BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c92501_g1_i1 len=701 path=[679:0-700]

Length=701
                                                                      Score     E

ref|XP_006357089.1|  PREDICTED: uncharacterized protein LOC102594143    135   2e-36   
gb|EYU21994.1|  hypothetical protein MIMGU_mgv1a021797mg                133   1e-35   
ref|XP_006483484.1|  PREDICTED: uncharacterized protein LOC102630261    132   3e-35   
ref|XP_004244525.1|  PREDICTED: uncharacterized protein LOC101251603    131   6e-35   
ref|XP_010526251.1|  PREDICTED: uncharacterized protein LOC104803862    130   1e-34   
ref|XP_009126604.1|  PREDICTED: uncharacterized protein LOC103851502    130   2e-34   
gb|KDP33509.1|  hypothetical protein JCGZ_07080                         129   5e-34   
ref|XP_006412549.1|  hypothetical protein EUTSA_v10026655mg             128   7e-34   
ref|XP_009601690.1|  PREDICTED: uncharacterized protein LOC104096936    128   7e-34   
ref|XP_009783119.1|  PREDICTED: uncharacterized protein LOC104231762    127   1e-33   
ref|XP_011081973.1|  PREDICTED: uncharacterized protein LOC105164866    127   3e-33   
ref|NP_194911.1|  uncharacterized protein                               127   3e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDP07853.1|  unnamed protein product                                127   3e-33   
ref|XP_010447548.1|  PREDICTED: uncharacterized protein LOC104730140    126   4e-33   
ref|XP_010437987.1|  PREDICTED: uncharacterized protein LOC104721652    126   4e-33   
ref|XP_002867277.1|  hypothetical protein ARALYDRAFT_913282             126   4e-33   
ref|XP_006284964.1|  hypothetical protein CARUB_v10006267mg             125   8e-33   
emb|CDY39881.1|  BnaC03g67360D                                          125   2e-32   
ref|XP_008452845.1|  PREDICTED: uncharacterized protein LOC103493743    125   3e-32   
ref|XP_010432810.1|  PREDICTED: uncharacterized protein LOC104717005    123   6e-32   
emb|CDP07849.1|  unnamed protein product                                123   7e-32   
gb|KFK29783.1|  hypothetical protein AALP_AA7G178700                    122   2e-31   
ref|XP_007226027.1|  hypothetical protein PRUPE_ppa013842mg             122   3e-31   
ref|XP_002515422.1|  conserved hypothetical protein                     122   3e-31   Ricinus communis
ref|XP_008220670.1|  PREDICTED: uncharacterized protein LOC103320730    121   3e-31   
ref|XP_010042210.1|  PREDICTED: uncharacterized protein LOC104431242    119   2e-30   
ref|XP_004145498.1|  PREDICTED: uncharacterized protein LOC101212329    119   2e-30   
ref|XP_002285534.1|  PREDICTED: uncharacterized protein LOC100254214    119   4e-30   Vitis vinifera
emb|CBI21144.3|  unnamed protein product                                118   1e-29   
ref|XP_010051081.1|  PREDICTED: uncharacterized protein LOC104439762    117   1e-29   
ref|XP_010273617.1|  PREDICTED: uncharacterized protein LOC104609100    115   5e-29   
ref|XP_009363597.1|  PREDICTED: uncharacterized protein LOC103953561    114   3e-28   
ref|XP_009109921.1|  PREDICTED: uncharacterized protein LOC103835489    114   4e-28   
ref|XP_004498805.1|  PREDICTED: uncharacterized protein LOC101506193    110   1e-26   
ref|XP_008379066.1|  PREDICTED: uncharacterized protein LOC103442092    109   1e-26   
ref|XP_004291963.1|  PREDICTED: uncharacterized protein LOC101299831    109   2e-26   
ref|XP_003588863.1|  hypothetical protein MTR_1g014110                  105   4e-25   
ref|XP_010670807.1|  PREDICTED: uncharacterized protein LOC104887770    105   1e-24   
ref|XP_008377636.1|  PREDICTED: uncharacterized protein LOC103440718    102   5e-24   
ref|XP_010912176.1|  PREDICTED: uncharacterized protein LOC105038162    100   4e-23   
ref|XP_008813081.1|  PREDICTED: uncharacterized protein LOC103723810    100   4e-23   
ref|XP_002324915.2|  hypothetical protein POPTR_0018s02620g             100   5e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011036691.1|  PREDICTED: uncharacterized protein LOC105134106  99.4    7e-23   
ref|XP_010101023.1|  hypothetical protein L484_013201                 99.0    8e-23   
ref|XP_002459894.1|  hypothetical protein SORBIDRAFT_02g013190        95.5    4e-21   Sorghum bicolor [broomcorn]
ref|XP_004977248.1|  PREDICTED: uncharacterized protein LOC101752778  93.2    3e-20   
ref|NP_001062611.1|  Os09g0127700                                     89.4    9e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007161083.1|  hypothetical protein PHAVU_001G041500g           82.4    1e-16   
gb|KHN37084.1|  hypothetical protein glysoja_009112                   81.3    3e-16   
ref|XP_008366080.1|  PREDICTED: uncharacterized protein LOC103429726  81.6    5e-16   
gb|KHN15299.1|  hypothetical protein glysoja_044361                   79.3    1e-15   
ref|NP_001145240.1|  hypothetical protein                             78.6    5e-15   Zea mays [maize]
dbj|BAK03593.1|  predicted protein                                    68.6    2e-11   
ref|XP_003577019.1|  PREDICTED: uncharacterized protein LOC100823613  66.2    2e-10   
ref|XP_007226554.1|  hypothetical protein PRUPE_ppa024627mg           61.6    4e-09   
gb|KHG17657.1|  Putative uncharacterized ycf15                        62.0    6e-09   
gb|EPS62568.1|  hypothetical protein M569_12222                       58.9    2e-08   
emb|CAN76000.1|  hypothetical protein VITISV_019164                   60.1    3e-07   Vitis vinifera
ref|XP_004507743.1|  PREDICTED: uncharacterized protein LOC101489664  55.8    4e-07   
ref|XP_007204520.1|  hypothetical protein PRUPE_ppa018177mg           55.8    4e-07   
ref|XP_008226859.1|  PREDICTED: uncharacterized protein LOC103326422  55.5    7e-07   
ref|XP_003610313.1|  hypothetical protein MTR_4g130810                55.1    8e-07   
ref|XP_008394315.1|  PREDICTED: uncharacterized protein LOC103456380  54.7    1e-06   
ref|XP_002308406.1|  hypothetical protein POPTR_0006s19740g           53.9    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009366186.1|  PREDICTED: uncharacterized protein LOC103955989  53.1    3e-06   
ref|XP_006453675.1|  hypothetical protein CICLE_v10010389mg           52.4    7e-06   
ref|XP_010106788.1|  hypothetical protein L484_009227                 49.3    9e-05   
emb|CDP10243.1|  unnamed protein product                              50.1    1e-04   
gb|EPS71167.1|  hypothetical protein M569_03598                       48.9    1e-04   
ref|XP_009612074.1|  PREDICTED: uncharacterized protein LOC104105467  48.5    4e-04   
ref|XP_011079453.1|  PREDICTED: uncharacterized protein LOC105162970  49.7    6e-04   



>ref|XP_006357089.1| PREDICTED: uncharacterized protein LOC102594143 [Solanum tuberosum]
Length=101

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  QEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAISGA  420
            +EWR  ADTHKMSPEEVK+AGVE S+RPPGHNPGTVLHQR  LP+S+TT+ IAGLAI+GA
Sbjct  6    EEWRKMADTHKMSPEEVKKAGVESSRRPPGHNPGTVLHQRGRLPYSITTMTIAGLAITGA  65

Query  421  VWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            VWY T+YA KKPEASA DVAKVA G GGP+ THPRK
Sbjct  66   VWYGTMYAMKKPEASAVDVAKVATGVGGPKDTHPRK  101



>gb|EYU21994.1| hypothetical protein MIMGU_mgv1a021797mg [Erythranthe guttata]
Length=100

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G +EWR  ADTHKMSPEEV+ AGVE SKRPPG NPG +LHQRR LP+SLTTI + G A++
Sbjct  3    GNEEWRKNADTHKMSPEEVRSAGVEASKRPPGSNPGGILHQRRSLPYSLTTITLVGFAVT  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GA+WYFTLY KKKPEA+AADVA+VA G   PE T PRK
Sbjct  63   GAMWYFTLYTKKKPEATAADVARVATGMANPEDTRPRK  100



>ref|XP_006483484.1| PREDICTED: uncharacterized protein LOC102630261 [Citrus sinensis]
 gb|KDO67440.1| hypothetical protein CISIN_1g042368mg [Citrus sinensis]
Length=100

 Score =   132 bits (331),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  QEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAISGA  420
            + WR  ADTHKMSPEEVKRAGVE SKRPPGHNPG +LHQRR LPFS TTIAI G AI G 
Sbjct  5    EGWRKNADTHKMSPEEVKRAGVEGSKRPPGHNPGGILHQRRSLPFSTTTIAITGFAIVGV  64

Query  421  VWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            + Y TLYAKKKPEA+A DVA+V+     PE THPRK
Sbjct  65   IGYLTLYAKKKPEATAGDVARVSTNVARPEDTHPRK  100



>ref|XP_004244525.1| PREDICTED: uncharacterized protein LOC101251603 [Solanum lycopersicum]
Length=101

 Score =   131 bits (329),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  QEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAISGA  420
            +EWR  ADTHKMSPEEVK+AGVE S+RPPGHNPGT+LHQR  LP+S+TT+ I GL I+GA
Sbjct  6    EEWRKMADTHKMSPEEVKKAGVESSRRPPGHNPGTILHQRGRLPYSITTMTIVGLGIAGA  65

Query  421  VWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            +WY T+YA KKPEASA DVAKVA G GGP+ THPRK
Sbjct  66   IWYGTMYAMKKPEASAVDVAKVATGVGGPKDTHPRK  101



>ref|XP_010526251.1| PREDICTED: uncharacterized protein LOC104803862 [Tarenaya hassleriana]
Length=103

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  220  MESGTGKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIA  399
            M  G G+++WR  ADTHKMSPE VK AGVE SKRPPGHNPG VLHQRR LP+S TT+ IA
Sbjct  1    MAIGGGEEDWRKNADTHKMSPENVKAAGVESSKRPPGHNPGGVLHQRRKLPYSYTTMGIA  60

Query  400  GLAISGAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GL ISGAV Y  +Y +KKPEA+A DVAK   G G PE THPRK
Sbjct  61   GLLISGAVMYAAIYVRKKPEATAVDVAKATTGLGRPEDTHPRK  103



>ref|XP_009126604.1| PREDICTED: uncharacterized protein LOC103851502 [Brassica rapa]
 emb|CDX75199.1| BnaA01g05030D [Brassica napus]
 emb|CDX68792.1| BnaC01g06610D [Brassica napus]
Length=100

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+ +WR  ADT KMSPE VK AGVE SKRPPG NPG VLHQRR+LP+S TT+AIAGLAIS
Sbjct  3    GENDWRKTADTTKMSPEGVKAAGVESSKRPPGSNPGGVLHQRRNLPYSYTTMAIAGLAIS  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GAV Y  +YAKKKPEASA DVAKVA G   PE THPRK
Sbjct  63   GAVMYTVMYAKKKPEASATDVAKVATGTAKPEDTHPRK  100



>gb|KDP33509.1| hypothetical protein JCGZ_07080 [Jatropha curcas]
Length=100

 Score =   129 bits (323),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  QEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAISGA  420
            +EWR AADTHKMSPEEVK AGVE SKRPPGHNPG VLHQRR+LPFS TTI +AG  I+ A
Sbjct  5    EEWRQAADTHKMSPEEVKAAGVEGSKRPPGHNPGGVLHQRRNLPFSKTTITVAGFFITAA  64

Query  421  VWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            + Y  LYAKKKPEASA DVAKVA G   P  THPRK
Sbjct  65   IGYMVLYAKKKPEASARDVAKVATGTADPRDTHPRK  100



>ref|XP_006412549.1| hypothetical protein EUTSA_v10026655mg [Eutrema salsugineum]
 gb|ESQ54002.1| hypothetical protein EUTSA_v10026655mg [Eutrema salsugineum]
Length=100

 Score =   128 bits (322),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+ +WR  ADT KMSPE VK AGVE SKRPPG NPG VLHQRR+LP+S TT+AIAGLAIS
Sbjct  3    GENDWRKTADTTKMSPEGVKAAGVESSKRPPGTNPGGVLHQRRNLPYSYTTMAIAGLAIS  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GAV Y  +Y KKKPEASA+DVAK A G   PE THPRK
Sbjct  63   GAVMYTVMYVKKKPEASASDVAKAATGTAKPEDTHPRK  100



>ref|XP_009601690.1| PREDICTED: uncharacterized protein LOC104096936 [Nicotiana tomentosiformis]
Length=100

 Score =   128 bits (322),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G +EWR  ADT KMSPEEVK AGVE S RPPGHNPGTVLHQR  LP+S+TT+A+ G AI+
Sbjct  3    GNEEWRKMADTTKMSPEEVKNAGVEASMRPPGHNPGTVLHQRGRLPYSITTMALVGFAIT  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GA+WY T+YA KKPEA+A DVAKVA G  GPE T PRK
Sbjct  63   GAIWYGTMYAMKKPEATAVDVAKVATGVAGPEDTRPRK  100



>ref|XP_009783119.1| PREDICTED: uncharacterized protein LOC104231762 [Nicotiana sylvestris]
Length=100

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G +EWR  ADT KMSPEEVK AGVE SKRPPGH+PGTVLHQR  LP+S+TT+A+ G AI+
Sbjct  3    GNEEWRKMADTTKMSPEEVKNAGVEASKRPPGHSPGTVLHQRGRLPYSITTMALVGFAIT  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GA+WY T+YA KKPEA+A DVAKVA+G GGPE T PRK
Sbjct  63   GAIWYGTMYAMKKPEATAVDVAKVASGVGGPEDTRPRK  100



>ref|XP_011081973.1| PREDICTED: uncharacterized protein LOC105164866 [Sesamum indicum]
Length=100

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            GK+EWR  ADTHKMSPEEVK AGVE SKRPPGHNPG +LHQRR LP+   T+ + G+A+ 
Sbjct  3    GKEEWRKNADTHKMSPEEVKWAGVEASKRPPGHNPGGILHQRRSLPYGPYTVTLVGVALV  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            G +WYFTLYAKKKPEASA DVAKV+ G   PE T PRK
Sbjct  63   GTMWYFTLYAKKKPEASAVDVAKVSVGAANPEETRPRK  100



>ref|NP_194911.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB40753.1| putative protein [Arabidopsis thaliana]
 emb|CAB79901.1| putative protein [Arabidopsis thaliana]
 gb|AAR24180.1| At4g31830 [Arabidopsis thaliana]
 gb|AAR92326.1| At4g31830 [Arabidopsis thaliana]
 gb|AEE85965.1| uncharacterized protein AT4G31830 [Arabidopsis thaliana]
Length=100

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+++WR  ADT KMS E VK AGVE SKRPPG NPG VLHQRR+LP+S TT+A+AGLAIS
Sbjct  3    GEEDWRKTADTTKMSSEGVKAAGVESSKRPPGSNPGGVLHQRRNLPYSYTTMALAGLAIS  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GA+ Y  +YAKKKPEA+A DVAK A G   PE THPRK
Sbjct  63   GAIMYTVMYAKKKPEATATDVAKAATGTAKPEDTHPRK  100



>emb|CDP07853.1| unnamed protein product [Coffea canephora]
Length=100

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G ++WRN ADTHKMSPE+V++AGV+ SKRPPGH+PG VLHQRR+LP+S TT+A+ G AI+
Sbjct  3    GGEDWRNNADTHKMSPEDVRKAGVDNSKRPPGHSPGGVLHQRRNLPYSPTTMAVIGFAIA  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            G+++YFTLYAKKK EASA DVA+V+     P  T PRK
Sbjct  63   GSIFYFTLYAKKKAEASARDVARVSTNTADPHDTRPRK  100



>ref|XP_010447548.1| PREDICTED: uncharacterized protein LOC104730140 [Camelina sativa]
Length=100

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+++WR  ADT KMS E VK AGVE SKRPPG NPG VLHQRR+LP+S TT+A+ GLAIS
Sbjct  3    GEEDWRKTADTTKMSSESVKAAGVESSKRPPGSNPGGVLHQRRNLPYSYTTMALVGLAIS  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GAV Y  +YAKKKPEASA DVAK A G   PE THPRK
Sbjct  63   GAVMYSVMYAKKKPEASATDVAKAATGTAKPEDTHPRK  100



>ref|XP_010437987.1| PREDICTED: uncharacterized protein LOC104721652 [Camelina sativa]
Length=100

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+++WR  ADT KMS E VK AGVE SKRPPG NPG VLHQRR+LP+S TT+ +AGLAIS
Sbjct  3    GEEDWRKTADTTKMSSESVKAAGVESSKRPPGSNPGGVLHQRRNLPYSYTTMVLAGLAIS  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GAV Y  +YAKKKPEASA DVAK A G   PE THPRK
Sbjct  63   GAVMYSVMYAKKKPEASATDVAKAATGTAKPEDTHPRK  100



>ref|XP_002867277.1| hypothetical protein ARALYDRAFT_913282 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43536.1| hypothetical protein ARALYDRAFT_913282 [Arabidopsis lyrata subsp. 
lyrata]
Length=100

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+ +WR  ADT KMS E VK AGVE SKRPPG NPG VLHQRR+LP+S TT+A+AGLAIS
Sbjct  3    GEDDWRKTADTTKMSSEGVKAAGVESSKRPPGSNPGGVLHQRRNLPYSYTTMALAGLAIS  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GA+ Y  +YAKKKPEA+A DVAK A G   PE THPRK
Sbjct  63   GAIMYTVMYAKKKPEATATDVAKAATGTAKPEDTHPRK  100



>ref|XP_006284964.1| hypothetical protein CARUB_v10006267mg [Capsella rubella]
 gb|EOA17862.1| hypothetical protein CARUB_v10006267mg [Capsella rubella]
Length=100

 Score =   125 bits (315),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+++WR  ADT KMS E VK AGVE SKRPPG NPG VLHQRR+LP+S TT+A+ GLAIS
Sbjct  3    GEEDWRKTADTTKMSSEGVKTAGVESSKRPPGSNPGGVLHQRRNLPYSYTTMALVGLAIS  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GAV Y  +YAKKKPEASA DVAK A G   PE THPRK
Sbjct  63   GAVMYTVMYAKKKPEASATDVAKAATGTAKPEDTHPRK  100



>emb|CDY39881.1| BnaC03g67360D [Brassica napus]
 emb|CDY23312.1| BnaA08g12340D [Brassica napus]
Length=100

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+ +WR  ADT KMS E VK AGVE SKRPPG NPG VLHQRR+LP+S TT+A+AGLAIS
Sbjct  3    GENDWRKTADTTKMSSEGVKAAGVESSKRPPGSNPGGVLHQRRNLPYSYTTMALAGLAIS  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GA+ Y  +Y KKKPEASA DVAK A G   PE THPRK
Sbjct  63   GAIMYTVMYVKKKPEASATDVAKAATGTAKPEDTHPRK  100



>ref|XP_008452845.1| PREDICTED: uncharacterized protein LOC103493743 [Cucumis melo]
Length=151

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = +1

Query  148  AQTDNHRSN*NSCVLASLLI*QLAMESGTGKQEWRNAADTHKMSPEEVKRAGVEESKRPP  327
            A  + H++      L  L I +   E G+  +EWR  ADTHKM PE+VK AGVE SKRPP
Sbjct  26   ATLERHKNFNELYYLLHLKIVERNREMGSN-EEWRKNADTHKMRPEDVKAAGVEASKRPP  84

Query  328  GHNPGTVLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaaggggP  507
            GH+PGT+LHQRR LP+S TT+ +AGL I GA+ YFTLY+ KKPEASA DVAKVA     P
Sbjct  85   GHHPGTILHQRRSLPYSYTTMTVAGLLIVGAIGYFTLYSMKKPEASAKDVAKVATNVAEP  144

Query  508  ESTHPRK  528
            E T PRK
Sbjct  145  EDTKPRK  151



>ref|XP_010432810.1| PREDICTED: uncharacterized protein LOC104717005 [Camelina sativa]
Length=100

 Score =   123 bits (309),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+++WR  ADT KMS E VK AGVE SKRPPG N G VLHQRR+LP+S TT+ +AGLAIS
Sbjct  3    GEEDWRKTADTTKMSSESVKAAGVESSKRPPGSNLGGVLHQRRNLPYSYTTMVLAGLAIS  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GAV Y  +YAKKKPEASA DVAK A G   PE THPRK
Sbjct  63   GAVMYSVMYAKKKPEASATDVAKAATGTAKPEDTHPRK  100



>emb|CDP07849.1| unnamed protein product [Coffea canephora]
 emb|CDP07850.1| unnamed protein product [Coffea canephora]
Length=100

 Score =   123 bits (308),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G ++WRN ADT KMS E+V++AG + SKRPPGHNPG VLHQRR+LP+S TT+A+ G  I+
Sbjct  3    GDEDWRNNADTQKMSSEDVRKAGADNSKRPPGHNPGGVLHQRRNLPYSPTTMALIGFTIA  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            G+++YFTLYAKKKPEASA DVA+V+     P  T PRK
Sbjct  63   GSIFYFTLYAKKKPEASARDVARVSTNTADPHDTGPRK  100



>gb|KFK29783.1| hypothetical protein AALP_AA7G178700 [Arabis alpina]
Length=100

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+ +WR  ADT KMSPE VK AGV+ SKRPPG NPG VLHQRR++P+S TT+AIAGLAI+
Sbjct  3    GENDWRKNADTTKMSPEGVKAAGVDPSKRPPGSNPGGVLHQRRNMPYSYTTMAIAGLAIT  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            G + Y  LY+KKKPEASA DVAK   G   PE THPRK
Sbjct  63   GVIMYTVLYSKKKPEASARDVAKAEIGMAKPEDTHPRK  100



>ref|XP_007226027.1| hypothetical protein PRUPE_ppa013842mg [Prunus persica]
 gb|EMJ27226.1| hypothetical protein PRUPE_ppa013842mg [Prunus persica]
Length=100

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G ++WR  ADT KMS EEVKRAGVE SKRPPGHNPG VLHQRR LPFS T +AI G  I+
Sbjct  3    GNEDWRKTADTTKMSAEEVKRAGVEASKRPPGHNPGGVLHQRRRLPFSPTAMAITGFLIT  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            G + YFTLY  KKPEASA DVA+VA     PE THPRK
Sbjct  63   GVIGYFTLYHLKKPEASAGDVARVATNVAEPEHTHPRK  100



>ref|XP_002515422.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46871.1| conserved hypothetical protein [Ricinus communis]
Length=100

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G ++WR  ADTHKMSPEEVK AG+E SKRPPGHNPG VLHQRR LPFS TT+ + G  I 
Sbjct  3    GDEDWRKQADTHKMSPEEVKAAGIEGSKRPPGHNPGGVLHQRRKLPFSTTTMTVGGFLIV  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
              + Y  LYAKKKPEASA DVA+VA     P  THPRK
Sbjct  63   ATIGYMVLYAKKKPEASAHDVARVATNTADPRDTHPRK  100



>ref|XP_008220670.1| PREDICTED: uncharacterized protein LOC103320730 [Prunus mume]
Length=100

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G ++WR  ADT KMS EEVKRAGVE SKRPPGHNPG VLHQRR LPFS T +AI G  I+
Sbjct  3    GNEDWRKTADTTKMSAEEVKRAGVEASKRPPGHNPGGVLHQRRKLPFSPTAMAITGFLIT  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            G + YFTLY  KKPEASA DVA+VA    GPE THPRK
Sbjct  63   GVIGYFTLYHLKKPEASAGDVARVATNVAGPEHTHPRK  100



>ref|XP_010042210.1| PREDICTED: uncharacterized protein LOC104431242 [Eucalyptus grandis]
Length=102

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G  +WR  ADTHKMSPEEV+ AGVE SKRPPGH PG VLHQRR LP+S   +AIAG  I+
Sbjct  5    GDGDWRKMADTHKMSPEEVRAAGVEASKRPPGHGPGEVLHQRRGLPYSFPAMAIAGFLIT  64

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GAV YF LY  KKPEA A DVAKVA G  GPE T PRK
Sbjct  65   GAVGYFALYVLKKPEADAGDVAKVATGVAGPEDTRPRK  102



>ref|XP_004145498.1| PREDICTED: uncharacterized protein LOC101212329 [Cucumis sativus]
 ref|XP_004157097.1| PREDICTED: uncharacterized LOC101212329 [Cucumis sativus]
 gb|KGN55424.1| hypothetical protein Csa_4G651900 [Cucumis sativus]
Length=100

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  QEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAISGA  420
            +EWR  ADTHKM PE+VK AGVE SKRPPGH+PGTVLHQRR LP+S TT+ +AGL I G 
Sbjct  5    EEWRKNADTHKMKPEDVKAAGVEASKRPPGHHPGTVLHQRRSLPYSYTTMTVAGLLIVGT  64

Query  421  VWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            + Y TLY  KKPEASA DVAKVA     PE T PRK
Sbjct  65   IGYLTLYTLKKPEASAKDVAKVATNVAEPEETKPRK  100



>ref|XP_002285534.1| PREDICTED: uncharacterized protein LOC100254214 [Vitis vinifera]
Length=102

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  TGKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAI  411
            +GK+EWR  ADTH M  EEVK  GVE SKRPPGHNPG VLHQRR LP+S  T+A+AG  I
Sbjct  4    SGKEEWRKMADTHMMKDEEVKTKGVEASKRPPGHNPGEVLHQRRKLPYSPPTMAVAGFLI  63

Query  412  SGAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            +  + YFTLYA KKPEA+A DVAKVA G   P+ THPRK
Sbjct  64   AATLGYFTLYAMKKPEATAKDVAKVATGTAEPQDTHPRK  102



>emb|CBI21144.3| unnamed protein product [Vitis vinifera]
Length=112

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  TGKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAI  411
            +GK+EWR  ADTH M  EEVK  GVE SKRPPGHNPG VLHQRR LP+S  T+A+AG  I
Sbjct  2    SGKEEWRKMADTHMMKDEEVKTKGVEASKRPPGHNPGEVLHQRRKLPYSPPTMAVAGFLI  61

Query  412  SGAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            +  + YFTLYA KKPEA+A DVAKVA G   P+ THPRK
Sbjct  62   AATLGYFTLYAMKKPEATAKDVAKVATGTAEPQDTHPRK  100



>ref|XP_010051081.1| PREDICTED: uncharacterized protein LOC104439762 [Eucalyptus grandis]
 gb|KCW81239.1| hypothetical protein EUGRSUZ_C02607 [Eucalyptus grandis]
Length=102

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G  +WR  ADTHKMSPEEV+ AGVE SKRPPGH  G VLHQRR LP+S   +AIAGL I+
Sbjct  5    GDGDWRKMADTHKMSPEEVRTAGVEASKRPPGHGLGEVLHQRRGLPYSFPAMAIAGLLIT  64

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GAV YF LY  KKPEA A DVAKVA G  GPE T PRK
Sbjct  65   GAVGYFALYMLKKPEADAGDVAKVATGVAGPEDTRPRK  102



>ref|XP_010273617.1| PREDICTED: uncharacterized protein LOC104609100 [Nelumbo nucifera]
Length=100

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+++WR  ADTHKM PE+V+ AGVE SKR PG  PG VLHQRR LPFS  T+A  G  I 
Sbjct  3    GEEDWRKMADTHKMRPEDVEAAGVEASKRAPGQQPGGVLHQRRALPFSPMTMAAGGFLIV  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GA+ YFTLYAKKKPEA+A DVAKV AG G PE+T PRK
Sbjct  63   GAIAYFTLYAKKKPEATAVDVAKVTAGAGDPETTRPRK  100



>ref|XP_009363597.1| PREDICTED: uncharacterized protein LOC103953561 [Pyrus x bretschneideri]
Length=100

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G ++WR  A+T KMS EEVKRAG+E ++RPPGHNPG VLHQRR LPF   T+A+ G  I 
Sbjct  3    GDEDWRKTAETTKMSSEEVKRAGLEGAQRPPGHNPGGVLHQRRGLPFGPITMAVTGFLIV  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            GA+ YFTLY  KKPEA+A DV KV+A    PE T PRK
Sbjct  63   GAIGYFTLYTLKKPEATAGDVVKVSANVATPEDTSPRK  100



>ref|XP_009109921.1| PREDICTED: uncharacterized protein LOC103835489 [Brassica rapa]
Length=124

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G+ +WR  ADT KMS E VK AGVE SKRPPG NPG VLHQRR+LP+S TT+A+AGLAIS
Sbjct  3    GENDWRKTADTTKMSSEGVKAAGVESSKRPPGSNPGGVLHQRRNLPYSYTTMALAGLAIS  62

Query  415  GAVWYFTLYAKKKPE  459
            GA+ Y  +Y KKKPE
Sbjct  63   GAIMYTVMYVKKKPE  77



>ref|XP_004498805.1| PREDICTED: uncharacterized protein LOC101506193 [Cicer arietinum]
Length=103

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 75/102 (74%), Gaps = 3/102 (3%)
 Frame = +1

Query  232  TGKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGT---VLHQRRHLPFSLTTIAIAG  402
            +G ++WR  A+THKMS EEVK  GVE SKRPPG N GT   VLHQR+ LPFS TTI ++G
Sbjct  2    SGNEDWRKNAETHKMSSEEVKACGVEGSKRPPGSNHGTARNVLHQRKSLPFSFTTITLSG  61

Query  403  LAISGAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            L I+ A+ Y  LY KKKPEASA DVAKV+ G   P+ THP+K
Sbjct  62   LLITAAIGYTVLYTKKKPEASAVDVAKVSVGVANPDDTHPKK  103



>ref|XP_008379066.1| PREDICTED: uncharacterized protein LOC103442092 [Malus domestica]
Length=100

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G ++WR  A+T KMSPEEVKRAG+E ++RPPGHNPG VLHQRR LP     +A+ G  I 
Sbjct  3    GDEDWRKTAETTKMSPEEVKRAGLEGAQRPPGHNPGGVLHQRRGLPLGPIIMAVTGFLIV  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            G + YF+LY  KKPEA+A DVAKV+A    PE T PRK
Sbjct  63   GTIGYFSLYTLKKPEATAGDVAKVSANVATPEDTRPRK  100



>ref|XP_004291963.1| PREDICTED: uncharacterized protein LOC101299831 [Fragaria vesca 
subsp. vesca]
Length=110

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G +EWR  ADTHKMSPEEV RAGVE SKRPPG +PG VLHQRR LPFS T + + G  I 
Sbjct  4    GNEEWRKTADTHKMSPEEVNRAGVEGSKRPPGQHPGGVLHQRRTLPFSPTGMFLGGFLIC  63

Query  415  GAVWYFTLYAKKKPEasaadvakvaag-gggPESTHPR  525
             A+ YFTLY+ KKPEASA DVA+V+      P+ T PR
Sbjct  64   TAIGYFTLYSLKKPEASAGDVARVSTNITATPDDTKPR  101



>ref|XP_003588863.1| hypothetical protein MTR_1g014110 [Medicago truncatula]
 gb|AES59114.1| transmembrane protein, putative [Medicago truncatula]
Length=107

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 6/105 (6%)
 Frame = +1

Query  232  TGKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGT------VLHQRRHLPFSLTTIA  393
            T  ++WR  A+THKMS EEVK AGVE SKRPPG N G+      VLHQR+ LP++ TT+ 
Sbjct  3    TTNEDWRKNAETHKMSSEEVKAAGVEASKRPPGSNHGSAAAGANVLHQRKSLPYNFTTMT  62

Query  394  IAGLAISGAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            I GL I+ A+ Y  LY KKKPEASA DVAKV AG   PE THP+K
Sbjct  63   IGGLLITAAIGYTVLYTKKKPEASAVDVAKVTAGVANPEDTHPKK  107



>ref|XP_010670807.1| PREDICTED: uncharacterized protein LOC104887770 [Beta vulgaris 
subsp. vulgaris]
Length=131

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHN--PGTVLHQRRHLPFSLTTIAIAGLA  408
            G Q WR  ADTHKM+PE VK AGVE S+RPPGH   PG VLHQRR LPFS TT+ IAG A
Sbjct  30   GDQSWRKTADTHKMTPEHVKAAGVEASQRPPGHGRGPGEVLHQRRRLPFSYTTMTIAGFA  89

Query  409  ISGAVWYFTLYAKKKPEasaadvakvaaggggPESTHPR  525
            I+  + Y  LY+KKK E  A DVA+VA     PE+T  R
Sbjct  90   ITAIIGYGVLYSKKKAEVDAVDVARVATNTARPENTENR  128



>ref|XP_008377636.1| PREDICTED: uncharacterized protein LOC103440718 [Malus domestica]
Length=100

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G ++WR  A+T KMS EEVKRAG++ S+RPPGHNPG  LHQRR +P   T  A AG    
Sbjct  3    GDEDWRKTAETTKMSXEEVKRAGLQGSQRPPGHNPGGXLHQRRLVPXGPTAXAXAGXLXV  62

Query  415  GAVWYFTLYAKKKPEasaadvakvaaggggPESTHPRK  528
            G + YFTLYA+KKPEA+A DVA+V+A    PE T PRK
Sbjct  63   GTIXYFTLYARKKPEATAGDVARVSANVASPEDTRPRK  100



>ref|XP_010912176.1| PREDICTED: uncharacterized protein LOC105038162 [Elaeis guineensis]
Length=108

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  226  SGTGKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGL  405
            S T K+ WR+ ADTHKM PE+VK  GVE SKRPPG +PG VLHQRR+LPFS   +A+ G 
Sbjct  4    SNTEKEGWRSNADTHKMRPEDVKAQGVEASKRPPGQHPGGVLHQRRNLPFSPAAMAVGGF  63

Query  406  AISGAVWYFTLYAKKKP  456
             I  A+ Y TLY+K KP
Sbjct  64   LIVAAIGYVTLYSKSKP  80



>ref|XP_008813081.1| PREDICTED: uncharacterized protein LOC103723810 [Phoenix dactylifera]
Length=108

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  226  SGTGKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGL  405
            S + +  WR+ ADTHKM PE+VK  GVE SKRPPG +PG VLHQRR++PF+   +A+ G 
Sbjct  4    SDSDRDGWRSNADTHKMRPEDVKAQGVEASKRPPGQHPGGVLHQRRNMPFNPAAMAVGGF  63

Query  406  AISGAVWYFTLYAKKKP  456
             I  A+ YFTLYAK KP
Sbjct  64   LIVAAIGYFTLYAKSKP  80



>ref|XP_002324915.2| hypothetical protein POPTR_0018s02620g [Populus trichocarpa]
 gb|EEF03480.2| hypothetical protein POPTR_0018s02620g [Populus trichocarpa]
Length=108

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +1

Query  259  ADTHKMSPEEVKRAGVEESKRPPGHN-PGTVLHQRRHLPFSLTTIAIAGLAISGAVWYFT  435
            A THKMSPEEV+R G E SKRPPG+N PG VLHQRR LPFS  T+A+ G  I+ A+ +  
Sbjct  18   AVTHKMSPEEVRRTGAEGSKRPPGNNNPGEVLHQRRKLPFSPATMAVTGFGITAAIGFMV  77

Query  436  LYAKKKPEasaadvakvaaggggPESTHPRK  528
            LYAKKKPEASA+DVAKVA G   P+ THPR+
Sbjct  78   LYAKKKPEASASDVAKVATGAADPKDTHPRE  108



>ref|XP_011036691.1| PREDICTED: uncharacterized protein LOC105134106 [Populus euphratica]
Length=86

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = +1

Query  274  MSPEEVKRAGVEESKRPPGHN-PGTVLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKK  450
            MSPEEV+R G E SKRPPG+N PG VLHQRR LPFS  T+A+ G  I+ A+ Y  LYAKK
Sbjct  1    MSPEEVRRTGAEGSKRPPGNNNPGEVLHQRRKLPFSTATMAVTGFGITAAIGYMVLYAKK  60

Query  451  KPEasaadvakvaaggggPESTHPRK  528
            KPEASA+DVAKVA G   PE THPR+
Sbjct  61   KPEASASDVAKVATGAADPEDTHPRE  86



>ref|XP_010101023.1| hypothetical protein L484_013201 [Morus notabilis]
 gb|EXB86671.1| hypothetical protein L484_013201 [Morus notabilis]
Length=86

 Score = 99.0 bits (245),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +1

Query  274  MSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAI-AGLAISGAVWYFTLYAKK  450
            MSPEEVK AG E+SKRPPG NPG VLHQRR LP+S TT+AI AGL I GAV YF  Y+ K
Sbjct  1    MSPEEVKAAGAEQSKRPPGQNPGEVLHQRRKLPYSPTTMAIAAGLVIVGAVAYFVAYSTK  60

Query  451  KPEasaadvakvaaggggPESTHPRK  528
            KPEASA DVAKV  G   PE T PRK
Sbjct  61   KPEASAKDVAKVTTGTAHPEETRPRK  86



>ref|XP_002459894.1| hypothetical protein SORBIDRAFT_02g013190 [Sorghum bicolor]
 gb|EER96415.1| hypothetical protein SORBIDRAFT_02g013190 [Sorghum bicolor]
Length=116

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  232  TGKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAI  411
            +G +EWR  ADTHKMSPEEV+ AGVE S RPPG  PG VLHQR  LP+   T+A+ G  I
Sbjct  4    SGTEEWRRNADTHKMSPEEVRAAGVEASMRPPGRGPGEVLHQRGRLPYGPGTMALVGFGI  63

Query  412  SGAVWYFTLYAKKKP  456
             G + Y  LY K +P
Sbjct  64   VGVIGYLVLYQKARP  78



>ref|XP_004977248.1| PREDICTED: uncharacterized protein LOC101752778 [Setaria italica]
Length=109

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  232  TGKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAI  411
            +G +EWR  ADTHKMS EEV+ AGVE S RPPG  PG VLHQR  LP+   T+A+ G  I
Sbjct  4    SGTEEWRRNADTHKMSAEEVRAAGVEASMRPPGRGPGEVLHQRGRLPYGPGTMALVGFGI  63

Query  412  SGAVWYFTLYAKKKP  456
             GA+ +  LY K +P
Sbjct  64   VGAIGFLVLYQKARP  78



>ref|NP_001062611.1| Os09g0127700 [Oryza sativa Japonica Group]
 dbj|BAD22375.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24525.1| Os09g0127700 [Oryza sativa Japonica Group]
 gb|EAZ08187.1| hypothetical protein OsI_30446 [Oryza sativa Indica Group]
 gb|EAZ43815.1| hypothetical protein OsJ_28434 [Oryza sativa Japonica Group]
 dbj|BAG98191.1| unnamed protein product [Oryza sativa Japonica Group]
Length=121

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +1

Query  232  TGKQEWRNAADTHKMSPEEVKRAGVEESKRPP--GHNPGTVLHQRRHLPFSLTTIAIAGL  405
            +G +EWR   DTHKMS EEV+ AGVE S RPP  GH PG VLHQR  +P+   T+A+AGL
Sbjct  4    SGTEEWRRNTDTHKMSAEEVRAAGVEASMRPPGRGHGPGEVLHQRGRMPYGPGTMALAGL  63

Query  406  AISGAVWYFTLYAKKKP  456
             I G + Y  LY K +P
Sbjct  64   GIFGVLGYLVLYHKARP  80



>ref|XP_007161083.1| hypothetical protein PHAVU_001G041500g [Phaseolus vulgaris]
 gb|ESW33077.1| hypothetical protein PHAVU_001G041500g [Phaseolus vulgaris]
Length=86

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  271  KMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKK  450
            KM P+   +A  E SKRPPGH    VLHQR+ LP+S TT+A+AG  ++ AV Y  LYAKK
Sbjct  4    KMDPQ---KAQAEASKRPPGHGATEVLHQRKSLPYSYTTMAVAGFLVTAAVGYTVLYAKK  60

Query  451  KPEasaadvakvaaggggPESTHPRK  528
            KPEASA DVAKV+AG   P+ THP K
Sbjct  61   KPEASAKDVAKVSAGVAQPQDTHPEK  86



>gb|KHN37084.1| hypothetical protein glysoja_009112 [Glycine soja]
Length=82

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  292  KRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaa  471
            ++A  E SKRPPGH    VLHQR+ LPF+ TT+ IAGL I+ AV Y  LY KKKPEASA 
Sbjct  4    QKAQAEASKRPPGHGATEVLHQRKSLPFNFTTMTIAGLVITAAVGYTVLYVKKKPEASAK  63

Query  472  dvakvaaggggPESTHPRK  528
            DVAKV  G   PE THP++
Sbjct  64   DVAKVTLGVANPEETHPKR  82



>ref|XP_008366080.1| PREDICTED: uncharacterized protein LOC103429726 [Malus domestica]
Length=121

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +1

Query  235  GKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAIS  414
            G  +WR   +T KMSP EVKR  +E ++RPPGHNPG VLHQRR LPF   T+A+ G    
Sbjct  3    GDADWRKTEETTKMSPNEVKRNRLEGAQRPPGHNPGGVLHQRRGLPFGPITMAVTGFLTV  62

Query  415  GAVWYFTLYAKKKPE  459
            G + YF     K+ E
Sbjct  63   GTIGYFISLQLKQQE  77



>gb|KHN15299.1| hypothetical protein glysoja_044361 [Glycine soja]
Length=82

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  292  KRAGVEESKRPPGHNPGTVLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaa  471
            ++A  E SKRPPGH    VLHQ++ LPFS TT+ IAGL I+ AV Y  LY KKKPEASA 
Sbjct  4    QKAQAEASKRPPGHGATEVLHQKKSLPFSFTTMTIAGLLITAAVGYSVLYVKKKPEASAK  63

Query  472  dvakvaaggggPESTHPR  525
            DV KV+ G   PE THP 
Sbjct  64   DVTKVSVGVAKPEETHPE  81



>ref|NP_001145240.1| hypothetical protein [Zea mays]
 gb|ACG46211.1| hypothetical protein [Zea mays]
 tpg|DAA39554.1| TPA: hypothetical protein ZEAMMB73_323154 [Zea mays]
Length=114

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +1

Query  232  TGKQEWRNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQ--RRHLPFSLTTIAIAGL  405
            +G +EWR  ADTHKMS EEV+ AGVEES RPPG  PG VLHQ  RR LP+   T+A+ G 
Sbjct  4    SGTEEWRRNADTHKMSAEEVRAAGVEESMRPPGRGPGEVLHQRGRRPLPYGPGTMALVGF  63

Query  406  AISGAVWYFTLYAKKK  453
             I G V Y  LY K +
Sbjct  64   GIVGVVGYLVLYQKAR  79



>dbj|BAK03593.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=121

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +1

Query  232  TGKQEWRNAADTHKMSPEEVKRAGVEES--KRPPGHNPGTVLHQR-RHLPFSLTTIAIAG  402
            +G +EWR  ADTHKMSPEEV+ AGVE S      G   G VLHQR   LPF   T+A+ G
Sbjct  4    SGTEEWRRNADTHKMSPEEVRAAGVEASMRPPGRGGGAGEVLHQRGGRLPFGPGTMALMG  63

Query  403  LAISGAVWYFTLYAKKKP  456
              I G + Y  LY K +P
Sbjct  64   FGIVGVIGYLVLYQKARP  81



>ref|XP_003577019.1| PREDICTED: uncharacterized protein LOC100823613 [Brachypodium 
distachyon]
Length=127

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 49/81 (60%), Gaps = 6/81 (7%)
 Frame = +1

Query  232  TGKQEWRNAADTHKMSPEEVKRAGVEES-----KRPPGHNPGTVLHQR-RHLPFSLTTIA  393
            +G +EWR  ADTHKMSPEEV+ AGVE S     +   G  PG VLHQR   LP+   T+A
Sbjct  4    SGTEEWRRNADTHKMSPEEVRAAGVEASMRPPGRAGGGGGPGEVLHQRGGRLPYGPGTMA  63

Query  394  IAGLAISGAVWYFTLYAKKKP  456
            + G  I G + Y  LY K +P
Sbjct  64   LLGFGIVGVIGYMVLYQKARP  84



>ref|XP_007226554.1| hypothetical protein PRUPE_ppa024627mg, partial [Prunus persica]
 gb|EMJ27753.1| hypothetical protein PRUPE_ppa024627mg, partial [Prunus persica]
Length=101

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 9/71 (13%)
 Frame = +1

Query  250  RNAADTHKMSPEEVKRAGVEESKRPPGHNPGTVLHQRRHLPFSLTT-IAIAGLAISGAVW  426
            R   DTHK+SPE+V+RAG E  KR PG         R  L F  T+ +A+ GL  +G + 
Sbjct  9    RKMPDTHKVSPEDVRRAGAEAGKRAPG--------LRSSLYFGATSCMAVTGLLFAGTIG  60

Query  427  YFTLYAKKKPE  459
            Y+TLY KKKP+
Sbjct  61   YYTLYVKKKPD  71



>gb|KHG17657.1| Putative uncharacterized ycf15 [Gossypium arboreum]
Length=147

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -1

Query  440  YKVKYQTAPEMARPAMAMVVRLKGRWRLWWRTVPGLWPGGRFDSSTPALFTSSGLILW  267
            Y  +Y  A  M RP M +VV   G   LW  T PG WPGG FD S PA  TSSGLILW
Sbjct  62   YNTEYPMAAVMRRPPMVIVVMETGSLLLWCNTPPGWWPGGLFDPSKPAALTSSGLILW  119



>gb|EPS62568.1| hypothetical protein M569_12222, partial [Genlisea aurea]
Length=63

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  340  GTVLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaaggggPESTH  519
            G VLHQRR LP++ TT+ +AGLA++G +WYFTLY KKKPEA+A DVA+VAAG   PE TH
Sbjct  1    GEVLHQRRTLPYNFTTVTLAGLALAGGLWYFTLYLKKKPEATAGDVARVAAGVADPEHTH  60

Query  520  PRK  528
            PRK
Sbjct  61   PRK  63



>emb|CAN76000.1| hypothetical protein VITISV_019164 [Vitis vinifera]
Length=773

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +1

Query  292  KRAGVEESKRPP--GHNPGTVLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEas  465
            K+AG   + + P  G +   VLHQR  LP S   +AI GLA   A+ YFTLY KKKPEAS
Sbjct  693  KKAGEAGAPKMPAAGQHSTEVLHQRSKLPHSPLKLAIGGLAFVAALSYFTLYTKKKPEAS  752

Query  466  aadvakvaaggggPESTHPRK  528
            A DVAKV AG   PE THPRK
Sbjct  753  ALDVAKVVAGVSTPEDTHPRK  773



>ref|XP_004507743.1| PREDICTED: uncharacterized protein LOC101489664 [Cicer arietinum]
Length=82

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  322  PPGHNPGTVLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaaggg  501
            PP  +   VLHQR+ +PF    +AI G A    + YF LYA KKPEASA DVAKV+ G  
Sbjct  14   PPRPHSTDVLHQRKKMPFCPMRMAIGGFAAISVLGYFVLYANKKPEASALDVAKVSTGMA  73

Query  502  gPESTHPRK  528
             P+STHPR 
Sbjct  74   HPDSTHPRN  82



>ref|XP_007204520.1| hypothetical protein PRUPE_ppa018177mg, partial [Prunus persica]
 gb|EMJ05719.1| hypothetical protein PRUPE_ppa018177mg, partial [Prunus persica]
Length=85

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +1

Query  280  PEEVKRA-GVEESKRP-PGHNPGTVLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKK  453
            P++VK A G +  K P P  +   VLHQ   + F    +A+ G A+   + YFTLY KKK
Sbjct  1    PQQVKAAAGAQGMKGPSPAQHSTEVLHQTSKVSFCPMRMALGGFAVIVTIGYFTLYTKKK  60

Query  454  PEasaadvakvaaggggPESTHPRK  528
            PEASA DVAKVA G   PE+THPRK
Sbjct  61   PEASALDVAKVATGFSHPENTHPRK  85



>ref|XP_008226859.1| PREDICTED: uncharacterized protein LOC103326422 [Prunus mume]
Length=88

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = +1

Query  280  PEEVKRA-GVEESKRP-PGHNPGTVLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKK  453
            P++VK A G    K P P  +   VLHQ   + F    +A+ G AI   + YFTLY KKK
Sbjct  4    PQQVKAAAGARGMKGPSPAQHSTEVLHQTSKVSFCPMRMALGGFAIIVTIGYFTLYTKKK  63

Query  454  PEasaadvakvaaggggPESTHPRK  528
            PEASA DVAKV  G   PE+THPRK
Sbjct  64   PEASALDVAKVVTGFSHPENTHPRK  88



>ref|XP_003610313.1| hypothetical protein MTR_4g130810 [Medicago truncatula]
 gb|AES92510.1| transmembrane protein, putative [Medicago truncatula]
Length=81

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  322  PPGHNPGTVLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaaggg  501
            PP  +   VLHQR+ +PF    +AI G A    + YF LYA KKPEASA DVAKV+ G  
Sbjct  13   PPRPHSTDVLHQRKKVPFCPMRMAIGGFAAISVLGYFVLYANKKPEASALDVAKVSTGMA  72

Query  502  gPESTHPRK  528
             PE+THPR 
Sbjct  73   HPENTHPRN  81



>ref|XP_008394315.1| PREDICTED: uncharacterized protein LOC103456380 [Malus domestica]
Length=77

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 4/71 (6%)
 Frame = +1

Query  328  GHNPGT----VLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaag  495
            GH+P      +LHQ ++ PF    +AI G A+   + YFTLY+KKKPEA+A DVAKV  G
Sbjct  7    GHSPAQHSPEILHQTKNAPFCPMKMAIGGFAVVVTIGYFTLYSKKKPEATALDVAKVITG  66

Query  496  gggPESTHPRK  528
                +STHPRK
Sbjct  67   TAHQDSTHPRK  77



>ref|XP_002308406.1| hypothetical protein POPTR_0006s19740g [Populus trichocarpa]
 gb|EEE91929.1| hypothetical protein POPTR_0006s19740g [Populus trichocarpa]
Length=74

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  346  VLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaaggggPESTHPR  525
            VLHQRR L       AI G+A+  A+ YF LY KKKPEASA DVAKV  G   P +THPR
Sbjct  14   VLHQRRKLSLCPLKTAIGGVAVVAAIGYFVLYTKKKPEASALDVAKVTVGVANPANTHPR  73

Query  526  K  528
             
Sbjct  74   N  74



>ref|XP_009366186.1| PREDICTED: uncharacterized protein LOC103955989 [Pyrus x bretschneideri]
Length=77

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 4/71 (6%)
 Frame = +1

Query  328  GHNPGT----VLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaag  495
            GH+P      +LHQ ++ PF    +AI G A+   + YFTLY+KKKPEA+A DVAKV +G
Sbjct  7    GHSPAQHSSEILHQSKNAPFCPMKMAIGGFAVVVTIGYFTLYSKKKPEATALDVAKVVSG  66

Query  496  gggPESTHPRK  528
                ++THPRK
Sbjct  67   TAHHDNTHPRK  77



>ref|XP_006453675.1| hypothetical protein CICLE_v10010389mg [Citrus clementina]
 gb|ESR66915.1| hypothetical protein CICLE_v10010389mg [Citrus clementina]
 gb|KDO59391.1| hypothetical protein CISIN_1g045567mg [Citrus sinensis]
Length=74

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  346  VLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaaggggPESTHPR  525
            VLHQR+ L      +A+ G A +G + YF LY+KKKPEASA DVAKV AG   PE+THPR
Sbjct  14   VLHQRKSLGQCPLKMALTGFAFAGIIGYFVLYSKKKPEASALDVAKVTAGVARPENTHPR  73

Query  526  K  528
             
Sbjct  74   N  74



>ref|XP_010106788.1| hypothetical protein L484_009227 [Morus notabilis]
 gb|EXC11816.1| hypothetical protein L484_009227 [Morus notabilis]
Length=72

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  346  VLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaaggggPESTHP  522
            VLHQR  +PF    +A  G AI+  + YFTLY  KKPEASA DVA+VA G   P +THP
Sbjct  11   VLHQRSKMPFCPMRMAFGGFAIALTIGYFTLYTMKKPEASALDVARVATGTSHPANTHP  69



>emb|CDP10243.1| unnamed protein product [Coffea canephora]
Length=126

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  346  VLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaaggggPESTHPR  525
            VLHQ R LP+    +A+AG A    + YFTL++ KKPEA+A DVA+V  G   PE+T PR
Sbjct  66   VLHQTRKLPYCPARMAMAGFACVATLAYFTLFSHKKPEATALDVARVTTGTATPENTRPR  125



>gb|EPS71167.1| hypothetical protein M569_03598 [Genlisea aurea]
Length=84

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  346  VLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaaggggPESTHP  522
            VLHQ   +P S   + + G+A++G + YFTLY+KK PEA+A DVAKV  G   PE+T P
Sbjct  24   VLHQTGRMPVSPARMIVGGVAVAGLIGYFTLYSKKTPEATAVDVAKVTTGTATPENTRP  82



>ref|XP_009612074.1| PREDICTED: uncharacterized protein LOC104105467 [Nicotiana tomentosiformis]
Length=126

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  346  VLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaaggggPESTHPR  525
            VL+Q R +PF     AI G A++  + YFTLY+KKKPEA+A DVA+V  G    E T PR
Sbjct  66   VLNQTRKMPFCPAKAAIGGFAVAMTLAYFTLYSKKKPEATAMDVARVVTGTSTTEHTRPR  125

Query  526  K  528
             
Sbjct  126  N  126



>ref|XP_011079453.1| PREDICTED: uncharacterized protein LOC105162970 [Sesamum indicum]
Length=273

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  346  VLHQRRHLPFSLTTIAIAGLAISGAVWYFTLYAKKKPEasaadvakvaaggggPESTHPR  525
            VL+QR+ LPF    +A+ G A++  + YFTLY+ KKPEA+A DVA+VA+G    ++T PR
Sbjct  61   VLNQRKKLPFCPARLAVGGFAVAMVIGYFTLYSNKKPEATALDVARVASGTANIDNTRPR  120

Query  526  K  528
            K
Sbjct  121  K  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104441609276