BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c92541_g1_i1 len=612 path=[630:0-611]

Length=612
                                                                      Score     E

gb|EMT05507.1|  hypothetical protein F775_09606                       48.5    1e-04   
emb|CBI21477.3|  unnamed protein product                              47.0    7e-04   



>gb|EMT05507.1| hypothetical protein F775_09606 [Aegilops tauschii]
Length=81

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 41/80 (51%), Gaps = 18/80 (23%)
 Frame = +1

Query  82   MSSIGFSYAHVHVQQERLKEKIRRSDQ------------GEEGRGKDATQQEPKR-----  210
            MSSIGFSYA VHV+QERL+ KI  S++            GEE + K+ +  E K+     
Sbjct  1    MSSIGFSYAQVHVKQERLRRKISDSEKAAATMTMSKSMAGEEEKKKEGSMGEEKKKAACT  60

Query  211  -GKAKKIHPAGGFPAPDSQH  267
               A ++HP    P P   H
Sbjct  61   SWTAGRVHPFASSPVPKGGH  80



>emb|CBI21477.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 6/59 (10%)
 Frame = +1

Query  82   MSSIGFSYAHVHVQQERLKEKIRRSDQGEE--GRGKDATQQEPKRGKA----KKIHPAG  240
            MSSIG S+A V+VQQ+R +EK++R D   E  G G D   ++   G +     KIHPAG
Sbjct  38   MSSIGASFARVYVQQKRCEEKMKRVDGANEKRGVGADGVAEKSDSGCSFVRRSKIHPAG  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 776559819808