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYSKMNQRMPLIYVKLYFYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIHN IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHNSIGVCHRDIKPQNLLVN  207



>gb|ACJ85178.1| unknown [Medicago truncatula]
Length=384

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 159/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  438   DNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             D  AS+  V + PE+  D   +D+ +    ++V G GTE G IIVTT+GG NGQPK+ +S
Sbjct  15    DKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTTIGGKNGQPKQTIS  74

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  75    YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHC  134

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV RV RHY++MN  MP +YV+LY YQICRAL+YIHN I
Sbjct  135   FFSTTEKDELYLNLVLEYVPETVSRVIRHYNKMNQRMPMIYVKLYSYQICRALAYIHNSI  194

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  195   GVCHRDIKPQNLLVN  209



>ref|XP_008799541.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Phoenix dactylifera]
Length=469

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 164/274 (60%), Positives = 191/274 (70%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQDNT---------  446
             M ++RR KSIAS  SS SDPGGDP  ++ K +Q     VS E  L E  +          
Sbjct  1     MHMMRRLKSIASGRSSISDPGGDPGTKRAKFDQDGAGEVSSEQHLVEDKSVGLDHNMTST  60

Query  447   -----ASTSNVARPEKSGDNN------------------EQDNNKDMEPSVVSGKGTEPG  557
                  ASTSN+  P ++ D                    E  N KD E +++ G GTE G
Sbjct  61    HLPLDASTSNMDPPARTEDAAVDQLPKEMHEMTIKDDKVEDHNEKDTEGTMMIGNGTERG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QII TT+GG NGQPK+ +SYMAER VG+GSFG+VFQAKC+ETGETVAIKKVLQDKRYKNR
Sbjct  121   QIIATTIGGRNGQPKQTISYMAERVVGTGSFGIVFQAKCVETGETVAIKKVLQDKRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIM + DHPNVVQ KH F+STTD +EVYLNLV+EYV ETVYR+ ++YSRMN  MP +Y
Sbjct  181   ELQIMHLLDHPNVVQLKHYFFSTTDNDEVYLNLVLEYVSETVYRICKYYSRMNQRMPLIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICRALSYIH V+GVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQICRALSYIHRVVGVCHRDIKPQNLLVN  274



>ref|XP_008799540.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Phoenix dactylifera]
Length=474

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 164/274 (60%), Positives = 191/274 (70%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQDNT---------  446
             M ++RR KSIAS  SS SDPGGDP  ++ K +Q     VS E  L E  +          
Sbjct  1     MHMMRRLKSIASGRSSISDPGGDPGTKRAKFDQDGAGEVSSEQHLVEDKSVGLDHNMTST  60

Query  447   -----ASTSNVARPEKSGDNN------------------EQDNNKDMEPSVVSGKGTEPG  557
                  ASTSN+  P ++ D                    E  N KD E +++ G GTE G
Sbjct  61    HLPLDASTSNMDPPARTEDAAVDQLPKEMHEMTIKDDKVEDHNEKDTEGTMMIGNGTERG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
             QII TT+GG NGQPK+ +SYMAER VG+GSFG+VFQAKC+ETGETVAIKKVLQDKRYKNR
Sbjct  121   QIIATTIGGRNGQPKQTISYMAERVVGTGSFGIVFQAKCVETGETVAIKKVLQDKRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIM + DHPNVVQ KH F+STTD +EVYLNLV+EYV ETVYR+ ++YSRMN  MP +Y
Sbjct  181   ELQIMHLLDHPNVVQLKHYFFSTTDNDEVYLNLVLEYVSETVYRICKYYSRMNQRMPLIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICRALSYIH V+GVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQICRALSYIHRVVGVCHRDIKPQNLLVN  274



>gb|KDO86864.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=354

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  20    PEEMNDMKIRDD-KEMEATVVDGNGTEAGHIIVTTIGGKNGQPKQTISYMAERVVGHGSF  78

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGE VAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  79    GVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  138

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +H+ +M+  MP +YV+LY YQICRAL+YIHN IGVCHRDIKPQNL
Sbjct  139   NLVLEYVPETVHRVIKHHYKMSQRMPLIYVKLYFYQICRALAYIHNTIGVCHRDIKPQNL  198

Query  1011  LVN  1019
             LVN
Sbjct  199   LVN  201



>ref|XP_004306833.1| PREDICTED: shaggy-related protein kinase theta-like [Fragaria 
vesca subsp. vesca]
Length=470

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             + KDME +++SG GTE G II TTVGG NGQPK+ +SYMAE  VG+GSFGVVFQAKCLET
Sbjct  104   DEKDMEETIISGNGTETGHIIATTVGGRNGQPKQTISYMAECVVGTGSFGVVFQAKCLET  163

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GE VAIKKVLQDKRYKNRELQIMR+ DH NVVQ KH F+STT+K+E+YLNLV+EY+ ETV
Sbjct  164   GEAVAIKKVLQDKRYKNRELQIMRLLDHSNVVQLKHCFFSTTEKDELYLNLVLEYISETV  223

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRVS+HY RMN H+P +YVQLY YQICRAL+Y+H+V+GVCHRDIKPQNLLVN
Sbjct  224   YRVSKHYVRMNQHIPIIYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVN  275



>ref|XP_009131508.1| PREDICTED: shaggy-related protein kinase epsilon-like [Brassica 
rapa]
Length=319

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K+ME +VV G GTE G IIVTT+G  +GQPK+ +SYMAER V  GSFG+VFQAKCLET
Sbjct  5     DDKEMEAAVVDGNGTETGHIIVTTIGCKDGQPKQTISYMAERVVEQGSFGIVFQAKCLET  64

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV
Sbjct  65    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETV  124

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRVS+HYSR N  MPT+YV+LY YQICRAL+YIH  +GVCHRDIKPQNLLVN
Sbjct  125   YRVSKHYSRANQRMPTIYVKLYTYQICRALAYIHGGVGVCHRDIKPQNLLVN  176



>emb|CDY51144.1| BnaA09g51790D [Brassica napus]
Length=478

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             + N    +KDMEP+VV+G GTE GQ+I TTVGG +G+PK+ +SYMA+R VG+GSFGVVFQ
Sbjct  101   ERNANREDKDMEPTVVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQ  160

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKCLETGE VAIKKVLQDKRYKNRELQIMR+ DHPNVV+ +HSF+STT+K+E+YLNLV+E
Sbjct  161   AKCLETGEQVAIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHSFFSTTEKDELYLNLVLE  220

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +VPETVYR  +HY++MN HMP + VQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  221   FVPETVYRALKHYTKMNQHMPIILVQLYTYQICRALNYLHRVVGVCHRDIKPQNLLVN  278



>ref|XP_004492676.1| PREDICTED: shaggy-related protein kinase theta-like [Cicer arietinum]
Length=472

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 158/182 (87%), Gaps = 4/182 (2%)
 Frame = +3

Query  474   EKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFG  653
             EKS +NNE    KDME ++V+G GTE GQII T++GG +GQPKR +SYMAER VG+GSFG
Sbjct  100   EKSKNNNE----KDMEATIVNGNGTETGQIITTSIGGRDGQPKRIISYMAERVVGTGSFG  155

Query  654   VVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLN  833
             VV+QAKC+ETGE VAIKKVLQDKRYKNRELQ+MRM +H NV++ KH FYST +K +VYLN
Sbjct  156   VVYQAKCIETGEAVAIKKVLQDKRYKNRELQVMRMLEHTNVLKLKHCFYSTAEKEDVYLN  215

Query  834   LVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLL  1013
             LV+EYVPETVYRVS+HY RM+ HMP +YVQLY YQICR L+Y+H+V+GVCHRDIKPQNLL
Sbjct  216   LVLEYVPETVYRVSKHYVRMHQHMPIIYVQLYTYQICRGLNYMHHVVGVCHRDIKPQNLL  275

Query  1014  VN  1019
             VN
Sbjct  276   VN  277



>gb|ABY60447.1| serine/threonine protein kinase [Adonis aestivalis var. palaestina]
Length=409

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 163/205 (80%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             VS  P    +D T +     R PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG
Sbjct  4     VSMAPPSGLRDPTGNAGGADRLPEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    RNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPET +RV +HY++MN  MP +YV+LY YQIC
Sbjct  123   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETAHRVIKHYNKMNQRMPLIYVKLYTYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHGTIGVCHRDIKPQNLLVN  207



>ref|XP_003518657.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Glycine 
max]
Length=409

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = +3

Query  435   QDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             +D  AS+  V R     +  +  + ++ME +VV G GTE G IIVTT+GG NGQPK+ +S
Sbjct  13    RDVNASSVAVERLPDEMNGMKIRDEREMEATVVDGNGTETGHIIVTTIGGKNGQPKQTIS  72

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG+GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  73    YMAERVVGNGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHC  132

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV+RV RHY++MN  MP +YV+LY YQICRAL+YIHN I
Sbjct  133   FFSTTEKDELYLNLVLEYVPETVHRVIRHYNKMNQRMPLIYVKLYFYQICRALAYIHNCI  192

Query  975   GVCHRDIKPQNLLVN  1019
             GV HRDIKPQNLLVN
Sbjct  193   GVSHRDIKPQNLLVN  207



>ref|XP_010524830.1| PREDICTED: shaggy-related protein kinase alpha-like [Tarenaya 
hassleriana]
Length=409

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             V   P    +D+T   S V R PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG
Sbjct  4     VGLAPTSGARDSTGHASGVDRLPEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+FD
Sbjct  63    RNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLFD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY++++  MP +YV+LY YQI 
Sbjct  123   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLSQRMPLIYVKLYTYQIF  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RALSYIH+ IGVCHRDIKPQNLLVN
Sbjct  183   RALSYIHHCIGVCHRDIKPQNLLVN  207



>ref|XP_008230580.1| PREDICTED: shaggy-related protein kinase epsilon [Prunus mume]
Length=409

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  +   +D  K+ME +VV+G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEINEMKIKDE-KEMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             G+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YL
Sbjct  85    GIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETVYRVS+HY + N  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVYRVSKHYCKANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|XP_006643997.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Oryza brachyantha]
 ref|XP_006643998.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Oryza brachyantha]
Length=408

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 165/195 (85%), Gaps = 3/195 (2%)
 Frame = +3

Query  441   NTASTSNVAR--PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             N++ TS  A   P++  D   +D+ K++E ++++GKGTE G IIVTT GG NGQPK+ +S
Sbjct  13    NSSGTSMGAEKLPDQMNDLKIRDD-KEVEATIINGKGTETGHIIVTTTGGRNGQPKQTVS  71

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  72    YMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHC  131

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY+YQICRAL+YIHN I
Sbjct  132   FFSTTEKDELYLNLVLEYVPETVHRVVKHYNKMNQRMPLIYVKLYMYQICRALAYIHNSI  191

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  192   GVCHRDIKPQNLLVN  206



>ref|XP_006470301.1| PREDICTED: shaggy-related protein kinase epsilon-like [Citrus 
sinensis]
Length=429

 Score =   288 bits (737),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  510   KDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGE  689
             K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFG+VFQAKCLETGE
Sbjct  58    KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGE  117

Query  690   TVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYR  869
             TVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YLNLV+E+VPETVYR
Sbjct  118   TVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEFVPETVYR  177

Query  870   VSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             V++HYSR N  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  178   VAKHYSRANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVN  227



>ref|XP_009383704.1| PREDICTED: shaggy-related protein kinase alpha [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNV-ARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             VS  P  E ++N  ++  V + P++  D   +D+ K++E +V+ G GTE G IIVTT+GG
Sbjct  4     VSMAPSSELKNNDGTSICVDSLPDELNDMKIRDD-KEVEATVIDGNGTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    RNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRILD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K E+YLNLV+EYVPETV+RV +HY++MN  MP LYV+LY+YQIC
Sbjct  123   HPNVVCLKHCFFSTTEKEELYLNLVLEYVPETVHRVIKHYNKMNQRMPLLYVKLYMYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHGCIGVCHRDIKPQNLLVN  207



>gb|AFK38277.1| unknown [Medicago truncatula]
 gb|AES82238.2| glycogen synthase kinase [Medicago truncatula]
Length=412

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 159/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  438   DNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             D  AS+  V + PE+  D   +D+ +    ++V G GTE G IIVTT+GG NGQPK+ +S
Sbjct  15    DKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTTIGGKNGQPKQTIS  74

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  75    YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHC  134

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV RV RHY++MN  MP +YV+LY YQICRAL+YIHN I
Sbjct  135   FFSTTEKDELYLNLVLEYVPETVSRVIRHYNKMNQRMPMIYVKLYSYQICRALAYIHNSI  194

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  195   GVCHRDIKPQNLLVN  209



>ref|XP_003626019.1| Protein kinase, putative [Medicago truncatula]
Length=411

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 159/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  438   DNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             D  AS+  V + PE+  D   +D+ +    ++V G GTE G IIVTT+GG NGQPK+ +S
Sbjct  14    DKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTTIGGKNGQPKQTIS  73

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  74    YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHC  133

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV RV RHY++MN  MP +YV+LY YQICRAL+YIHN I
Sbjct  134   FFSTTEKDELYLNLVLEYVPETVSRVIRHYNKMNQRMPMIYVKLYSYQICRALAYIHNSI  193

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  194   GVCHRDIKPQNLLVN  208



>ref|XP_010276519.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
 ref|XP_010276520.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
Length=409

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 162/196 (83%), Gaps = 2/196 (1%)
 Frame = +3

Query  435   QDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             ++ + S   V R PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +
Sbjct  13    RETSGSNVGVDRLPEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH
Sbjct  72    SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVCLKH  131

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+STT+K E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY+YQICRAL+YIH  
Sbjct  132   CFFSTTEKEELYLNLVLEYVPETVHRVIKHYNKMNQRMPLIYVKLYMYQICRALAYIHGS  191

Query  972   IGVCHRDIKPQNLLVN  1019
             IGVCHRDIKPQNLLVN
Sbjct  192   IGVCHRDIKPQNLLVN  207



>ref|XP_002991115.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
 ref|XP_002991645.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07216.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07923.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
Length=456

 Score =   289 bits (739),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 170/221 (77%), Gaps = 9/221 (4%)
 Frame = +3

Query  384   DEQGVDQPVSGEPVLEEQDNTASTSNVA--RPEKSGDNNEQDN-------NKDMEPSVVS  536
             +EQG+   VS   ++         SNV    P++  +   +D+        K++E +V+ 
Sbjct  34    EEQGMASSVSAAGLIANPRAATVNSNVVDQLPDEMHEMKIRDDKAATHIDEKEVEAAVID  93

Query  537   GKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQ  716
             G GTE G II TT+GG NGQPK+ +SY+AER VG+GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  94    GNGTETGHIIATTIGGRNGQPKQTISYVAERVVGTGSFGIVFQAKCLETGETVAIKKVLQ  153

Query  717   DKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMN  896
             DKRYKNRELQIMR+ DHP++V  KH F+STTDK+E+YLNLV+EYVPETVYR+++HY+RMN
Sbjct  154   DKRYKNRELQIMRLLDHPSIVSLKHCFFSTTDKDELYLNLVLEYVPETVYRIAKHYNRMN  213

Query  897   HHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
               MP LYV+LY YQICRAL+YIH  +GVCHRDIKPQNLLVN
Sbjct  214   QRMPLLYVKLYTYQICRALTYIHGGMGVCHRDIKPQNLLVN  254



>ref|XP_006394905.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
 gb|ESQ32191.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
Length=409

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = +3

Query  420   PVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQ  596
             P+   +D+TA  + V + PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQ
Sbjct  8     PIPGARDSTAQATGVDKLPEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQ  66

Query  597   PKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNV  776
             PK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+ DHPNV
Sbjct  67    PKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNV  126

Query  777   VQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALS  956
             V  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI RALS
Sbjct  127   VSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLVYVKLYTYQIFRALS  186

Query  957   YIHNVIGVCHRDIKPQNLLVN  1019
             YIH  IGVCHRDIKPQNLLVN
Sbjct  187   YIHRCIGVCHRDIKPQNLLVN  207



>ref|XP_006446534.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 ref|XP_006446536.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59774.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59776.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
Length=429

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 155/185 (84%), Gaps = 2/185 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDN--NKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSG  644
             PE+  +   +D    K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG G
Sbjct  43    PEEINEMKIKDERVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQG  102

Query  645   SFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEV  824
             SFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+
Sbjct  103   SFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDEL  162

Query  825   YLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQ  1004
             YLNLV+E+VPETVYRV++HYSR N  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQ
Sbjct  163   YLNLVLEFVPETVYRVAKHYSRANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQ  222

Query  1005  NLLVN  1019
             NLLVN
Sbjct  223   NLLVN  227



>emb|CAA48472.1| protein kinase [Medicago sativa]
Length=412

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 159/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  438   DNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             D  AS+  V + PE+  D   +D+ +    ++V G GTE G IIVTT+GG NGQPK+ +S
Sbjct  15    DKNASSVGVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTTIGGKNGQPKQTIS  74

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  75    YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHC  134

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV RV RHY++MN  MP +YV+LY YQICRAL+YIHN I
Sbjct  135   FFSTTEKDELYLNLVLEYVPETVSRVIRHYNKMNQRMPMIYVKLYSYQICRALAYIHNSI  194

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  195   GVCHRDIKPQNLLVN  209



>ref|XP_004495878.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-2-like [Cicer 
arietinum]
Length=410

 Score =   287 bits (734),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +3

Query  441   NTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYM  620
             NT+S     R        +  ++K+ME +VV G  TE G +IVT +GG NGQPK+ +SYM
Sbjct  16    NTSSVVAADRLPDEIHGMKIKDDKEMEANVVDGNSTEAGHVIVTIIGGKNGQPKQTISYM  75

Query  621   AERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFY  800
             AERAVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+
Sbjct  76    AERAVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHCFF  135

Query  801   STTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGV  980
             STT+K+E+YLNLV+EYVPETVYRV RHYS+MN  MP +YV+LY YQICRAL+YIHN +GV
Sbjct  136   STTEKDELYLNLVLEYVPETVYRVIRHYSKMNQRMPLIYVKLYFYQICRALAYIHNCVGV  195

Query  981   CHRDIKPQNLLVN  1019
              HRDIKPQNLLVN
Sbjct  196   SHRDIKPQNLLVN  208



>gb|EYU46859.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
 gb|EYU46860.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
Length=409

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGS  587
             VS  P L  +D    T ++ R     +  +  + KDMEP+VV G GTE G IIVTT+GG 
Sbjct  4     VSVAPSLGVRDPGRKTGSLDRLPDEMNEMKLRDEKDMEPAVVDGNGTETGHIIVTTIGGR  63

Query  588   NGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDH  767
             NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DH
Sbjct  64    NGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDH  123

Query  768   PNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICR  947
             PNVV  KH F+STT+K+E++LNLV+EYVPETV+RV RHY++M+  MP +YV+LY YQI R
Sbjct  124   PNVVSLKHCFFSTTEKDELFLNLVLEYVPETVHRVIRHYNKMSQRMPMIYVKLYAYQIFR  183

Query  948   ALSYIHNVIGVCHRDIKPQNLLVN  1019
             AL+YIH  IGVCHRDIKPQNLLVN
Sbjct  184   ALAYIHGSIGVCHRDIKPQNLLVN  207



>sp|P51139.2|MSK3_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-3 [Medicago 
sativa]
Length=411

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 159/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  438   DNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             D  AS+  V + PE+  D   +D+ +    ++V G GTE G IIVTT+GG NGQPK+ +S
Sbjct  14    DKNASSVGVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTTIGGKNGQPKQTIS  73

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  74    YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHC  133

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV RV RHY++MN  MP +YV+LY YQICRAL+YIHN I
Sbjct  134   FFSTTEKDELYLNLVLEYVPETVSRVIRHYNKMNQRMPMIYVKLYSYQICRALAYIHNSI  193

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  194   GVCHRDIKPQNLLVN  208



>ref|XP_007221484.1| hypothetical protein PRUPE_ppa006462mg [Prunus persica]
 gb|EMJ22683.1| hypothetical protein PRUPE_ppa006462mg [Prunus persica]
Length=410

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = +3

Query  480   SGDNNEQ-DNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGV  656
             SG N+ +  + K+ME ++V G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFG+
Sbjct  27    SGMNDMKIRDEKEMEATIVDGNGTEAGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGL  86

Query  657   VFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNL  836
             VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPN+V  KH F+STT K+E+YLNL
Sbjct  87    VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNIVSLKHCFFSTTGKDELYLNL  146

Query  837   VMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLV  1016
             V+EYVPETV+RV +HYS+MN  MP +YV+LY YQICRAL+YIHN IGVCHRDIKPQNLLV
Sbjct  147   VLEYVPETVHRVIKHYSKMNQRMPLIYVKLYFYQICRALAYIHNSIGVCHRDIKPQNLLV  206

Query  1017  N  1019
             N
Sbjct  207   N  207



>ref|XP_007051226.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 ref|XP_007051227.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOX95383.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOX95384.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=409

 Score =   286 bits (733),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 165/205 (80%), Gaps = 5/205 (2%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             P SG  + E   NT     +  P++  D   +D+ K++E ++V G GTE G IIVTT+GG
Sbjct  8     PTSG--LREPSGNTVGVDRL--PDEMNDMKIRDD-KEVEATIVDGNGTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    KNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY YQIC
Sbjct  123   HPNVVCLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKMNQRMPLIYVKLYFYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIHN IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHNSIGVCHRDIKPQNLLVN  207



>ref|XP_003534597.1| PREDICTED: shaggy-related protein kinase theta [Glycine max]
Length=460

 Score =   288 bits (737),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 167/217 (77%), Gaps = 1/217 (0%)
 Frame = +3

Query  372   RKGKD-EQGVDQPVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGT  548
             R GKD E  VD  V   P  E+         +   +   D  + +N KDME ++VSG GT
Sbjct  49    RCGKDQEHHVDSNVPSVPRTEKSGYDQLPKELNEMKIGDDKGKNNNEKDMEATIVSGNGT  108

Query  549   EPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRY  728
             E G+II T +GG +GQPKR +SY+AER VG+GSFGVV+QAKCLETGE VAIKKVLQDKRY
Sbjct  109   ETGEIITTAIGGRDGQPKRTISYIAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRY  168

Query  729   KNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMP  908
             KNRELQ+MRM DH NV++ KH FYST +K+++YLNLV+EYVPETVYRVS+HY RM+ HMP
Sbjct  169   KNRELQVMRMLDHTNVLRLKHCFYSTAEKDDLYLNLVLEYVPETVYRVSKHYVRMHQHMP  228

Query  909   TLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
              + VQLY YQICR L+Y+H+VIGVCHRDIKPQNLLVN
Sbjct  229   IINVQLYTYQICRGLNYLHHVIGVCHRDIKPQNLLVN  265



>ref|XP_011003165.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
 ref|XP_011003166.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   286 bits (733),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGS  587
             VS  P    +D   +T+ + +     +  +  ++K+ME +VV G GTE G IIVTT+GG 
Sbjct  4     VSVVPASGLRDTRGNTTGIDKLPDEMNGMKISDDKEMEAAVVDGNGTETGHIIVTTIGGK  63

Query  588   NGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDH  767
             NGQPK+ +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DH
Sbjct  64    NGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDH  123

Query  768   PNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICR  947
             PNVV  KH F+STT+K+E+YLNLV+EYVPET++RV +HY +M+  MP +YV+LY YQICR
Sbjct  124   PNVVSLKHCFFSTTEKDELYLNLVLEYVPETIHRVIKHYYKMSQRMPLIYVKLYFYQICR  183

Query  948   ALSYIHNVIGVCHRDIKPQNLLVN  1019
             AL+YIHN IGVCHRDIKPQNLLVN
Sbjct  184   ALAYIHNSIGVCHRDIKPQNLLVN  207



>gb|KHG00969.1| Glycogen synthase kinase-3 MsK-3 [Gossypium arboreum]
Length=409

 Score =   286 bits (733),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             P++  D   +D+ K++E ++V G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PDEMNDMKIRDD-KEVEATIVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY++MN  MP +YV+LY YQICRAL+YIHN IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVIKHYNKMNQRMPLIYVKLYFYQICRALAYIHNSIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|XP_011040636.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 159/193 (82%), Gaps = 1/193 (1%)
 Frame = +3

Query  441   NTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYM  620
             N  ST     P++  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYM
Sbjct  16    NRNSTGVDKLPDEMNDMRIRDD-KEMEATVVDGNGTETGHIIVTTIGGKNGQPKQTISYM  74

Query  621   AERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFY  800
             AER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+
Sbjct  75    AERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFF  134

Query  801   STTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGV  980
             STT+K+E+YLNLV+EYVPET++RV +HY +M+  MP +YV+LY YQICRAL+YIHN IGV
Sbjct  135   STTEKDELYLNLVLEYVPETIHRVIKHYYKMSQRMPLIYVKLYFYQICRALAYIHNSIGV  194

Query  981   CHRDIKPQNLLVN  1019
             CHRDIKPQNLLVN
Sbjct  195   CHRDIKPQNLLVN  207



>gb|KHN29413.1| Shaggy-related protein kinase theta [Glycine soja]
Length=460

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 167/217 (77%), Gaps = 1/217 (0%)
 Frame = +3

Query  372   RKGKD-EQGVDQPVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGT  548
             R GKD E  VD  V   P  E+         +   +   D  + +N KDME ++VSG GT
Sbjct  49    RCGKDQEHHVDSNVPSVPRTEKSGYYQLPKELNEMKIGDDKGKNNNEKDMEATIVSGNGT  108

Query  549   EPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRY  728
             E G+II T +GG +GQPKR +SY+AER VG+GSFGVV+QAKCLETGE VAIKKVLQDKRY
Sbjct  109   ETGEIITTAIGGRDGQPKRTISYIAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDKRY  168

Query  729   KNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMP  908
             KNRELQ+MRM DH NV++ KH FYST +K+++YLNLV+EYVPETVYRVS+HY RM+ HMP
Sbjct  169   KNRELQVMRMLDHTNVLRLKHCFYSTAEKDDLYLNLVLEYVPETVYRVSKHYVRMHQHMP  228

Query  909   TLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
              + VQLY YQICR L+Y+H+VIGVCHRDIKPQNLLVN
Sbjct  229   IINVQLYTYQICRGLNYLHHVIGVCHRDIKPQNLLVN  265



>ref|XP_007031504.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 ref|XP_007031505.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02430.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02431.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
Length=412

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 161/195 (83%), Gaps = 3/195 (2%)
 Frame = +3

Query  444   TASTSNVAR-PEKSGDNNEQDN--NKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             T +T+ V + PE+  +   +D    K+ME +VV G GTE G IIVTT+GG NG+PK+ +S
Sbjct  16    TGNTTFVDKLPEEINEMKIKDEKVEKEMEATVVDGNGTETGHIIVTTIGGRNGEPKQTIS  75

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFG+VFQAKCLE+GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  76    YMAERVVGQGSFGIVFQAKCLESGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHC  135

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STTDK+E+YLNLV+EYVPETVYRV++HYSR N  MP +YV+LY YQICRAL+YIH  +
Sbjct  136   FFSTTDKDELYLNLVLEYVPETVYRVAKHYSRANQRMPLIYVKLYTYQICRALAYIHGGV  195

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  196   GVCHRDIKPQNLLVN  210



>ref|XP_010248490.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
 ref|XP_010248491.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
 ref|XP_010248492.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
Length=408

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K+ME +VV   GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFG+VFQAKCLET
Sbjct  35    DDKEMEATVVDENGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLET  94

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV
Sbjct  95    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETV  154

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRVS+HYSR N  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  155   YRVSKHYSRANQRMPMIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVN  206



>ref|XP_007031506.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
 gb|EOY02432.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
Length=413

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 161/195 (83%), Gaps = 3/195 (2%)
 Frame = +3

Query  444   TASTSNVAR-PEKSGDNNEQDN--NKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             T +T+ V + PE+  +   +D    K+ME +VV G GTE G IIVTT+GG NG+PK+ +S
Sbjct  16    TGNTTFVDKLPEEINEMKIKDEKVEKEMEATVVDGNGTETGHIIVTTIGGRNGEPKQTIS  75

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFG+VFQAKCLE+GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  76    YMAERVVGQGSFGIVFQAKCLESGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHC  135

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STTDK+E+YLNLV+EYVPETVYRV++HYSR N  MP +YV+LY YQICRAL+YIH  +
Sbjct  136   FFSTTDKDELYLNLVLEYVPETVYRVAKHYSRANQRMPLIYVKLYTYQICRALAYIHGGV  195

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  196   GVCHRDIKPQNLLVN  210



>ref|XP_004304635.1| PREDICTED: shaggy-related protein kinase epsilon-like [Fragaria 
vesca subsp. vesca]
Length=412

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 156/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  +   +D  K++E +VV+G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  29    PEEINEMKIKDE-KEIEAAVVNGNGTETGHIIVTTIGGRNGQPKQTVSYMAERVVGQGSF  87

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             G+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YL
Sbjct  88    GIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTDKDELYL  147

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETVYRV++HYS+ N  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNL
Sbjct  148   NLVLEYVPETVYRVAKHYSKANQRMPMIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNL  207

Query  1011  LVN  1019
             LVN
Sbjct  208   LVN  210



>ref|XP_003566380.1| PREDICTED: shaggy-related protein kinase alpha [Brachypodium 
distachyon]
Length=408

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 164/197 (83%), Gaps = 3/197 (2%)
 Frame = +3

Query  435   QDNTASTSNVAR--PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRK  608
             Q N++STS      P++  D   +D+ K++E ++++GKGTE G IIVTT GG NGQPK+ 
Sbjct  11    QKNSSSTSMGVEKLPDQMNDLKIRDD-KEVEATIINGKGTETGHIIVTTTGGRNGQPKQT  69

Query  609   LSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKK  788
             +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  K
Sbjct  70    VSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALK  129

Query  789   HSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHN  968
             H F+STT+K+E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY YQICRAL+YIH 
Sbjct  130   HCFFSTTEKDELYLNLVLEYVPETVHRVVKHYNKMNQRMPLIYVKLYTYQICRALAYIHG  189

Query  969   VIGVCHRDIKPQNLLVN  1019
              IGVCHRDIKPQNLLVN
Sbjct  190   SIGVCHRDIKPQNLLVN  206



>ref|XP_003626020.1| Protein kinase, putative [Medicago truncatula]
Length=451

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 159/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  438   DNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             D  AS+  V + PE+  D   +D+ +    ++V G GTE G IIVTT+GG NGQPK+ +S
Sbjct  14    DKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTTIGGKNGQPKQTIS  73

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  74    YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHC  133

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV RV RHY++MN  MP +YV+LY YQICRAL+YIHN I
Sbjct  134   FFSTTEKDELYLNLVLEYVPETVSRVIRHYNKMNQRMPMIYVKLYSYQICRALAYIHNSI  193

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  194   GVCHRDIKPQNLLVN  208



>ref|XP_008343189.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Malus 
domestica]
Length=372

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             P SG  + E   N     N+  P +  D   +D+ K+M  +VV G GTE G IIVTT+GG
Sbjct  8     PASG--LREPGGNAVGVDNL--PNEMNDMKIRDD-KEMGATVVDGNGTEAGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    KNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPN+V  +H F+STT+K+E+YLNLV+EYVPET +RV +HYS+MN  MP +YV+LY YQIC
Sbjct  123   HPNIVSLRHCFFSTTEKDELYLNLVLEYVPETAHRVIKHYSKMNQRMPHIYVKLYFYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIHN IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHNTIGVCHRDIKPQNLLVN  207



>ref|XP_006588497.1| PREDICTED: uncharacterized protein LOC100817819 isoform X1 [Glycine 
max]
Length=409

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = +3

Query  435   QDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             +D  A++  V R     +  +  + ++ME +VV G GTE G IIVTT+GG NGQPK+ +S
Sbjct  13    RDVNANSVAVERLPDEMNGMKIRDEREMEATVVDGNGTETGHIIVTTIGGKNGQPKQTIS  72

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG+GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  73    YMAERVVGNGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHC  132

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV+RV RHY++MN  MP +YV+LY YQICRAL+YIHN I
Sbjct  133   FFSTTEKDELYLNLVLEYVPETVHRVIRHYNKMNQRMPLIYVKLYFYQICRALAYIHNCI  192

Query  975   GVCHRDIKPQNLLVN  1019
             GV HRDIKPQNLLVN
Sbjct  193   GVSHRDIKPQNLLVN  207



>ref|XP_003552357.1| PREDICTED: shaggy-related protein kinase theta-like [Glycine 
max]
 gb|KHN24281.1| Shaggy-related protein kinase theta [Glycine soja]
Length=467

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 174/232 (75%), Gaps = 24/232 (10%)
 Frame = +3

Query  372   RKGKD-EQGVDQPVSGEPVLEEQDNTASTSNVARPEKSG---------------DNNEQD  503
             R GKD EQ VD        L+E  N+ +  +VAR EKSG               D  + +
Sbjct  49    RCGKDQEQYVD-------ALKESVNS-NVPSVARTEKSGFDQLPKELNEMKIGDDKGKNN  100

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             N KDME ++V+G GTE GQI  T +GG +GQPKR +SYMAER VG+GSFGVV+QAKCLET
Sbjct  101   NKKDMEATIVNGNGTETGQITTTVIGGRDGQPKRTISYMAERVVGTGSFGVVYQAKCLET  160

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GE VAIKKVLQDKRYKNRELQ+MRM DH NV++ KH FYST +K+++YLNLV+EYVPETV
Sbjct  161   GEAVAIKKVLQDKRYKNRELQVMRMLDHTNVLRLKHCFYSTAEKDDLYLNLVLEYVPETV  220

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YRVS+HY RM+ HMP + VQLY YQICR L+Y+H+VI VCHRDIKPQNLLVN
Sbjct  221   YRVSKHYIRMHQHMPIINVQLYTYQICRGLNYLHHVIRVCHRDIKPQNLLVN  272



>ref|XP_006841582.1| hypothetical protein AMTR_s00003p00196730 [Amborella trichopoda]
 gb|ERN03257.1| hypothetical protein AMTR_s00003p00196730 [Amborella trichopoda]
Length=409

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             VS  P    ++ + ST  V + PE+  D   +D+ K++E +VV G GTE G IIVTT+GG
Sbjct  4     VSVVPATGFRELSGSTMGVDKLPEEMNDMKIRDD-KEVEATVVDGNGTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFG+VFQAKCLE+GETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    RNGQPKQTISYMAERVVGHGSFGIVFQAKCLESGETVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HYSR+N  MP +YV+LY YQIC
Sbjct  123   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVLKHYSRVNQRMPMIYVKLYTYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHGSIGVCHRDIKPQNLLVN  207



>ref|XP_006444573.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006444575.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006492384.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like isoform 
X1 [Citrus sinensis]
 gb|ESR57813.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|ESR57815.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|KDO86860.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86861.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86862.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86863.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=403

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  20    PEEMNDMKIRDD-KEMEATVVDGNGTEAGHIIVTTIGGKNGQPKQTISYMAERVVGHGSF  78

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGE VAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  79    GVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  138

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +H+ +M+  MP +YV+LY YQICRAL+YIHN IGVCHRDIKPQNL
Sbjct  139   NLVLEYVPETVHRVIKHHYKMSQRMPLIYVKLYFYQICRALAYIHNTIGVCHRDIKPQNL  198

Query  1011  LVN  1019
             LVN
Sbjct  199   LVN  201



>ref|XP_010933863.1| PREDICTED: shaggy-related protein kinase epsilon-like [Elaeis 
guineensis]
Length=469

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  E  N K+ E ++V+G GTE GQII TT+GG NG+PK+ +SYMAE  VG+GSFGVVFQ
Sbjct  97    DKVEGHNEKETEGTMVNGNGTETGQIIATTIGGRNGEPKQTISYMAEHVVGTGSFGVVFQ  156

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKC+E+GETVAIKKVLQDKRYKNRELQIM + DHPNVVQ KH F+STT+K+E+YLNLV+E
Sbjct  157   AKCVESGETVAIKKVLQDKRYKNRELQIMHLLDHPNVVQLKHYFFSTTEKDELYLNLVLE  216

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YV ETVYR+ ++YSRMN HMP +YVQLY YQICRALSYIH+V+GVCHRDIKPQNLLVN
Sbjct  217   YVSETVYRICKYYSRMNQHMPLIYVQLYTYQICRALSYIHHVVGVCHRDIKPQNLLVN  274



>ref|XP_002279596.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Vitis 
vinifera]
 emb|CAN75652.1| hypothetical protein VITISV_017659 [Vitis vinifera]
Length=409

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 163/205 (80%), Gaps = 5/205 (2%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             P SG  + E   NT     +  P++  D   +D+ K+ME +VV G GTE G IIVTT+GG
Sbjct  8     PASG--LREPNGNTVGVDRL--PDEMNDMKIRDD-KEMEDTVVDGNGTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    KNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY YQIC
Sbjct  123   HPNVVSLKHCFFSTTEKEELYLNLVLEYVPETVHRVIKHYNKMNQRMPMIYVKLYTYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHGGIGVCHRDIKPQNLLVN  207



>gb|KDO45354.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=353

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERIVGQGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +H++++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVVKHFNKLNQRMPMIYVKLYAYQIFRALSYIHRSIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>tpg|DAA53953.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=320

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 166/196 (85%), Gaps = 5/196 (3%)
 Frame = +3

Query  441   NTASTSNVARPEKSGDN-NEQD--NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             N++STS  A  EK  D+ NE    ++K++E ++++GKGTE G IIVTT GG NGQPK+ +
Sbjct  13    NSSSTSIGA--EKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTTGGKNGQPKQTV  70

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH
Sbjct  71    SYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKH  130

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+STT+K+E+YLNLV+EYVPETV+RV +H+++M+  MP +YV+LY+YQICRAL+YIH  
Sbjct  131   CFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMHQRMPLIYVKLYMYQICRALAYIHGT  190

Query  972   IGVCHRDIKPQNLLVN  1019
             IGVCHRDIKPQNLLVN
Sbjct  191   IGVCHRDIKPQNLLVN  206



>ref|XP_008812956.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Phoenix 
dactylifera]
Length=409

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             P++  D   +D+ K++E +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PDEMNDMKIRDD-KEVEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             G+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  85    GIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY++MN  MP +YV+LY+YQICRAL+YIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVIKHYNKMNQRMPLIYVKLYMYQICRALAYIHGSIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|XP_009384446.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384447.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384448.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   285 bits (728),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             P++  D   +D+ K++E +V++GKGTE G IIVTT+ G NGQPK+ +SYMAERAVG GSF
Sbjct  26    PQEMSDMKIRDD-KEVEATVINGKGTEAGHIIVTTINGKNGQPKQTVSYMAERAVGHGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGE+VAIKKVLQDKRYKNRELQ MR+ DHPNV+  KH F+STT+K+E+YL
Sbjct  85    GVVFQAKCLETGESVAIKKVLQDKRYKNRELQTMRLLDHPNVIYLKHCFFSTTEKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY++MN  MP +YV+LY+YQICRAL+YIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVIKHYNKMNQRMPLIYVKLYMYQICRALAYIHGCIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|XP_002882438.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58697.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   285 bits (728),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             V  EP    +D+T + ++V R PE+  D   QD+ K+ME ++V+G  TE G IIVTT+GG
Sbjct  4     VGIEPSAAVRDSTGNVTDVDRLPEEMKDMKIQDD-KEMEATIVNGNVTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+ D
Sbjct  63    RNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI 
Sbjct  123   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLVYVKLYTYQIF  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             R+LSYIH  IGVCHRDIKPQNLLVN
Sbjct  183   RSLSYIHRCIGVCHRDIKPQNLLVN  207



>ref|XP_006382290.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382291.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382292.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|ERP60087.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60088.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60089.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score =   285 bits (728),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HYS++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVIKHYSKLNQKMPLIYVKLYTYQIFRALSYIHRAIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>gb|KHN00323.1| Glycogen synthase kinase-3 like MsK-2 [Glycine soja]
Length=373

 Score =   283 bits (725),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  510   KDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGE  689
             ++ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG+GSFGVVFQAKCLETGE
Sbjct  2     QEMEATVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGNGSFGVVFQAKCLETGE  61

Query  690   TVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYR  869
             TVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV+R
Sbjct  62    TVAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHCFFSTTEKDELYLNLVLEYVPETVHR  121

Query  870   VSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             V RHY++MN  MP +YV+LY YQICRAL+YIHN IGV HRDIKPQNLLVN
Sbjct  122   VIRHYNKMNQRMPLIYVKLYFYQICRALAYIHNCIGVSHRDIKPQNLLVN  171



>ref|XP_008353866.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
 ref|XP_009367184.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Pyrus 
x bretschneideri]
 ref|XP_009367186.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Pyrus 
x bretschneideri]
Length=409

 Score =   285 bits (728),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             P SG  + E   N     N+  P +  D   +D+ K+M  +VV G GTE G IIVTT+GG
Sbjct  8     PASG--LREPGGNAVGVDNL--PNEMNDMKIRDD-KEMGATVVDGNGTEAGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    KNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPN+V  +H F+STT+K+E+YLNLV+EYVPET +RV +HYS+MN  MP +YV+LY YQIC
Sbjct  123   HPNIVSLRHCFFSTTEKDELYLNLVLEYVPETAHRVIKHYSKMNQRMPHIYVKLYFYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIHN IGVCHRDIKPQNLLVN
Sbjct  183   RALAYIHNTIGVCHRDIKPQNLLVN  207



>dbj|BAF36565.1| Shaggy-like kinase [Triticum aestivum]
Length=406

 Score =   285 bits (728),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 163/195 (84%), Gaps = 3/195 (2%)
 Frame = +3

Query  441   NTASTSNVAR--PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             N++ TS  A   P++  D   +D+ K++E ++++GKGTE G IIVTT GG NGQPK+ +S
Sbjct  13    NSSGTSMGAEKLPDQMNDLKIRDD-KEVEATIINGKGTETGHIIVTTTGGKNGQPKQTVS  71

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  72    YMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHC  131

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY YQICRAL+YIH  I
Sbjct  132   FFSTTEKDELYLNLVLEYVPETVHRVVKHYNKMNQRMPLIYVKLYTYQICRALAYIHGSI  191

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  192   GVCHRDIKPQNLLVN  206



>emb|CDM82575.1| unnamed protein product [Triticum aestivum]
Length=406

 Score =   285 bits (728),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 163/195 (84%), Gaps = 3/195 (2%)
 Frame = +3

Query  441   NTASTSNVAR--PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             N++ TS  A   P++  D   +D+ K++E ++++GKGTE G IIVTT GG NGQPK+ +S
Sbjct  13    NSSGTSMGAEKLPDQMNDLKIRDD-KEVEATIINGKGTETGHIIVTTTGGKNGQPKQTVS  71

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  72    YMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHC  131

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY YQICRAL+YIH  I
Sbjct  132   FFSTTEKDELYLNLVLEYVPETVHRVVKHYNKMNQRMPLIYVKLYTYQICRALAYIHGSI  191

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  192   GVCHRDIKPQNLLVN  206



>ref|XP_011039006.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039008.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039009.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039010.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039011.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   285 bits (728),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HYS++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVIKHYSKLNQKMPLIYVKLYTYQIFRALSYIHRAIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>gb|KDO45355.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=371

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERIVGQGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +H++++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVVKHFNKLNQRMPMIYVKLYAYQIFRALSYIHRSIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>gb|KCW84977.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=293

 Score =   280 bits (717),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  +   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  30    PEEMNEMKIRDD-KEMETTVVDGNGTEAGHIIVTTIGGRNGQPKQTISYMAERVVGQGSF  88

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+S T+K+E+YL
Sbjct  89    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSETEKDELYL  148

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  149   NLVLEYVPETVHRVIKHYNKLNQRMPIIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNL  208

Query  1011  LVN  1019
             LVN
Sbjct  209   LVN  211



>ref|XP_006588498.1| PREDICTED: uncharacterized protein LOC100817819 isoform X2 [Glycine 
max]
Length=382

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  513   DMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGET  692
             +ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG+GSFGVVFQAKCLETGET
Sbjct  12    EMEATVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGNGSFGVVFQAKCLETGET  71

Query  693   VAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRV  872
             VAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV
Sbjct  72    VAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHCFFSTTEKDELYLNLVLEYVPETVHRV  131

Query  873   SRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
              RHY++MN  MP +YV+LY YQICRAL+YIHN IGV HRDIKPQNLLVN
Sbjct  132   IRHYNKMNQRMPLIYVKLYFYQICRALAYIHNCIGVSHRDIKPQNLLVN  180



>gb|KEH18946.1| shaggy-like kinase [Medicago truncatula]
Length=468

 Score =   286 bits (732),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 157/184 (85%), Gaps = 4/184 (2%)
 Frame = +3

Query  468   RPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGS  647
             R EKS +NNE    KD+E + VSG GTE GQII TT+ G +GQPK+ +SYMAER VG+GS
Sbjct  94    RDEKSKNNNE----KDIEATTVSGNGTETGQIITTTIAGRDGQPKQTISYMAERVVGTGS  149

Query  648   FGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVY  827
             FGVVFQAKCLET E VAIKKVLQDKRYKNRELQ+MRM DHPN+V+ KH FYSTT+K+E+Y
Sbjct  150   FGVVFQAKCLETNEAVAIKKVLQDKRYKNRELQVMRMVDHPNIVKLKHCFYSTTEKDELY  209

Query  828   LNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQN  1007
             LNLV+EYVPETVY+VS++Y RM+ HMP ++VQLY YQI R L+Y+H VIGVCHRDIKPQN
Sbjct  210   LNLVLEYVPETVYKVSKNYIRMHQHMPIIHVQLYTYQILRGLNYLHEVIGVCHRDIKPQN  269

Query  1008  LLVN  1019
             LLVN
Sbjct  270   LLVN  273



>ref|XP_010270906.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010270907.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
Length=409

 Score =   284 bits (727),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG+GSFG+VFQAKCLET
Sbjct  36    DDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGNGSFGIVFQAKCLET  95

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K E+YLNLV+EYVPETV
Sbjct  96    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKEELYLNLVLEYVPETV  155

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +RV +HY++MN  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  156   HRVIKHYNKMNQRMPLIYVKLYTYQICRALAYIHGSIGVCHRDIKPQNLLVN  207



>gb|KHN00229.1| Glycogen synthase kinase-3 like MsK-3 [Glycine soja]
Length=585

 Score =   290 bits (741),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = +3

Query  435   QDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             +D  AS+  V R     +  +  + ++ME +VV G GTE G IIVTT+GG NGQPK+ +S
Sbjct  189   RDVNASSVAVERLPDEMNGMKIRDEREMEATVVDGNGTETGHIIVTTIGGKNGQPKQTIS  248

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG+GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  249   YMAERVVGNGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHC  308

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV+RV RHY++MN  MP +YV+LY YQICRAL+YIHN I
Sbjct  309   FFSTTEKDELYLNLVLEYVPETVHRVIRHYNKMNQRMPLIYVKLYFYQICRALAYIHNCI  368

Query  975   GVCHRDIKPQNLLVN  1019
             GV HRDIKPQNLLVN
Sbjct  369   GVSHRDIKPQNLLVN  383



>gb|AFN42826.1| GSK3-like protein [Marsilea vestita]
 gb|AFN42827.1| gsk3-like protein [Marsilea vestita]
Length=392

 Score =   284 bits (726),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +3

Query  483   GDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVF  662
             G  +  + ++++E +VV G G E G IIVTT+GG NGQPK+ +SYMAER VG+GSFGVVF
Sbjct  11    GAEHGGNEDREIEAAVVDGNGAETGHIIVTTIGGKNGQPKQTISYMAERVVGTGSFGVVF  70

Query  663   QAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVM  842
             Q KCLETGETVAIKKVLQDKRYKNRELQIMR+ DHPN+V  KH FYS+T+K+EV+LNLV+
Sbjct  71    QGKCLETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFYSSTEKDEVFLNLVL  130

Query  843   EYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             EYVPETVYR+++HY+RMN  MP ++V+LY YQICRAL+YIH  +GVCHRDIKPQNLLVN
Sbjct  131   EYVPETVYRIAKHYNRMNQRMPLIFVKLYTYQICRALAYIHGAMGVCHRDIKPQNLLVN  189



>ref|XP_008781189.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008781190.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   284 bits (727),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 161/194 (83%), Gaps = 1/194 (1%)
 Frame = +3

Query  441   NTASTS-NVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSY  617
             NT+ TS  V R     +  +  ++K++E +V+ G GTE G IIVTT+GG NGQPK+ +SY
Sbjct  14    NTSGTSVGVDRLPDEMNEMKIRDDKEVEATVIDGNGTETGHIIVTTIGGRNGQPKQTISY  73

Query  618   MAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSF  797
             MAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F
Sbjct  74    MAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCF  133

Query  798   YSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIG  977
             +STT+K+E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY+YQICRAL+YIH  IG
Sbjct  134   FSTTEKDELYLNLVLEYVPETVHRVVKHYNKMNQRMPLIYVKLYMYQICRALAYIHGSIG  193

Query  978   VCHRDIKPQNLLVN  1019
             VCHRDIKPQNLLVN
Sbjct  194   VCHRDIKPQNLLVN  207



>ref|XP_002515218.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF47202.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=409

 Score =   284 bits (727),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 163/205 (80%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             VS  P    +D   + + V R P++  D   +D+ K+ME +VV G GTE G IIVTT+GG
Sbjct  4     VSVAPTSGIRDPGGNAAGVDRLPDEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQ MR+ D
Sbjct  63    KNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY++M   MP +YV+LY YQIC
Sbjct  123   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKMGQRMPLIYVKLYFYQIC  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RAL+YIHN IGVCHRDIKP NLLVN
Sbjct  183   RALAYIHNSIGVCHRDIKPHNLLVN  207



>ref|XP_008793304.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   284 bits (727),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             P++  D   +D+ K++E +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PDEMNDMKIRDD-KEVEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             G+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPN+V  KH F+STT+K+E+YL
Sbjct  85    GIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNIVSLKHCFFSTTEKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY++MN  MP +YV+LY+YQICRAL+YIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVVKHYNKMNQRMPLIYVKLYMYQICRALAYIHGSIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>gb|KHG02936.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
 gb|KHG22311.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
Length=407

 Score =   284 bits (727),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 162/192 (84%), Gaps = 2/192 (1%)
 Frame = +3

Query  447   ASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMA  623
             +ST++V + PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMA
Sbjct  15    SSTASVEKLPEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMA  73

Query  624   ERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYS  803
             ER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+S
Sbjct  74    ERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFS  133

Query  804   TTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVC  983
             TT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI RALSYIH  IGVC
Sbjct  134   TTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLVYVKLYTYQIFRALSYIHRSIGVC  193

Query  984   HRDIKPQNLLVN  1019
             HRDIKPQNLLVN
Sbjct  194   HRDIKPQNLLVN  205



>ref|XP_004495628.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Cicer arietinum]
Length=410

 Score =   284 bits (726),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 162/205 (79%), Gaps = 4/205 (2%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             P SG   L E    A+      PE+  D   +D+ ++ME +VV G GTE G IIVTT+GG
Sbjct  8     PTSG---LRETSGHAAAGVDRLPEEMNDMKIRDD-REMEATVVDGNGTETGHIIVTTIGG  63

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  64    RNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  123

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI 
Sbjct  124   HPNVVALKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIF  183

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RALSYIH  IGVCHRDIKPQNLLVN
Sbjct  184   RALSYIHRCIGVCHRDIKPQNLLVN  208



>emb|CBI37005.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFGVVFQAKCLET
Sbjct  8     DDKEMEDTVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLET  67

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K E+YLNLV+EYVPETV
Sbjct  68    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKEELYLNLVLEYVPETV  127

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +RV +HY++MN  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  128   HRVIKHYNKMNQRMPMIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVN  179



>ref|XP_010940878.1| PREDICTED: shaggy-related protein kinase epsilon-like [Elaeis 
guineensis]
Length=469

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/274 (58%), Positives = 199/274 (73%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGE-PVLEEQ-----------  437
             M+V+RR KS+AS  SS SDPGGD  ++K K EQ V+   S E  V+E++           
Sbjct  1     MNVMRRLKSVASGRSSVSDPGGDSGMKKVKVEQDVEGKESTEHSVVEDKAMGLKQLTTSA  60

Query  438   --DNTASTSN---VARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPG  557
               D+ ASTS+     R + +G               D  + +N+KD++ +V+ G GTE G
Sbjct  61    HLDSDASTSSKGTTTRAKNAGIDQLPKEMYEMTIRNDKADGNNDKDVKATVLKGNGTETG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
              +I  T+GG NGQPK+ +SYMA+  VG+GSFGVVFQAKCL TGE VAIKKVLQDKR+KNR
Sbjct  121   HLITATIGGQNGQPKQTVSYMADCVVGTGSFGVVFQAKCLGTGEAVAIKKVLQDKRFKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIM++ DHPNVVQ K+ F+STT+K+EV+LNLV+EYV ETVYRV+RHY RMNHHMP +Y
Sbjct  181   ELQIMQLLDHPNVVQLKNYFFSTTEKDEVFLNLVLEYVSETVYRVARHYHRMNHHMPLIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQICRALAYMHGVVGVCHRDIKPQNLLVN  274



>ref|XP_010455024.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010455025.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 164/204 (80%), Gaps = 5/204 (2%)
 Frame = +3

Query  420   PVLEEQDNT----ASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGS  587
             P+   +D+T    A+T     PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG 
Sbjct  8     PIPGARDSTTTAHAATGVEKLPEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGR  66

Query  588   NGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDH  767
             NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+ DH
Sbjct  67    NGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDH  126

Query  768   PNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICR  947
             PNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI R
Sbjct  127   PNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFR  186

Query  948   ALSYIHNVIGVCHRDIKPQNLLVN  1019
             ALSYIH  IGVCHRDIKPQNLLVN
Sbjct  187   ALSYIHRCIGVCHRDIKPQNLLVN  210



>ref|XP_010251219.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X3 [Nelumbo nucifera]
Length=382

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  513   DMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGET  692
             +ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFG+VFQAKCLETGET
Sbjct  12    EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGET  71

Query  693   VAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRV  872
             VAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K E+YLNLV+EYVPETVYRV
Sbjct  72    VAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKEELYLNLVLEYVPETVYRV  131

Query  873   SRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             ++HYSR N  MP +YV+LY YQICRAL YIH  IGVCHRDIKPQNLLVN
Sbjct  132   AKHYSRANQRMPMIYVKLYTYQICRALLYIHGGIGVCHRDIKPQNLLVN  180



>ref|XP_003591238.1| Glycogen synthase kinase [Medicago truncatula]
 gb|AES61489.1| glycogen synthase kinase [Medicago truncatula]
 gb|AFK45213.1| unknown [Medicago truncatula]
Length=411

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ ++ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  28    PEEMSDMKIRDD-REMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  86

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  87    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  146

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HYS++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  147   NLVLEYVPETVHRVIKHYSKLNQRMPMIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNL  206

Query  1011  LVN  1019
             LVN
Sbjct  207   LVN  209



>gb|EMT32435.1| Glycogen synthase kinase-3-MsK-3-like protein [Aegilops tauschii]
Length=435

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 163/195 (84%), Gaps = 3/195 (2%)
 Frame = +3

Query  441   NTASTSNVAR--PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLS  614
             N++ TS  A   P++  D   +D+ K++E ++++GKGTE G IIVTT GG NGQPK+ +S
Sbjct  29    NSSGTSMGAEKLPDQMNDLKIRDD-KEVEATIINGKGTETGHIIVTTTGGKNGQPKQTVS  87

Query  615   YMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHS  794
             YMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH 
Sbjct  88    YMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHC  147

Query  795   FYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVI  974
             F+STT+K+E+YLNLV+EYVPETV+RV +HY++MN  MP +YV+LY YQICRAL+YIH  I
Sbjct  148   FFSTTEKDELYLNLVLEYVPETVHRVVKHYNKMNQRMPLIYVKLYTYQICRALAYIHGSI  207

Query  975   GVCHRDIKPQNLLVN  1019
             GVCHRDIKPQNLLVN
Sbjct  208   GVCHRDIKPQNLLVN  222



>gb|AAT85177.1| putative glycogen synthase kinase [Oryza sativa Japonica Group]
Length=361

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 161/196 (82%), Gaps = 1/196 (1%)
 Frame = +3

Query  435   QDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             Q+ T+++ +  R P +  + + +D+NKD++  VV+G GTEPG +IVT++ G NGQ K+ +
Sbjct  14    QNETSTSGDADRLPNEMSNMSIRDDNKDIDDIVVNGNGTEPGHVIVTSIDGRNGQAKQTI  73

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFG VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH
Sbjct  74    SYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRVLDHPNVVSLKH  133

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+S T+K E+YLNLV+EYVPET +RV +HY++MN  MP +Y +LY+YQICRAL+YIHN 
Sbjct  134   CFFSKTEKEELYLNLVLEYVPETAHRVIKHYNKMNQRMPLIYAKLYMYQICRALAYIHNT  193

Query  972   IGVCHRDIKPQNLLVN  1019
             IGVCHRDIKPQNLLVN
Sbjct  194   IGVCHRDIKPQNLLVN  209



>sp|P51137.1|MSK1_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-1 [Medicago 
sativa]
 emb|CAA48474.1| protein kinase [Medicago sativa]
Length=411

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ ++ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  28    PEEMSDMKIRDD-REMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  86

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  87    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  146

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HYS++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  147   NLVLEYVPETVHRVIKHYSKLNQRMPMIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNL  206

Query  1011  LVN  1019
             LVN
Sbjct  207   LVN  209



>ref|XP_010493927.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
 ref|XP_010493928.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
Length=412

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 164/204 (80%), Gaps = 5/204 (2%)
 Frame = +3

Query  420   PVLEEQDNT----ASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGS  587
             P+   +D+T    A+T     PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG 
Sbjct  8     PIPGARDSTTSAHAATGVDKLPEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGR  66

Query  588   NGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDH  767
             NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+ DH
Sbjct  67    NGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDH  126

Query  768   PNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICR  947
             PNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI R
Sbjct  127   PNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFR  186

Query  948   ALSYIHNVIGVCHRDIKPQNLLVN  1019
             ALSYIH  IGVCHRDIKPQNLLVN
Sbjct  187   ALSYIHRCIGVCHRDIKPQNLLVN  210



>ref|XP_008778092.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008778093.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 162/194 (84%), Gaps = 4/194 (2%)
 Frame = +3

Query  447   ASTSNVA---RPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSY  617
             AS +N+A    P++  D   +D+ K++E +V+ G GTE G IIVTT+GG NGQPKR +SY
Sbjct  15    ASGNNIAVDRLPDEMNDMKIRDD-KEVEATVIDGNGTETGHIIVTTIGGRNGQPKRTISY  73

Query  618   MAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSF  797
             MAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F
Sbjct  74    MAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVCLKHCF  133

Query  798   YSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIG  977
             +STT+K+E+YLNLV+EYVPE ++RV +HY++MN  MP ++V+LY+YQICRAL+YIH  IG
Sbjct  134   FSTTEKDELYLNLVLEYVPENLHRVIKHYNKMNQRMPLIFVKLYMYQICRALAYIHGSIG  193

Query  978   VCHRDIKPQNLLVN  1019
             VCHRDIKPQNLLVN
Sbjct  194   VCHRDIKPQNLLVN  207



>gb|AAM62970.1| shaggy related protein kinase ASK-GAMMA [Arabidopsis thaliana]
Length=409

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             V  EP    +++T + ++V R PE+  D   QD+ K+ME +VV+G  TE G IIVTT+GG
Sbjct  4     VGIEPSAAVRESTGNVTDVDRLPEEMKDMKIQDD-KEMEATVVNGNVTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+ D
Sbjct  63    RNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI 
Sbjct  123   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLVYVKLYTYQIF  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             R+LSYIH  IGVCHRDIKPQNLLVN
Sbjct  183   RSLSYIHRCIGVCHRDIKPQNLLVN  207



>tpg|DAA53950.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=373

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 166/196 (85%), Gaps = 5/196 (3%)
 Frame = +3

Query  441   NTASTSNVARPEKSGDN-NEQD--NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             N++STS  A  EK  D+ NE    ++K++E ++++GKGTE G IIVTT GG NGQPK+ +
Sbjct  13    NSSSTSIGA--EKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTTGGKNGQPKQTV  70

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH
Sbjct  71    SYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKH  130

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+STT+K+E+YLNLV+EYVPETV+RV +H+++M+  MP +YV+LY+YQICRAL+YIH  
Sbjct  131   CFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMHQRMPLIYVKLYMYQICRALAYIHGT  190

Query  972   IGVCHRDIKPQNLLVN  1019
             IGVCHRDIKPQNLLVN
Sbjct  191   IGVCHRDIKPQNLLVN  206



>ref|XP_010270905.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Nelumbo nucifera]
Length=434

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG+GSFG+VFQAKCLET
Sbjct  61    DDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGNGSFGIVFQAKCLET  120

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K E+YLNLV+EYVPETV
Sbjct  121   GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKEELYLNLVLEYVPETV  180

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +RV +HY++MN  MP +YV+LY YQICRAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  181   HRVIKHYNKMNQRMPLIYVKLYTYQICRALAYIHGSIGVCHRDIKPQNLLVN  232



>ref|XP_008795404.1| PREDICTED: shaggy-related protein kinase theta-like isoform X1 
[Phoenix dactylifera]
Length=381

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  E  N KD E ++V+G GTE GQII TT+GG +GQPK+ +SYMAER VG+GSFGVVFQ
Sbjct  9     DKVEGRNEKDTEGTMVNGNGTETGQIIATTIGGRHGQPKQTISYMAERVVGTGSFGVVFQ  68

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKC+ETGETVAIKKVLQDKRYKNRELQIM + DHPNVVQ KH F+STT+K+EVYLNLV+E
Sbjct  69    AKCVETGETVAIKKVLQDKRYKNRELQIMHLLDHPNVVQLKHYFFSTTEKDEVYLNLVLE  128

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YV ETVY + +++ RMN HMP +YVQLY YQICR LSYIH V+GVCHRDIKPQNLLVN
Sbjct  129   YVSETVYCICKYHRRMNQHMPLIYVQLYTYQICRVLSYIHRVLGVCHRDIKPQNLLVN  186



>ref|NP_001148880.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
 ref|XP_008654975.1| PREDICTED: glycogen synthase kinase-3 MsK-3 isoform X1 [Zea mays]
 gb|ACG33274.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
 gb|AFW79697.1| putative glycogen synthase kinase family protein [Zea mays]
Length=408

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 165/196 (84%), Gaps = 5/196 (3%)
 Frame = +3

Query  441   NTASTSNVARPEKSGDN-NEQD--NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             N++STS  A  EK  D  NE    ++K++E ++++GKGTE G IIVTT GG NGQPK+ +
Sbjct  13    NSSSTSIGA--EKLQDQMNELKIRDDKEVEATIINGKGTETGHIIVTTTGGKNGQPKQTV  70

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH
Sbjct  71    SYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKH  130

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+STT+K+E+YLNLV+EYVPETV+RV +H+++MN  MP +YV+LY+YQICRAL+YIH  
Sbjct  131   CFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMNQRMPLIYVKLYMYQICRALAYIHGT  190

Query  972   IGVCHRDIKPQNLLVN  1019
             IGVCHRDIKPQNLLVN
Sbjct  191   IGVCHRDIKPQNLLVN  206



>ref|XP_011079505.1| PREDICTED: shaggy-related protein kinase alpha-like [Sesamum 
indicum]
Length=413

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++KDMEP+V+ G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSFGVVFQAKCLET
Sbjct  36    DDKDMEPAVIDGNGTETGHIIVTTIGGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLET  95

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E++LNLV+EYVPETV
Sbjct  96    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELFLNLVLEYVPETV  155

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +RV RHY++M+  MP +YV+LY YQI RAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  156   HRVIRHYNKMSQRMPMIYVKLYAYQIFRALAYIHGSIGVCHRDIKPQNLLVN  207



>gb|KDO45353.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=409

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERIVGQGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +H++++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVVKHFNKLNQRMPMIYVKLYAYQIFRALSYIHRSIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|XP_007205270.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205271.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205272.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06469.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06470.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06471.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
Length=410

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>gb|ACJ85100.1| unknown [Medicago truncatula]
Length=250

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K+ME  VV G  TE G +IVTT+GG NGQPK+ +SYMAERAVG GSFGVVFQAKCLET
Sbjct  5     DDKEMEAHVVDGNSTEAGHVIVTTIGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCLET  64

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+E+VPETV
Sbjct  65    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHCFFSTTEKDELYLNLVLEFVPETV  124

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +RV RHYS+MN  MP +YV+LY YQI R+L+YIHN +GV HRDIKPQNLLVN
Sbjct  125   HRVIRHYSKMNQRMPLIYVKLYSYQILRSLAYIHNCVGVSHRDIKPQNLLVN  176



>ref|XP_008246288.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246289.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246290.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
Length=410

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEELNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|XP_006480288.1| PREDICTED: shaggy-related protein kinase alpha-like [Citrus sinensis]
Length=409

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERIVGQGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +H++++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVVKHFNKLNQRMPMIYVKLYAYQIFRALSYIHRSIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|XP_007031229.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOY11731.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=407

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  24    PEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  82

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  83    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEKDELYL  142

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  143   NLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNL  202

Query  1011  LVN  1019
             LVN
Sbjct  203   LVN  205



>ref|XP_001762052.1| predicted protein [Physcomitrella patens]
 gb|EDQ73156.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  +  ++K++E +VV G GTE G II TT+GG NGQPK+ +SY AER VG+GSFG+VFQ
Sbjct  45    DKVDHGDDKEIEATVVDGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQ  104

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKC+E+GETVAIKKVLQDKRYKNRELQIMR+ DHPN+V  KH F+STT+K+E+YLNLV+E
Sbjct  105   AKCIESGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTEKDELYLNLVLE  164

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YVPETVYR+++HY+RMN  MP +YV+LY YQICR+L+YIH+ IGVCHRDIKPQNLLVN
Sbjct  165   YVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHSGIGVCHRDIKPQNLLVN  222



>ref|XP_002512564.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF50016.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=383

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 159/194 (82%), Gaps = 4/194 (2%)
 Frame = +3

Query  447   ASTSNVA---RPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSY  617
             AS  NV     PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SY
Sbjct  14    ASGHNVGVDKLPEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISY  72

Query  618   MAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSF  797
             MAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F
Sbjct  73    MAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCF  132

Query  798   YSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIG  977
             +STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI RALSYIH  IG
Sbjct  133   FSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYAYQIFRALSYIHCAIG  192

Query  978   VCHRDIKPQNLLVN  1019
             VCHRDIKPQNLLVN
Sbjct  193   VCHRDIKPQNLLVN  206



>ref|XP_006299606.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
 gb|EOA32504.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
Length=409

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             V  EP    +D+T + ++  R PE+  D   QD+ K+ME ++V+G  TE G IIVTT+GG
Sbjct  4     VGIEPSAAVRDSTGNATDADRLPEELKDMKIQDD-KEMEATIVNGNVTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+ D
Sbjct  63    RNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI 
Sbjct  123   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLVYVKLYTYQIF  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             R+LSYIH  IGVCHRDIKPQNLLVN
Sbjct  183   RSLSYIHRCIGVCHRDIKPQNLLVN  207



>gb|AAQ23109.1| shaggy-related protein kinase 4 [Physcomitrella patens]
Length=424

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  +  ++K++E +VV G GTE G II TT+GG NGQPK+ +SY AER VG+GSFG+VFQ
Sbjct  45    DKVDHGDDKEIEATVVDGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQ  104

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKC+E+GETVAIKKVLQDKRYKNRELQIMR+ DHPN+V  KH F+STT+K+E+YLNLV+E
Sbjct  105   AKCIESGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCFFSTTEKDELYLNLVLE  164

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YVPETVYR+++HY+RMN  MP +YV+LY YQICR+L+YIH+ IGVCHRDIKPQNLLVN
Sbjct  165   YVPETVYRIAKHYNRMNQRMPLVYVKLYTYQICRSLAYIHSGIGVCHRDIKPQNLLVN  222



>ref|XP_004967857.1| PREDICTED: shaggy-related protein kinase alpha-like [Setaria 
italica]
Length=408

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = +3

Query  447   ASTSNVARPEKSGDNNEQD--NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYM  620
             +S++NV   +     NE    ++K++E ++++GKGTE G IIVTT GG NGQPK+ +SYM
Sbjct  14    SSSTNVGADKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTTGGKNGQPKQTVSYM  73

Query  621   AERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFY  800
             AER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+
Sbjct  74    AERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFF  133

Query  801   STTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGV  980
             STT+K+E+YLNLV+EYVPETV+RV +H+++MN  MP +YV+LY+YQICRAL+YIH  IGV
Sbjct  134   STTEKDELYLNLVLEYVPETVHRVVKHHNKMNQRMPLIYVKLYMYQICRALAYIHGSIGV  193

Query  981   CHRDIKPQNLLVN  1019
             CHRDIKPQNLLVN
Sbjct  194   CHRDIKPQNLLVN  206



>ref|XP_002455378.1| hypothetical protein SORBIDRAFT_03g009580 [Sorghum bicolor]
 gb|EES00498.1| hypothetical protein SORBIDRAFT_03g009580 [Sorghum bicolor]
Length=408

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K++E ++++GKGTE G IIVTT GG NGQPK+ +SYMAER VG GSFG+VFQAKCLET
Sbjct  35    DDKEVEATIINGKGTETGHIIVTTTGGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLET  94

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV
Sbjct  95    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPETV  154

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +RV +H+++MN  MP +YV+LY+YQICRAL+YIH  IGVCHRDIKPQNLLVN
Sbjct  155   HRVVKHHNKMNQRMPLIYVKLYMYQICRALAYIHGTIGVCHRDIKPQNLLVN  206



>ref|XP_010486058.1| PREDICTED: shaggy-related protein kinase gamma-like [Camelina 
sativa]
Length=408

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 163/201 (81%), Gaps = 1/201 (0%)
 Frame = +3

Query  417   EPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQ  596
             EP    +D++ +T     PE+  D   QD+ K+ME ++V+G  TE G IIVTT+GG NGQ
Sbjct  7     EPSAAVRDSSTTTDVDRLPEEMKDMKIQDD-KEMEATIVNGNVTETGHIIVTTIGGRNGQ  65

Query  597   PKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNV  776
             PK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+ DHPNV
Sbjct  66    PKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNV  125

Query  777   VQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALS  956
             V  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI R+LS
Sbjct  126   VALKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLVYVKLYTYQIFRSLS  185

Query  957   YIHNVIGVCHRDIKPQNLLVN  1019
             YIH  IGVCHRDIKPQNLLVN
Sbjct  186   YIHRCIGVCHRDIKPQNLLVN  206



>ref|XP_004960405.1| PREDICTED: shaggy-related protein kinase alpha-like [Setaria 
italica]
Length=410

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 163/196 (83%), Gaps = 2/196 (1%)
 Frame = +3

Query  435   QDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             Q++T+S+S+  R P + G+ + +D+ KD+E  VV+G GTEPG IIVT++ G NGQ K+ +
Sbjct  14    QNDTSSSSDADRLPNELGNMSIRDD-KDIEDIVVNGNGTEPGHIIVTSIDGRNGQAKQTI  72

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFG VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH
Sbjct  73    SYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRVLDHPNVVALKH  132

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+S T+K E+YLNLV+EYVPET +RV +HY++MN  MP +Y +LY+YQICRAL+YIHN 
Sbjct  133   CFFSKTEKEELYLNLVLEYVPETAHRVIKHYNKMNQRMPLIYAKLYMYQICRALAYIHNC  192

Query  972   IGVCHRDIKPQNLLVN  1019
             IGVCHRDIKPQNLLVN
Sbjct  193   IGVCHRDIKPQNLLVN  208



>emb|CDP17018.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 153/178 (86%), Gaps = 5/178 (3%)
 Frame = +3

Query  501   DNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLE  680
              ++K+ME +V++G GTE G IIVTTVGG NGQPK+ +SYMAERAVG GSFGVVFQAKCLE
Sbjct  7     SDDKEMEATVINGNGTEAGHIIVTTVGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCLE  66

Query  681   TGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPET  860
             TGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K E++LNLV+EYVPET
Sbjct  67    TGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKKELFLNLVLEYVPET  126

Query  861   VYRVSRHYSRMNHHMPTLYVQLYIYQIC-----RALSYIHNVIGVCHRDIKPQNLLVN  1019
             V+RV +HYS+M+  MPT+YV+LY YQ C     RAL+YIH VIGVCHRDIKPQNLLVN
Sbjct  127   VHRVIKHYSKMSQRMPTIYVKLYTYQACIWPIFRALAYIHGVIGVCHRDIKPQNLLVN  184



>ref|XP_002874323.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50582.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 161/196 (82%), Gaps = 2/196 (1%)
 Frame = +3

Query  435   QDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             +D+T     V + PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +
Sbjct  13    RDSTTHAIGVDKLPEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+ DHPNVV  KH
Sbjct  72    SYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKH  131

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI RALSYIH  
Sbjct  132   CFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRALSYIHRC  191

Query  972   IGVCHRDIKPQNLLVN  1019
             IGVCHRDIKPQNLLVN
Sbjct  192   IGVCHRDIKPQNLLVN  207



>gb|AFW79696.1| putative glycogen synthase kinase family protein [Zea mays]
Length=402

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 165/196 (84%), Gaps = 5/196 (3%)
 Frame = +3

Query  441   NTASTSNVARPEKSGDN-NEQD--NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             N++STS  A  EK  D  NE    ++K++E ++++GKGTE G IIVTT GG NGQPK+ +
Sbjct  13    NSSSTSIGA--EKLQDQMNELKIRDDKEVEATIINGKGTETGHIIVTTTGGKNGQPKQTV  70

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH
Sbjct  71    SYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKH  130

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+STT+K+E+YLNLV+EYVPETV+RV +H+++MN  MP +YV+LY+YQICRAL+YIH  
Sbjct  131   CFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMNQRMPLIYVKLYMYQICRALAYIHGT  190

Query  972   IGVCHRDIKPQNLLVN  1019
             IGVCHRDIKPQNLLVN
Sbjct  191   IGVCHRDIKPQNLLVN  206



>ref|XP_001765207.1| predicted protein [Physcomitrella patens]
 gb|EDQ69935.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  486   DNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQ  665
             D  +  ++K+ E +VV G GTE G II TT+GG NGQPK+ +SY AER VG+GSFG+VFQ
Sbjct  45    DKVDHSDDKEFEATVVDGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQ  104

Query  666   AKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVME  845
             AKC+E+GETVAIKKVLQDKRYKNRELQIMR+ +HPN+V  KH F+STT+K+E+YLNLV+E
Sbjct  105   AKCIESGETVAIKKVLQDKRYKNRELQIMRLLEHPNIVALKHCFFSTTEKDELYLNLVLE  164

Query  846   YVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             YVPETVYRV++HY+RMN  MP LYV+LY YQICR+L+YIH+ IGVCHRDIKPQNLLVN
Sbjct  165   YVPETVYRVAKHYNRMNQRMPLLYVKLYTYQICRSLAYIHSGIGVCHRDIKPQNLLVN  222



>ref|XP_011023844.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011023845.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 153/183 (84%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D  KDME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG+GSF
Sbjct  26    PEEMNDMKIRDE-KDMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGNGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLET ETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  85    GVVFQAKCLETSETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY ++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVIKHYRKLNQKMPLIYVKLYTYQIFRALSYIHRAIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|NP_001242506.1| uncharacterized protein LOC100817819 [Glycine max]
 gb|ACU18867.1| unknown [Glycine max]
Length=374

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  516   MEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETV  695
             ME +VV G GTE G +IVTT+GG NGQPK+ +SYMAER VG+GSFGVVFQAKCLETGETV
Sbjct  5     MEATVVDGNGTETGHMIVTTIGGKNGQPKQTISYMAERVVGNGSFGVVFQAKCLETGETV  64

Query  696   AIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVS  875
             AIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV 
Sbjct  65    AIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHCFFSTTEKDELYLNLVLEYVPETVHRVI  124

Query  876   RHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             RHY++MN  MP +YV+LY YQICRAL+YIHN IGV HRDIKPQNLLVN
Sbjct  125   RHYNKMNQRMPLIYVKLYFYQICRALAYIHNCIGVSHRDIKPQNLLVN  172



>ref|XP_009384996.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGS  587
             +S  P    +D T S+ +V     + +  +  ++K++E +VV G GTE G IIVTT+GG 
Sbjct  4     ISLPPSSRLKDTTGSSVSVDTLPHAMNVMKIKDDKEVEATVVDGNGTETGHIIVTTIGGR  63

Query  588   NGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDH  767
             NGQPK+ +SYMAER VG GSFGVVFQAKCLET ETVAIKKVLQDKRYKNRELQ MR+ DH
Sbjct  64    NGQPKQTISYMAERVVGHGSFGVVFQAKCLETVETVAIKKVLQDKRYKNRELQTMRLLDH  123

Query  768   PNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICR  947
             PNVV  KH F+STT+K E+YLNLV+EYVPET++RV +HY++MN  MP +YV+LY+YQICR
Sbjct  124   PNVVCLKHCFFSTTEKEELYLNLVLEYVPETLHRVIKHYNKMNQRMPLIYVKLYMYQICR  183

Query  948   ALSYIHNVIGVCHRDIKPQNLLVN  1019
             AL+YIH  IGVCHRDIKPQNLLVN
Sbjct  184   ALAYIHRSIGVCHRDIKPQNLLVN  207



>ref|XP_002280673.1| PREDICTED: shaggy-related protein kinase alpha [Vitis vinifera]
Length=409

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRALSYIHRSIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>sp|P51138.1|MSK2_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-2 [Medicago 
sativa]
 emb|CAA48473.1| protein kinase [Medicago sativa]
Length=411

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLET  683
             ++K+ME  VV G  TE G +IVTT+GG NGQPK+ +SYMAERAVG GSFGVVFQAKCLET
Sbjct  37    DDKEMEAHVVDGNSTEAGHVIVTTIGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCLET  96

Query  684   GETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETV  863
             GETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YLNLV+E+VPETV
Sbjct  97    GETVAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHCFFSTTEKDELYLNLVLEFVPETV  156

Query  864   YRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             +RV RHYS+MN  MP +YV+LY YQICR+L+YIHN +GV HRDIKPQNLLVN
Sbjct  157   HRVIRHYSKMNQRMPLIYVKLYSYQICRSLAYIHNCVGVSHRDIKPQNLLVN  208



>ref|XP_003555781.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Glycine max]
 ref|XP_006605787.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Glycine max]
 ref|XP_006605788.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Glycine max]
 ref|XP_006605789.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Glycine max]
Length=426

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 161/205 (79%), Gaps = 4/205 (2%)
 Frame = +3

Query  405   PVSGEPVLEEQDNTASTSNVARPEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             P SG   L E     + +    PE+  D   +D+ ++ME +VV G GTE G IIVTT+GG
Sbjct  24    PTSG---LREASGHGAAAADRLPEEMNDMKIRDD-REMEATVVDGNGTETGHIIVTTIGG  79

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ D
Sbjct  80    RNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLD  139

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV RV +HY+++N  MP +YV+LY YQI 
Sbjct  140   HPNVVALKHCFFSTTEKDELYLNLVLEYVPETVNRVIKHYNKLNQRMPLIYVKLYTYQIF  199

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             RALSYIH  IGVCHRDIKPQNLLVN
Sbjct  200   RALSYIHRCIGVCHRDIKPQNLLVN  224



>ref|XP_010941497.1| PREDICTED: shaggy-related protein kinase alpha [Elaeis guineensis]
Length=409

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 156/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             P++  D   +D+ K++E +V+ G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PDEMNDMKIRDD-KEVEAAVIDGNGTETGHIIVTTIGGRNGQPKQTISYMAERIVGHGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STT+K+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPE V+RV +HY++MN  MP +YV+LY+YQICRAL+YIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPENVHRVIKHYNKMNQRMPLIYVKLYMYQICRALAYIHGSIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|XP_010432712.1| PREDICTED: shaggy-related protein kinase gamma-like [Camelina 
sativa]
Length=407

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 162/192 (84%), Gaps = 2/192 (1%)
 Frame = +3

Query  447   ASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMA  623
             +ST++V R PE+  D   QD+ K+ME ++V+G  TE G IIVTT+GG NGQPK+ +SYMA
Sbjct  15    SSTTDVDRLPEEMKDMKIQDD-KEMEATIVNGNVTETGHIIVTTIGGRNGQPKQTISYMA  73

Query  624   ERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYS  803
             ER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+ DHPNVV  KH F+S
Sbjct  74    ERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVALKHCFFS  133

Query  804   TTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVC  983
             TT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI R+LSYIH  IGVC
Sbjct  134   TTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLVYVKLYTYQIFRSLSYIHRCIGVC  193

Query  984   HRDIKPQNLLVN  1019
             HRDIKPQNLLVN
Sbjct  194   HRDIKPQNLLVN  205



>ref|XP_003574217.1| PREDICTED: shaggy-related protein kinase alpha-like [Brachypodium 
distachyon]
Length=469

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 161/278 (58%), Positives = 193/278 (69%), Gaps = 40/278 (14%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVDQPVSGEPVLEEQ------------  437
             M ++RR KSIAS  SS SDPGGD   ++ K     DQ  SG+ V+E Q            
Sbjct  1     MHMMRRLKSIASGRSSVSDPGGDSGSKRPK----FDQEGSGDIVIEPQLSDDKPMHLDQE  56

Query  438   ------DNTASTSNVARPEK------------------SGDNNEQDNNKDMEPSVVSGKG  545
                   D  ASTS    P K                  S D  +   +KD E  +V+G G
Sbjct  57    SSSSHRDADASTSTSMNPAKTEETGADLLPKGMNDMTISDDRVDGLTDKDAEGVIVNGNG  116

Query  546   TEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKR  725
             TE GQIIVTT+GG NG+PK+K+SYMAER VG+GSFGVV+QAKCLETGET AIKKVLQDKR
Sbjct  117   TEAGQIIVTTIGGQNGKPKQKVSYMAERVVGTGSFGVVYQAKCLETGETFAIKKVLQDKR  176

Query  726   YKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHM  905
             YKNRELQ M++ D+PN+VQ KH F+STTD+ EVYLNLV+EYVPETVYRV+++Y+RMN  +
Sbjct  177   YKNRELQTMQLLDNPNIVQLKHHFFSTTDRGEVYLNLVLEYVPETVYRVAKYYNRMNQRV  236

Query  906   PTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             P LYV+LY YQ+CRAL+YIH V+GVCHRDIKPQNLLVN
Sbjct  237   PILYVKLYTYQMCRALAYIHRVVGVCHRDIKPQNLLVN  274



>gb|EAY96448.1| hypothetical protein OsI_18343 [Oryza sativa Indica Group]
Length=411

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 161/196 (82%), Gaps = 1/196 (1%)
 Frame = +3

Query  435   QDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             Q+ T+++ +  R P +  + + +D+NKD++  VV+G GTEPG IIVT++ G NGQ K+ +
Sbjct  14    QNETSTSGDADRLPNEMSNMSIRDDNKDIDDIVVNGNGTEPGHIIVTSIDGRNGQAKQTI  73

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFG VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH
Sbjct  74    SYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRVLDHPNVVSLKH  133

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+S T+K E+YLNLV+EYVPET +RV +HY++MN  MP +Y +LY+YQICRAL+YIHN 
Sbjct  134   CFFSKTEKEELYLNLVLEYVPETAHRVIKHYNKMNQRMPLIYAKLYMYQICRALAYIHNT  193

Query  972   IGVCHRDIKPQNLLVN  1019
             IGVCHRDIKPQNLLVN
Sbjct  194   IGVCHRDIKPQNLLVN  209



>ref|XP_008803034.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Phoenix dactylifera]
Length=468

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 159/274 (58%), Positives = 198/274 (72%), Gaps = 32/274 (12%)
 Frame = +3

Query  294   MDVVRRFKSIassgssasdpggdpaIRKGKDEQGVD-QPVSGEPVLEEQ-----------  437
             M+V+RR KSIAS  SS SDPGGD +++K K EQ V+ +  +   V+E +           
Sbjct  1     MNVMRRLKSIASGRSSVSDPGGDSSMKKVKVEQDVEGKECTEHSVVENKAMGLEQLTTSA  60

Query  438   --DNTASTSN---VARPEKSG---------------DNNEQDNNKDMEPSVVSGKGTEPG  557
               D+ ASTS+     R + +G               D  +  N+K+++ +V+ GK TE G
Sbjct  61    HLDSDASTSSKGPTTRLKNAGIDQLSKEMHEMTIRNDKADGHNDKNVKATVIKGKSTETG  120

Query  558   QIIVTTVGGSNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNR  737
              +I TT+GG NGQPK+ +SYMA+R VG+GSFGVV QAKCL TGE VAIKKVLQDKRYKNR
Sbjct  121   HLITTTIGGQNGQPKQTISYMADRVVGTGSFGVVLQAKCLGTGEAVAIKKVLQDKRYKNR  180

Query  738   ELQIMRMFDHPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLY  917
             ELQIM++ DHPNVVQ K+ F+STT+K+EVYLNLV+EYV ETVYRV+RHY RMN HMP +Y
Sbjct  181   ELQIMQLLDHPNVVQLKNYFFSTTEKDEVYLNLVLEYVSETVYRVARHYHRMNQHMPLIY  240

Query  918   VQLYIYQICRALSYIHNVIGVCHRDIKPQNLLVN  1019
             VQLY YQICRAL+Y+H V+GVCHRDIKPQNLLVN
Sbjct  241   VQLYTYQICRALAYMHGVVGVCHRDIKPQNLLVN  274



>ref|XP_009629200.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
 ref|XP_009629201.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME ++V G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEMNDMRIRDD-KEMEAAIVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +HY+++N  MP + V+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVIKHYNKLNQRMPLILVKLYTYQIFRALSYIHRTIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>ref|XP_006428242.1| hypothetical protein CICLE_v10013624mg [Citrus clementina]
 gb|ESR41482.1| hypothetical protein CICLE_v10013624mg [Citrus clementina]
Length=453

 Score =   283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = +3

Query  471   PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKLSYMAERAVGSGSF  650
             PE+  D   +D+ K+ME +VV G GTE G IIVTT+GG NGQPK+ +SYMAER VG GSF
Sbjct  26    PEEMNDMKIRDD-KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERIVGQGSF  84

Query  651   GVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKHSFYSTTDKNEVYL  830
             GVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH F+STTDK+E+YL
Sbjct  85    GVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYL  144

Query  831   NLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNVIGVCHRDIKPQNL  1010
             NLV+EYVPETV+RV +H++++N  MP +YV+LY YQI RALSYIH  IGVCHRDIKPQNL
Sbjct  145   NLVLEYVPETVHRVVKHFNKLNQRMPMIYVKLYAYQIFRALSYIHRSIGVCHRDIKPQNL  204

Query  1011  LVN  1019
             LVN
Sbjct  205   LVN  207



>gb|AEN14336.1| hypothetical protein rf1-C1-g7 [Zea mays]
Length=408

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 166/196 (85%), Gaps = 5/196 (3%)
 Frame = +3

Query  441   NTASTSNVARPEKSGDN-NEQD--NNKDMEPSVVSGKGTEPGQIIVTTVGGSNGQPKRKL  611
             N++STS  A  EK  D+ NE    ++K++E ++++GKGTE G IIVTT GG NGQPK+ +
Sbjct  13    NSSSTSIGA--EKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTTGGKNGQPKQAM  70

Query  612   SYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFDHPNVVQKKH  791
             SYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MR+ DHPNVV  KH
Sbjct  71    SYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKH  130

Query  792   SFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQICRALSYIHNV  971
              F+STT+K+E+YLNLV+EYVPETV+RV +H+++M+  MP +YV+LY+YQICRAL+YIH  
Sbjct  131   CFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMHQRMPLIYVKLYMYQICRALAYIHGT  190

Query  972   IGVCHRDIKPQNLLVN  1019
             IGVCHRDIKPQNLLVN
Sbjct  191   IGVCHRDIKPQNLLVN  206



>ref|XP_006408021.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 ref|XP_006408023.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49474.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49476.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
Length=409

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = +3

Query  408   VSGEPVLEEQDNTASTSNVAR-PEKSGDNNEQDNNKDMEPSVVSGKGTEPGQIIVTTVGG  584
             V  EP    +D   + ++V R PE+  D   QD+ K+ME ++V+G  TE G IIVTT+GG
Sbjct  4     VGIEPSAPVRDTAGNATDVDRLPEEMNDMKIQDD-KEMEATIVNGNVTETGHIIVTTIGG  62

Query  585   SNGQPKRKLSYMAERAVGSGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRMFD  764
              NGQPK+ +SYMAER VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR+ D
Sbjct  63    RNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLD  122

Query  765   HPNVVQKKHSFYSTTDKNEVYLNLVMEYVPETVYRVSRHYSRMNHHMPTLYVQLYIYQIC  944
             HPNVV  KH F+STT+K+E+YLNLV+EYVPETV+RV +HY+++N  MP +YV+LY YQI 
Sbjct  123   HPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLVYVKLYTYQIF  182

Query  945   RALSYIHNVIGVCHRDIKPQNLLVN  1019
             R+L+YIH  IGVCHRDIKPQNLLVN
Sbjct  183   RSLAYIHRCIGVCHRDIKPQNLLVN  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2302838196460