BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9246_g1_i1 len=1216 path=[1232:0-808 40:809-1215]

Length=1216
                                                                      Score     E

ref|XP_008243222.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    459   2e-157   
ref|XP_009796559.1|  PREDICTED: tetraketide alpha-pyrone reductas...    457   2e-156   
gb|KHN24189.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    454   9e-156   
ref|XP_009592083.1|  PREDICTED: tetraketide alpha-pyrone reductas...    454   1e-155   
ref|XP_007225717.1|  hypothetical protein PRUPE_ppa008777mg             452   9e-155   
ref|XP_003529183.1|  PREDICTED: tetraketide alpha-pyrone reductas...    451   2e-154   
ref|NP_001242138.1|  uncharacterized protein LOC100808002               451   2e-154   
gb|ACS32301.1|  cinnamoyl-CoA reductase                                 450   4e-154   Jatropha curcas
gb|AFK36139.1|  unknown                                                 449   1e-153   
ref|XP_004514695.1|  PREDICTED: tetraketide alpha-pyrone reductas...    449   1e-153   
ref|XP_006437666.1|  hypothetical protein CICLE_v10032139mg             448   3e-153   
ref|XP_004510886.1|  PREDICTED: tetraketide alpha-pyrone reductas...    448   3e-153   
ref|XP_008389294.1|  PREDICTED: tetraketide alpha-pyrone reductas...    447   6e-153   
ref|XP_009356275.1|  PREDICTED: tetraketide alpha-pyrone reductas...    447   8e-153   
ref|XP_004229182.1|  PREDICTED: tetraketide alpha-pyrone reductas...    447   1e-152   
ref|XP_009356276.1|  PREDICTED: tetraketide alpha-pyrone reductas...    446   1e-152   
ref|XP_003614640.1|  Dihydroflavonol-4-reductase                        446   1e-152   
ref|XP_006484464.1|  PREDICTED: tetraketide alpha-pyrone reductas...    446   1e-152   
ref|XP_004299083.1|  PREDICTED: tetraketide alpha-pyrone reductas...    446   3e-152   
ref|XP_002282497.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    446   3e-152   Vitis vinifera
gb|AFK47752.1|  unknown                                                 444   7e-152   
ref|XP_006349152.1|  PREDICTED: tetraketide alpha-pyrone reductas...    444   8e-152   
gb|EYU26765.1|  hypothetical protein MIMGU_mgv1a010143mg                444   1e-151   
ref|XP_007044379.1|  NAD(P)-binding Rossmann-fold superfamily pro...    444   2e-151   
ref|XP_010066727.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    443   3e-151   
ref|XP_011076862.1|  PREDICTED: tetraketide alpha-pyrone reductas...    443   4e-151   
ref|XP_002312396.1|  oxidoreductase family protein                      440   5e-150   Populus trichocarpa [western balsam poplar]
ref|XP_011022102.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    439   1e-149   
ref|XP_010681550.1|  PREDICTED: tetraketide alpha-pyrone reductas...    438   2e-149   
ref|XP_006484463.1|  PREDICTED: tetraketide alpha-pyrone reductas...    438   3e-149   
ref|XP_002531631.1|  cinnamoyl-CoA reductase, putative                  438   3e-149   Ricinus communis
gb|AIX92155.1|  cinnamoyl-CoA reductase 1                               438   4e-149   
emb|CDP00614.1|  unnamed protein product                                437   8e-149   
gb|AIA24414.1|  coniferyl-alcohol dehydrogenase                         435   6e-148   
ref|XP_010265154.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    434   1e-147   
ref|XP_008446595.1|  PREDICTED: tetraketide alpha-pyrone reductas...    429   8e-146   
ref|XP_004135096.1|  PREDICTED: tetraketide alpha-pyrone reductas...    427   3e-145   
ref|XP_009121757.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    427   5e-145   
ref|XP_010415474.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    427   6e-145   
ref|XP_004159297.1|  PREDICTED: LOW QUALITY PROTEIN: tetraketide ...    426   2e-144   
emb|CDX69634.1|  BnaA10g19830D                                          426   2e-144   
ref|XP_010511852.1|  PREDICTED: tetraketide alpha-pyrone reductas...    425   3e-144   
emb|CDY38590.1|  BnaC06g30130D                                          425   4e-144   
ref|NP_177021.1|  tetraketide alpha-pyrone reductase 2                  424   6e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887188.1|  oxidoreductase family protein                      424   1e-143   
ref|XP_007153391.1|  hypothetical protein PHAVU_003G031200g             424   1e-143   
emb|CDX96012.1|  BnaA07g27190D                                          423   3e-143   
ref|XP_006391128.1|  hypothetical protein EUTSA_v10018881mg             422   4e-143   
gb|AIA24416.1|  cinnamoyl-CoA reductase 2                               422   8e-143   
ref|XP_006300539.1|  hypothetical protein CARUB_v10020661mg             421   1e-142   
ref|XP_009105396.1|  PREDICTED: tetraketide alpha-pyrone reductas...    421   2e-142   
ref|XP_010470804.1|  PREDICTED: tetraketide alpha-pyrone reductas...    420   3e-142   
gb|KDO69956.1|  hypothetical protein CISIN_1g039049mg                   418   9e-142   
ref|XP_011007939.1|  PREDICTED: tetraketide alpha-pyrone reductas...    416   1e-140   
ref|XP_002314863.1|  oxidoreductase family protein                      414   6e-140   Populus trichocarpa [western balsam poplar]
gb|KFK41274.1|  hypothetical protein AALP_AA2G108800                    412   3e-139   
ref|XP_010551271.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    408   1e-137   
ref|XP_010916354.1|  PREDICTED: tetraketide alpha-pyrone reductas...    407   3e-137   
ref|XP_006484465.1|  PREDICTED: tetraketide alpha-pyrone reductas...    404   2e-136   
ref|XP_010470805.1|  PREDICTED: tetraketide alpha-pyrone reductas...    396   7e-133   
ref|XP_010103774.1|  Bifunctional dihydroflavonol 4-reductase/fla...    395   1e-132   
ref|XP_010916353.1|  PREDICTED: tetraketide alpha-pyrone reductas...    394   9e-132   
ref|XP_008797849.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    393   2e-131   
gb|AFX98067.1|  cinnamoyl-CoA reductase                                 390   3e-130   
ref|NP_001185351.1|  tetraketide alpha-pyrone reductase 2               385   9e-129   
ref|XP_006572878.1|  PREDICTED: uncharacterized protein LOC100808...    382   7e-128   
ref|XP_008360157.1|  PREDICTED: tetraketide alpha-pyrone reductas...    381   3e-127   
ref|XP_010926052.1|  PREDICTED: tetraketide alpha-pyrone reductas...    379   3e-126   
ref|XP_009403958.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    374   1e-123   
emb|CDY42105.1|  BnaA09g28550D                                          372   3e-123   
ref|XP_009115319.1|  PREDICTED: tetraketide alpha-pyrone reductas...    373   4e-123   
emb|CDX84989.1|  BnaC05g20660D                                          370   8e-123   
ref|XP_009592084.1|  PREDICTED: tetraketide alpha-pyrone reductas...    368   1e-122   
ref|XP_006305188.1|  hypothetical protein CARUB_v10009553mg             364   1e-119   
ref|XP_003565283.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    363   1e-119   
ref|XP_006305187.1|  hypothetical protein CARUB_v10009553mg             362   4e-119   
ref|XP_002457441.1|  hypothetical protein SORBIDRAFT_03g007400          361   6e-119   Sorghum bicolor [broomcorn]
gb|EMT07290.1|  Dihydroflavonol-4-reductase                             361   8e-119   
gb|EMS54203.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    360   9e-119   
ref|NP_173917.1|  tetraketide alpha-pyrone reductase 2-like protein     360   2e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004971624.1|  PREDICTED: tetraketide alpha-pyrone reductas...    360   2e-118   
emb|CDM80595.1|  unnamed protein product                                358   6e-118   
ref|XP_006845299.1|  hypothetical protein AMTR_s00005p00268810          352   6e-116   
ref|NP_001041904.1|  Os01g0127500                                       348   1e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009115320.1|  PREDICTED: tetraketide alpha-pyrone reductas...    340   1e-110   
ref|XP_010460374.1|  PREDICTED: tetraketide alpha-pyrone reductas...    335   7e-109   
ref|XP_010460375.1|  PREDICTED: tetraketide alpha-pyrone reductas...    335   1e-108   
ref|XP_010501600.1|  PREDICTED: tetraketide alpha-pyrone reductas...    325   6e-105   
ref|XP_002893422.1|  hypothetical protein ARALYDRAFT_472827             318   2e-102   
ref|XP_006415874.1|  hypothetical protein EUTSA_v10008284mg             315   2e-101   
ref|XP_006645458.1|  PREDICTED: tetraketide alpha-pyrone reductas...    315   3e-101   
ref|XP_001769440.1|  predicted protein                                  305   3e-97    
ref|XP_006583682.1|  PREDICTED: tetraketide alpha-pyrone reductas...    299   1e-95    
ref|XP_009115321.1|  PREDICTED: tetraketide alpha-pyrone reductas...    299   2e-95    
ref|XP_002992359.1|  hypothetical protein SELMODRAFT_135301             299   7e-95    
emb|CDX84988.1|  BnaC05g20670D                                          293   1e-92    
ref|XP_006412106.1|  hypothetical protein EUTSA_v10025703mg             275   3e-85    
gb|EPS59559.1|  hypothetical protein M569_15245                         268   1e-84    
gb|KFK30181.1|  hypothetical protein AALP_AA7G228100                    272   2e-84    
ref|NP_195268.2|  dihydroflavonol 4-reductase-like1                     271   4e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867074.1|  dihydroflavonol 4-reductase family                 270   2e-83    
ref|XP_009109293.1|  PREDICTED: tetraketide alpha-pyrone reductas...    268   8e-83    
ref|XP_010446925.1|  PREDICTED: tetraketide alpha-pyrone reductas...    268   9e-83    
ref|XP_010432286.1|  PREDICTED: tetraketide alpha-pyrone reductas...    267   2e-82    
ref|XP_006378487.1|  hypothetical protein POPTR_0010s13520g             261   1e-81    
ref|XP_010437474.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    265   2e-81    
ref|XP_010548188.1|  PREDICTED: tetraketide alpha-pyrone reductas...    261   5e-80    
emb|CDY24810.1|  BnaA08g15000D                                          260   1e-79    
ref|XP_009102146.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    260   1e-79    
ref|XP_008799152.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    259   2e-79    
emb|CDY41656.1|  BnaC03g62280D                                          258   8e-79    
emb|CDX75502.1|  BnaA01g02000D                                          256   5e-78    
ref|XP_010548187.1|  PREDICTED: tetraketide alpha-pyrone reductas...    256   1e-77    
ref|XP_010932167.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    257   2e-77    
ref|XP_004236874.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    254   5e-77    
ref|XP_010531309.1|  PREDICTED: tetraketide alpha-pyrone reductas...    253   6e-77    
ref|XP_006360850.1|  PREDICTED: tetraketide alpha-pyrone reductas...    253   7e-77    
ref|XP_010270635.1|  PREDICTED: tetraketide alpha-pyrone reductas...    253   2e-76    
emb|CDX69139.1|  BnaC01g03140D                                          251   2e-76    
ref|XP_010270636.1|  PREDICTED: tetraketide alpha-pyrone reductas...    251   3e-76    
ref|XP_006660279.1|  PREDICTED: tetraketide alpha-pyrone reductas...    249   2e-75    
ref|XP_002462592.1|  hypothetical protein SORBIDRAFT_02g028700          248   4e-75    Sorghum bicolor [broomcorn]
ref|XP_006849855.1|  hypothetical protein AMTR_s00022p00057010          248   5e-75    
ref|XP_002523596.1|  cinnamoyl-CoA reductase, putative                  248   6e-75    Ricinus communis
emb|CDP14491.1|  unnamed protein product                                248   7e-75    
ref|XP_004957228.1|  PREDICTED: tetraketide alpha-pyrone reductas...    248   7e-75    
ref|XP_006422368.1|  hypothetical protein CICLE_v10028834mg             247   1e-74    
ref|XP_006486836.1|  PREDICTED: tetraketide alpha-pyrone reductas...    247   1e-74    
ref|XP_009386710.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    246   2e-74    
ref|XP_008448150.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    246   2e-74    
ref|XP_008651868.1|  PREDICTED: dihydroflavanoid reductase-like1 ...    246   4e-74    
ref|XP_009599462.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    246   5e-74    
gb|ACG33357.1|  dihydroflavonol-4-reductase                             247   5e-74    Zea mays [maize]
gb|ACG40388.1|  dihydroflavonol-4-reductase                             246   6e-74    Zea mays [maize]
gb|AEZ53298.1|  tetraketide alpha-pyrone reductase 1                    245   1e-73    
ref|XP_009776908.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    244   1e-73    
ref|NP_001105644.1|  dihydroflavanoid reductase-like1                   244   2e-73    Zea mays [maize]
ref|XP_002983967.1|  hypothetical protein SELMODRAFT_119444             244   2e-73    
ref|XP_004290099.1|  PREDICTED: tetraketide alpha-pyrone reductas...    244   2e-73    
ref|NP_001141357.1|  uncharacterized protein LOC100273448               243   5e-73    Zea mays [maize]
gb|EYU23972.1|  hypothetical protein MIMGU_mgv1a009951mg                243   5e-73    
gb|AFC36879.1|  tetraketide alpha-pyrone reductase 1                    243   5e-73    
ref|XP_003578347.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    243   6e-73    
dbj|BAK06753.1|  predicted protein                                      243   7e-73    
ref|XP_004139985.1|  PREDICTED: tetraketide alpha-pyrone reductas...    243   7e-73    
ref|XP_010028888.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    242   1e-72    
ref|XP_010690599.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    241   3e-72    
ref|XP_008382751.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    241   3e-72    
ref|XP_008235846.1|  PREDICTED: tetraketide alpha-pyrone reductas...    241   3e-72    
gb|EYU23973.1|  hypothetical protein MIMGU_mgv1a009951mg                239   9e-72    
gb|EEC84809.1|  hypothetical protein OsI_31879                          239   1e-71    Oryza sativa Indica Group [Indian rice]
dbj|BAK08080.1|  predicted protein                                      239   1e-71    
gb|EEE68992.1|  hypothetical protein OsJ_27928                          239   2e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011024587.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    239   2e-71    
ref|XP_006661385.1|  PREDICTED: tetraketide alpha-pyrone reductas...    239   2e-71    
ref|XP_004973909.1|  PREDICTED: tetraketide alpha-pyrone reductas...    239   2e-71    
ref|XP_002960169.1|  hypothetical protein SELMODRAFT_74610              239   3e-71    
dbj|BAC78578.1|  dihydroflavonol reductase                              238   4e-71    Oryza sativa Japonica Group [Japonica rice]
emb|CDY42108.1|  BnaA09g28520D                                          235   4e-71    
ref|XP_007200400.1|  hypothetical protein PRUPE_ppa008548mg             238   5e-71    
ref|XP_001772000.1|  predicted protein                                  239   5e-71    
ref|XP_011080359.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          236   1e-70    
gb|AAD24584.3|AF134807_1  putative dihydroflavonol reductase            236   2e-70    Oryza sativa [red rice]
ref|NP_001063545.1|  Os09g0493500                                       237   2e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008651870.1|  PREDICTED: dihydroflavanoid reductase-like1 ...    236   2e-70    
ref|XP_011088719.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    236   3e-70    
ref|XP_002283345.2|  PREDICTED: tetraketide alpha-pyrone reductase 1    233   2e-69    Vitis vinifera
ref|XP_004509912.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    233   3e-69    
ref|XP_008235844.1|  PREDICTED: tetraketide alpha-pyrone reductas...    232   1e-68    
ref|XP_004486774.1|  PREDICTED: tetraketide alpha-pyrone reductas...    232   1e-68    
gb|EPS73655.1|  hypothetical protein M569_01100                         231   3e-68    
gb|KDP22108.1|  hypothetical protein JCGZ_25939                         233   3e-68    
gb|AGS57528.1|  cinnamyl alcohol dehydrogenase 1                        229   6e-68    
ref|XP_002444755.1|  hypothetical protein SORBIDRAFT_07g027340          230   6e-68    Sorghum bicolor [broomcorn]
gb|KHG03033.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    229   2e-67    
ref|XP_006365621.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          228   2e-67    
ref|XP_003597698.1|  Dihydroflavonol-4-reductase                        228   3e-67    
ref|XP_003598007.1|  CCP                                                227   5e-67    
ref|NP_001234823.1|  phenylacetaldehyde reductase                       227   5e-67    
ref|XP_007150619.1|  hypothetical protein PHAVU_005G167400g             227   5e-67    
ref|XP_010557405.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          228   5e-67    
gb|EYU31375.1|  hypothetical protein MIMGU_mgv1a010032mg                227   6e-67    
ref|XP_006379787.1|  hypothetical protein POPTR_0008s13800g             226   2e-66    
dbj|BAD09991.1|  putative dihydroflavonol reductase                     226   3e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002311546.2|  dihydroflavonol 4-reductase family protein         225   3e-66    Populus trichocarpa [western balsam poplar]
gb|AFK38743.1|  unknown                                                 224   9e-66    
ref|XP_010102362.1|  hypothetical protein L484_015311                   224   9e-66    
ref|XP_003546537.1|  PREDICTED: tetraketide alpha-pyrone reductas...    223   2e-65    
ref|XP_007131544.1|  hypothetical protein PHAVU_011G022100g             223   2e-65    
ref|XP_003628601.1|  Dihydroflavonol-4-reductase                        223   2e-65    
gb|ACN40591.1|  unknown                                                 223   2e-65    Picea sitchensis
ref|XP_006341347.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X2    223   3e-65    
ref|XP_011080432.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          223   3e-65    
ref|XP_006306213.1|  hypothetical protein CARUB_v10011885mg             223   3e-65    
ref|XP_010479624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          222   5e-65    
ref|XP_009144901.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    222   5e-65    
gb|ACG40042.1|  hypothetical protein                                    222   6e-65    Zea mays [maize]
ref|XP_009795334.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          221   7e-65    
ref|XP_010461970.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          221   9e-65    
ref|XP_006427617.1|  hypothetical protein CICLE_v10026012mg             222   9e-65    
ref|XP_006393056.1|  hypothetical protein EUTSA_v10011653mg             221   9e-65    
ref|XP_006378485.1|  hypothetical protein POPTR_0010s13520g             217   1e-64    
ref|XP_002513513.1|  cinnamoyl-CoA reductase, putative                  223   1e-64    Ricinus communis
ref|NP_001242322.1|  uncharacterized protein LOC100809326               221   1e-64    
ref|XP_010534743.1|  PREDICTED: cinnamoyl-CoA reductase 1               221   1e-64    
ref|XP_009107209.1|  PREDICTED: cinnamoyl-CoA reductase 1               221   1e-64    
ref|XP_010500717.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          221   1e-64    
ref|XP_009618541.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          221   1e-64    
ref|XP_009114927.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          221   2e-64    
gb|KEH19926.1|  cinnamyl alcohol dehydrogenase                          221   2e-64    
ref|XP_008382526.1|  PREDICTED: tetraketide alpha-pyrone reductas...    221   2e-64    
ref|XP_009592182.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          221   2e-64    
gb|KHN20640.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    221   2e-64    
gb|KFK35854.1|  hypothetical protein AALP_AA4G045500                    221   2e-64    
ref|XP_003531735.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          221   2e-64    
emb|CDY22576.1|  BnaC05g24140D                                          220   2e-64    
pdb|4QTZ|A  Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydr...    220   2e-64    
ref|XP_003598002.1|  Dihydroflavonol-4-reductase                        220   3e-64    
ref|NP_175552.2|  putative alcohol dehydrogenase                        220   3e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006493352.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          220   3e-64    
ref|XP_007043128.1|  Dihydroflavonol 4-reductase-like1                  221   5e-64    
emb|CDY43911.1|  BnaA05g15210D                                          219   5e-64    
gb|AAX83110.1|  alcohol dehydrogenase-like protein                      219   5e-64    Ocimum basilicum [basil]
ref|XP_003543630.1|  PREDICTED: tetraketide alpha-pyrone reductas...    219   6e-64    
gb|AFK47262.1|  unknown                                                 219   6e-64    
ref|XP_003529771.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          219   6e-64    
ref|XP_002977011.1|  hypothetical protein SELMODRAFT_175949             219   6e-64    
ref|XP_009758397.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          219   6e-64    
ref|XP_010673664.1|  PREDICTED: tetraketide alpha-pyrone reductas...    219   6e-64    
ref|XP_010102363.1|  hypothetical protein L484_015312                   219   9e-64    
gb|ACJ85556.1|  unknown                                                 219   9e-64    Medicago truncatula
ref|XP_011073328.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          219   1e-63    
ref|NP_001274901.1|  cinnamoyl CoA reductase                            219   1e-63    
ref|XP_002517788.1|  cinnamoyl-CoA reductase, putative                  218   1e-63    Ricinus communis
pdb|4QUK|A  Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydr...    218   1e-63    
ref|NP_001234297.1|  cinnamoyl-CoA reductase                            218   1e-63    
gb|EPS73808.1|  alcohol dehydrogenase-like protein                      218   1e-63    
gb|EMT20121.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    219   1e-63    
emb|CAN78571.1|  hypothetical protein VITISV_020578                     220   2e-63    Vitis vinifera
ref|XP_009374930.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          218   2e-63    
ref|XP_006446146.1|  hypothetical protein CICLE_v10015912mg             218   2e-63    
gb|ACF17647.1|  putative cinnamoyl-CoA reductase                        218   2e-63    Capsicum annuum
emb|CDP09262.1|  unnamed protein product                                218   2e-63    
dbj|BAQ20438.1|  2-phenylethanol                                        218   2e-63    
ref|XP_006365623.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          218   3e-63    
ref|XP_002980750.1|  hypothetical protein SELMODRAFT_154000             218   3e-63    
gb|AAY26021.2|  cinnamyl alcohol dehydrogenase                          217   3e-63    Eucommia ulmoides
ref|XP_008363357.1|  PREDICTED: cinnamoyl-CoA reductase 1               217   3e-63    
ref|XP_011090120.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          217   4e-63    
gb|AHC29025.1|  phenylacetaldehyde reductase                            217   4e-63    
dbj|BAG13450.2|  phenylacetaldehyde reductase                           217   5e-63    Rosa x damascena [damask rose]
ref|XP_007023416.1|  Cinnamoyl coa reductase 1 isoform 1                217   5e-63    
ref|XP_011082327.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          217   5e-63    
gb|ADD23217.1|  cinnamyl alcohol dehydrogenase                          217   5e-63    Cistanche deserticola
ref|XP_010045028.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          216   7e-63    
ref|NP_001280189.1|  cinnamoyl-CoA reductase 1                          216   7e-63    
ref|XP_010045026.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          216   7e-63    
ref|XP_008349860.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          216   7e-63    
ref|XP_010316141.1|  PREDICTED: phenylacetaldehyde reductase isof...    224   7e-63    
ref|XP_006365632.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          216   7e-63    
gb|AAC06319.1|  putative cinnamyl alcohol dehydrogenase                 216   8e-63    Malus domestica [apple tree]
ref|XP_011080358.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          216   8e-63    
ref|XP_007015091.1|  Cinnamyl alcohol dehydrogenase, 82967-79323,...    216   9e-63    
gb|AAX15955.1|  cinnamyl alcohol dehydrogenase 1                        216   1e-62    Nicotiana tabacum [American tobacco]
ref|XP_004143234.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          216   1e-62    
gb|AEO13438.1|  cinnamoyl-CoA reductase                                 216   1e-62    
ref|NP_001241540.1|  uncharacterized protein LOC100799213               216   1e-62    
ref|XP_010102364.1|  hypothetical protein L484_015313                   216   1e-62    
gb|KHG14771.1|  Dihydroflavonol-4-reductase                             216   1e-62    
gb|KHN04175.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    216   1e-62    
ref|XP_010536092.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          215   2e-62    
ref|XP_009397092.1|  PREDICTED: cinnamoyl-CoA reductase 1               215   2e-62    
gb|EAY74373.1|  hypothetical protein OsI_02260                          216   2e-62    Oryza sativa Indica Group [Indian rice]
emb|CBI29130.3|  unnamed protein product                                215   2e-62    
ref|XP_008363567.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          215   2e-62    
emb|CAA56103.1|  cinnamoyl-CoA reductase                                216   2e-62    Eucalyptus gunnii
gb|KEH19920.1|  cinnamyl alcohol dehydrogenase                          215   2e-62    
gb|KCW87173.1|  hypothetical protein EUGRSUZ_B03696                     216   2e-62    
gb|ACF88378.1|  unknown                                                 215   2e-62    Zea mays [maize]
gb|AAX15956.1|  cinnamyl alcohol dehydrogenase 1                        215   2e-62    
ref|NP_001234830.1|  phenylacetaldehyde reductase                       215   3e-62    
ref|XP_004491683.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          215   3e-62    
gb|ACQ59094.1|  cinnamoyl-CoA reductase 4                               215   3e-62    
ref|XP_010493010.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    215   3e-62    
ref|NP_001043234.1|  Os01g0528800                                       215   3e-62    
ref|XP_011025486.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    215   3e-62    
gb|ABK24144.1|  unknown                                                 214   3e-62    
ref|XP_007149030.1|  hypothetical protein PHAVU_005G034600g             214   4e-62    
ref|XP_003628576.1|  Dihydroflavonol-4-reductase                        214   4e-62    
ref|XP_007211587.1|  hypothetical protein PRUPE_ppa008618mg             214   5e-62    
ref|XP_001765354.1|  predicted protein                                  214   5e-62    
gb|AFY97683.1|  cinnamyl alcohol dehydrogenase 1                        214   5e-62    
gb|KCW55715.1|  hypothetical protein EUGRSUZ_I01552                     212   5e-62    
ref|XP_010454217.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    214   6e-62    
ref|XP_009594427.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          214   7e-62    
ref|XP_008349583.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          214   7e-62    
ref|XP_010493011.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    214   8e-62    
ref|XP_004291772.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          214   8e-62    
ref|XP_007015092.1|  Cinnamyl alcohol dehydrogenase, 82967-79323,...    214   8e-62    
ref|XP_010922610.1|  PREDICTED: cinnamoyl-CoA reductase 1               214   8e-62    
ref|XP_008790952.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    214   8e-62    
emb|CAA61275.1|  cinnamyl alcohol dehydrogenase                         214   9e-62    
ref|XP_002517775.1|  cinnamoyl-CoA reductase, putative                  222   9e-62    
ref|XP_002298395.1|  cinnamyl-alcohol dehydrogenase family protein      213   1e-61    
ref|XP_010519769.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          213   1e-61    
ref|XP_007149032.1|  hypothetical protein PHAVU_005G034800g             213   1e-61    
ref|XP_008449698.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          213   1e-61    
emb|CBI29100.3|  unnamed protein product                                213   1e-61    
ref|XP_010493006.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    213   1e-61    
ref|NP_001150399.1|  LOC100284029                                       213   1e-61    
gb|AFX98066.1|  cinnamoyl-CoA reductase                                 213   1e-61    
ref|XP_006851072.1|  hypothetical protein AMTR_s00025p00240760          213   2e-61    
ref|XP_002285368.1|  PREDICTED: cinnamoyl-CoA reductase 1               213   2e-61    
ref|XP_003633516.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X1    213   2e-61    
ref|XP_010420747.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    213   2e-61    
ref|XP_010673674.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          213   2e-61    
emb|CDO98223.1|  unnamed protein product                                213   2e-61    
emb|CDY14000.1|  BnaC09g38260D                                          213   2e-61    
ref|XP_010493007.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    212   3e-61    
ref|XP_010092193.1|  Bifunctional dihydroflavonol 4-reductase/fla...    213   3e-61    
ref|XP_010045029.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          212   3e-61    
ref|NP_001289243.1|  CAD protein                                        212   3e-61    
ref|XP_002963214.1|  hypothetical protein SELMODRAFT_80798              212   4e-61    
gb|AIB06353.1|  cinnamyl alcohol dehydrogenase                          212   4e-61    
ref|XP_009395948.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          213   4e-61    
ref|XP_010659458.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          212   4e-61    
ref|XP_010246748.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          212   4e-61    
ref|XP_006470635.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          212   4e-61    
ref|XP_003598003.1|  Dihydroflavonol-4-reductase                        210   5e-61    
ref|XP_010420748.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    212   5e-61    
ref|XP_006365624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          211   6e-61    
ref|NP_001234612.1|  cinnamoyl-CoA reductase                            211   6e-61    
ref|XP_002314053.2|  putative cinnamoyl-CoA reductase family protein    211   6e-61    
gb|AHX56186.1|  cinnamoyl-CoA reductase 1                               211   7e-61    
gb|ABK21028.1|  unknown                                                 211   7e-61    
ref|XP_010493009.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          211   7e-61    
ref|XP_002871885.1|  hypothetical protein ARALYDRAFT_488833             211   8e-61    
gb|KEH19927.1|  cinnamyl alcohol dehydrogenase                          211   8e-61    
ref|XP_007131546.1|  hypothetical protein PHAVU_011G022300g             211   8e-61    
pdb|4R1S|A  Chain A, Crystal Structure Of Petunia Hydrida Cinnamo...    211   9e-61    
gb|KCW87172.1|  hypothetical protein EUGRSUZ_B03695                     213   9e-61    
gb|ADU64758.1|  cinnamoyl-CoA reductase                                 211   9e-61    
gb|KFK26207.1|  hypothetical protein AALP_AA8G216400                    211   1e-60    
ref|XP_010039187.1|  PREDICTED: tetraketide alpha-pyrone reductas...    211   1e-60    
ref|XP_008349627.1|  PREDICTED: tetraketide alpha-pyrone reductas...    211   1e-60    
gb|ADO51749.1|  cinnamyl alcohol dehydrogenase                          211   1e-60    
ref|XP_008465156.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          211   1e-60    
ref|XP_002981578.1|  hypothetical protein SELMODRAFT_233749             210   1e-60    
ref|XP_008366589.1|  PREDICTED: tetraketide alpha-pyrone reductas...    211   1e-60    
ref|XP_006400504.1|  hypothetical protein EUTSA_v10014099mg             211   1e-60    
ref|XP_006356249.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          211   1e-60    
ref|XP_010483446.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          210   1e-60    
gb|KGN58666.1|  hypothetical protein Csa_3G717370                       211   2e-60    
gb|EPS74552.1|  hypothetical protein M569_00199                         210   2e-60    
ref|XP_008790953.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    210   2e-60    
ref|NP_197445.1|  alcohol dehydrogenase-like protein                    210   2e-60    
ref|XP_008234536.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          210   2e-60    
ref|XP_010539540.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    211   2e-60    
ref|XP_006287932.1|  hypothetical protein CARUB_v10001167mg             211   2e-60    
ref|XP_010454220.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    210   2e-60    
ref|XP_008234771.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          210   2e-60    
ref|XP_009762377.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          210   2e-60    
ref|XP_008354954.1|  PREDICTED: tetraketide alpha-pyrone reductas...    210   3e-60    
ref|XP_002891638.1|  hypothetical protein ARALYDRAFT_314503             219   3e-60    
ref|XP_011025551.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          209   3e-60    
gb|AAD53967.1|  aldehyde reductase                                      209   3e-60    
ref|XP_002453729.1|  hypothetical protein SORBIDRAFT_04g011550          210   3e-60    
gb|EYU46248.1|  hypothetical protein MIMGU_mgv1a010028mg                209   3e-60    
gb|ACI14382.1|  cinnamoyl-CoA reductase                                 210   3e-60    
ref|XP_002517778.1|  cinnamoyl-CoA reductase, putative                  209   4e-60    
gb|AFU90744.1|  cinnamyl alcohol dehydrogenase                          209   4e-60    
ref|XP_009631380.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          209   4e-60    
ref|XP_010443586.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          209   4e-60    
ref|XP_011025483.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    209   4e-60    
gb|ABK21248.1|  unknown                                                 209   4e-60    
ref|XP_009120886.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X1    209   4e-60    
ref|XP_002314050.2|  putative cinnamoyl-CoA reductase family protein    209   4e-60    
ref|XP_011032045.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          209   4e-60    
ref|XP_010453772.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          209   5e-60    
gb|KDP45781.1|  hypothetical protein JCGZ_17388                         209   6e-60    
gb|KHN20639.1|  Dihydroflavonol-4-reductase                             209   6e-60    
emb|CAJ43901.1|  cinnamyl alcohol dehydrogenase                         209   6e-60    
ref|XP_002864577.1|  cinnamoyl-CoA reductase family                     209   7e-60    
ref|XP_010493008.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          209   7e-60    
gb|KGN58665.1|  hypothetical protein Csa_3G716870                       209   7e-60    
ref|XP_006281734.1|  hypothetical protein CARUB_v10027890mg             208   7e-60    
ref|XP_008465155.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          209   7e-60    
emb|CDX92530.1|  BnaA10g15690D                                          209   8e-60    
emb|CAA12276.1|  cinnamoyl CoA reductase                                209   8e-60    
ref|XP_003519267.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X1    208   8e-60    
gb|AAM65984.1|  cinnamyl-alcohol dehydrogenase-like protein             208   8e-60    
gb|AFK46906.1|  unknown                                                 208   9e-60    
gb|AIA24415.1|  cinnamoyl-CoA reductase 1                               208   9e-60    
ref|XP_010067827.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          208   1e-59    
ref|XP_006368925.1|  hypothetical protein POPTR_0001s14890g             208   1e-59    
ref|XP_002314079.1|  cinnamyl-alcohol dehydrogenase family protein      208   1e-59    
gb|AAQ88099.1|  NADPH-dependent cinnamyl alcohol dehydrogenase          208   1e-59    
ref|XP_010230911.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          208   1e-59    
ref|XP_011013832.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          208   1e-59    
gb|KCW49548.1|  hypothetical protein EUGRSUZ_K03067                     207   1e-59    
ref|XP_007016967.1|  NAD(P)-binding Rossmann-fold superfamily pro...    208   1e-59    
ref|XP_007205561.1|  hypothetical protein PRUPE_ppa008662mg             208   1e-59    
emb|CDP09263.1|  unnamed protein product                                207   2e-59    
ref|XP_002299260.1|  hypothetical protein POPTR_0001s14910g             208   2e-59    
ref|XP_004145235.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          207   2e-59    
ref|XP_009413954.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          209   2e-59    
ref|XP_007015094.1|  Cinnamyl alcohol dehydrogenase, 82967-79323,...    206   2e-59    
ref|XP_011045419.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          207   2e-59    
ref|XP_007149029.1|  hypothetical protein PHAVU_005G034500g             207   2e-59    
emb|CAJ43716.1|  cinnamoyl alcohol dehydrogenase                        207   2e-59    
ref|XP_008461762.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          207   2e-59    
ref|XP_007205560.1|  hypothetical protein PRUPE_ppa008662mg             207   2e-59    
ref|XP_008231479.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          207   3e-59    
gb|AAG52618.1|AC024261_5  cinnamyl alcohol dehydrogenase, putativ...    217   3e-59    
ref|XP_004987233.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          207   3e-59    
gb|KDP43566.1|  hypothetical protein JCGZ_16853                         207   3e-59    
ref|XP_010537872.1|  PREDICTED: cinnamoyl-CoA reductase 1               207   3e-59    
gb|AFK47425.1|  unknown                                                 207   3e-59    
ref|XP_010454218.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    207   4e-59    
ref|XP_011034539.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    207   4e-59    
ref|NP_001242261.1|  uncharacterized protein LOC100804704               207   4e-59    
ref|XP_009354346.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    206   4e-59    
ref|XP_010905792.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          208   4e-59    
ref|XP_009358921.1|  PREDICTED: LOW QUALITY PROTEIN: tetraketide ...    206   4e-59    
gb|AJD79908.1|  CCR                                                     207   5e-59    
ref|XP_011034540.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    207   5e-59    
ref|XP_003633515.2|  PREDICTED: LOW QUALITY PROTEIN: cinnamoyl-Co...    213   6e-59    
gb|ABK22554.1|  unknown                                                 206   6e-59    
ref|XP_008234651.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          206   6e-59    
gb|AAG16242.1|AF297877_1  cinnamoyl-CoA reductase                       206   6e-59    
gb|AHM10331.1|  cinnamoyl-CoA reductase                                 206   6e-59    
ref|XP_010905794.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          206   7e-59    
dbj|BAJ90096.1|  predicted protein                                      206   7e-59    
ref|XP_009354348.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    213   7e-59    
ref|XP_007205558.1|  hypothetical protein PRUPE_ppa008648mg             206   7e-59    
ref|XP_006401074.1|  hypothetical protein EUTSA_v10014107mg             206   8e-59    
ref|XP_007149031.1|  hypothetical protein PHAVU_005G034700g             206   8e-59    
ref|XP_007131545.1|  hypothetical protein PHAVU_011G022200g             206   8e-59    
gb|ADK24219.1|  cinnamoyl-CoA reductase                                 206   8e-59    
gb|AEV93474.1|  cinnamoyl-CoA reductase                                 206   8e-59    
ref|XP_002462058.1|  hypothetical protein SORBIDRAFT_02g014910          206   8e-59    
gb|KEH19918.1|  cinnamyl alcohol dehydrogenase                          204   8e-59    
dbj|BAM05562.1|  cinnamoyl-CoA reductase                                206   9e-59    
ref|XP_010673676.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    206   1e-58    
gb|EMT10896.1|  Dihydroflavonol-4-reductase                             206   1e-58    
ref|XP_010065291.1|  PREDICTED: tetraketide alpha-pyrone reductas...    205   1e-58    
emb|CBI24952.3|  unnamed protein product                                206   1e-58    
gb|KEH19922.1|  cinnamyl alcohol dehydrogenase                          204   1e-58    
ref|XP_008363305.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          205   1e-58    
ref|XP_004956189.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          205   1e-58    
ref|XP_010067835.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          205   1e-58    
gb|EMS49381.1|  Dihydroflavonol-4-reductase                             206   1e-58    
ref|XP_008361199.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          206   1e-58    
gb|EYU18819.1|  hypothetical protein MIMGU_mgv1a010012mg                205   1e-58    
gb|AFN26940.1|  cinnamoyl-CoA reductase                                 205   1e-58    
emb|CAK18610.1|  cinnamoyl CoA reductase                                205   1e-58    
emb|CDY57397.1|  BnaCnng32000D                                          205   2e-58    
ref|XP_008457319.1|  PREDICTED: cinnamoyl-CoA reductase 1               205   2e-58    
gb|ACU24500.1|  unknown                                                 203   2e-58    
gb|KHG11742.1|  Dihydroflavonol-4-reductase                             205   2e-58    
ref|XP_004156308.1|  PREDICTED: tetraketide alpha-pyrone reductas...    205   2e-58    
dbj|BAA12161.1|  CPRD14 protein                                         205   2e-58    
ref|XP_008349589.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          205   2e-58    
ref|XP_011078732.1|  PREDICTED: tetraketide alpha-pyrone reductas...    204   2e-58    
gb|ACZ59062.1|  cinnamoyl CoA reductase                                 205   2e-58    
gb|ACZ59064.1|  cinnamoyl CoA reductase                                 205   2e-58    
gb|ACQ41893.1|  cinnamoyl-CoA reductase                                 205   2e-58    
emb|CAC07424.1|  cinnamoyl-CoA reductase                                205   3e-58    
gb|KHG07124.1|  Dihydroflavonol-4-reductase                             204   3e-58    
ref|XP_010651224.1|  PREDICTED: cinnamoyl-CoA reductase 1               204   3e-58    
gb|ACZ59063.1|  cinnamoyl CoA reductase                                 205   3e-58    
ref|XP_010067830.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          204   3e-58    
ref|XP_011016290.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          204   3e-58    
emb|CDP18888.1|  unnamed protein product                                204   3e-58    
ref|XP_010673673.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          204   3e-58    
gb|KFK27376.1|  hypothetical protein AALP_AA8G374900                    204   3e-58    
ref|XP_007131547.1|  hypothetical protein PHAVU_011G022400g             204   3e-58    
ref|XP_010042036.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          204   3e-58    
ref|XP_008449700.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          204   3e-58    
ref|XP_010265623.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          204   4e-58    
ref|XP_006851070.1|  hypothetical protein AMTR_s00025p00240180          204   4e-58    
ref|XP_006368515.1|  hypothetical protein POPTR_0001s03660g             204   4e-58    
gb|EMT28388.1|  Dihydroflavonol-4-reductase                             204   4e-58    
ref|XP_009120358.1|  PREDICTED: cinnamoyl-CoA reductase 1               204   4e-58    
emb|CAD29427.1|  cinnamoyl-CoA reductase                                204   4e-58    
gb|AAF43141.1|AF217958_1  cinnamoyl CoA reductase                       204   5e-58    
gb|ABV44810.1|  cinnamyl alcohol dehydrogenase 1                        203   5e-58    
gb|AAX08107.1|  cinnamoyl-CoA reductase                                 205   5e-58    
gb|AFK49131.1|  unknown                                                 204   5e-58    
ref|XP_003604238.1|  Cinnamoyl CoA reductase                            204   5e-58    
gb|ACE95172.1|  cinnamoyl-CoA reductase                                 204   5e-58    
gb|AFK41102.1|  unknown                                                 204   6e-58    
ref|XP_010905793.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          205   6e-58    
ref|XP_010551176.1|  PREDICTED: cinnamoyl-CoA reductase 1               203   6e-58    
ref|XP_003543700.1|  PREDICTED: cinnamoyl-CoA reductase 1               204   6e-58    
gb|AEN02913.1|  CCR7                                                    204   7e-58    
ref|XP_007142167.1|  hypothetical protein PHAVU_008G257900g             203   7e-58    
ref|XP_004507089.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          204   7e-58    
ref|XP_004135875.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          204   7e-58    
pdb|4R1U|A  Chain A, Crystal Structure Of Medicago Truncatula Cin...    204   8e-58    



>ref|XP_008243222.1| PREDICTED: tetraketide alpha-pyrone reductase 2 [Prunus mume]
Length=331

 Score =   459 bits (1181),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/326 (70%), Positives = 272/326 (83%), Gaps = 1/326 (0%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             E+   K PEYCVTGGTG I +YLVK+LL+KG+ VRTTVR+P ++ KVGFLWEL GAKERL
Sbjct  7     ERRDRKMPEYCVTGGTGFIAAYLVKALLEKGHLVRTTVRDPEDVGKVGFLWELNGAKERL  66

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM  751
             K+ + D+MEEGS ++   GVDGVFHTASPVLVPYD N+Q TLIDP +KGTLNVLTS  K 
Sbjct  67    KMFRADLMEEGSFDEAIQGVDGVFHTASPVLVPYDDNVQATLIDPCIKGTLNVLTSCSKA  126

Query  750   MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAE  571
              VKRVVLTSSCS IRYR+DA Q+SPLNESHW+D +YCK YNLWYAYAKT AE+EAW+ A+
Sbjct  127   RVKRVVLTSSCSSIRYRYDAEQVSPLNESHWSDPEYCKNYNLWYAYAKTTAEKEAWRVAK  186

Query  570   QNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHI  391
             ++ G++LVVVN SFVVGPLL PQPTSTL +ILA+ KG  GEYPN  VGFVHI+D V AHI
Sbjct  187   ES-GMDLVVVNPSFVVGPLLAPQPTSTLLMILAVTKGARGEYPNTTVGFVHIDDVVSAHI  245

Query  390   LAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIME  211
             LAME   ASGRLICS++VAH+SQII MLR KYPSY Y +KCS+++GD++ HS+D +KI +
Sbjct  246   LAMEESKASGRLICSSSVAHWSQIIEMLRAKYPSYSYESKCSSQKGDNNPHSMDTSKIAQ  305

Query  210   LGLPPFATLSQMFDDCIHSFQQKGFL  133
             LG PPF TL +MFDDCI SFQ+KGFL
Sbjct  306   LGFPPFKTLEKMFDDCITSFQEKGFL  331



>ref|XP_009796559.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Nicotiana 
sylvestris]
Length=331

 Score =   457 bits (1175),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 233/332 (70%), Positives = 273/332 (82%), Gaps = 5/332 (2%)
 Frame = -2

Query  1116  MDEQAKSKR---PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKG  946
             MD + K K+    EYCVTGGTG I + L+K+LL KG+ VRTTVR+P  +EKVGFLWEL+G
Sbjct  1     MDRRRKRKKQEMAEYCVTGGTGFIAACLIKALLHKGHIVRTTVRDPDNVEKVGFLWELEG  60

Query  945   AKERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLT  766
             AKERLKI+K D++ EGS +D   GVDGVFHTASPV VPYD N++KTLIDPSVKGTLNVL 
Sbjct  61    AKERLKIMKADLLVEGSFDDAIQGVDGVFHTASPVSVPYDDNVEKTLIDPSVKGTLNVLN  120

Query  765   SARKM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQE  589
             S +K   +KR+VLTSSCS IRYR DA Q+SPLNESHW+DL YC+RYNLWY YAK +AE+E
Sbjct  121   SCKKASKLKRLVLTSSCSAIRYRDDAQQVSPLNESHWSDLQYCQRYNLWYPYAKAIAEKE  180

Query  588   AWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIED  409
             AW+ A++  GI+LVVVN SFVVGPLL PQPTSTL +ILAIVKG++GEYPNKR+GFVHIED
Sbjct  181   AWRVAKEC-GIDLVVVNPSFVVGPLLAPQPTSTLLIILAIVKGVLGEYPNKRLGFVHIED  239

Query  408   AVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLD  229
              V AHIL ME Q ASGR ICS +V H SQII MLR KYPSYP+  KCSN+EG+D  HS+D
Sbjct  240   VVAAHILVMEEQKASGRYICSNSVQHMSQIIDMLRTKYPSYPFENKCSNQEGEDMPHSMD  299

Query  228   CTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
              +KI ELGLPP  TL++MFDDCI SFQ+KGFL
Sbjct  300   TSKITELGLPPLKTLTRMFDDCIKSFQEKGFL  331



>gb|KHN24189.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=319

 Score =   454 bits (1169),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 229/319 (72%), Positives = 266/319 (83%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGGTG I SYLVK+LL+KG++VRTTVRNPG++EKVGFL EL GAKERLKILK D+
Sbjct  2     PEFCVTGGTGFIASYLVKALLEKGHTVRTTVRNPGDVEKVGFLTELSGAKERLKILKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             + EGS ++   GVDGVFH ASPVL+PYD N+Q+ LIDP +KGTLNVL S  K  VK  VL
Sbjct  62    LVEGSFDEAVRGVDGVFHMASPVLIPYDENVQQNLIDPCIKGTLNVLNSCVKATVKHFVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR D  ++ PLNESHWTDL+YCKRY LWYAYAKT+AE+EAW+ A++N G++L
Sbjct  122   TSSCSSIRYRDDVQEVCPLNESHWTDLEYCKRYKLWYAYAKTIAEREAWRIAKEN-GMDL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQPTSTL LIL+IVKG+ GEYPN  VGFVHI D V AH+LAME   
Sbjct  181   VVVNPSFVVGPLLAPQPTSTLLLILSIVKGMKGEYPNTTVGFVHINDVVAAHLLAMEDPK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRLICS+TVAH+SQII MLR KYPSYPY  +CS++EGD++ HS+D TKI +LG PPF 
Sbjct  241   ASGRLICSSTVAHWSQIIEMLRAKYPSYPYENECSSQEGDNNPHSMDTTKITQLGFPPFK  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL QMFDDCI SFQ KGFL
Sbjct  301   TLEQMFDDCIKSFQDKGFL  319



>ref|XP_009592083.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=320

 Score =   454 bits (1168),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 269/319 (84%), Gaps = 2/319 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EYCVTGGTG I +YL+K+LL KG+ VRTTVR+P  +EKVGFLWEL+GAKERLKI+K D++
Sbjct  3     EYCVTGGTGFIAAYLIKALLQKGHIVRTTVRDPENVEKVGFLWELEGAKERLKIMKADLL  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVVL  730
              EGS ++   GVDGVFHTASPV VPYD N++KTLI+PSVKGTLNVL S +K   +KR+VL
Sbjct  63    VEGSFDNAIQGVDGVFHTASPVSVPYDDNVEKTLIEPSVKGTLNVLNSCKKTTKLKRLVL  122

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR DA Q+SPLNESHW+DL YC+RYNLWY YAKT+AE+EAW+ A++  GI+L
Sbjct  123   TSSCSSIRYRDDAQQVSPLNESHWSDLQYCQRYNLWYPYAKTIAEKEAWRVAKEC-GIDL  181

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFV+GPLL PQPTSTL +ILAIVKG++GEYPNKR+GFVHIED V AHIL ME Q 
Sbjct  182   VVVNPSFVLGPLLAPQPTSTLLIILAIVKGVLGEYPNKRLGFVHIEDVVAAHILVMEEQK  241

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGR ICS +V H SQII MLR KYPSYP+  KCS++EG+D  HS+D +KI ELGLPP  
Sbjct  242   ASGRYICSNSVQHMSQIIDMLRTKYPSYPFENKCSSQEGEDMPHSMDTSKITELGLPPLK  301

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL+QMFDDCI SFQ+KGFL
Sbjct  302   TLTQMFDDCIKSFQKKGFL  320



>ref|XP_007225717.1| hypothetical protein PRUPE_ppa008777mg [Prunus persica]
 gb|EMJ26916.1| hypothetical protein PRUPE_ppa008777mg [Prunus persica]
Length=319

 Score =   452 bits (1163),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 226/319 (71%), Positives = 268/319 (84%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVK+LL+KG+ VRTTVR+P ++ KVGFLWEL GAKERLK+ + D+
Sbjct  2     PEYCVTGGTGFIAAYLVKALLEKGHLVRTTVRDPEDVGKVGFLWELNGAKERLKMFRADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             MEEGS ++   GVDGVFHTASPVLVP D N+Q TLIDP +KGTLNVLTS  K  VKRVVL
Sbjct  62    MEEGSFDEAIQGVDGVFHTASPVLVPSDDNVQATLIDPCIKGTLNVLTSCSKARVKRVVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR+DA Q+SPLNESHW+D +YCK YNLWYAYAKT AE+EAW+ A+++ G++L
Sbjct  122   TSSCSSIRYRYDAEQVSPLNESHWSDPEYCKNYNLWYAYAKTTAEKEAWRVAKES-GMDL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             V+VN SFVVGPLL PQPTSTL +ILAI KG  GEYPN  VGFVHI+D V AHILAME   
Sbjct  181   VMVNPSFVVGPLLAPQPTSTLLMILAITKGARGEYPNTTVGFVHIDDVVSAHILAMEESK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRLICS++VAH+SQII MLR KYPSY Y +KCS+++GD++ HS+D +KI +LG PPF 
Sbjct  241   ASGRLICSSSVAHWSQIIEMLRAKYPSYSYESKCSSQKGDNNPHSMDTSKIAQLGFPPFK  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL +MFDDCI SFQ+KGFL
Sbjct  301   TLGKMFDDCITSFQEKGFL  319



>ref|XP_003529183.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoformX1 
[Glycine max]
 gb|KHN12548.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=319

 Score =   451 bits (1160),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 225/319 (71%), Positives = 269/319 (84%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGGTG IGSYLVK+LL+KG++VRTTVRNP ++EKVGFL EL GAKERL+ILK ++
Sbjct  2     PEFCVTGGTGFIGSYLVKALLEKGHTVRTTVRNPEDVEKVGFLTELSGAKERLRILKAEL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             + EGS ++   GVDGVFHTASPVLVPYD N+Q+ LIDP +KGT+NVL S  K  VKRVVL
Sbjct  62    LVEGSFDEVVKGVDGVFHTASPVLVPYDENVQENLIDPCLKGTINVLNSCIKANVKRVVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR D  Q+ PLNESHWTDL+YC+R+NLWYAYAKT+AE+EAW+ A++N G++L
Sbjct  122   TSSCSSIRYRDDVQQVCPLNESHWTDLEYCRRHNLWYAYAKTIAEREAWRIAKEN-GMDL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGP+L PQPTSTL LIL+IVKG+ GEYPN  VGFVHI D +  H+LAME   
Sbjct  181   VVVNPSFVVGPMLAPQPTSTLLLILSIVKGMKGEYPNTAVGFVHINDVIATHLLAMEDPK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
              SGRLICS+TVAH+SQII MLR KYPSYPY  +CS++EGD++ H++D TKI +LG PPF 
Sbjct  241   TSGRLICSSTVAHWSQIIEMLRAKYPSYPYENRCSSQEGDNNPHNMDITKISQLGFPPFR  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL QMFDDCI SFQ+KGFL
Sbjct  301   TLEQMFDDCIKSFQEKGFL  319



>ref|NP_001242138.1| uncharacterized protein LOC100808002 [Glycine max]
 gb|ACU21070.1| unknown [Glycine max]
Length=319

 Score =   451 bits (1160),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 265/319 (83%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGGTG I SYLVK+LL+KG++VRTTVRNPG++EKVGFL EL GAKERLKILK D+
Sbjct  2     PEFCVTGGTGFIASYLVKALLEKGHTVRTTVRNPGDVEKVGFLTELSGAKERLKILKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             + EGS ++   GVDGVFH ASPVL+PYD N+Q+ LIDP +KGTLNVL S  K  VK  VL
Sbjct  62    LVEGSFDEAVRGVDGVFHMASPVLIPYDENVQQNLIDPCIKGTLNVLNSCVKATVKHFVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR D  ++ PLNESHWTDL+YCKRY LWYAYAKT+AE+EAW+ A++N G++L
Sbjct  122   TSSCSSIRYRDDVQEVCPLNESHWTDLEYCKRYKLWYAYAKTIAEREAWRIAKEN-GMDL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQPTSTL LIL+IVKG+ GEYPN  VGFVHI D V AH+LAME   
Sbjct  181   VVVNPSFVVGPLLAPQPTSTLLLILSIVKGVKGEYPNTTVGFVHINDVVAAHLLAMEDPK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRLICS+TVAH+SQII MLR KYPSYPY  +CS++EGD++ HS+  TKI +LG PPF 
Sbjct  241   ASGRLICSSTVAHWSQIIEMLRAKYPSYPYENECSSQEGDNNPHSMGTTKITQLGFPPFK  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL QMFDDCI SFQ KGFL
Sbjct  301   TLEQMFDDCIKSFQDKGFL  319



>gb|ACS32301.1| cinnamoyl-CoA reductase [Jatropha curcas]
 gb|KDP29402.1| hypothetical protein JCGZ_18323 [Jatropha curcas]
Length=320

 Score =   450 bits (1158),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 227/320 (71%), Positives = 266/320 (83%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YL+KSLLDKG++VR TVR+PG+ EKVGFL E  GAKERLKILK D+
Sbjct  2     PEYCVTGGTGFIAAYLIKSLLDKGHTVRATVRDPGDSEKVGFLREFNGAKERLKILKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             + EGS ++   GVDGVFHTASPV+V YD N+Q TLIDP +KGTLNVL+S  K   VKRVV
Sbjct  62    LVEGSFDEAIQGVDGVFHTASPVIVSYDDNVQATLIDPCIKGTLNVLSSCTKATSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR+D  Q+ PLNESHW+D DYCKRYNLWYAYAKT+ E EAW+ A+++ GI+
Sbjct  122   LTSSCSSIRYRYDVQQVCPLNESHWSDTDYCKRYNLWYAYAKTIGETEAWRIAKES-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL PQPTSTL LIL+IVKG +G+YPN  VGFVHI+D + AHILAME  
Sbjct  181   LVVVNPSFVVGPLLAPQPTSTLHLILSIVKGSLGQYPNTTVGFVHIDDVIAAHILAMEDS  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRL+CS++VAH+S+II MLR KYPSYPY  KCS++EGD++ HS+D TKI +LG PPF
Sbjct  241   RASGRLVCSSSVAHWSEIIEMLRAKYPSYPYENKCSSQEGDNNPHSMDTTKITQLGFPPF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              TL QMFDDCI SFQ KGFL
Sbjct  301   RTLEQMFDDCIKSFQDKGFL  320



>gb|AFK36139.1| unknown [Lotus japonicus]
Length=319

 Score =   449 bits (1155),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 226/319 (71%), Positives = 265/319 (83%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGGTG I +YLV++LL+KG++VRTTVRNPG++EKVGFL EL GAKERLKILK D+
Sbjct  2     PEFCVTGGTGFIAAYLVQALLEKGHTVRTTVRNPGDVEKVGFLMELSGAKERLKILKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             + EGS ++   GVDGVFHTASPVLVPYD NIQ TLIDP +KG LNVL S  K  VKRVVL
Sbjct  62    LNEGSFDEAVSGVDGVFHTASPVLVPYDDNIQATLIDPCIKGALNVLNSCVKANVKRVVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR D  Q+SPLNESHW+D +YCKRYNLWYAYAKT+AE+EAWK A+++ G++L
Sbjct  122   TSSCSSIRYRDDEQQVSPLNESHWSDPEYCKRYNLWYAYAKTLAEKEAWKIAKES-GMDL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQPTSTL +IL+I+KGL GEYPN  VGFVHI D V AH+LAME   
Sbjct  181   VVVNPSFVVGPLLAPQPTSTLLVILSIIKGLKGEYPNTTVGFVHIHDVVGAHLLAMEEPK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRL+CS+TVAH+SQII ML+ +YP YPY  KC  +EGD++ HS+D TKI  LG P F 
Sbjct  241   ASGRLVCSSTVAHWSQIIEMLQSQYPFYPYEKKCGGQEGDNNTHSMDTTKITALGFPAFK  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             +L QMFDDCI SFQ+KGFL
Sbjct  301   SLEQMFDDCIKSFQEKGFL  319



>ref|XP_004514695.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Cicer arietinum]
Length=319

 Score =   449 bits (1155),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 227/318 (71%), Positives = 264/318 (83%), Gaps = 1/318 (0%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             E+CVTGGTG I  YLVK+LLDKG++VRTTVRNP +LEKVG+L +L GAKERLKILK D++
Sbjct  3     EFCVTGGTGFIAGYLVKALLDKGHTVRTTVRNPEDLEKVGYLTQLSGAKERLKILKADLL  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLT  727
              EGS ++   GVDGVFHTASPVLVPYD+N+Q TLIDP +KGT NVL S  K  VKRVVLT
Sbjct  63    VEGSFDEAVSGVDGVFHTASPVLVPYDNNVQATLIDPCIKGTQNVLNSCVKANVKRVVLT  122

Query  726   SSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             SSCS IRYR D  Q+SPLNESHW+D +YCKRY LWYAYAKT+ E+EAWK A+++ GI+LV
Sbjct  123   SSCSSIRYRDDVQQVSPLNESHWSDPEYCKRYKLWYAYAKTIGEREAWKIAKES-GIDLV  181

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNA  367
             VVN SFVVGPLL PQPTSTL +IL++VKGL GEY N  VG+VHI+D + AH+LAME   A
Sbjct  182   VVNPSFVVGPLLAPQPTSTLLVILSLVKGLKGEYMNTTVGYVHIDDVIAAHLLAMEQSKA  241

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
             SGRLICS+TVAH SQII MLR KYPSYPY +KCS++ GDD+ HS+D TKI +LG PPF T
Sbjct  242   SGRLICSSTVAHTSQIIQMLRSKYPSYPYESKCSSQVGDDNMHSMDTTKITQLGFPPFKT  301

Query  186   LSQMFDDCIHSFQQKGFL  133
             L QMFDDCI SFQ KGFL
Sbjct  302   LEQMFDDCIKSFQDKGFL  319



>ref|XP_006437666.1| hypothetical protein CICLE_v10032139mg [Citrus clementina]
 gb|ESR50906.1| hypothetical protein CICLE_v10032139mg [Citrus clementina]
Length=320

 Score =   448 bits (1153),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 230/320 (72%), Positives = 269/320 (84%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I ++LVK+LLDKG+ VRTTVR+P +L KVGFLWEL GA+ERLKI+K D+
Sbjct  2     PEYCVTGGTGFIAAHLVKALLDKGHMVRTTVRDPEDLSKVGFLWELNGAEERLKIMKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             + EGS ++   GVDGVFHTASPVLVPYD+NIQ TLIDP +KGTLNVL+S +K   VKRVV
Sbjct  62    LMEGSFDEAIQGVDGVFHTASPVLVPYDNNIQATLIDPCIKGTLNVLSSCKKAKSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYRHDA Q+SPLNESHW+D DYCK YNLWYAYAKT+AE+EAW+ A ++ GI+
Sbjct  122   LTSSCSSIRYRHDAQQVSPLNESHWSDPDYCKHYNLWYAYAKTIAEKEAWRIA-KDCGID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             +VVVN SFVVGPLL PQPTSTL LILA+VKGL GEYPN  VGFVHI+D V AHILAME  
Sbjct  181   MVVVNPSFVVGPLLAPQPTSTLLLILAMVKGLRGEYPNTTVGFVHIDDVVGAHILAMEET  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRLICS++VAH+S II ML+ KYPSYPY +KCS +EGD+S HS+D +K+ ELG   F
Sbjct  241   RASGRLICSSSVAHWSPIIEMLKAKYPSYPYESKCSKQEGDNSPHSMDTSKLFELGFVGF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              ++ QMFDDCI SFQ KGFL
Sbjct  301   KSVPQMFDDCIKSFQDKGFL  320



>ref|XP_004510886.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Cicer arietinum]
Length=318

 Score =   448 bits (1152),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 261/319 (82%), Gaps = 2/319 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGG G I +YLVK+LL+KGY+VRTTVRNP +LEKVG+L +L G KERLKILK D+
Sbjct  2     PEFCVTGGNGFIAAYLVKALLEKGYTVRTTVRNP-DLEKVGYLTQLSGDKERLKILKADL  60

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             + EGS ++   GVDGVFHTASPVLVPYD+NIQ TLIDP +KGT NVL S  K  VKRVVL
Sbjct  61    LVEGSFDEAVIGVDGVFHTASPVLVPYDNNIQATLIDPCIKGTKNVLNSCAKANVKRVVL  120

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR D  QISPLNESHW+D DYCKR+NLWYAYAKT+ E+EAWK A++ND I+L
Sbjct  121   TSSCSSIRYRDDVQQISPLNESHWSDPDYCKRHNLWYAYAKTVGEREAWKIAKEND-IDL  179

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLLTP P STL +IL I+KGL GEYPN  VGFVHI+D + AH+LAME   
Sbjct  180   VVVNPSFVVGPLLTPHPASTLYIILNIIKGLKGEYPNTTVGFVHIDDVIEAHLLAMEEPK  239

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRLICS  VAH+SQII MLR KYPSYPY +KCSN EGD+  HS+D TKI + G PPF 
Sbjct  240   ASGRLICSGPVAHWSQIIEMLRAKYPSYPYESKCSNHEGDNGTHSMDTTKITQFGFPPFK  299

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL QMFDDCI SFQ KGFL
Sbjct  300   TLEQMFDDCIKSFQDKGFL  318



>ref|XP_008389294.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Malus domestica]
Length=319

 Score =   447 bits (1150),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 260/319 (82%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVK+LLDKG+ VRTTVRNP +  KVG+LWE  GAKERLK+LK D+
Sbjct  2     PEYCVTGGTGFIAAYLVKALLDKGHVVRTTVRNPEDGGKVGYLWEFNGAKERLKVLKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             M EGS ++   GVDGVFHTASPVLVPYD N+Q  LIDP +KGTLNVL S  K  VKRVVL
Sbjct  62    MVEGSFDEAVRGVDGVFHTASPVLVPYDDNVQXNLIDPCIKGTLNVLNSCSKARVKRVVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR+DA Q SPLNESHW+D +YCK YNLWYAYAKT AE+EAW+ A ++ G++L
Sbjct  122   TSSCSSIRYRYDAQQASPLNESHWSDAEYCKHYNLWYAYAKTTAEKEAWRIAGES-GMDL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQPTSTL +ILAI+KG  GEYPN  VGFVHI+D V AHILAME   
Sbjct  181   VVVNPSFVVGPLLAPQPTSTLYMILAILKGSRGEYPNTTVGFVHIDDVVAAHILAMEESK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRLICS++VAH+S+II  LR KYPSYPY  KCS+ EGD + HS+D +KI +LG PPF 
Sbjct  241   ASGRLICSSSVAHWSEIIETLRAKYPSYPYENKCSSVEGDSNPHSMDTSKIAQLGFPPFK  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL  MFDDCI SFQQKGFL
Sbjct  301   TLETMFDDCITSFQQKGFL  319



>ref|XP_009356275.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Pyrus x 
bretschneideri]
Length=319

 Score =   447 bits (1150),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 227/319 (71%), Positives = 260/319 (82%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVK+LLDKG+ VRTTVRNP +  KVG+LWE  GA ERLK+LK D+
Sbjct  2     PEYCVTGGTGFIAAYLVKALLDKGHVVRTTVRNPEDGGKVGYLWEFNGANERLKVLKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             M EGS ++   GVDGVFHTASPVLVPYD N+Q  LIDP ++GTLNVL S  K  VKRVVL
Sbjct  62    MVEGSFDEAVRGVDGVFHTASPVLVPYDDNVQANLIDPCIRGTLNVLNSCSKARVKRVVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR+DA Q SPLNESHW+D +YCK YNLWYAYAKT AE+EAW+ A ++ G++L
Sbjct  122   TSSCSSIRYRYDAQQASPLNESHWSDAEYCKHYNLWYAYAKTTAEKEAWRIAGES-GMDL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQPTSTL +ILAI+KG  GEYPN  VGFVHI+D V AHILAME   
Sbjct  181   VVVNPSFVVGPLLAPQPTSTLYMILAILKGSRGEYPNTTVGFVHIDDVVAAHILAMEESK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRLICS++VAH+S+II MLR KYPSYPY  KCS+ EGD + HS+D +KI +LG PPF 
Sbjct  241   ASGRLICSSSVAHWSEIIEMLRAKYPSYPYENKCSSMEGDSNPHSMDTSKIAQLGFPPFK  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL  MFDDCI SFQQKGFL
Sbjct  301   TLETMFDDCITSFQQKGFL  319



>ref|XP_004229182.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Solanum 
lycopersicum]
Length=320

 Score =   447 bits (1149),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 229/320 (72%), Positives = 265/320 (83%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YL+K+LL KG+ VRTTVR+P   EKVGFLWEL+GAKERLKILK D+
Sbjct  2     PEYCVTGGTGFIAAYLIKALLLKGHIVRTTVRDPDNAEKVGFLWELEGAKERLKILKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-MMVKRVV  733
             + EGS +D  +GVDGVFHTASPVLVPYD NIQKTLIDP V GTLNVL S +K   +KR+V
Sbjct  62    LVEGSFDDAIEGVDGVFHTASPVLVPYDDNIQKTLIDPCVNGTLNVLNSCKKSSTLKRLV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DA QISPLNESHW+DL YC++YNLWYAYAKT AE+EAW+ AE+  GI+
Sbjct  122   LTSSCSSIRYREDAQQISPLNESHWSDLQYCQKYNLWYAYAKTKAEKEAWRVAEEF-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL PQPTSTLQ+IL  VKG+IGEY N+R+GFVHIED V AHIL ME Q
Sbjct  181   LVVVNPSFVVGPLLAPQPTSTLQIILGTVKGVIGEYANRRLGFVHIEDVVGAHILVMEEQ  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR ICS +V H SQI  +LR KYPSYP+  KC N++G+D  HSLD +KI +LGLPP 
Sbjct  241   KASGRYICSNSVRHMSQINDLLRTKYPSYPHENKCGNQQGEDIPHSLDTSKITQLGLPPL  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L++MFDDCI SFQ+KGFL
Sbjct  301   KSLNEMFDDCIQSFQEKGFL  320



>ref|XP_009356276.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Pyrus x 
bretschneideri]
Length=319

 Score =   446 bits (1148),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 226/319 (71%), Positives = 261/319 (82%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG + +YLVK+LLDKG+ VRTTVRNP ++ KVG+LWE  GA+ERLK+LK D+
Sbjct  2     PEYCVTGGTGFLAAYLVKALLDKGHVVRTTVRNPEDVGKVGYLWEFNGARERLKMLKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             M EGS ++   GVDGVFHTASPVLVPYD N+Q  LIDP ++GTLNVL S  K  VKRVVL
Sbjct  62    MVEGSFDEAVRGVDGVFHTASPVLVPYDDNVQANLIDPCIRGTLNVLNSCSKARVKRVVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR+DA Q SPLNESHW+D +YCK YNLWYAYAKT AE+EAW+ A ++ G++L
Sbjct  122   TSSCSSIRYRYDAQQASPLNESHWSDAEYCKHYNLWYAYAKTTAEKEAWRIAGES-GMDL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQPTSTL +ILAI+KG  GEYPN  VGFVHI+D V AHILAME   
Sbjct  181   VVVNPSFVVGPLLAPQPTSTLYMILAILKGSSGEYPNTTVGFVHIDDVVAAHILAMEESK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRLICS++VAH+S+II MLR KYPSYPY  KCS+ EGD + HS+D  KI +LG PPF 
Sbjct  241   ASGRLICSSSVAHWSEIIEMLRAKYPSYPYENKCSSVEGDSNPHSMDNGKIAQLGFPPFK  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL  MFDDCI SFQQKGFL
Sbjct  301   TLETMFDDCITSFQQKGFL  319



>ref|XP_003614640.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AES97598.1| cinnamoyl-CoA reductase [Medicago truncatula]
Length=319

 Score =   446 bits (1148),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 225/319 (71%), Positives = 264/319 (83%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGGTG I +YLVK+LL+KG+ VRTTVRNP +LEKVG+L +L G KERLKILK D+
Sbjct  2     PEFCVTGGTGFIAAYLVKALLEKGHIVRTTVRNPDDLEKVGYLTQLSGDKERLKILKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             M EGS ++   GVDGVFHTASPV+VPYD+NIQ TLIDP +KGT NVL S  K  VKRVVL
Sbjct  62    MVEGSFDEAVTGVDGVFHTASPVIVPYDNNIQATLIDPCIKGTQNVLNSCIKANVKRVVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR D  Q+SPLNESHW+D +YCKRYNLWYAYAKT+ E+EAW+ AE++ G++L
Sbjct  122   TSSCSSIRYRDDVQQVSPLNESHWSDPEYCKRYNLWYAYAKTLGEREAWRIAEES-GLDL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQP STL +IL+IVKG  GEYPN  VGFVHI+D + AHILAME   
Sbjct  181   VVVNPSFVVGPLLAPQPASTLLMILSIVKGSRGEYPNTTVGFVHIDDVIAAHILAMEEPK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRL+CS+TVAH+SQII ML+ KYPSYPY TKCS++EGD++ HS+D TKI +LG   F 
Sbjct  241   ASGRLVCSSTVAHWSQIIQMLQAKYPSYPYETKCSSQEGDNNTHSMDTTKITQLGFSQFK  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             +L QMFDDCI SFQ KGFL
Sbjct  301   SLEQMFDDCIKSFQDKGFL  319



>ref|XP_006484464.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoform 
X2 [Citrus sinensis]
Length=320

 Score =   446 bits (1148),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 229/320 (72%), Positives = 268/320 (84%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I ++LVK+LLDKG+ VRTTVR+P +L KVGFLWEL GA+ERLKI+K D+
Sbjct  2     PEYCVTGGTGFIAAHLVKALLDKGHMVRTTVRDPEDLSKVGFLWELNGAEERLKIMKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             + EGS ++   GVDGVFHTASPVLVPYD+NIQ TLIDP +KGTLNVL+S +K   VKRVV
Sbjct  62    LMEGSFDEAIQGVDGVFHTASPVLVPYDNNIQATLIDPCIKGTLNVLSSCKKAKSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYRHDA Q+SPLNESHW+D DYCK YNLWYAYAKT+AE+EAW+ A ++ GI+
Sbjct  122   LTSSCSSIRYRHDAQQVSPLNESHWSDPDYCKHYNLWYAYAKTIAEKEAWRIA-KDCGID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             +VVVN SFVVGPLL PQPTSTL LILA+VKGL GEYPN  VGFVHI+D V AHILAME  
Sbjct  181   MVVVNPSFVVGPLLAPQPTSTLLLILAMVKGLRGEYPNTTVGFVHIDDVVGAHILAMEET  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRLICS++VAH+S II ML+  YPSYPY +KCS +EGD+S HS+D +K+ ELG   F
Sbjct  241   RASGRLICSSSVAHWSPIIEMLKATYPSYPYESKCSKQEGDNSPHSMDTSKLFELGFVGF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              ++ QMFDDCI SFQ KGFL
Sbjct  301   KSVPQMFDDCIKSFQDKGFL  320



>ref|XP_004299083.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Fragaria 
vesca subsp. vesca]
Length=319

 Score =   446 bits (1146),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 222/319 (70%), Positives = 266/319 (83%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVK+LL+ G+ VR TVR+P +L KVG+LWEL GAK+RLK++K D+
Sbjct  2     PEYCVTGGTGFIAAYLVKALLENGHVVRATVRDPEDLGKVGYLWELNGAKDRLKLIKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             M EGS ++   GVDGVFHTASPVLVPYD+NIQ TLIDP +KGTLNVL+S  K  VKR+VL
Sbjct  62    MVEGSFDEAMQGVDGVFHTASPVLVPYDNNIQATLIDPCIKGTLNVLSSCSKARVKRIVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR+DA + SPLNESHW+D +YCK +NLWYAYAKT AE++AW+ AE++ G+ L
Sbjct  122   TSSCSSIRYRYDAQEASPLNESHWSDPEYCKHFNLWYAYAKTTAEKDAWRIAEES-GLNL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQPTSTL +ILAI+KGL G+YPN  VGFVHI+D V AHILAME   
Sbjct  181   VVVNPSFVVGPLLAPQPTSTLLMILAILKGLRGDYPNTTVGFVHIDDVVAAHILAMEESK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGR ICS +VAH+SQII +L+ KYPSYPY +KCS+ EGD++ HS+D TKI +LG PPF 
Sbjct  241   ASGRFICSGSVAHWSQIIEILKAKYPSYPYESKCSSNEGDNNPHSMDTTKIAQLGFPPFK  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL +MFDDCI SFQ+KGFL
Sbjct  301   TLEEMFDDCITSFQEKGFL  319



>ref|XP_002282497.1| PREDICTED: tetraketide alpha-pyrone reductase 2 [Vitis vinifera]
 emb|CBI27024.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   446 bits (1146),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 224/318 (70%), Positives = 264/318 (83%), Gaps = 2/318 (1%)
 Frame = -2

Query  1083  YCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVME  904
             +CVTGGTG I +YLVK LL+ G+ VRTTVR+PG++EKVGFLWEL GAKERLKI+K D+M 
Sbjct  4     FCVTGGTGFIAAYLVKRLLEDGHFVRTTVRDPGDVEKVGFLWELSGAKERLKIMKADLMV  63

Query  903   EGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVVLT  727
             E S ++   GVDGVFHTASPVLVPYD NI+ TLIDP + GTLNVL S  K   +KRVVLT
Sbjct  64    EESFDEAVQGVDGVFHTASPVLVPYDENIKATLIDPCINGTLNVLRSCSKSSSLKRVVLT  123

Query  726   SSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             SSCS IRYR D  Q+SPLNESHW+D +YCKRYNLWYAYAKT AE+EAWK A++N GI+LV
Sbjct  124   SSCSSIRYRDDVQQVSPLNESHWSDPEYCKRYNLWYAYAKTEAEKEAWKLAKEN-GIDLV  182

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNA  367
              VN SFVVGPLL  QPTSTL +IL++VKGL GEYPN  VGFVHI+D + AHILAME   A
Sbjct  183   AVNPSFVVGPLLAWQPTSTLHMILSVVKGLCGEYPNTTVGFVHIDDVIAAHILAMEESKA  242

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
             SGRL+CS++VAH+SQII MLR KYP+YP+ +KCS+ EGD+  HS+D +KI++LGLPPF T
Sbjct  243   SGRLVCSSSVAHWSQIIDMLRAKYPAYPFESKCSSSEGDNHPHSMDTSKIIQLGLPPFKT  302

Query  186   LSQMFDDCIHSFQQKGFL  133
             L+QMFDDCI SFQ KGFL
Sbjct  303   LAQMFDDCIKSFQDKGFL  320



>gb|AFK47752.1| unknown [Medicago truncatula]
Length=319

 Score =   444 bits (1143),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 263/319 (82%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGGTG I +YLVK+LL+KG+ VRTTVRNP +LEKVG+L +L G KERLKILK D+
Sbjct  2     PEFCVTGGTGFIAAYLVKALLEKGHIVRTTVRNPDDLEKVGYLTQLSGDKERLKILKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             M EGS ++   GVDGVFHTASPV+VPYD+NIQ TLIDP + GT NVL S  K  VKRVVL
Sbjct  62    MVEGSFDEAVTGVDGVFHTASPVIVPYDNNIQATLIDPCINGTQNVLNSCIKANVKRVVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR D  Q+SPLNESHW+D +YCKRYNLWYAYAKT+ E+EAW+ AE++ G++L
Sbjct  122   TSSCSSIRYRDDVQQVSPLNESHWSDPEYCKRYNLWYAYAKTLGEREAWRIAEES-GLDL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQP STL +IL+IVKG  GEYPN  VGFVHI+D + AHILAME   
Sbjct  181   VVVNPSFVVGPLLAPQPASTLLMILSIVKGSRGEYPNTTVGFVHIDDVIAAHILAMEEPK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRL+CS+TVAH+SQII ML+ KYPSYPY TKCS++EGD++ HS+D TKI +LG   F 
Sbjct  241   ASGRLVCSSTVAHWSQIIQMLQAKYPSYPYETKCSSQEGDNNTHSMDTTKITQLGFSQFK  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             +L QMFDDCI SFQ KGFL
Sbjct  301   SLEQMFDDCIKSFQDKGFL  319



>ref|XP_006349152.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Solanum 
tuberosum]
Length=320

 Score =   444 bits (1143),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 228/320 (71%), Positives = 263/320 (82%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YL+K+LL KG+ VRTTVR+P   EKVGFLWEL GAKERLKI+K D+
Sbjct  2     PEYCVTGGTGFIAAYLIKALLLKGHIVRTTVRDPDNAEKVGFLWELDGAKERLKIMKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-MMVKRVV  733
             + EGS +D   GVDGVFHTASPVLVPYD NIQKTLIDP V GTLNVL S +K   +KR+V
Sbjct  62    LVEGSFDDAIRGVDGVFHTASPVLVPYDDNIQKTLIDPCVNGTLNVLNSCKKSSTLKRLV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DA QISPLNESHW+DL YC++YNLWYAYAKT AE+EAW+ AE+  GI+
Sbjct  122   LTSSCSSIRYREDAQQISPLNESHWSDLQYCQKYNLWYAYAKTKAEKEAWRVAEEC-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL PQPTSTLQ+IL  VKG+IGEY NKR+GFVHIED V AHIL ME Q
Sbjct  181   LVVVNPSFVVGPLLAPQPTSTLQIILGTVKGMIGEYANKRLGFVHIEDVVGAHILVMEEQ  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR ICS +V H SQI  +LR KYPSYP+  KC N++G+D  HS+D +KI +LGLPP 
Sbjct  241   KASGRYICSNSVRHMSQINDLLRTKYPSYPHENKCGNQQGEDIPHSMDTSKITQLGLPPL  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L++MFDDCI SFQ+KGFL
Sbjct  301   KSLNEMFDDCIQSFQEKGFL  320



>gb|EYU26765.1| hypothetical protein MIMGU_mgv1a010143mg [Erythranthe guttata]
Length=321

 Score =   444 bits (1142),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 222/321 (69%), Positives = 270/321 (84%), Gaps = 3/321 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YL+KSLL  G++VRTTVR+P  +EK+G+LWEL GAK+RL+I++ D+
Sbjct  2     PEYCVTGGTGFIAAYLIKSLLQNGHTVRTTVRDPENVEKIGYLWELNGAKKRLRIMRADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM--VKRV  736
             +EEGS ++  DGVDGVFHTASPVLVPYD+N+   LIDP VKG LNVL S +K    VKRV
Sbjct  62    LEEGSFDEAVDGVDGVFHTASPVLVPYDNNVMANLIDPCVKGALNVLRSCKKASASVKRV  121

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             VLTSSCS IRYR+DA Q+SPLNE+HW+D +YCK  NLWYAYAKT+AE+EAW+ AE+  GI
Sbjct  122   VLTSSCSSIRYRYDAEQVSPLNETHWSDPEYCKSNNLWYAYAKTVAEREAWRLAEE-IGI  180

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LVVVN SFVVGPLL PQPTSTL LILA+VKG+ GE PN RVGFVHI+D V AHILAME 
Sbjct  181   DLVVVNPSFVVGPLLAPQPTSTLLLILALVKGVRGECPNMRVGFVHIDDVVNAHILAMEQ  240

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               ASGRL+CS++VAH++ II MLR KYPSYPY  KCS+E+G++++HS+D +KI+ELGLPP
Sbjct  241   SKASGRLLCSSSVAHWTDIIRMLRAKYPSYPYENKCSSEKGNENQHSMDSSKILELGLPP  300

Query  195   FATLSQMFDDCIHSFQQKGFL  133
               TL QMFDDCI SF++KGFL
Sbjct  301   LKTLEQMFDDCIASFREKGFL  321



>ref|XP_007044379.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY00211.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=322

 Score =   444 bits (1141),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 232/322 (72%), Positives = 267/322 (83%), Gaps = 4/322 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I  YLVKSLL+KGY VRTTVR+PG + KVGFL EL GAKERLKI+K D+
Sbjct  2     PEYCVTGGTGFIAGYLVKSLLEKGYLVRTTVRDPGNVGKVGFLKELPGAKERLKIMKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             MEEGS ++   GVDGVFHTASPVLVPYD +IQ TLIDP +KGTLNVLTS  K   VKRVV
Sbjct  62    MEEGSFDEAVQGVDGVFHTASPVLVPYDDSIQATLIDPCIKGTLNVLTSCSKASSVKRVV  121

Query  732   LTSSCSCIRYRHDAT--QISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDG  559
             LTSSCS IRYR D    QIS LNESHW+D +YCKRYNL+YAYAKT  E+EAW+ A++  G
Sbjct  122   LTSSCSSIRYRFDVQKQQISSLNESHWSDPEYCKRYNLFYAYAKTTGEKEAWRVAKEC-G  180

Query  558   IELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAME  379
             I+LVVVN SFVVGPLL PQPTSTL LIL+IVKGL GEYPN  VGFVHI+D + AHILAME
Sbjct  181   IDLVVVNPSFVVGPLLAPQPTSTLLLILSIVKGLKGEYPNTTVGFVHIDDVIAAHILAME  240

Query  378   AQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLP  199
              + ASGRL+CS++VA ++QII MLR KYPSYP+ +KCSN EGD++EHS+D TKI +LG P
Sbjct  241   ERKASGRLVCSSSVADWTQIIEMLRAKYPSYPFESKCSNHEGDNNEHSMDTTKIQQLGFP  300

Query  198   PFATLSQMFDDCIHSFQQKGFL  133
             PF +L++MFDDCI SFQ KGFL
Sbjct  301   PFKSLAEMFDDCIKSFQDKGFL  322



>ref|XP_010066727.1| PREDICTED: tetraketide alpha-pyrone reductase 2 [Eucalyptus grandis]
 gb|KCW64743.1| hypothetical protein EUGRSUZ_G02325 [Eucalyptus grandis]
Length=320

 Score =   443 bits (1140),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 225/320 (70%), Positives = 259/320 (81%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVKSLL+ G++VRTTVR+PG+  KVGFL ELKGAKERL+I+K D+
Sbjct  2     PEYCVTGGTGFIAAYLVKSLLENGHAVRTTVRDPGDDGKVGFLKELKGAKERLRIMKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             M EGS +   DGVDGVFHTASPVLVPYD N+Q  L+DP++ G LNVL S  K   VKRVV
Sbjct  62    MVEGSFDAAVDGVDGVFHTASPVLVPYDDNVQANLVDPTINGALNVLKSCSKASSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR D  Q+SPLNESHW+D +YCKRYNLWY YAKT+AE+EAWK AEQ  GI+
Sbjct  122   LTSSCSAIRYRDDVQQVSPLNESHWSDPEYCKRYNLWYPYAKTIAEKEAWKAAEQY-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN S V+GPLL PQPTSTL L LAIVKGL GE+PN  +GFVHI+D V  HILAME +
Sbjct  181   LVVVNPSLVIGPLLAPQPTSTLLLTLAIVKGLQGEFPNLTIGFVHIDDVVATHILAMEEK  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRLICS++VAH+SQII MLR KYP YP+  KC  + GDD+ HS+D  KIMELGLPP 
Sbjct  241   RASGRLICSSSVAHWSQIIEMLRAKYPQYPFENKCGGQSGDDNAHSMDAGKIMELGLPPL  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L QMFDDCI SFQ +GFL
Sbjct  301   KSLEQMFDDCIKSFQDRGFL  320



>ref|XP_011076862.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Sesamum 
indicum]
Length=327

 Score =   443 bits (1139),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 224/320 (70%), Positives = 267/320 (83%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGG G I +YL+KSLL+KG+ VRTTVRNP   EKVG+LWEL GA ERL+I+K D+
Sbjct  2     PEYCVTGGNGFIAAYLIKSLLEKGHIVRTTVRNPENAEKVGYLWELNGANERLRIMKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             + EGS ++  DGVDGVFHTASPVLV YD NI++ LIDP +KGTLNVL S +K   VKR+V
Sbjct  62    LIEGSFDEAVDGVDGVFHTASPVLVAYDDNIKENLIDPCIKGTLNVLNSCKKTSTVKRIV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR+D  + SPLNESHW+DL+YCK +NLWYAYAKT+AEQEAWK+A+++ GI+
Sbjct  122   LTSSCSSIRYRYDVEKESPLNESHWSDLEYCKNHNLWYAYAKTIAEQEAWKFAKES-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL PQPTSTL LILA+VKGL G YPN  VGFVHI+D V AHILAME  
Sbjct  181   LVVVNPSFVVGPLLAPQPTSTLLLILAVVKGLRGGYPNTTVGFVHIDDVVNAHILAMEES  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRL+CS +VAH+S+II MLR KYPSYPY  KC +++GDD+ H++D +KI++LGLPP 
Sbjct  241   KASGRLVCSGSVAHWSEIIEMLRAKYPSYPYENKCISQKGDDNPHTMDTSKILKLGLPPL  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L QMFDDCI SFQQKGFL
Sbjct  301   KSLDQMFDDCITSFQQKGFL  320



>ref|XP_002312396.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE89763.1| oxidoreductase family protein [Populus trichocarpa]
Length=320

 Score =   440 bits (1131),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 226/320 (71%), Positives = 263/320 (82%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVKSLL+KG+ VRTTVR+PG++ KVG L E  GAKERLKI K D+
Sbjct  2     PEYCVTGGTGFIAAYLVKSLLEKGHRVRTTVRDPGDVGKVGLLREFDGAKERLKIFKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             +EEGS ++   GVDGVFHTASPVL+P+D NIQ  LIDP + GTLNVL S  K   VKRVV
Sbjct  62    LEEGSFDEAIQGVDGVFHTASPVLLPHDDNIQAMLIDPCINGTLNVLNSCSKANTVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR D  Q+SPLNESHW+D +YCKRY+LWYAYAKT+ E+EAW+ A++N GI+
Sbjct  122   LTSSCSSIRYRDDVQQVSPLNESHWSDPEYCKRYDLWYAYAKTIGEKEAWRSAKEN-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL PQPTSTL LILAIVKGL GEYPN  +GFVHI+D V AHILAME +
Sbjct  181   LVVVNPSFVVGPLLAPQPTSTLLLILAIVKGLRGEYPNMTIGFVHIDDVVAAHILAMEDK  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRL+CS +VAH+S+II MLR KYPSYPY  KCS+++GD + HS+D TKI  LG PPF
Sbjct  241   KASGRLVCSGSVAHWSEIIEMLRAKYPSYPYENKCSSQKGDCNPHSMDTTKIATLGFPPF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              TL +MFDDCI SFQ+KGFL
Sbjct  301   KTLEEMFDDCIKSFQEKGFL  320



>ref|XP_011022102.1| PREDICTED: tetraketide alpha-pyrone reductase 2 [Populus euphratica]
Length=320

 Score =   439 bits (1129),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 224/320 (70%), Positives = 262/320 (82%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +Y+++SLL+KG+ VRTTVR+PG++ KVG L E  GAKERLKI K D+
Sbjct  2     PEYCVTGGTGFIAAYVIRSLLEKGHRVRTTVRDPGDVGKVGLLREFDGAKERLKIFKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             +EEGS ++   GVDGVFHTASPVLVP+D NIQ  LIDP + G LNVL S  K   VKRVV
Sbjct  62    LEEGSFDEAIQGVDGVFHTASPVLVPHDDNIQAMLIDPCINGALNVLNSCSKAKTVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR D  Q+SPLNESHW+D +YCKRY+LWYAYAKT+ E+EAW+ A++N GI+
Sbjct  122   LTSSCSSIRYRDDVQQVSPLNESHWSDPEYCKRYDLWYAYAKTIGEKEAWRSAKEN-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL PQPTSTL LILAIVKGL GEYPN  VGFVHI+D V AHILAME +
Sbjct  181   LVVVNPSFVVGPLLAPQPTSTLLLILAIVKGLRGEYPNMTVGFVHIDDVVAAHILAMEDK  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRL+CS +VAH+S+II MLR KYPSYPY  KCS+++GD + HS+D TKI  LG PPF
Sbjct  241   KASGRLVCSGSVAHWSEIIEMLRAKYPSYPYENKCSSQKGDSNPHSMDTTKIATLGFPPF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              TL +MFDDCI SFQ+KGFL
Sbjct  301   KTLEEMFDDCIKSFQEKGFL  320



>ref|XP_010681550.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=320

 Score =   438 bits (1127),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 216/320 (68%), Positives = 262/320 (82%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I SY+VKSLL++G++VRTTVRNP  +EKVGFLWEL+GAKE+LK++K D+
Sbjct  2     PEYCVTGGTGFIASYIVKSLLERGHTVRTTVRNPENVEKVGFLWELRGAKEQLKVMKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             MEEGS ++   GVDGVFHTA+PVLV YD N+   LI+PS+KGTLNVL S A+   VKR+V
Sbjct  62    MEEGSFDEAIQGVDGVFHTAAPVLVTYDENVYANLIEPSMKGTLNVLKSCAKATTVKRIV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
              TSSCS IRYR D  QISPLNESHW+D +YCK +NLWYAYAKT+AEQ AW+ A+++ G+ 
Sbjct  122   FTSSCSAIRYRADIQQISPLNESHWSDAEYCKNHNLWYAYAKTLAEQSAWQMAKES-GLN  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFV+GP+L PQPTSTL L+L I+KG IGEYPN+ +GFVHIED V AHILAME  
Sbjct  181   LVVVNPSFVIGPVLGPQPTSTLLLLLGIIKGAIGEYPNQEIGFVHIEDVVAAHILAMEES  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              A+GRLICS++VAH+SQII M++ KY  YPY  KC  ++GDD  HS+D +KI +LG P F
Sbjct  241   TATGRLICSSSVAHWSQIIDMMKAKYEGYPYENKCGTQKGDDKPHSMDTSKIEQLGFPGF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              T+SQMFDDCI SFQ KGFL
Sbjct  301   RTISQMFDDCIRSFQDKGFL  320



>ref|XP_006484463.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoform 
X1 [Citrus sinensis]
Length=330

 Score =   438 bits (1127),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 229/330 (69%), Positives = 268/330 (81%), Gaps = 12/330 (4%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I ++LVK+LLDKG+ VRTTVR+P +L KVGFLWEL GA+ERLKI+K D+
Sbjct  2     PEYCVTGGTGFIAAHLVKALLDKGHMVRTTVRDPEDLSKVGFLWELNGAEERLKIMKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQK----------TLIDPSVKGTLNVLTSA  760
             + EGS ++   GVDGVFHTASPVLVPYD+NIQ           TLIDP +KGTLNVL+S 
Sbjct  62    LMEGSFDEAIQGVDGVFHTASPVLVPYDNNIQAGILLSKFSIATLIDPCIKGTLNVLSSC  121

Query  759   RKMM-VKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAW  583
             +K   VKRVVLTSSCS IRYRHDA Q+SPLNESHW+D DYCK YNLWYAYAKT+AE+EAW
Sbjct  122   KKAKSVKRVVLTSSCSSIRYRHDAQQVSPLNESHWSDPDYCKHYNLWYAYAKTIAEKEAW  181

Query  582   KWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAV  403
             + A ++ GI++VVVN SFVVGPLL PQPTSTL LILA+VKGL GEYPN  VGFVHI+D V
Sbjct  182   RIA-KDCGIDMVVVNPSFVVGPLLAPQPTSTLLLILAMVKGLRGEYPNTTVGFVHIDDVV  240

Query  402   RAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCT  223
              AHILAME   ASGRLICS++VAH+S II ML+  YPSYPY +KCS +EGD+S HS+D +
Sbjct  241   GAHILAMEETRASGRLICSSSVAHWSPIIEMLKATYPSYPYESKCSKQEGDNSPHSMDTS  300

Query  222   KIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             K+ ELG   F ++ QMFDDCI SFQ KGFL
Sbjct  301   KLFELGFVGFKSVPQMFDDCIKSFQDKGFL  330



>ref|XP_002531631.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF30759.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=320

 Score =   438 bits (1126),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 225/320 (70%), Positives = 262/320 (82%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVKSLLDKG+ VR TVR+P +  KVGFL E  GAKERLKI+K D+
Sbjct  2     PEYCVTGGTGFIAAYLVKSLLDKGHIVRATVRDPEDDGKVGFLKEFNGAKERLKIMKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             M EGS ++   GVDGVFHTASPVLVPYD+N+Q TLIDP +KGTLNVL S  K   VKRVV
Sbjct  62    MIEGSFDEAIHGVDGVFHTASPVLVPYDNNVQATLIDPCIKGTLNVLNSCTKSTSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR+D  Q+SPLNESHW+D +YCKRYNLWYAYAKT+ E+EAW+ AE+  GI+
Sbjct  122   LTSSCSSIRYRYDVQQVSPLNESHWSDPEYCKRYNLWYAYAKTIGEKEAWRVAEER-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL PQPTSTL LILAIVKGL GEYPN  VGFVHI+D V AH+LAME  
Sbjct  181   LVVVNPSFVVGPLLAPQPTSTLLLILAIVKGLRGEYPNTTVGFVHIDDVVAAHVLAMENS  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRL+CS++VAH+S+II ML+ KYPSYP+  KCS++EGD + HS+D +KI +LG PP 
Sbjct  241   RASGRLVCSSSVAHWSEIIEMLKVKYPSYPHENKCSSQEGDSNPHSMDTSKIAQLGFPPL  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              T+  MFDDCI SFQ+KG L
Sbjct  301   KTVEHMFDDCIKSFQEKGLL  320



>gb|AIX92155.1| cinnamoyl-CoA reductase 1 [Betula platyphylla]
Length=325

 Score =   438 bits (1126),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 228/324 (70%), Positives = 265/324 (82%), Gaps = 7/324 (2%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EYCVTGGTGLI +YLVK+LL+KG++VRTTVR+PG++ KVGFLWE  GAKERLK++K D++
Sbjct  3     EYCVTGGTGLIAAYLVKALLEKGHTVRTTVRDPGDVRKVGFLWEFNGAKERLKLIKADLL  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQK-----TLIDPSVKGTLNVLTSARKMM-V  745
              EGS +D   GVDGVFHTASPVLVPYD NIQ      TLIDP +KGTLNVL S  K   V
Sbjct  63    VEGSFDDAVQGVDGVFHTASPVLVPYDENIQAYKGPATLIDPCIKGTLNVLRSCSKASSV  122

Query  744   KRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQN  565
             KRVVLTSSCS IRY  D  Q S LNES+W+D DYCKR+NLWYAYAKT AE+EAW+ A++ 
Sbjct  123   KRVVLTSSCSSIRYCDDVHQASSLNESNWSDPDYCKRHNLWYAYAKTSAEKEAWRIAKET  182

Query  564   DGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILA  385
              G++LVVVN SFVVGPLL PQPTSTL LILA +KG  GEYPN  VGFVHI+D   AH+LA
Sbjct  183   -GMDLVVVNPSFVVGPLLAPQPTSTLLLILATIKGARGEYPNTTVGFVHIDDVTAAHMLA  241

Query  384   MEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELG  205
             ME + ASGRLICS++VAH+SQII MLR KYPSYP+  KCSN++GD++ HSLD TKI +LG
Sbjct  242   MEEKKASGRLICSSSVAHWSQIIEMLRAKYPSYPFENKCSNQKGDNNPHSLDTTKITQLG  301

Query  204   LPPFATLSQMFDDCIHSFQQKGFL  133
             LPPF TL QMFDDCI SFQ+KGFL
Sbjct  302   LPPFKTLDQMFDDCIISFQEKGFL  325



>emb|CDP00614.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   437 bits (1123),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/320 (70%), Positives = 268/320 (84%), Gaps = 4/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YL+KSLL+KGY+VRTTVR+P  +EKV +LWEL GAKERLK+LK D+
Sbjct  2     PEYCVTGGTGFIAAYLIKSLLEKGYTVRTTVRDPENVEKVAYLWELNGAKERLKVLKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             + EGS ++G +GVDGVFHTASPVLVPYD N++  LIDP +KGTLNVLTS +K    +RVV
Sbjct  62    LVEGSFDEGIEGVDGVFHTASPVLVPYDENVKANLIDPCIKGTLNVLTSCKKARSCRRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DA QISPLNESHW+D +YCKRYNLWYAYAKT+AE+EAWK+AE++ GI+
Sbjct  122   LTSSCSAIRYRDDAQQISPLNESHWSDTEYCKRYNLWYAYAKTIAEKEAWKFAEES-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVV+ SFVVGPLL PQPTSTLQ+ILAIVKGLI E+PN  VGFVHI+D V AHILAME  
Sbjct  181   LVVVSPSFVVGPLLAPQPTSTLQMILAIVKGLIKEHPNTTVGFVHIDDVVAAHILAMEES  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRL+CS++VAH+S+II MLR        + +CSN +GDD+ HS+D  KI++LGLPP 
Sbjct  241   KASGRLVCSSSVAHWSEIIEMLRNNV--LFSMFRCSNTKGDDNPHSMDSNKIIQLGLPPL  298

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L QMF+DCI SFQ+KGFL
Sbjct  299   KSLDQMFEDCIRSFQEKGFL  318



>gb|AIA24414.1| coniferyl-alcohol dehydrogenase [Sinopodophyllum hexandrum]
Length=320

 Score =   435 bits (1118),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 217/320 (68%), Positives = 265/320 (83%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGGTG I +Y+VK+LLDKGYSVR TVRNP +++KVGFL E+ GAKERLK++K D+
Sbjct  2     PEFCVTGGTGFIAAYIVKALLDKGYSVRATVRNPDDVDKVGFLLEMNGAKERLKLVKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             M +GS +D  +GVDGVFHTASPVLVP ++N Q+TL+DP +KGT+NVL S  K   VKRVV
Sbjct  62    MVDGSFDDAIEGVDGVFHTASPVLVPQNNNYQETLVDPIIKGTVNVLASCLKASTVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR+D  Q+ PLNESHW+D +YCK+Y+LWYAYAKT+ E+EAW+ AE+  GI 
Sbjct  122   LTSSCSSIRYRYDVQQVCPLNESHWSDPEYCKQYDLWYAYAKTLGEKEAWRLAEEK-GIN  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPL+ PQPTSTL +IL I+KG +GEYPN  VGFVHI+D V AHILAME +
Sbjct  181   LVVVNPSFVVGPLIAPQPTSTLLVILGIIKGKLGEYPNTTVGFVHIDDVVSAHILAMEEK  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRLI S+TVAH+S+II ML+  YPSYP+ TKCS+++GDD+ HSLD +KI +LG P F
Sbjct  241   KASGRLISSSTVAHWSEIIKMLKQNYPSYPFETKCSDKKGDDNPHSLDTSKIQKLGFPSF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              TL QMFDDCI SFQ+KG L
Sbjct  301   KTLPQMFDDCIKSFQEKGLL  320



>ref|XP_010265154.1| PREDICTED: tetraketide alpha-pyrone reductase 2 [Nelumbo nucifera]
Length=320

 Score =   434 bits (1115),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 212/320 (66%), Positives = 268/320 (84%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGGTG I ++LVKSLL+KG++VR TVR+PG++ KVGFLWE+ GAKERLK+++ D+
Sbjct  2     PEFCVTGGTGFIAAHLVKSLLEKGHTVRATVRDPGDVGKVGFLWEMSGAKERLKLMRADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-MMVKRVV  733
             M EGS +    GVDGVFHTASPV+VPYD+NIQ+TLI+P+++GT+NVL S  K   VKR+V
Sbjct  62    MVEGSFDQAIQGVDGVFHTASPVIVPYDNNIQETLIEPAIRGTVNVLKSCSKATTVKRIV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRY  D ++ SPL+ESHW+D +YCKRYNLWYAYAKT+AEQEAW+ A +  GI+
Sbjct  122   LTSSCSSIRYSDDVSKASPLDESHWSDPEYCKRYNLWYAYAKTLAEQEAWQLAREW-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPL+ PQPTS+L+++L I+KG IGEYPN  VGFVHI+D V AH+LAME  
Sbjct  181   LVVVNPSFVVGPLIAPQPTSSLRMVLGIIKGAIGEYPNTTVGFVHIDDVVAAHLLAMEES  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR+ICS++VAH+S+II +LRPKYPSYP+ TKC +++GDD+ HS+D  KI +LGL  F
Sbjct  241   KASGRIICSSSVAHWSEIIEILRPKYPSYPFETKCGSQKGDDNPHSMDTRKINQLGLSSF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              TL +MFDDCI SFQ+KG L
Sbjct  301   KTLPEMFDDCIKSFQEKGLL  320



>ref|XP_008446595.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Cucumis 
melo]
Length=320

 Score =   429 bits (1103),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 221/320 (69%), Positives = 261/320 (82%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I S LVK+LL+ G+ VRTTVRNPG+   VGFLWE  GAKERLKI+K D+
Sbjct  2     PEYCVTGGTGFIASCLVKTLLENGHHVRTTVRNPGDYGHVGFLWEFNGAKERLKIVKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             +EEGS ++   GVDGVFHTASPVLVPYD+NI+ TLIDPS+ GT+NVL S  K   VKRVV
Sbjct  62    LEEGSFDEAIQGVDGVFHTASPVLVPYDNNIKATLIDPSINGTVNVLNSCLKANSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IR R++  Q+ PLNESHWTD DYCKRYNLWYA+AKT+AE+EAW+ AE++ GI+
Sbjct  122   LTSSCSAIRCRYNVQQLCPLNESHWTDPDYCKRYNLWYAFAKTLAEKEAWRMAEEH-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLLTP+PTST  L+L I+KG  GEYPN   GFVHI+D V AHILAME  
Sbjct  181   LVVVNPSFVVGPLLTPKPTSTQHLLLTIMKGERGEYPNSTFGFVHIDDVVAAHILAMEDP  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR+ICS TVAH+S+II MLR KYPSYP+ +KCS+++GD + HS+D +KI ELG P F
Sbjct  241   KASGRIICSGTVAHWSKIIDMLRSKYPSYPFESKCSSQQGDCNPHSMDTSKIYELGFPGF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              T+ QMFDD I SFQ+KGFL
Sbjct  301   KTIEQMFDDSIKSFQEKGFL  320



>ref|XP_004135096.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Cucumis 
sativus]
 gb|KGN52077.1| hypothetical protein Csa_5G609630 [Cucumis sativus]
Length=320

 Score =   427 bits (1099),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 219/320 (68%), Positives = 262/320 (82%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I SYLVK+LL+ G+ VRTTVRNPG+  +VGFLWE  GAKERLKI+K D+
Sbjct  2     PEYCVTGGTGFIASYLVKTLLENGHHVRTTVRNPGDYGRVGFLWEFNGAKERLKIVKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             +EEGS ++  +GVDGVFHTASPVLVPYD+NI+ TLIDPS+ GT+NVL S  K   VKRVV
Sbjct  62    LEEGSFDEAIEGVDGVFHTASPVLVPYDNNIKTTLIDPSINGTVNVLNSCLKANSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR+D  Q+  LNESHWTD DYCKRYNLWYA+AKT+AE+EAW+ A ++ GI+
Sbjct  122   LTSSCSAIRYRYDVQQLCLLNESHWTDPDYCKRYNLWYAFAKTLAEKEAWRMAGEH-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLLTP+PTST  L+L I+KG  GEYPN  +GFVH++D V AHILAME  
Sbjct  181   LVVVNPSFVVGPLLTPKPTSTQHLVLTIMKGERGEYPNCTLGFVHVDDVVAAHILAMENP  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR+ICS+TVAH+SQII  LR KYPSYP+ +KCS ++G+ + H++D +KI ELG P F
Sbjct  241   KASGRIICSSTVAHWSQIIDTLRSKYPSYPFESKCSFQQGECNPHNMDTSKISELGFPGF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              T+ QMFDD I SFQ KGFL
Sbjct  301   KTMEQMFDDSIKSFQDKGFL  320



>ref|XP_009121757.1| PREDICTED: tetraketide alpha-pyrone reductase 2 [Brassica rapa]
Length=321

 Score =   427 bits (1098),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 216/320 (68%), Positives = 260/320 (81%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGTG I SY++KSLL+ G++VRTTVRNP + EKVGFLWELKGAKERLK+ K D+ 
Sbjct  3     EYLVTGGTGFIASYIIKSLLELGHTVRTTVRNPQDEEKVGFLWELKGAKERLKMFKADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK--MMVKRVV  733
              +GS ++  +GVDGVFHTASPVLVP DHNIQ+TL+DP +KGT NV+ S  K    +KR+V
Sbjct  63    VDGSFDEAVNGVDGVFHTASPVLVPQDHNIQETLVDPIIKGTTNVMNSCAKPKTTLKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DAT+ SPLNESHW+D DYCKR+NLWYAYAKT+ E+EAW+ AE+  G+ 
Sbjct  123   LTSSCSSIRYRFDATKASPLNESHWSDPDYCKRFNLWYAYAKTLGEKEAWRIAEEK-GLN  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL P+PTSTL  ILAIVKGL GEYPN  VGFVHI+D V AH+LAME  
Sbjct  182   LVVVNPSFVVGPLLGPKPTSTLLYILAIVKGLAGEYPNLTVGFVHIDDVVAAHVLAMEEP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR++CS++VAH+S+II +LR KYP+YP   KCSN+EGD++ HS+D  KI ELG   F
Sbjct  242   KASGRIVCSSSVAHWSEIIELLRNKYPNYPLENKCSNKEGDNNPHSMDTRKIHELGFASF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L +MFDDCI SFQ+KG L
Sbjct  302   KSLLEMFDDCIRSFQEKGLL  321



>ref|XP_010415474.1| PREDICTED: tetraketide alpha-pyrone reductase 2 [Camelina sativa]
Length=321

 Score =   427 bits (1098),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 213/321 (66%), Positives = 264/321 (82%), Gaps = 3/321 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEY VTGGTG I SY++KSLL+ G++VRTTVRNP + EKVGFLWE +GAK+RLKIL+ D+
Sbjct  2     PEYLVTGGTGFIASYIIKSLLELGHTVRTTVRNPRDEEKVGFLWEFQGAKQRLKILQADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA--RKMMVKRV  736
               EGS ++  +GVDGVFHTASPVLVP DHN+Q+TL+DP +KGT NV++S    K  +KR+
Sbjct  62    TVEGSFDEAVNGVDGVFHTASPVLVPQDHNVQETLVDPIIKGTTNVMSSCAKSKATLKRI  121

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             VLTSSCS IRYR DAT+ SPLNESHW+D +YCKR+NLWY YAKT+ E+EAW+ AE+  G+
Sbjct  122   VLTSSCSSIRYRFDATEASPLNESHWSDPEYCKRFNLWYGYAKTLGEKEAWRIAEEK-GL  180

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LVVVN SFVVGPLL P+PTSTL +ILAIVKGL GEYPN  VGFVHI+D V +H+LAME 
Sbjct  181   DLVVVNPSFVVGPLLGPKPTSTLLMILAIVKGLAGEYPNFTVGFVHIDDVVASHVLAMEE  240

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               ASGR+ICS++VAH+S+II ++R KYP+YP+  KCSN+EGD+S HS+D  KI ELG   
Sbjct  241   PKASGRIICSSSVAHWSEIIELMRNKYPNYPFENKCSNKEGDNSPHSMDTRKIQELGFGS  300

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F +L +MFDDCI SFQ+KG L
Sbjct  301   FKSLPEMFDDCIISFQKKGLL  321



>ref|XP_004159297.1| PREDICTED: LOW QUALITY PROTEIN: tetraketide alpha-pyrone reductase 
2-like [Cucumis sativus]
Length=320

 Score =   426 bits (1095),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 219/320 (68%), Positives = 260/320 (81%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I SYLVK+LL+ G+ VRTTVRNPG+  +VGFLWE  GAKERLKI+K D+
Sbjct  2     PEYCVTGGTGFIASYLVKTLLENGHHVRTTVRNPGDYGRVGFLWEFNGAKERLKIVKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             +EEGS ++  +GVDGVFHTASPVLVPYD+NI+ TLIDPS+ GT+NVL S  K   VKRVV
Sbjct  62    LEEGSFDEAIEGVDGVFHTASPVLVPYDNNIKTTLIDPSINGTVNVLNSCLKANSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR+D  Q+  LNESHWTD DYCKRYNLWYA+AKT+AE EAW+ A ++ GI+
Sbjct  122   LTSSCSAIRYRYDVQQLCLLNESHWTDPDYCKRYNLWYAFAKTLAEXEAWRMAGEH-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLLTP+PTST  L+L I+KG  GEYPN  +GFVH++D V AHILAME  
Sbjct  181   LVVVNPSFVVGPLLTPKPTSTQHLVLTIMKGERGEYPNCTLGFVHVDDVVAAHILAMENP  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR+ICS+TVAH+SQII  LR KYPSYP+ +KCS  +G+ + H++D +KI ELG P F
Sbjct  241   KASGRIICSSTVAHWSQIIDTLRSKYPSYPFESKCSFRQGECNPHNMDTSKISELGFPGF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              T+ QMFDD I SFQ KGFL
Sbjct  301   KTMEQMFDDSIKSFQDKGFL  320



>emb|CDX69634.1| BnaA10g19830D [Brassica napus]
Length=321

 Score =   426 bits (1094),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 215/320 (67%), Positives = 260/320 (81%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGTG I SY++KSLL+ G++VRTTVRNP + EKVGFLWELKGAKERLK+ K D+ 
Sbjct  3     EYLVTGGTGFIASYIIKSLLELGHTVRTTVRNPQDEEKVGFLWELKGAKERLKMFKADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA--RKMMVKRVV  733
              +GS ++  +GV GVFHTASPVLVP DHNIQ+TL+DP +KGT NV+ S    K ++KR+V
Sbjct  63    VDGSFDEAVNGVVGVFHTASPVLVPQDHNIQETLVDPIIKGTTNVMNSCAKSKTILKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DAT+ SPLNESHW+D DYCKR+NLWYAYAKT+ E+EAW+ AE+  G+ 
Sbjct  123   LTSSCSSIRYRFDATKASPLNESHWSDPDYCKRFNLWYAYAKTLGEKEAWRIAEEK-GLN  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL P+PTSTL  ILAIVKGL GEYPN  VGFVHI+D V AH+LAME  
Sbjct  182   LVVVNPSFVVGPLLGPKPTSTLLYILAIVKGLSGEYPNLTVGFVHIDDVVAAHVLAMEEP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR++CS++VAH+S+II +LR KYP+YP   KCSN+EGD++ HS+D  KI ELG   F
Sbjct  242   KASGRIVCSSSVAHWSEIIELLRNKYPNYPLENKCSNKEGDNNPHSMDTRKIHELGFASF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L +MFDDCI SFQ+KG L
Sbjct  302   KSLPEMFDDCIRSFQEKGLL  321



>ref|XP_010511852.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Camelina 
sativa]
 ref|XP_010511853.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Camelina 
sativa]
Length=321

 Score =   425 bits (1093),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 213/321 (66%), Positives = 263/321 (82%), Gaps = 3/321 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEY VTGGTG I SY++KSLL+ G++VRTTVRNP +  KVGFLWE +GAK+RLKIL+ D+
Sbjct  2     PEYLVTGGTGFIASYIIKSLLELGHTVRTTVRNPRDEAKVGFLWEFQGAKQRLKILQADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA--RKMMVKRV  736
               EGS ++  +GVDGVFHTASPVLVP DHNIQ+TL+DP +KGT NV++S    K  +KR+
Sbjct  62    TVEGSFDEAVNGVDGVFHTASPVLVPNDHNIQETLVDPIIKGTTNVMSSCAKSKATLKRI  121

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             VLTSSCS IRYR DAT+ SPLNESHW+D +YCKR+NLWY YAKT+ E+EAW+ AE+  G+
Sbjct  122   VLTSSCSSIRYRFDATEASPLNESHWSDPEYCKRFNLWYGYAKTLGEKEAWRIAEEK-GL  180

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LVVVN SFVVGPLL P+PTSTL +ILAIVKGL GEYPN  VGFVHI+D V +H+LAME 
Sbjct  181   DLVVVNPSFVVGPLLGPKPTSTLLMILAIVKGLAGEYPNFTVGFVHIDDVVASHVLAMEE  240

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               ASGR+ICS++VAH+S+II ++R KYP+YP+  KCSN+EGD+S HS+D  KI ELG   
Sbjct  241   PKASGRIICSSSVAHWSEIIELMRNKYPNYPFENKCSNKEGDNSPHSMDTRKIQELGFGT  300

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F +L +MFDDCI SFQ+KG L
Sbjct  301   FKSLPEMFDDCIISFQKKGLL  321



>emb|CDY38590.1| BnaC06g30130D [Brassica napus]
Length=321

 Score =   425 bits (1093),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 215/320 (67%), Positives = 259/320 (81%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGTG I SY++KSLL+ G++VRTTVRNP + EKVGFLWELKGAKERLK+ K D+ 
Sbjct  3     EYLVTGGTGFIASYIIKSLLELGHTVRTTVRNPQDEEKVGFLWELKGAKERLKMFKADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA--RKMMVKRVV  733
              EGS ++  +GVDGVFHTASPV+VP DHNIQ+TL+DP +KGT NV+ S    K  +KR+V
Sbjct  63    AEGSFDEPVNGVDGVFHTASPVIVPQDHNIQETLVDPIIKGTTNVMNSCAKSKTTLKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DAT+ SPLNESHW+D DYCKR+NLWYAYAKT+ E+EAW+ AE+  G+ 
Sbjct  123   LTSSCSSIRYRFDATKASPLNESHWSDPDYCKRFNLWYAYAKTLGEKEAWRIAEEK-GLN  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL P+PTSTL  ILAIVKGL GEY N  VGFVHI+D V AH+LAME  
Sbjct  182   LVVVNPSFVVGPLLGPKPTSTLLYILAIVKGLAGEYRNLTVGFVHIDDVVAAHVLAMEEP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR++CS++VAH+S+II +LR KYP+YP   KCSN+EGD++ HS+D  KI ELG   F
Sbjct  242   KASGRIVCSSSVAHWSEIIELLRNKYPNYPLENKCSNKEGDNNPHSMDTRKIHELGFASF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L +MFDDCI SFQ+KG L
Sbjct  302   KSLPEMFDDCIRSFQEKGLL  321



>ref|NP_177021.1| tetraketide alpha-pyrone reductase 2 [Arabidopsis thaliana]
 sp|Q9CA28.1|TKPR2_ARATH RecName: Full=Tetraketide alpha-pyrone reductase 2; AltName: 
Full=Protein CINNAMOYL-COA REDUCTASE-LIKE 6 [Arabidopsis thaliana]
 gb|AAG52392.1|AC011915_6 putative reductase; 61412-62628 [Arabidopsis thaliana]
 gb|ABI93893.1| At1g68540 [Arabidopsis thaliana]
 gb|AEE34806.1| tetraketide alpha-pyrone reductase 2 [Arabidopsis thaliana]
Length=321

 Score =   424 bits (1091),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 262/320 (82%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGTG I SY++KSLL+ G++VRTTVRNP + EKVGFLWE +GAK+RLKIL+ D+ 
Sbjct  3     EYLVTGGTGFIASYIIKSLLELGHTVRTTVRNPRDEEKVGFLWEFQGAKQRLKILQADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA--RKMMVKRVV  733
              EGS ++  +GVDGVFHTASPVLVP DHNIQ+TL+DP +KGT NV++S    K  +KR+V
Sbjct  63    VEGSFDEAVNGVDGVFHTASPVLVPQDHNIQETLVDPIIKGTTNVMSSCAKSKATLKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DAT+ SPLNESHW+D +YCKR+NLWY YAKT+ E+EAW+ AE+  G++
Sbjct  123   LTSSCSSIRYRFDATEASPLNESHWSDPEYCKRFNLWYGYAKTLGEREAWRIAEEK-GLD  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL P+PTSTL +ILAI KGL GEYPN  VGFVHI+D V AH+LAME  
Sbjct  182   LVVVNPSFVVGPLLGPKPTSTLLMILAIAKGLAGEYPNFTVGFVHIDDVVAAHVLAMEEP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR+ICS++VAH+S+II ++R KYP+YP+  KCSN+EGD+S HS+D  KI ELG   F
Sbjct  242   KASGRIICSSSVAHWSEIIELMRNKYPNYPFENKCSNKEGDNSPHSMDTRKIHELGFGSF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L +MFDDCI SFQ+KG L
Sbjct  302   KSLPEMFDDCIISFQKKGLL  321



>ref|XP_002887188.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63447.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=321

 Score =   424 bits (1089),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 261/320 (82%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGTG I SY++KSLL+ G++VRTTVRNP + EKVGFLWE +GAK+RLKIL+ D+ 
Sbjct  3     EYLVTGGTGFIASYIIKSLLELGHTVRTTVRNPRDEEKVGFLWEFQGAKQRLKILQADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA--RKMMVKRVV  733
              EGS ++  +GVDGVFHTASPVLVP DHNIQ+TL+DP +KGT NV+TS    K  +KR+V
Sbjct  63    VEGSFDEAVNGVDGVFHTASPVLVPQDHNIQETLVDPIIKGTTNVMTSCAKSKTSLKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DA + SPLNESHW+D +YCKR+NLWY YAKT+ E+EAW+ AE+  G++
Sbjct  123   LTSSCSSIRYRFDAAEASPLNESHWSDPEYCKRFNLWYGYAKTLGEKEAWRIAEEK-GLD  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL P+PTSTL +ILAI KGL GEYPN  VGFVHI+D V AH+LAME  
Sbjct  182   LVVVNPSFVVGPLLGPKPTSTLLMILAIAKGLAGEYPNFTVGFVHIDDVVAAHVLAMEEP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR+ICS++VAH+S+II ++R KYP+YP+  KCSN+EGD+S HS+D  KI ELG   F
Sbjct  242   KASGRIICSSSVAHWSEIIELMRNKYPNYPFENKCSNKEGDNSPHSMDTRKIHELGFGSF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L +MFDDCI SFQ+KG L
Sbjct  302   KSLPEMFDDCIISFQKKGLL  321



>ref|XP_007153391.1| hypothetical protein PHAVU_003G031200g [Phaseolus vulgaris]
 gb|ESW25385.1| hypothetical protein PHAVU_003G031200g [Phaseolus vulgaris]
Length=319

 Score =   424 bits (1089),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 260/319 (82%), Gaps = 1/319 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGG G I SYLVK+LL+KGY+VRTTVRNP + +KVGFL EL GAKERLKILK D+
Sbjct  2     PEFCVTGGAGFIASYLVKALLEKGYTVRTTVRNPEDKDKVGFLTELSGAKERLKILKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             + EGS ++   GVDGVFHTASPVL+P   N+Q  LIDP +KGTLNVL S  K  VKR VL
Sbjct  62    LVEGSFDEAVTGVDGVFHTASPVLLPPGENVQANLIDPCIKGTLNVLNSCLKANVKRFVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR D  Q+ PLNESHWTD DYC+RYNLWYAYAKT AE+E W+ AE+ND I++
Sbjct  122   TSSCSSIRYRDDVQQLCPLNESHWTDTDYCQRYNLWYAYAKTTAEREVWRIAEEND-IDV  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQPTSTL LIL+I+KG++GEYPN  VGFV I+D V AH+LAME   
Sbjct  181   VVVNPSFVVGPLLAPQPTSTLLLILSIIKGMVGEYPNTTVGFVDIKDVVAAHLLAMEDTR  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRLICS+TVAH+SQII MLR KYPSYPY  KCS++EGD++ HS+D TKI +LG P F 
Sbjct  241   ASGRLICSSTVAHWSQIIEMLRSKYPSYPYENKCSSKEGDNNPHSMDTTKITQLGFPAFI  300

Query  189   TLSQMFDDCIHSFQQKGFL  133
             +L QMFD+CI SFQ KGFL
Sbjct  301   SLQQMFDECIKSFQDKGFL  319



>emb|CDX96012.1| BnaA07g27190D [Brassica napus]
Length=321

 Score =   423 bits (1087),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 260/320 (81%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGTG I SY++KSLL+ G++VRTTVRNP + EKVGFLWELKGAKERLK+ K D+ 
Sbjct  3     EYLVTGGTGFIASYIIKSLLELGHTVRTTVRNPQDEEKVGFLWELKGAKERLKMFKADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA--RKMMVKRVV  733
              +GS  +  +GVDGVFHTASPVLVP DHNIQ+TL+DP +KGT NV+ S    K  +KR+V
Sbjct  63    VDGSFNEAVNGVDGVFHTASPVLVPQDHNIQETLVDPIIKGTTNVMNSCAKSKTTLKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DAT+ SPLNESHW+D DYCKR+NLWYAYAKT+ E+EAW+ AE+  G+ 
Sbjct  123   LTSSCSSIRYRFDATKASPLNESHWSDPDYCKRFNLWYAYAKTLGEKEAWRIAEEK-GLN  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL P+PTSTL  ILAIVKGL GEYPN  VGFVHI+D V AH+LAME  
Sbjct  182   LVVVNSSFVVGPLLGPKPTSTLLYILAIVKGLAGEYPNLTVGFVHIDDVVAAHVLAMEEP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR++CS++VAH+S+II +LR KYP+YP  +KCS++EG+++ HS+D  K+ ELG   F
Sbjct  242   KASGRIVCSSSVAHWSEIIVLLRNKYPNYPLESKCSDKEGENNPHSMDTRKMHELGFASF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L +MFDDCI SFQ+KG L
Sbjct  302   KSLPEMFDDCIRSFQEKGLL  321



>ref|XP_006391128.1| hypothetical protein EUTSA_v10018881mg [Eutrema salsugineum]
 gb|ESQ28414.1| hypothetical protein EUTSA_v10018881mg [Eutrema salsugineum]
Length=321

 Score =   422 bits (1086),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 215/320 (67%), Positives = 259/320 (81%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGTG I SY+VKSLL+ G++VRTTVR+P + EKVGFLWELKGAK+RLKI K D+ 
Sbjct  3     EYLVTGGTGFIASYIVKSLLELGHTVRTTVRDPRDEEKVGFLWELKGAKQRLKIFKADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA--RKMMVKRVV  733
              EGS ++  +GVDGVFHTASPVLVP DHNIQ+TL+DP +KGT NV+ S    K  +KR+V
Sbjct  63    VEGSFDEAVNGVDGVFHTASPVLVPQDHNIQETLVDPIIKGTTNVMNSCAKSKTTLKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DAT+ SPLNESHW+D  YCKR+NLWY YAKT+ E++AW+ AE+  G+ 
Sbjct  123   LTSSCSSIRYRFDATKASPLNESHWSDPAYCKRFNLWYGYAKTLGERDAWRIAEEK-GLN  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL P+PTSTL +ILAIVKGL GEYPN  VGFVHI+D V AH+LAME  
Sbjct  182   LVVVNPSFVVGPLLGPKPTSTLLMILAIVKGLAGEYPNFTVGFVHIDDVVAAHVLAMEEP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR++CS++VAH+S+II +LR KYP+YP+  KCSN+EGD+S HS+D  KI ELG   F
Sbjct  242   KASGRIVCSSSVAHWSEIIELLRNKYPNYPFENKCSNKEGDNSPHSMDTRKIHELGFGSF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L +MFDDCI SFQ KG L
Sbjct  302   KSLPEMFDDCIRSFQLKGLL  321



>gb|AIA24416.1| cinnamoyl-CoA reductase 2 [Sinopodophyllum hexandrum]
Length=319

 Score =   422 bits (1084),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 215/320 (67%), Positives = 261/320 (82%), Gaps = 3/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGGTG I +Y+VK+LLDKGYSVR TVRNP +++KVGFL E+ GAKERLK++K D+
Sbjct  2     PEFCVTGGTGFIAAYIVKALLDKGYSVRATVRNPDDVDKVGFLLEMNGAKERLKLVKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             M +GS +D  +GVDGVFHTASP LVP     Q+TL+DP +KGT+NVL S  K   VKRVV
Sbjct  62    MVDGSFDDAIEGVDGVFHTASP-LVPQKVPWQETLVDPIIKGTVNVLASCLKASTVKRVV  120

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR+D  Q+ PLNESHW+D +YCK+Y+LWYAYAKT+ E+EAW+ AE+  GI 
Sbjct  121   LTSSCSSIRYRYDVQQVCPLNESHWSDPEYCKQYDLWYAYAKTLGEKEAWRLAEEK-GIN  179

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPL+ PQPTSTL +IL I+KG +GEYPN  VGFVHI+D V AHILAME +
Sbjct  180   LVVVNPSFVVGPLIAPQPTSTLLVILGIIKGKLGEYPNTTVGFVHIDDVVSAHILAMEEK  239

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRLI S+TVAH+S+II ML+  YPSYP+ TKCS+++GDD+ HSLD +KI +LG P F
Sbjct  240   KASGRLISSSTVAHWSEIIKMLKQNYPSYPFETKCSDKKGDDNPHSLDTSKIQKLGFPSF  299

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              TL QMFDDCI SFQ+KG L
Sbjct  300   KTLPQMFDDCIKSFQEKGLL  319



>ref|XP_006300539.1| hypothetical protein CARUB_v10020661mg [Capsella rubella]
 gb|EOA33437.1| hypothetical protein CARUB_v10020661mg [Capsella rubella]
Length=321

 Score =   421 bits (1082),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 211/321 (66%), Positives = 261/321 (81%), Gaps = 3/321 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEY VTGGTG I SY++KSLL+ G++VRTTVRNP + EKVGFLWE +GAK+RLKI + D+
Sbjct  2     PEYLVTGGTGFIASYIIKSLLELGHTVRTTVRNPRDEEKVGFLWEFQGAKQRLKIFQADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA--RKMMVKRV  736
               EGS ++  +GVDGVFHTASPVLVP DHNIQ+TL+DP +KGT NV++S    K  +KR+
Sbjct  62    TVEGSFDEAVNGVDGVFHTASPVLVPQDHNIQETLVDPIIKGTTNVMSSCAKSKATLKRI  121

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             VLTSSCS IRYR DAT+ SPLNESHW+D +YCKR+NLWY YAKT+ E+EAW+ AE+  G+
Sbjct  122   VLTSSCSSIRYRFDATEASPLNESHWSDPEYCKRFNLWYGYAKTLGEKEAWRIAEEK-GL  180

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LVVVN SFVVGPLL P+PTSTL +ILAI KGL GEYPN  VGFVHI+D V +H+LAME 
Sbjct  181   DLVVVNPSFVVGPLLGPKPTSTLLMILAIAKGLAGEYPNFTVGFVHIDDVVASHVLAMEE  240

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               ASGR+ICS++VAH+S+II ++R KYP+YP+  KCSN+EGD+  HS+D  KI ELG   
Sbjct  241   PKASGRIICSSSVAHWSEIIELMRNKYPNYPFENKCSNKEGDNIPHSMDTKKIHELGFGS  300

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F +L +MFDDCI SFQ+KG L
Sbjct  301   FKSLPEMFDDCIISFQKKGLL  321



>ref|XP_009105396.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Brassica 
rapa]
Length=321

 Score =   421 bits (1081),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 259/320 (81%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGTG I SY++KSLL+ G++VRTTVRNP + EKVGFLWELKGAKERLK+ K D+ 
Sbjct  3     EYLVTGGTGFIASYIIKSLLELGHTVRTTVRNPQDEEKVGFLWELKGAKERLKMFKADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA--RKMMVKRVV  733
              +GS  +  +GVDGVFHTASPVLVP DHNIQ+TL+DP +KGT NV+ S    K  +KR+V
Sbjct  63    VDGSFNEAVNGVDGVFHTASPVLVPQDHNIQETLVDPIIKGTTNVMNSCAKSKTTLKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRY  DAT+ SPLNESHW+D DYCKR+NLWYAYAKT+ E+EAW+ AE+  G+ 
Sbjct  123   LTSSCSSIRYCFDATKASPLNESHWSDPDYCKRFNLWYAYAKTLGEKEAWRIAEEK-GLN  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL P+PTSTL  ILAIVKGL GEYPN  VGFVHI+D V AH+LAME  
Sbjct  182   LVVVNPSFVVGPLLGPKPTSTLLYILAIVKGLAGEYPNLTVGFVHIDDVVAAHVLAMEEP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR++CS++VAH+S+II +LR KYP+YP  +KCS++EGD++ HS+D  K+ ELG   F
Sbjct  242   KASGRIVCSSSVAHWSEIIVLLRNKYPNYPLESKCSDKEGDNNPHSMDTRKMHELGFASF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L +MFDDCI SFQ+KG L
Sbjct  302   KSLPEMFDDCIRSFQEKGLL  321



>ref|XP_010470804.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoform 
X1 [Camelina sativa]
Length=321

 Score =   420 bits (1080),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/321 (65%), Positives = 263/321 (82%), Gaps = 3/321 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEY VTGG G I SY++KSLL+ G++VRTTVRNP + EKVGFL E +GAK+RLKIL+ D+
Sbjct  2     PEYLVTGGAGFIASYIIKSLLELGHTVRTTVRNPRDEEKVGFLCEFQGAKQRLKILQADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLT--SARKMMVKRV  736
               EGS ++  +GVDGVFHTASPVLVP DHN+++TL+DP++KGT NV++  +  K  +KR+
Sbjct  62    TVEGSFDEAVNGVDGVFHTASPVLVPQDHNVRETLVDPTIKGTTNVMSFCAKSKATLKRI  121

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             VLTSSCS IRYR DAT+ SPLNESHW+D +YCKR+NLWY YAKT+ E+EAW+ AE+  G+
Sbjct  122   VLTSSCSSIRYRFDATEASPLNESHWSDPEYCKRFNLWYGYAKTLGEKEAWRIAEEK-GL  180

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LVVVN SFVVGPLL P+PTSTL +ILAIVKGL GEYPN  VGFVHI+D V +H+LAME 
Sbjct  181   DLVVVNPSFVVGPLLGPKPTSTLLMILAIVKGLAGEYPNFTVGFVHIDDVVASHVLAMEE  240

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               ASGR+ICS++VAH+S+II ++R KYPSYP+  KCSN+EGD+S HS+D  KI ELG   
Sbjct  241   PKASGRIICSSSVAHWSEIIELMRNKYPSYPFENKCSNKEGDNSPHSMDTRKIQELGFGS  300

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F +L +MFDDCI SFQ+KG L
Sbjct  301   FKSLPEMFDDCIISFQKKGLL  321



>gb|KDO69956.1| hypothetical protein CISIN_1g039049mg, partial [Citrus sinensis]
Length=305

 Score =   418 bits (1075),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 216/305 (71%), Positives = 255/305 (84%), Gaps = 2/305 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I ++LVK+LLDKG+ VRTTVR+P +L KVGFLWEL GA+ERLKI+K D+
Sbjct  2     PEYCVTGGTGFIAAHLVKALLDKGHMVRTTVRDPEDLSKVGFLWELNGAEERLKIMKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             + EGS ++   GVDGVFHTASPVLVPYD+NIQ TLIDP +KGTLNVL+S +K   VKRVV
Sbjct  62    LMEGSFDEAIQGVDGVFHTASPVLVPYDNNIQATLIDPCIKGTLNVLSSCKKAKSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYRHDA Q+SPLNESHW+D DYCK YNLWYAYAKT+AE+EAW+ A ++ GI+
Sbjct  122   LTSSCSSIRYRHDAQQVSPLNESHWSDPDYCKHYNLWYAYAKTIAEKEAWRIA-KDCGID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             +VVVN SFVVGPLL PQPTSTL LILA+VKGL GEYPN  VGFVHI+D V AHILAME  
Sbjct  181   MVVVNPSFVVGPLLAPQPTSTLLLILAMVKGLRGEYPNTTVGFVHIDDVVGAHILAMEET  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRLICS++VAH+S II ML+  YPSYPY +KCS +EGD+S HS+D +K+ ELG   F
Sbjct  241   RASGRLICSSSVAHWSPIIEMLKATYPSYPYESKCSKQEGDNSPHSMDTSKLFELGFVGF  300

Query  192   ATLSQ  178
              ++ Q
Sbjct  301   KSVPQ  305



>ref|XP_011007939.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Populus 
euphratica]
Length=323

 Score =   416 bits (1070),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 251/320 (78%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVKSLL+KG++VR TVR+PG + KVGFL E  GAKERLKI K D+
Sbjct  2     PEYCVTGGTGFIAAYLVKSLLEKGHTVRITVRDPGNVRKVGFLQEFNGAKERLKIFKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             +EEGS ++   GVDGVFH A+PVLVP+   IQ+TLIDP +KGTLNVL S  K   VKRVV
Sbjct  62    LEEGSFDEAIQGVDGVFHIAAPVLVPFSDRIQETLIDPCIKGTLNVLNSCLKASSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
              TSS S +RYR D  QI  LNESHW+D +YCKR+NLWYAYAKT+AE+EAW+ +++N GI+
Sbjct  122   FTSSSSTVRYRDDTPQIFSLNESHWSDTEYCKRHNLWYAYAKTVAEKEAWRVSKEN-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LV    SFVVGPLL P+P STL LI +IVKG  GEYPN  VGF HI+D V  +ILAME  
Sbjct  181   LVSFIPSFVVGPLLAPEPNSTLLLIQSIVKGSRGEYPNMTVGFTHIDDVVAGNILAMENS  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRL+CS  VAH+SQII MLR KYPSYPY  KCS++EGD+  HS+D TKI +LGLPPF
Sbjct  241   EASGRLLCSGPVAHWSQIIKMLRAKYPSYPYENKCSSQEGDNIPHSMDTTKIAQLGLPPF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              T+ QMFDDCI S Q+KGFL
Sbjct  301   KTVEQMFDDCIKSLQEKGFL  320



>ref|XP_002314863.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEF01034.1| oxidoreductase family protein [Populus trichocarpa]
Length=320

 Score =   414 bits (1065),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 212/320 (66%), Positives = 250/320 (78%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVKSLL+KG++VR TVR+PG + KVGFL E  GAKERLKI K ++
Sbjct  2     PEYCVTGGTGFIAAYLVKSLLEKGHTVRITVRDPGNVRKVGFLQEFNGAKERLKIFKAEL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             +EEGS ++   GVDGVFH A+PVLVPY   IQ+TLIDP +KGTLNVL S  K   VKRVV
Sbjct  62    LEEGSFDEAIQGVDGVFHVAAPVLVPYSDRIQETLIDPCIKGTLNVLNSCLKASSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
              TSS S +RYR D  QI  LNESHW+D +YCKR+NLWYAYAKT+AE+EAW+ +++N GI+
Sbjct  122   FTSSSSTVRYRDDTPQIFSLNESHWSDTEYCKRHNLWYAYAKTVAEKEAWRVSKEN-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LV    SFVVGPLL P+P STL LI ++VKG  GEYPN  VGF HI+D V  +ILAME  
Sbjct  181   LVSFIPSFVVGPLLAPEPNSTLLLIQSVVKGSRGEYPNMTVGFTHIDDVVAGNILAMENS  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRL+CS  VAH+SQII MLR KYPSYPY  KCS++EGD+  HS+D TKI +LGLPPF
Sbjct  241   EASGRLVCSGPVAHWSQIIKMLRAKYPSYPYENKCSSQEGDNIPHSMDTTKIAQLGLPPF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              T  QMFDDCI S Q+KGFL
Sbjct  301   KTHEQMFDDCIRSLQEKGFL  320



>gb|KFK41274.1| hypothetical protein AALP_AA2G108800 [Arabis alpina]
Length=320

 Score =   412 bits (1060),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 210/319 (66%), Positives = 256/319 (80%), Gaps = 2/319 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGTG I SY++KSLL  G+ VRTTVRNP + EKVGFLWEL+GAK RLKI + D+ 
Sbjct  3     EYLVTGGTGFIASYIIKSLLQLGHIVRTTVRNPRDEEKVGFLWELEGAKHRLKIFQADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVL  730
              EGS ++  +GVDGVFHTASPVLVP DHNIQ+TL+D  +KGT NV+ S A+   +KR+VL
Sbjct  63    VEGSFDEAVNGVDGVFHTASPVLVPQDHNIQETLVDLIIKGTTNVMNSCAKSKTLKRIVL  122

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR DAT+ S LNE+HW+D +YCKR+NLWY YAKT+ E+EAW+ AE+  G+ L
Sbjct  123   TSSCSSIRYRFDATEASSLNETHWSDPEYCKRFNLWYGYAKTLGEKEAWRIAEEK-GLNL  181

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL P+PTSTL +ILAIVKGL GEYPN  VGFVHIED V +HILAME   
Sbjct  182   VVVNPSFVVGPLLGPKPTSTLLMILAIVKGLAGEYPNFTVGFVHIEDVVASHILAMEEPK  241

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGR+I S++VAH+S+II +LR KYP+YPY  KC+N+EGD++ HS+D  KI ELG   F 
Sbjct  242   ASGRIISSSSVAHWSEIIELLRNKYPNYPYENKCNNKEGDNTPHSMDTRKIHELGFASFK  301

Query  189   TLSQMFDDCIHSFQQKGFL  133
             ++ +MFDDCI SFQ+KG L
Sbjct  302   SIPEMFDDCIRSFQEKGLL  320



>ref|XP_010551271.1| PREDICTED: tetraketide alpha-pyrone reductase 2 [Tarenaya hassleriana]
Length=321

 Score =   408 bits (1049),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 215/321 (67%), Positives = 257/321 (80%), Gaps = 5/321 (2%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGTG I S++VKSLL+ G+ VRTTVR+PG+  KVGFL ELKGAKERLKILK D+ 
Sbjct  3     EYLVTGGTGFIASHIVKSLLELGHIVRTTVRDPGDEGKVGFLKELKGAKERLKILKADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM--MVKRVV  733
              EGS ++  DGVDGVFHTASPVL P+D NIQ TL+DP +KGT NVL S  K    +KRVV
Sbjct  63    VEGSFDEAVDGVDGVFHTASPVLAPHD-NIQATLVDPIIKGTTNVLNSCSKAKATLKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSC+ IRYR DATQ SPLNESHW+D +YCKR+NLWYAYAKT+ E+EAW+ A +  G++
Sbjct  122   LTSSCTAIRYRFDATQASPLNESHWSDPEYCKRFNLWYAYAKTLGEKEAWRIAAEK-GLD  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL P+PTSTL +ILAIVKGL GEYPN  VGFVH++D V AHILA+E  
Sbjct  181   LVVVNPSFVVGPLLGPKPTSTLLMILAIVKGLAGEYPNFTVGFVHVDDVVAAHILAIEEP  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGL-PP  196
              ASGR+ICS++VAH+S+I+ MLR KYPSYP+  KCS++EG+D  HS+D  KI ELG    
Sbjct  241   RASGRIICSSSVAHWSEIVPMLRAKYPSYPFENKCSSKEGNDQPHSMDTGKIRELGFSSS  300

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F +LS+MFDDCI SFQ K  +
Sbjct  301   FKSLSEMFDDCIKSFQDKSLI  321



>ref|XP_010916354.1| PREDICTED: tetraketide alpha-pyrone reductase 2 isoform X2 [Elaeis 
guineensis]
Length=320

 Score =   407 bits (1047),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 254/320 (79%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVK LL  G+SVR TVR+PG+  KVGFLW L GAKERL ++K D+
Sbjct  2     PEYCVTGGTGFIAAYLVKELLASGHSVRATVRDPGDEAKVGFLWSLDGAKERLSLVKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             + EGS ++  +GVDGVFHTA PV V  D +IQ+ LI+P++KGT NVL S  K   V+RVV
Sbjct  62    LVEGSFDEAVNGVDGVFHTACPVFVSSDQDIQEKLINPAIKGTANVLKSCSKASSVRRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DATQ SPLNES W+D+DYCKRY+LWYAYAKT+AE+EAW+ + ++  I+
Sbjct  122   LTSSCSSIRYRDDATQASPLNESSWSDIDYCKRYSLWYAYAKTLAEKEAWRLS-KDFRID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL PQPTSTL +IL+++KG   +YPN  VGFVHI+D V +HILAME  
Sbjct  181   LVVVNPSFVVGPLLAPQPTSTLHMILSLLKGERPDYPNTTVGFVHIDDVVLSHILAMEDS  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRL+CS++VAH+S+I+ MLR KYP YP   KC +++GD + HS+D TKI ELG PPF
Sbjct  241   RASGRLVCSSSVAHWSEIVEMLRAKYPYYPIPNKCGDQKGDSNPHSMDTTKIRELGFPPF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              TL QMFDDC+ SFQ+K FL
Sbjct  301   KTLPQMFDDCVKSFQEKKFL  320



>ref|XP_006484465.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoform 
X3 [Citrus sinensis]
Length=293

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 241/320 (75%), Gaps = 29/320 (9%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I ++LVK+LLDKG+ VRTTVR+P +L KVGFLWEL GA+ERLKI+K D+
Sbjct  2     PEYCVTGGTGFIAAHLVKALLDKGHMVRTTVRDPEDLSKVGFLWELNGAEERLKIMKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             + EGS ++   GVDGVFHTASPVLVPYD+NIQ TLIDP +KGTLNVL+S +K   VKRVV
Sbjct  62    LMEGSFDEAIQGVDGVFHTASPVLVPYDNNIQATLIDPCIKGTLNVLSSCKKAKSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYRHDA Q+SPLNESHW+D DYCK YNLWYAYAKT+AE+EAW+ A ++ GI+
Sbjct  122   LTSSCSSIRYRHDAQQVSPLNESHWSDPDYCKHYNLWYAYAKTIAEKEAWRIA-KDCGID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             +VVVN SFVVGP                   L+   P          D V AHILAME  
Sbjct  181   MVVVNPSFVVGP-------------------LLAPQPTN--------DVVGAHILAMEET  213

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRLICS++VAH+S II ML+  YPSYPY +KCS +EGD+S HS+D +K+ ELG   F
Sbjct  214   RASGRLICSSSVAHWSPIIEMLKATYPSYPYESKCSKQEGDNSPHSMDTSKLFELGFVGF  273

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              ++ QMFDDCI SFQ KGFL
Sbjct  274   KSVPQMFDDCIKSFQDKGFL  293



>ref|XP_010470805.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoform 
X2 [Camelina sativa]
Length=308

 Score =   396 bits (1017),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 253/321 (79%), Gaps = 16/321 (5%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEY VTGG G I SY++KSLL+ G++VRTTVRNP              AK+RLKIL+ D+
Sbjct  2     PEYLVTGGAGFIASYIIKSLLELGHTVRTTVRNPR-------------AKQRLKILQADL  48

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLT--SARKMMVKRV  736
               EGS ++  +GVDGVFHTASPVLVP DHN+++TL+DP++KGT NV++  +  K  +KR+
Sbjct  49    TVEGSFDEAVNGVDGVFHTASPVLVPQDHNVRETLVDPTIKGTTNVMSFCAKSKATLKRI  108

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             VLTSSCS IRYR DAT+ SPLNESHW+D +YCKR+NLWY YAKT+ E+EAW+ AE+  G+
Sbjct  109   VLTSSCSSIRYRFDATEASPLNESHWSDPEYCKRFNLWYGYAKTLGEKEAWRIAEEK-GL  167

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LVVVN SFVVGPLL P+PTSTL +ILAIVKGL GEYPN  VGFVHI+D V +H+LAME 
Sbjct  168   DLVVVNPSFVVGPLLGPKPTSTLLMILAIVKGLAGEYPNFTVGFVHIDDVVASHVLAMEE  227

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               ASGR+ICS++VAH+S+II ++R KYPSYP+  KCSN+EGD+S HS+D  KI ELG   
Sbjct  228   PKASGRIICSSSVAHWSEIIELMRNKYPSYPFENKCSNKEGDNSPHSMDTRKIQELGFGS  287

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F +L +MFDDCI SFQ+KG L
Sbjct  288   FKSLPEMFDDCIISFQKKGLL  308



>ref|XP_010103774.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Morus notabilis]
 gb|EXB97052.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Morus notabilis]
Length=306

 Score =   395 bits (1015),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 207/319 (65%), Positives = 247/319 (77%), Gaps = 14/319 (4%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVK+LL+KG++VRTTVR+PG++ KVGFL +  GAKERLKI K D+
Sbjct  2     PEYCVTGGTGFIAAYLVKALLEKGHTVRTTVRDPGDVGKVGFLKDFDGAKERLKIFKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             M EGS ++   GVDGVFHTASPV+VPYD N+Q     P +  +           V+R+V 
Sbjct  62    MVEGSFDEAIQGVDGVFHTASPVVVPYDDNLQAN--PPPLFSS-----------VRRIVF  108

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR+D  Q+SPLNESHW+D +YCK YNLWYAYAKT+AE+EAWK+AE+  G +L
Sbjct  109   TSSCSSIRYRYDVQQVSPLNESHWSDPEYCKHYNLWYAYAKTVAEKEAWKFAEET-GKDL  167

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQPTSTL LIL+I KG  GEYPN  VGFVHI+D V AHILAME   
Sbjct  168   VVVNPSFVVGPLLAPQPTSTLLLILSIAKGAKGEYPNMTVGFVHIDDVVAAHILAMENSK  227

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRLICS++VA +SQII ML+ KYPSYP+  KCSN+ GD++ HS+D +KI +LG   F 
Sbjct  228   ASGRLICSSSVAPWSQIIEMLKSKYPSYPFENKCSNQVGDNNPHSMDTSKITQLGFHAFK  287

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL QMF DCI SFQ KGFL
Sbjct  288   TLDQMFGDCIKSFQDKGFL  306



>ref|XP_010916353.1| PREDICTED: tetraketide alpha-pyrone reductase 2 isoform X1 [Elaeis 
guineensis]
Length=341

 Score =   394 bits (1013),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 207/341 (61%), Positives = 254/341 (74%), Gaps = 23/341 (7%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVK LL  G+SVR TVR+PG+  KVGFLW L GAKERL ++K D+
Sbjct  2     PEYCVTGGTGFIAAYLVKELLASGHSVRATVRDPGDEAKVGFLWSLDGAKERLSLVKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             + EGS ++  +GVDGVFHTA PV V  D +IQ+ LI+P++KGT NVL S  K   V+RVV
Sbjct  62    LVEGSFDEAVNGVDGVFHTACPVFVSSDQDIQEKLINPAIKGTANVLKSCSKASSVRRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYN---------------------LWYA  616
             LTSSCS IRYR DATQ SPLNES W+D+DYCKRY+                     LWYA
Sbjct  122   LTSSCSSIRYRDDATQASPLNESSWSDIDYCKRYSIKQHHFITRIGLLDTYIFEWQLWYA  181

Query  615   YAKTMAEQEAWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNK  436
             YAKT+AE+EAW+ + ++  I+LVVVN SFVVGPLL PQPTSTL +IL+++KG   +YPN 
Sbjct  182   YAKTLAEKEAWRLS-KDFRIDLVVVNPSFVVGPLLAPQPTSTLHMILSLLKGERPDYPNT  240

Query  435   RVGFVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEE  256
              VGFVHI+D V +HILAME   ASGRL+CS++VAH+S+I+ MLR KYP YP   KC +++
Sbjct  241   TVGFVHIDDVVLSHILAMEDSRASGRLVCSSSVAHWSEIVEMLRAKYPYYPIPNKCGDQK  300

Query  255   GDDSEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             GD + HS+D TKI ELG PPF TL QMFDDC+ SFQ+K FL
Sbjct  301   GDSNPHSMDTTKIRELGFPPFKTLPQMFDDCVKSFQEKKFL  341



>ref|XP_008797849.1| PREDICTED: tetraketide alpha-pyrone reductase 2 [Phoenix dactylifera]
Length=320

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 252/320 (79%), Gaps = 2/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVK LL +GY+VR TVR+PG+  +VGFL  L GA+ERL+++K D+
Sbjct  2     PEYCVTGGTGFIAAYLVKELLARGYTVRATVRDPGDESRVGFLRSLDGAEERLRLVKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVV  733
             + EGS ++  +GVDGVFHTA PV V  D NI++ LI+P+VKGT NVL S  K   V+RVV
Sbjct  62    LVEGSFDEAVNGVDGVFHTACPVFVSNDPNIEEKLINPAVKGTANVLKSCSKASSVRRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DATQ SPL+ES W+DLDYCKRY+LWYAYAKT+AE+EAW+ + ++  ++
Sbjct  122   LTSSCSSIRYRDDATQASPLDESIWSDLDYCKRYSLWYAYAKTLAEKEAWRLS-KDFQLD  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGPLL PQPTSTL +IL+++KG   +YPN  VGFVHI+D V  HILAME  
Sbjct  181   LVVVNPSFVVGPLLAPQPTSTLLMILSLLKGDCPDYPNMAVGFVHIDDVVLGHILAMEDS  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRL+CS++VAH+S+I+ MLR KYP YP   KC +++G+ + HS+D TKI ELG P F
Sbjct  241   RASGRLVCSSSVAHWSEIVEMLRAKYPYYPIPNKCGDQKGNSNPHSMDTTKIRELGFPRF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              TL QMFDDCI  FQ+K FL
Sbjct  301   KTLPQMFDDCIKRFQEKKFL  320



>gb|AFX98067.1| cinnamoyl-CoA reductase [Cunninghamia lanceolata]
Length=325

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 194/320 (61%), Positives = 252/320 (79%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             E CVTGGTG I +YL+++LL+KGY VRTTVRNP  +EK+G+LW+L GAKERLKI+K D++
Sbjct  7     EMCVTGGTGFIAAYLIRALLNKGYKVRTTVRNPDNVEKIGYLWDLPGAKERLKIMKADLV  66

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVL  730
             EEGS ++  +GVDGVFHTA+PV VP DHN ++TLIDP V GTLNVL S +R   VKRVV 
Sbjct  67    EEGSFDEAVNGVDGVFHTAAPVFVPSDHNFKETLIDPCVNGTLNVLKSCSRSASVKRVVH  126

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRY ++  Q+SPL+ESHW++ +YCK+YNLWYAY KT+AE+EAWK+AE+  G++L
Sbjct  127   TSSCSSIRYNYNTQQLSPLDESHWSNPEYCKQYNLWYAYGKTIAEKEAWKYAEE-QGLDL  185

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGE-YPNKRVGFVHIEDAVRAHILAMEAQ  373
             VVVN SFVVGPLL P+PTSTL  +L I+KG   + YPN R+GFVHI+D + AHI+AME  
Sbjct  186   VVVNPSFVVGPLLAPEPTSTLHFVLNIMKGGNNKTYPNFRLGFVHIDDVIAAHIMAMELP  245

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
             +ASGR+ICS  VAH+ +I+ ML+ KYP+YP   +C  E+G+   H+++  KI  LG   F
Sbjct  246   SASGRIICSGVVAHWEEIVKMLKEKYPTYPIADQCGTEQGNAPPHTMNTGKIRSLGFGNF  305

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              ++ QMF+DCI SFQ+KG L
Sbjct  306   KSIEQMFEDCIRSFQEKGLL  325



>ref|NP_001185351.1| tetraketide alpha-pyrone reductase 2 [Arabidopsis thaliana]
 gb|AEE34807.1| tetraketide alpha-pyrone reductase 2 [Arabidopsis thaliana]
Length=294

 Score =   385 bits (988),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 237/320 (74%), Gaps = 30/320 (9%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGTG I SY++KSLL+ G++VRTTVRNP + EKVGFLWE +GAK+RLKIL+ D+ 
Sbjct  3     EYLVTGGTGFIASYIIKSLLELGHTVRTTVRNPRDEEKVGFLWEFQGAKQRLKILQADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA--RKMMVKRVV  733
              EGS ++  +GVDGVFHTASPVLVP DHNIQ+TL+DP +KGT NV++S    K  +KR+V
Sbjct  63    VEGSFDEAVNGVDGVFHTASPVLVPQDHNIQETLVDPIIKGTTNVMSSCAKSKATLKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR DAT+ SPLNESHW+D +YCKR+NLWY YAKT+ E+EAW+ AE+  G++
Sbjct  123   LTSSCSSIRYRFDATEASPLNESHWSDPEYCKRFNLWYGYAKTLGEREAWRIAEEK-GLD  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SFVVGP                   L+G  P          D V AH+LAME  
Sbjct  182   LVVVNPSFVVGP-------------------LLGPKPTN--------DVVAAHVLAMEEP  214

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR+ICS++VAH+S+II ++R KYP+YP+  KCSN+EGD+S HS+D  KI ELG   F
Sbjct  215   KASGRIICSSSVAHWSEIIELMRNKYPNYPFENKCSNKEGDNSPHSMDTRKIHELGFGSF  274

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L +MFDDCI SFQ+KG L
Sbjct  275   KSLPEMFDDCIISFQKKGLL  294



>ref|XP_006572878.1| PREDICTED: uncharacterized protein LOC100808002 isoform X1 [Glycine 
max]
Length=273

 Score =   382 bits (980),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 197/270 (73%), Positives = 227/270 (84%), Gaps = 1/270 (0%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGGTG I SYLVK+LL+KG++VRTTVRNPG++EKVGFL EL GAKERLKILK D+
Sbjct  2     PEFCVTGGTGFIASYLVKALLEKGHTVRTTVRNPGDVEKVGFLTELSGAKERLKILKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             + EGS ++   GVDGVFH ASPVL+PYD N+Q+ LIDP +KGTLNVL S  K  VK  VL
Sbjct  62    LVEGSFDEAVRGVDGVFHMASPVLIPYDENVQQNLIDPCIKGTLNVLNSCVKATVKHFVL  121

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR D  ++ PLNESHWTDL+YCKRY LWYAYAKT+AE+EAW+ A++N G++L
Sbjct  122   TSSCSSIRYRDDVQEVCPLNESHWTDLEYCKRYKLWYAYAKTIAEREAWRIAKEN-GMDL  180

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQPTSTL LIL+IVKG+ GEYPN  VGFVHI D V AH+LAME   
Sbjct  181   VVVNPSFVVGPLLAPQPTSTLLLILSIVKGMKGEYPNTTVGFVHINDVVAAHLLAMEDPK  240

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPY  280
             ASGRLICS+TVAH+SQII MLR KYPSYPY
Sbjct  241   ASGRLICSSTVAHWSQIIEMLRAKYPSYPY  270



>ref|XP_008360157.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Malus domestica]
Length=285

 Score =   381 bits (978),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 205/319 (64%), Positives = 233/319 (73%), Gaps = 35/319 (11%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVK+LLDKG+ VRTTVRNPG   +    W                
Sbjct  2     PEYCVTGGTGFIAAYLVKALLDKGHVVRTTVRNPGCTRR---RW----------------  42

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
                            +FHTA PVLVPYD N+Q  LIDP +KGTLNVL S  K  VKRVVL
Sbjct  43    ---------------IFHTAXPVLVPYDDNVQANLIDPCIKGTLNVLNSCSKARVKRVVL  87

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR+DA Q SPLNESHW+D +YCK YNLWYAYAKT AE+EAW+ A ++ G++L
Sbjct  88    TSSCSSIRYRYDAQQASPLNESHWSDAEYCKHYNLWYAYAKTTAEKEAWRIAGES-GMDL  146

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGPLL PQPTSTL +ILAI+KG  GEYPN  VGFVHI+D V AHILAME   
Sbjct  147   VVVNPSFVVGPLLAPQPTSTLYMILAILKGSRGEYPNTTVGFVHIDDVVAAHILAMEESK  206

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRLICS++VAH+S+II MLR KYPSYPY  KCS+ EGD + HS+D +KI +LG PPF 
Sbjct  207   ASGRLICSSSVAHWSEIIKMLRAKYPSYPYENKCSSVEGDSNPHSMDTSKIAQLGFPPFK  266

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL  MFDDCI SFQQKGFL
Sbjct  267   TLETMFDDCITSFQQKGFL  285



>ref|XP_010926052.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Elaeis 
guineensis]
Length=319

 Score =   379 bits (974),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/320 (60%), Positives = 248/320 (78%), Gaps = 3/320 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTGLI S LV++LL KG++VR TVR+PG+  KVGFLW   GAKERL+++K D+
Sbjct  2     PEYCVTGGTGLIASQLVRALLAKGHTVRATVRDPGDEAKVGFLWSFDGAKERLRLVKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             + EGS ++  DG DGVFHTA PV  P   NIQ+ LIDP+++GT NVL S  K   V+RVV
Sbjct  62    LVEGSFDEAVDGADGVFHTACPVHAPPGQNIQEALIDPAIRGTANVLKSCSKASSVRRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTS+C+ +RYR DAT +SPL+ESHW+D +YCKRY +WYAYAKT+AE+EAW+ A++  GI+
Sbjct  122   LTSTCAAVRYRDDATAVSPLDESHWSDPEYCKRYKMWYAYAKTLAEKEAWQLAKEY-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVV  SFVVG  LTPQPTSTLQ +L+I+KG    YPN+  GFVHI+D V  HILAME  
Sbjct  181   LVVVLPSFVVGTFLTPQPTSTLQTLLSIIKGERPTYPNRTGGFVHIDDVVLGHILAMEES  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGRLICS +VA++++++ MLR K+PSYP  TKC + +G++  HS+D TKI +LG+PPF
Sbjct  241   RASGRLICSGSVANWTEVMEMLRTKHPSYPIPTKCGDYQGENP-HSMDTTKIKDLGMPPF  299

Query  192   ATLSQMFDDCIHSFQQKGFL  133
               + QMF D I + Q+KGFL
Sbjct  300   KAIPQMFADFIKNLQEKGFL  319



>ref|XP_009403958.1| PREDICTED: tetraketide alpha-pyrone reductase 2 [Musa acuminata 
subsp. malaccensis]
Length=352

 Score =   374 bits (960),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/352 (54%), Positives = 239/352 (68%), Gaps = 34/352 (10%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I S+L++ LL +G++VR TVR+  ++ KVGFLW + GAKERLK++K D+
Sbjct  2     PEYCVTGGTGFIASHLIRELLSRGHTVRATVRDTEDVAKVGFLWSMGGAKERLKLVKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             + +GS +   DGVDGVFHTASPV VP D N+Q+ LIDP+++GT NVL S  K   V+RVV
Sbjct  62    LVDGSFDLAVDGVDGVFHTASPVFVPQDQNVQQALIDPAIQGTKNVLKSCSKASSVRRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSSCS IRYR+D T +SPLNESHW+D +YCKRYNLWYAYAKT+AE+EAW+ A    GI 
Sbjct  122   LTSSCSSIRYRYDVTLVSPLNESHWSDPEYCKRYNLWYAYAKTLAEKEAWRLAGHF-GIN  180

Query  552   LVVVNLSFVVG--------------------------------plltpqptstlqliLAI  469
             LVVVN SFVVG                                       +  L     +
Sbjct  181   LVVVNPSFVVGPLIAPRPTSTLLLILSILKGKYTYVPISCSESQTSRKHLSLALLKPDHL  240

Query  468   VKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPS  289
             +KG I  YPN  VGFVH++D + +HILAME    SGRLICS +VA +S+I+ M+R   PS
Sbjct  241   LKGNISWYPNTTVGFVHVDDVIFSHILAMEDSRVSGRLICSGSVARWSEIVEMIRANNPS  300

Query  288   YPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             YP  +K +++EGD + HS+D TKI ELGLP F TL QMF+DCI SF++KG L
Sbjct  301   YPMPSKRNDQEGDSNPHSMDTTKIRELGLPCFKTLPQMFNDCIKSFREKGLL  352



>emb|CDY42105.1| BnaA09g28550D [Brassica napus]
Length=321

 Score =   372 bits (955),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 191/320 (60%), Positives = 241/320 (75%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGT  I S++VK+LLD G+SVRTTVR+  + EKV FLWELKGAKERLKI + D+ 
Sbjct  3     EYLVTGGTSFIASHVVKALLDLGHSVRTTVRDSSDEEKVRFLWELKGAKERLKIFEADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM--MVKRVV  733
              EGS ++   GVDGVFH AS V V  D N  + L+D  + GT N++ S  K    VKR+V
Sbjct  63    VEGSFDEAVKGVDGVFHIASRVTVCLDKNDLEKLVDRDINGTRNLMNSCEKSRNTVKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSS + +RYR+DAT  SPLNESH++DLDYC+ + +WY YAKT+ E+EAW  A + + ++
Sbjct  123   LTSSSTAVRYRYDATDASPLNESHYSDLDYCRNFKIWYGYAKTLGEKEAWTIAAEKN-LD  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVV  SF +GP+L+P+PTS+  ++L+I+KG+ G+YPN   GFVHIED V A ILAME  
Sbjct  182   LVVVIPSFCIGPILSPEPTSSPLILLSIIKGVRGDYPNVTGGFVHIEDVVAAQILAMEEP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR ICS++VAH+S+II MLRPKYP YP+ TKCS+EEG D  HSLD TKI ELGLPPF
Sbjct  242   KASGRFICSSSVAHWSEIIEMLRPKYPLYPFETKCSSEEGKDMPHSLDTTKIRELGLPPF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L++MFDDCI  FQ KG L
Sbjct  302   KSLAEMFDDCIKCFQDKGLL  321



>ref|XP_009115319.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Brassica 
rapa]
Length=363

 Score =   373 bits (957),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/323 (59%), Positives = 243/323 (75%), Gaps = 3/323 (1%)
 Frame = -2

Query  1095  KRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKG  916
             K  EY VTGGT  I S++VK+LLD G+SVRTTVR+  + EKV FLWELKGAKERLKI + 
Sbjct  42    KMGEYLVTGGTSFIASHVVKALLDLGHSVRTTVRDSSDEEKVRFLWELKGAKERLKIFEA  101

Query  915   DVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM--MVK  742
             D+  EGS ++   GVDGVFH AS V V  D N  + L+D  + GT N++ S  K    VK
Sbjct  102   DLTVEGSFDEAVKGVDGVFHIASRVTVCLDKNDLEKLVDRDINGTRNLMNSCEKSRNTVK  161

Query  741   RVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQND  562
             R+VLTSS + +RYR+DAT+ SPLNESH++DLDYC+ + +WY YAKT+ E+EAW  A + +
Sbjct  162   RIVLTSSSTAVRYRYDATEASPLNESHYSDLDYCRNFKIWYGYAKTLGEKEAWTIAAEKN  221

Query  561   GIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAM  382
              ++LVVV  SF +GP+L+P+PTS+  ++L+I+KG+ G+YPN   GFVHIED V A ILAM
Sbjct  222   -LDLVVVIPSFCIGPILSPEPTSSPLILLSIIKGVRGDYPNVTGGFVHIEDVVAAQILAM  280

Query  381   EAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGL  202
             E   ASGR ICS++VAH+S+II MLRPKYP YP+ TKCS+EEG D  HSLD TKI ELGL
Sbjct  281   EEPKASGRFICSSSVAHWSEIIEMLRPKYPLYPFETKCSSEEGKDMPHSLDTTKIRELGL  340

Query  201   PPFATLSQMFDDCIHSFQQKGFL  133
             PPF +L++MFDDCI  FQ KG L
Sbjct  341   PPFKSLAEMFDDCIKCFQDKGLL  363



>emb|CDX84989.1| BnaC05g20660D [Brassica napus]
Length=321

 Score =   370 bits (951),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 189/320 (59%), Positives = 243/320 (76%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGT  I S++VK+LLD G+SVRTTVR+  + EKV FLWELKGAKERLKI + D+ 
Sbjct  3     EYLVTGGTSFIASHVVKALLDLGHSVRTTVRDSSDEEKVRFLWELKGAKERLKIFEADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM--MVKRVV  733
              EGS ++   GVDGVFH AS V V  D+N  + L+D  + GT N++ S  K    VKR+V
Sbjct  63    VEGSFDEAVKGVDGVFHIASRVTVCLDNNDLEKLVDRDINGTRNLMNSCEKSRNTVKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSS + +RYR+DAT+ SPL+ESH++DLDYC+ + +WY YAKT+ E+EAW  A + + ++
Sbjct  123   LTSSSTSVRYRYDATEASPLDESHYSDLDYCRNFKIWYGYAKTLGEKEAWTIAAEKN-LD  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             +VVV  SF +GP+L+P+PTS+  ++L+I+KG+ G+YPN   GFVHIED V A ILAME  
Sbjct  182   IVVVIPSFCIGPILSPEPTSSPLILLSIIKGVRGDYPNVTGGFVHIEDVVAAQILAMEKP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR ICS++VAH+S+II MLRPKYP YP+ TKCS+EEG D  HSLD TKI ELGLPPF
Sbjct  242   KASGRFICSSSVAHWSEIIEMLRPKYPLYPFETKCSSEEGKDMPHSLDTTKIRELGLPPF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L++MFDDCI  FQ KG L
Sbjct  302   KSLAEMFDDCIKCFQDKGLL  321



>ref|XP_009592084.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009592085.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoform 
X2 [Nicotiana tomentosiformis]
Length=264

 Score =   368 bits (945),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 187/265 (71%), Positives = 221/265 (83%), Gaps = 2/265 (1%)
 Frame = -2

Query  924  LKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-  748
            +K D++ EGS ++   GVDGVFHTASPV VPYD N++KTLI+PSVKGTLNVL S +K   
Sbjct  1    MKADLLVEGSFDNAIQGVDGVFHTASPVSVPYDDNVEKTLIEPSVKGTLNVLNSCKKTTK  60

Query  747  VKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQ  568
            +KR+VLTSSCS IRYR DA Q+SPLNESHW+DL YC+RYNLWY YAKT+AE+EAW+ A++
Sbjct  61   LKRLVLTSSCSSIRYRDDAQQVSPLNESHWSDLQYCQRYNLWYPYAKTIAEKEAWRVAKE  120

Query  567  NDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHIL  388
              GI+LVVVN SFV+GPLL PQPTSTL +ILAIVKG++GEYPNKR+GFVHIED V AHIL
Sbjct  121  C-GIDLVVVNPSFVLGPLLAPQPTSTLLIILAIVKGVLGEYPNKRLGFVHIEDVVAAHIL  179

Query  387  AMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMEL  208
             ME Q ASGR ICS +V H SQII MLR KYPSYP+  KCS++EG+D  HS+D +KI EL
Sbjct  180  VMEEQKASGRYICSNSVQHMSQIIDMLRTKYPSYPFENKCSSQEGEDMPHSMDTSKITEL  239

Query  207  GLPPFATLSQMFDDCIHSFQQKGFL  133
            GLPP  TL+QMFDDCI SFQ+KGFL
Sbjct  240  GLPPLKTLTQMFDDCIKSFQKKGFL  264



>ref|XP_006305188.1| hypothetical protein CARUB_v10009553mg, partial [Capsella rubella]
 gb|EOA38086.1| hypothetical protein CARUB_v10009553mg, partial [Capsella rubella]
Length=357

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/331 (58%), Positives = 243/331 (73%), Gaps = 4/331 (1%)
 Frame = -2

Query  1119  YMDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAK  940
             ++ +Q+  K  EY VTGGT  I S+++K+LL+ G+ VRTTVR+  + EKVGFLWELKGAK
Sbjct  29    HLIDQSLLKMAEYLVTGGTSFIASHVIKALLESGHFVRTTVRDSEDEEKVGFLWELKGAK  88

Query  939   ERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA  760
             ERLKI + D+  EGS ++  +GVDGVFH AS V V  D N  +   DP   G +NV+ S 
Sbjct  89    ERLKIFEADLTVEGSFDEAVNGVDGVFHIASRVSVGLDSNNMERF-DPDRSGIMNVMNSC  147

Query  759   RKM--MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEA  586
              K    VKR+VLTSS + IRYR DATQ+SPLNESHWTDL+YCKR+ +WYAYAKT+AE+EA
Sbjct  148   AKSRNTVKRIVLTSSSTTIRYRFDATQVSPLNESHWTDLEYCKRFKIWYAYAKTLAEKEA  207

Query  585   WKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDA  406
             WK A +   + LVVV  +F +GP+L+P+PTS+  ++L++VKG  G YPN R GFVHI+D 
Sbjct  208   WKIAAEKK-LNLVVVIPTFCIGPILSPKPTSSPLILLSVVKGARGRYPNFRGGFVHIDDV  266

Query  405   VRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDC  226
             V A ILAME   ASGR++CS++VAH+S+II MLR KYP YP+ TKC +EEG D  HSLD 
Sbjct  267   VAAQILAMEELKASGRILCSSSVAHWSEIIEMLRIKYPLYPFETKCGSEEGRDMPHSLDT  326

Query  225   TKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             TKI ELG   F +L +MFDDCI  FQ KG L
Sbjct  327   TKIQELGFTCFKSLPEMFDDCIKCFQDKGLL  357



>ref|XP_003565283.1| PREDICTED: tetraketide alpha-pyrone reductase 2 [Brachypodium 
distachyon]
Length=325

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/324 (56%), Positives = 240/324 (74%), Gaps = 8/324 (2%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I S+L+++LL  G++VR TVR+P +  KVGFLW+L+GA ERL++++ D+
Sbjct  2     PEYCVTGGTGFIASHLIRALLAAGHTVRATVRDPADEAKVGFLWDLEGADERLQLVRADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYD--HNIQKTLIDPSVKGTLNVLTS---ARKMMV  745
             + +GS +D   GVDGVFHTASPV+V YD   + Q  L+DP V G  NVL S   A     
Sbjct  62    LVKGSFDDAVSGVDGVFHTASPVVVGYDDGEDAQAKLVDPIVLGAANVLRSCARATPAPP  121

Query  744   KRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQN  565
             +R+V TSSCSC+RY   +     LNE+HW+D  YC+ Y LWYAYAKT+AE+EAW+ A+Q+
Sbjct  122   RRIVFTSSCSCVRY--SSHHPPSLNETHWSDTGYCQSYGLWYAYAKTVAEKEAWRLAKQH  179

Query  564   DGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILA  385
              G++LVVVN SFVVGP+L P PTST  ++LA+++G +G+YPN  +GFVH++DAV AHILA
Sbjct  180   -GLDLVVVNPSFVVGPVLAPAPTSTALVVLALLRGELGKYPNTTIGFVHVDDAVLAHILA  238

Query  384   MEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELG  205
             ME   A GRL+CS  VAH+S+++  LR +YP YP  T+CS ++GDD  H +D  KI+ LG
Sbjct  239   MEDGRAKGRLVCSGDVAHWSEVLGALREQYPQYPIPTECSGQKGDDRAHKMDTGKILALG  298

Query  204   LPPFATLSQMFDDCIHSFQQKGFL  133
              PPF ++ QMFDDCI SFQ KG L
Sbjct  299   FPPFLSIRQMFDDCIKSFQDKGLL  322



>ref|XP_006305187.1| hypothetical protein CARUB_v10009553mg, partial [Capsella rubella]
 gb|EOA38085.1| hypothetical protein CARUB_v10009553mg, partial [Capsella rubella]
Length=356

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 193/331 (58%), Positives = 243/331 (73%), Gaps = 5/331 (2%)
 Frame = -2

Query  1119  YMDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAK  940
             ++ +Q+  K  EY VTGGT  I S+++K+LL+ G+ VRTTVR+  E EKVGFLWELKGAK
Sbjct  29    HLIDQSLLKMAEYLVTGGTSFIASHVIKALLESGHFVRTTVRDSDE-EKVGFLWELKGAK  87

Query  939   ERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA  760
             ERLKI + D+  EGS ++  +GVDGVFH AS V V  D N  +   DP   G +NV+ S 
Sbjct  88    ERLKIFEADLTVEGSFDEAVNGVDGVFHIASRVSVGLDSNNMERF-DPDRSGIMNVMNSC  146

Query  759   RKM--MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEA  586
              K    VKR+VLTSS + IRYR DATQ+SPLNESHWTDL+YCKR+ +WYAYAKT+AE+EA
Sbjct  147   AKSRNTVKRIVLTSSSTTIRYRFDATQVSPLNESHWTDLEYCKRFKIWYAYAKTLAEKEA  206

Query  585   WKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDA  406
             WK A +   + LVVV  +F +GP+L+P+PTS+  ++L++VKG  G YPN R GFVHI+D 
Sbjct  207   WKIAAEKK-LNLVVVIPTFCIGPILSPKPTSSPLILLSVVKGARGRYPNFRGGFVHIDDV  265

Query  405   VRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDC  226
             V A ILAME   ASGR++CS++VAH+S+II MLR KYP YP+ TKC +EEG D  HSLD 
Sbjct  266   VAAQILAMEELKASGRILCSSSVAHWSEIIEMLRIKYPLYPFETKCGSEEGRDMPHSLDT  325

Query  225   TKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             TKI ELG   F +L +MFDDCI  FQ KG L
Sbjct  326   TKIQELGFTCFKSLPEMFDDCIKCFQDKGLL  356



>ref|XP_002457441.1| hypothetical protein SORBIDRAFT_03g007400 [Sorghum bicolor]
 gb|EES02561.1| hypothetical protein SORBIDRAFT_03g007400 [Sorghum bicolor]
Length=325

 Score =   361 bits (926),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 187/328 (57%), Positives = 246/328 (75%), Gaps = 14/328 (4%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I ++L+++LL  G+SVR TVR+P +  KVGFLWEL+GA ERL++++ D+
Sbjct  2     PEYCVTGGTGFIAAHLIRALLAAGHSVRATVRDPEDEGKVGFLWELEGAGERLQLVRADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHN--IQKTLIDPSVKGTLNVLTSARKMMV---  745
             M EGS +D   GVDGVFHTASPV+V    N  +Q+TL++P VKG  NVL S  +      
Sbjct  62    MVEGSFDDAVSGVDGVFHTASPVVVVGKDNKDVQETLVEPIVKGAANVLRSCARAAAPDE  121

Query  744   --KRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAE  571
               +RVV TSSCSC+RY H AT    LNESHW+D DYCK ++LWYAYAKT+AE+EAW+ A+
Sbjct  122   RPRRVVFTSSCSCVRYCHAAT----LNESHWSDADYCKSHDLWYAYAKTVAEKEAWRLAK  177

Query  570   QNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHI  391
             ++ GI+LVVVN SFV+GP L P+PTST+ ++LA++KG +G+YPN  +GFVH++D V  H+
Sbjct  178   EH-GIDLVVVNPSFVIGPALGPKPTSTILIVLAMLKGELGKYPNTTIGFVHVDDVVLCHV  236

Query  390   LAMEAQNASGRLICSTTV-AHFSQIIHMLRPKYPSYPYLTKC-SNEEGDDSEHSLDCTKI  217
             LAME   ASGRLICS  V AH+S+I+  LR +YP YP   +C S+++GDD  H +D +K+
Sbjct  237   LAMEDARASGRLICSCDVAAHWSEILESLRERYPQYPIPRECSSSQKGDDRPHRMDTSKV  296

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LG PPF ++ QMFDDCI SFQ KG L
Sbjct  297   KALGFPPFLSVHQMFDDCIKSFQDKGLL  324



>gb|EMT07290.1| Dihydroflavonol-4-reductase [Aegilops tauschii]
Length=329

 Score =   361 bits (926),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 236/327 (72%), Gaps = 9/327 (3%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I S+L+++LL  G++VR TVR+P +  KVGFLWEL+GA ERL++L+ D+
Sbjct  2     PEYCVTGGTGFIASHLIRALLAAGHTVRATVRDPSDEAKVGFLWELEGADERLQLLRADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYD--HNIQKTLIDPSVKGTLNVLTSARKMMV--K  742
             + EGS +    GVDGVFH ASPV+V Y+   + Q+ L+DP +KG  NVL S  +  V  +
Sbjct  62    LVEGSFDAAVSGVDGVFHAASPVVVSYEDGKDAQEKLVDPIMKGAGNVLRSCARAAVPPR  121

Query  741   RVVLTSSCSCIRYRHDATQ---ISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAE  571
             RVV TSSCSC+RYRH          LNESHW+D DYC+ Y LWYAYAKT+AE+EAW+ A 
Sbjct  122   RVVFTSSCSCVRYRHHHVHGGAPPALNESHWSDADYCRTYGLWYAYAKTVAEKEAWRLAT  181

Query  570   QNDGIELVVVNLSFVVG-plltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAH  394
             ++ G++LVVVN SFVVG  L     TST  ++LA++ G +G+YPN  +GFVH++D V  H
Sbjct  182   EH-GLDLVVVNPSFVVGPVLGRAAATSTALVVLALLNGDLGKYPNTTIGFVHVDDVVLGH  240

Query  393   ILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIM  214
             +LAME   ASGRLICS  VAH+S+++  LR +YP YP  T+CS  +GDD  H +D +K+ 
Sbjct  241   VLAMEDGRASGRLICSGDVAHWSEVLGSLRERYPQYPIPTECSGGKGDDRAHKMDTSKME  300

Query  213   ELGLPPFATLSQMFDDCIHSFQQKGFL  133
              LG PPF ++ QMFDDCI SFQ+KG L
Sbjct  301   ALGFPPFLSIQQMFDDCIKSFQEKGLL  327



>gb|EMS54203.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Triticum urartu]
Length=329

 Score =   360 bits (925),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 238/327 (73%), Gaps = 9/327 (3%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I S+L+++LL  G++VR TVR+P +  KVGFLW+L+GA ERL++L+ D+
Sbjct  2     PEYCVTGGTGFIASHLIRALLAAGHTVRATVRDPSDEAKVGFLWDLEGADERLQLLRADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYD--HNIQKTLIDPSVKGTLNVLTSARKMMV--K  742
             + EGS +    GVDGVFH ASPV+V Y+   + Q+ L+DP VKG  NVL S  +  V  +
Sbjct  62    LVEGSFDAAVSGVDGVFHAASPVIVSYEDGKDAQEKLVDPIVKGAGNVLRSCARAAVPPR  121

Query  741   RVVLTSSCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAE  571
             RVV TSSCSC+RYRH          LNESHW+D DYC+ Y LWYAYAKT+AE+EAW+ A 
Sbjct  122   RVVFTSSCSCVRYRHHHVHGGAPPTLNESHWSDADYCRTYGLWYAYAKTVAEKEAWRLAT  181

Query  570   QNDGIELVVVNLSFVVGplltpqp-tstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAH  394
             ++ G++LVVVN SFV+GP+L     TST  ++LA++KG +G+YPN  +GFVH++D V  H
Sbjct  182   EH-GLDLVVVNPSFVIGPVLGRAAPTSTALVVLALLKGDLGKYPNTTIGFVHVDDVVLGH  240

Query  393   ILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIM  214
             +LAME   ASGRLICS  VAH+S+++  LR +YP YP  T+CS  +GDD  H +D +K+ 
Sbjct  241   VLAMEDGRASGRLICSGDVAHWSEVLGSLRERYPQYPIPTECSGGKGDDRAHKMDTSKME  300

Query  213   ELGLPPFATLSQMFDDCIHSFQQKGFL  133
              LG PPF ++ QMFDDCI SFQ KG L
Sbjct  301   ALGFPPFLSIQQMFDDCIKSFQDKGLL  327



>ref|NP_173917.1| tetraketide alpha-pyrone reductase 2-like protein [Arabidopsis 
thaliana]
 gb|AAG50819.1|AC079281_21 dihydroflavonol 4-reductase, putative [Arabidopsis thaliana]
 gb|AEE30627.1| tetraketide alpha-pyrone reductase 2-like protein [Arabidopsis 
thaliana]
Length=320

 Score =   360 bits (923),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/320 (59%), Positives = 237/320 (74%), Gaps = 4/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGT  I S+++KSLL+ G+ VRTTVR+  + EKVGFLW+LKGAKERLKI + D+ 
Sbjct  3     EYLVTGGTSFIASHVIKSLLEFGHYVRTTVRDSEDEEKVGFLWDLKGAKERLKIFEADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM--MVKRVV  733
              EGS ++  +GVDGVFH AS V V  D+N      DP++ GT+NV+ S  K    VKR+V
Sbjct  63    IEGSFDEAVNGVDGVFHIASRVSVRLDNN-NLDKFDPNISGTMNVMNSCAKSRNTVKRIV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSS + IRYR DATQ+SPLNESHWTDL+YCK + +WYAY KT+ E+EAW+ A  +  + 
Sbjct  122   LTSSSTAIRYRFDATQVSPLNESHWTDLEYCKHFKIWYAYKKTLGEKEAWRIA-ADKKLN  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVV  SF +GP+L+P+PTS+  + L+I+KG  G YPN R GFVHI+D V A ILAME  
Sbjct  181   LVVVIPSFCIGPILSPKPTSSPLIFLSIIKGTRGTYPNFRGGFVHIDDVVAAQILAMEEP  240

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR++CS++VAH+S+II MLR KYP YP+ TKC +EEG D  HSLD TKI ELG   F
Sbjct  241   KASGRILCSSSVAHWSEIIEMLRIKYPLYPFETKCGSEEGKDMPHSLDTTKIHELGFASF  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L++MFDDCI  FQ KG L
Sbjct  301   KSLTEMFDDCIKCFQDKGLL  320



>ref|XP_004971624.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Setaria 
italica]
Length=326

 Score =   360 bits (923),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 189/329 (57%), Positives = 242/329 (74%), Gaps = 15/329 (5%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPG-------ELEKVGFLWELKGAKERL  931
             PEYCVTGGTG I ++L+++LL  G++VR TVR+PG       +  KVGFLWEL GA ERL
Sbjct  2     PEYCVTGGTGFIAAHLIRALLAAGHTVRATVRDPGTHRSIPHDEGKVGFLWELDGAGERL  61

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNI-QKTLIDPSVKGTLNVLTSARK  754
              +++ D+M EGS ++   GVDGVFHTASPV+V       Q+ L+DP VKG  NVL S  +
Sbjct  62    TLVRADLMVEGSFDEAVSGVDGVFHTASPVVVVAGGKGVQEELVDPIVKGASNVLRSCAR  121

Query  753   M--MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWK  580
                  +RVV TSSCSC+RY H AT    LNESHW+D DYCK YNLWYAYAKT+AE+EAW+
Sbjct  122   ASERPRRVVFTSSCSCVRYCHAAT----LNESHWSDADYCKSYNLWYAYAKTVAEKEAWR  177

Query  579   WAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVR  400
              A+++ G++LVVVN SFV+GP L P+PTST+ ++LA++KG +G+YPN  +GFVH++D V 
Sbjct  178   LAKEH-GLDLVVVNPSFVIGPALGPRPTSTILIVLAMLKGELGKYPNTTIGFVHVDDVVL  236

Query  399   AHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTK  220
              H+LAME   ASGRLICS  VAH+S+I+  LR +YP YP  T+CS ++GDD  H +D TK
Sbjct  237   CHVLAMEDARASGRLICSCDVAHWSEILSSLRERYPQYPIPTECSAQKGDDRPHRMDTTK  296

Query  219   IMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             I  LG PPF ++ QMFDDCI SFQ KG L
Sbjct  297   IRALGFPPFLSVQQMFDDCIKSFQDKGLL  325



>emb|CDM80595.1| unnamed protein product [Triticum aestivum]
Length=329

 Score =   358 bits (920),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 182/327 (56%), Positives = 237/327 (72%), Gaps = 9/327 (3%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I S+L+++LL  G++VR TVR+P +  KVGFLWEL+GA ERL++L+ D+
Sbjct  2     PEYCVTGGTGFIASHLIRALLAAGHTVRATVRDPSDDAKVGFLWELEGADERLQLLRADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYD--HNIQKTLIDPSVKGTLNVLTSARKMMV--K  742
             + EGS +    GVDGVFH ASPV+V Y+   + Q+ L+DP VKG  NVL S  +  V  +
Sbjct  62    LVEGSFDAAVSGVDGVFHAASPVVVSYEDGKDAQEKLVDPIVKGAGNVLRSCARAAVPPR  121

Query  741   RVVLTSSCSCIRYRHD---ATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAE  571
             RVV TSSCS +RYRH          LNESHW+D DYC+ Y LWYAYAKT+AE+EAW+ A 
Sbjct  122   RVVFTSSCSSVRYRHHHVHGGAPPTLNESHWSDADYCRTYGLWYAYAKTVAEKEAWRLAT  181

Query  570   QNDGIELVVVNLSFVVGplltpqp-tstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAH  394
             ++ G++LVVVN SFVVGP+L     TST  ++LA++KG +G+YPN  +GFVH++D V  H
Sbjct  182   EH-GLDLVVVNPSFVVGPVLGRAAPTSTALVVLALLKGDLGKYPNTTIGFVHVDDVVLGH  240

Query  393   ILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIM  214
             +LAME   ASGRLICS  VAH+S+++  LR +YP YP  T+CS  +GDD  H +D +K+ 
Sbjct  241   VLAMEDGRASGRLICSGDVAHWSEVLGSLRERYPQYPIPTECSGGKGDDRAHKMDTSKME  300

Query  213   ELGLPPFATLSQMFDDCIHSFQQKGFL  133
              LG PPF ++ QMFDDCI SFQ KG L
Sbjct  301   ALGFPPFLSIQQMFDDCIKSFQDKGLL  327



>ref|XP_006845299.1| hypothetical protein AMTR_s00005p00268810 [Amborella trichopoda]
 gb|ERN06974.1| hypothetical protein AMTR_s00005p00268810 [Amborella trichopoda]
Length=292

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 182/285 (64%), Positives = 223/285 (78%), Gaps = 3/285 (1%)
 Frame = -2

Query  981  LEKVGFLWELKGAKERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLI  802
            ++KVGFLWE+ GAKERLK+++ +++EEGS + G DGVDGVFHTASPVLVPYD NI++++I
Sbjct  1    MDKVGFLWEMDGAKERLKLVRAELLEEGSFDKGIDGVDGVFHTASPVLVPYDQNIEESMI  60

Query  801  DPSVKGTLNVLTSARKMM-VKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNL  625
            +PS+KGT+NVL S  K   + RVVLTSSCS +RYR D  QISPLNESHW+D  YCK +NL
Sbjct  61   NPSIKGTINVLKSCSKATSLGRVVLTSSCSSVRYRDDVHQISPLNESHWSDPQYCKNHNL  120

Query  624  WYAYAKTMAEQEAWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGE-  448
            WYAYAKT+AEQEAWK A++   I+LVVVN SFVVGPLL PQPTSTL ++L I+ G+ G  
Sbjct  121  WYAYAKTLAEQEAWKAAKEWK-IDLVVVNPSFVVGPLLGPQPTSTLLMVLGILTGINGGV  179

Query  447  YPNKRVGFVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKC  268
            YPN R+GF HI+D V  H+LAME   ASGRLICS  VAH+S+I+ ML+PKYPS     KC
Sbjct  180  YPNTRIGFSHIDDVVTTHMLAMEKGEASGRLICSGPVAHWSEIVAMLKPKYPSLNIANKC  239

Query  267  SNEEGDDSEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
              + GDD  H++D TKI  LG P F T+ QMFDDC+ SFQ KGFL
Sbjct  240  GEQIGDDKPHNMDTTKIRNLGQPTFKTIEQMFDDCLKSFQDKGFL  284



>ref|NP_001041904.1| Os01g0127500 [Oryza sativa Japonica Group]
 dbj|BAB18290.1| putative cinnamoyl CoA reductase [Oryza sativa Japonica Group]
 dbj|BAF03818.1| Os01g0127500 [Oryza sativa Japonica Group]
 gb|EAY72372.1| hypothetical protein OsI_00225 [Oryza sativa Indica Group]
Length=337

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/335 (53%), Positives = 234/335 (70%), Gaps = 19/335 (6%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I S+L+++LL   ++VR TVR+P +  KVGFLWEL GA ERL+++K D+
Sbjct  2     PEYCVTGGTGFIASHLIRALLAASHTVRATVRDPEDEAKVGFLWELDGASERLQLVKADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLV----------PYDHN----IQKTLIDPSVKGTLNV  772
             M EGS +D   GVDGVFH ASPV+V          P D +    +Q+ L++P V+G  NV
Sbjct  62    MVEGSFDDAVRGVDGVFHAASPVVVVGNSSSNNGKPNDDDDEEEVQQRLVEPIVRGASNV  121

Query  771   LTSARKM--MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMA  598
             L S  +     +RVV TSSCSC+RY   A   + LNESHW+D  YC  + LWYAYAKT+A
Sbjct  122   LRSCARASPRPRRVVFTSSCSCVRY--GAGAAAALNESHWSDAAYCAAHGLWYAYAKTLA  179

Query  597   EQEAWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVH  418
             E+EAW+ A++  G+++V VN SFVVGP+L+  PTST  ++LA+++G +  YPN  VGFVH
Sbjct  180   EREAWRLAKER-GLDMVAVNPSFVVGPILSQAPTSTALIVLALLRGELPRYPNTTVGFVH  238

Query  417   IEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEH  238
             ++DAV AH++AME   ASGRLICS  VAH+S+I+  LR +YP YP   +C + +GDD  H
Sbjct  239   VDDAVLAHVVAMEDARASGRLICSCHVAHWSEIVGSLRERYPGYPIPAECGSHKGDDRAH  298

Query  237   SLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
              +D  KI  LG PPF ++ QMFDDCI SFQ KG L
Sbjct  299   KMDTAKIRALGFPPFLSVQQMFDDCIKSFQDKGLL  333



>ref|XP_009115320.1| PREDICTED: tetraketide alpha-pyrone reductase 2 isoform X1 [Brassica 
rapa]
Length=321

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 230/320 (72%), Gaps = 3/320 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGT  I S++VK+LLD GY VRTTVR+    EKV FLWELKGAKERLKI + D+ 
Sbjct  3     EYLVTGGTSFIASHVVKALLDFGYFVRTTVRDSSYEEKVRFLWELKGAKERLKIFEADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM--MVKRVV  733
              +GS +D   GVDGVFH AS + V  D N  + L D  + GT N++ S  K    VKR+V
Sbjct  63    VDGSFDDAVKGVDGVFHIASRISVCLDDNDLEKLADRDIYGTRNLMNSCEKSRNTVKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSS + +RY +DAT+ SPL  SHW+DL+Y + +++WY YAKT+ E+EAW  A + + + 
Sbjct  123   LTSSSTSVRYSYDATKASPLKGSHWSDLEYFRSFSIWYGYAKTLVEKEAWLIAAEKN-LN  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVV  SF +GP+L+P+PTS+  + L+I+KG+ GEYPN R GFVHI+D   A ILAM+  
Sbjct  182   LVVVIPSFCIGPILSPKPTSSPSIFLSIIKGVHGEYPNFRGGFVHIDDVAAAQILAMKEP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR+ICS++VAH+S+II ML+PKYP YP+ TKC +EEG D  HSLD  KI ELG   F
Sbjct  242   KASGRIICSSSVAHWSEIIEMLKPKYPLYPFETKCGSEEGRDMPHSLDTRKIHELGFGSF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L++MFDDCI  FQ KG L
Sbjct  302   KSLAEMFDDCIKCFQDKGLL  321



>ref|XP_010460374.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoform 
X1 [Camelina sativa]
Length=320

 Score =   335 bits (859),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 180/321 (56%), Positives = 225/321 (70%), Gaps = 15/321 (5%)
 Frame = -2

Query  1095  KRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKG  916
             K  EY VTGGT  I S++ K+LL+ G+SVRTTVR+  E EKVGFLWELKGAKERLKI + 
Sbjct  15    KMAEYLVTGGTSFIASHVTKALLESGHSVRTTVRDSDE-EKVGFLWELKGAKERLKIFEA  73

Query  915   DVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRV  736
             D+  EGS ++  +GVDG FH AS V V             +  G  N      +  VKR+
Sbjct  74    DLTVEGSFDEAVNGVDGFFHIASRVSV-------------ATVGLDNNNMVRLRNTVKRI  120

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             VLTSS + IRYR DATQ+SPLNESHWTDL+YCKR+ +WY YAKT+ E+EAWK A +   +
Sbjct  121   VLTSSSTAIRYRFDATQVSPLNESHWTDLEYCKRFRIWYGYAKTLGEKEAWKMAVEKK-L  179

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
              LVVV  +F +GP++ P+PTS+ ++ L+IVKG  G YPN R GFVHI+D V A ILAME 
Sbjct  180   NLVVVIPTFCIGPIICPKPTSSPRIFLSIVKGARGSYPNFRGGFVHIDDVVAAQILAMEE  239

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               AS R++CS+++AH+S+II MLR KYP YP+ TKC +EEG D  HSLD TKI +LG   
Sbjct  240   PKASERILCSSSMAHWSEIIEMLRIKYPLYPFETKCGSEEGRDMPHSLDTTKIQQLGFTS  299

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F +L +MFDDCI  FQ KG L
Sbjct  300   FKSLPEMFDDCIKCFQDKGLL  320



>ref|XP_010460375.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoform 
X2 [Camelina sativa]
Length=318

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 226/324 (70%), Gaps = 23/324 (7%)
 Frame = -2

Query  1095  KRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKG  916
             K  EY VTGGT  I S++ K+LL+ G+SVRTTVR+  E EKVGFLWELKGAKERLKI + 
Sbjct  15    KMAEYLVTGGTSFIASHVTKALLESGHSVRTTVRDSDE-EKVGFLWELKGAKERLKIFEA  73

Query  915   DVMEEGSMEDGFDGVDGVFHTASPVLVP---YDHNIQKTLIDPSVKGTLNVLTSARKMMV  745
             D+  EGS ++  +GVDG FH AS V V     D+N                  +  +  V
Sbjct  74    DLTVEGSFDEAVNGVDGFFHIASRVSVATVGLDNN------------------NMSRNTV  115

Query  744   KRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQN  565
             KR+VLTSS + IRYR DATQ+SPLNESHWTDL+YCKR+ +WY YAKT+ E+EAWK A + 
Sbjct  116   KRIVLTSSSTAIRYRFDATQVSPLNESHWTDLEYCKRFRIWYGYAKTLGEKEAWKMAVEK  175

Query  564   DGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILA  385
               + LVVV  +F +GP++ P+PTS+ ++ L+IVKG  G YPN R GFVHI+D V A ILA
Sbjct  176   K-LNLVVVIPTFCIGPIICPKPTSSPRIFLSIVKGARGSYPNFRGGFVHIDDVVAAQILA  234

Query  384   MEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELG  205
             ME   AS R++CS+++AH+S+II MLR KYP YP+ TKC +EEG D  HSLD TKI +LG
Sbjct  235   MEEPKASERILCSSSMAHWSEIIEMLRIKYPLYPFETKCGSEEGRDMPHSLDTTKIQQLG  294

Query  204   LPPFATLSQMFDDCIHSFQQKGFL  133
                F +L +MFDDCI  FQ KG L
Sbjct  295   FTSFKSLPEMFDDCIKCFQDKGLL  318



>ref|XP_010501600.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Camelina 
sativa]
Length=318

 Score =   325 bits (833),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 223/324 (69%), Gaps = 14/324 (4%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGT  I S+++KSLL+ G+SVRTT       EKVGFLWELKGAKERLKI + D+ 
Sbjct  3     EYLVTGGTSFIASHVIKSLLESGHSVRTTNYE----EKVGFLWELKGAKERLKIFEADLT  58

Query  906   EEGSMEDGFDGVDGVFHTASPVLVP---YDHNIQKTLIDPSVKGTLNVLTSARKM--MVK  742
              EGS ++  +GVDGVFH AS V V     D+N      DP   G +NV+ S  K    VK
Sbjct  59    VEGSFDEAVNGVDGVFHIASRVSVATGGLDNNNNMEKFDPDRSGIMNVMNSCAKSRNTVK  118

Query  741   RVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQND  562
             R+VLTSS + IRYR DATQ+SPLNESHWTDL+YCK + +WY YAKT+ E+EAWK A +  
Sbjct  119   RIVLTSSSTAIRYRFDATQVSPLNESHWTDLEYCKHFKIWYGYAKTLGEKEAWKMAAEKK  178

Query  561   GIELVVVNLSFVVGplltpqptstlqliLAIVKGLI-GEYPNKRVGFVHIEDAVRAHILA  385
              + LVVV  +F +GP+L+P+ TS+  +   + K    G YPN R GFVHI+DAV A ILA
Sbjct  179   -LNLVVVIPTFCIGPILSPKLTSSPLIFCPLSKFWARGRYPNFRGGFVHIDDAVAAQILA  237

Query  384   MEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELG  205
             ME   ASG ++CS++VAH+S+II MLR K   YP+ TKC +EEG D  HSLD TKI +LG
Sbjct  238   MEEPKASGIILCSSSVAHWSEIIEMLRIK---YPFETKCGSEEGRDMPHSLDTTKIQQLG  294

Query  204   LPPFATLSQMFDDCIHSFQQKGFL  133
                F +L +MFDDCI  FQ KG L
Sbjct  295   FTSFKSLPEMFDDCIKCFQDKGLL  318



>ref|XP_002893422.1| hypothetical protein ARALYDRAFT_472827 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69681.1| hypothetical protein ARALYDRAFT_472827 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 175/321 (55%), Positives = 222/321 (69%), Gaps = 24/321 (7%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEK-VGFLWELKGAKERLKILKGDV  910
             EY VTGGT  I S+++K+LL+ G+ VRTTVR+ G+ EK VGFLWELKGAKERLKI + D+
Sbjct  3     EYLVTGGTSFIASHVIKTLLEFGHYVRTTVRDSGDEEKDVGFLWELKGAKERLKIFEADL  62

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM--MVKRV  736
               EGS +D  +GVDGVFH AS V V  D+N  +   DP++ GT+NV+ S  K    VKR+
Sbjct  63    TVEGSFDDAVNGVDGVFHIASRVSVGRDNNNLEKF-DPNISGTMNVMNSCAKSRNTVKRI  121

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             VLTSS + IRYR DATQ+SPLNESHWTDL+YCKR+ +WY Y KT+ E+EAW+ A  +  +
Sbjct  122   VLTSSSTTIRYRFDATQVSPLNESHWTDLEYCKRFKIWYGYKKTLGEKEAWRIA-ADKKL  180

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
              LVVV  SF +GP+ +P+PTS+ ++ L+I+KG  G YPN R GFVHIED V A ILAME 
Sbjct  181   NLVVVIPSFCIGPIPSPKPTSSPRIFLSIIKGTRGAYPNFRGGFVHIEDVVAAQILAMED  240

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               ASGR++CS++VAH+                   C +EEG D  HSL+ TKI ELG   
Sbjct  241   PKASGRILCSSSVAHW-------------------CGSEEGRDMPHSLNTTKIHELGFAS  281

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F +L +MFDDCI  FQ  G L
Sbjct  282   FKSLPEMFDDCIKCFQDMGLL  302



>ref|XP_006415874.1| hypothetical protein EUTSA_v10008284mg [Eutrema salsugineum]
 gb|ESQ34227.1| hypothetical protein EUTSA_v10008284mg [Eutrema salsugineum]
Length=307

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 222/321 (69%), Gaps = 19/321 (6%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGT  I S++VK+LLD G+SVRTTVR+  + EKV FLWELKGAKERLKI + D+ 
Sbjct  3     EYLVTGGTSFIASHVVKALLDLGHSVRTTVRDSSDEEKVRFLWELKGAKERLKIFEADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM--MVKRVV  733
              EGS ++   GVDGVFH AS   V  D+N  + L+   + GT N++ S  K    VKR+V
Sbjct  63    VEGSFDEAVYGVDGVFHIASQASVCLDNNNLEKLMKSDISGTRNLMNSCEKSRNTVKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
              TSS + +RYR DAT+ SPLNESHW+DLDYCKR+N+    A   AE++          + 
Sbjct  123   FTSSSTTVRYRFDATEESPLNESHWSDLDYCKRFNICLRIA---AEKK----------LN  169

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVV  S+  GP+L+P+PT +   +L+IVKG +GEYPN R GFVHI+D V AHILAME  
Sbjct  170   LVVVIPSYSFGPILSPKPTRSPLTLLSIVKGDLGEYPNFRGGFVHIDDVVAAHILAMEEP  229

Query  372   NASGRLIC-STTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              ASGR IC S++VA++ +II MLR KYP YP+ T   NEEG D  HSLD TKI ELGL  
Sbjct  230   KASGRYICSSSSVANWPEIIEMLRTKYPLYPFET---NEEGKDMPHSLDTTKIRELGLTS  286

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F +L +MFDDCI SFQ KG L
Sbjct  287   FKSLDEMFDDCIKSFQDKGLL  307



>ref|XP_006645458.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Oryza brachyantha]
Length=295

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/317 (52%), Positives = 212/317 (67%), Gaps = 33/317 (10%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I S+L+++LL  G++VR TVR+P +  KVGFLWEL+GA ERL++L+ D+
Sbjct  2     PEYCVTGGTGFIASHLIRALLAAGHTVRATVRDPEDEAKVGFLWELEGASERLQLLRADL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             M EGS +D                              +V+G  NVL S  +   +RVV 
Sbjct  62    MVEGSFDD------------------------------AVRGAANVLRSCARARPRRVVF  91

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCSC+RY   A   + LNESHW+D  YC  + LWYAYAKT+AE+EAW+ A++  G+++
Sbjct  92    TSSCSCVRYCGGAA--TALNESHWSDAAYCAAHGLWYAYAKTVAEREAWRLAKER-GLDM  148

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGP+L P  TST  ++LA+++G +  YPN  VGFVH++DAV AH+LAME   
Sbjct  149   VVVNPSFVVGPVLGPAATSTALVVLALLRGDLPRYPNTTVGFVHVDDAVLAHVLAMEDPR  208

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             ASGRLICS  VAH+S+I+  LR ++P Y     CS  +GDD  H +D TKI  LG PPF 
Sbjct  209   ASGRLICSCHVAHWSEIVEALRERHPQYRLPAACSGHKGDDRAHRMDTTKIRALGFPPFL  268

Query  189   TLSQMFDDCIHSFQQKG  139
             +L QMFDDCI SFQ KG
Sbjct  269   SLQQMFDDCIKSFQDKG  285



>ref|XP_001769440.1| predicted protein [Physcomitrella patens]
 gb|EDQ65809.1| predicted protein [Physcomitrella patens]
Length=329

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 164/322 (51%), Positives = 227/322 (70%), Gaps = 4/322 (1%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             SK  E CVTGGTG I S L+++LL +GY VRTT RNP +  K GFLWEL GA ERL+I+ 
Sbjct  4     SKGAEVCVTGGTGYIASCLIQALLQRGYKVRTTARNPDDRAKTGFLWELPGATERLEIVG  63

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              +++EEG+ ++   GV  VFHTA PV+   + + + ++++P++KG LNVL +  K   ++
Sbjct  64    AELLEEGTFDEAVHGVHTVFHTACPVVYDPNGDPEVSMLNPALKGNLNVLRACTKSHSIQ  123

Query  741   RVVLTSSCSCIRYRHD-ATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQN  565
             RVV+TSSCS IRY H+   +  PL+ES W+  +YC+ + +WYA AKT+AE+EA+++A + 
Sbjct  124   RVVMTSSCSAIRYDHNRRPEDPPLSESVWSSPEYCRDHKMWYALAKTLAEKEAFEFAAR-  182

Query  564   DGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILA  385
             +G+ LVV+  SFV+GP LTP PTST+ LIL +++G   EYPNKR+GFVHI+D V AH+LA
Sbjct  183   EGLNLVVICPSFVIGPSLTPIPTSTVFLILDLLRGRAQEYPNKRIGFVHIDDVVTAHVLA  242

Query  384   MEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSN-EEGDDSEHSLDCTKIMEL  208
             ME   A GR ICS+ VAHF  I+ ML+ KYP     T+CS+   GDD  H +D TKI +L
Sbjct  243   MEVPEAHGRYICSSDVAHFGDIMSMLKTKYPKLQTPTRCSDMPPGDDIHHKMDTTKIKKL  302

Query  207   GLPPFATLSQMFDDCIHSFQQK  142
             GL  F ++ QMFDD + S  +K
Sbjct  303   GLTEFKSIEQMFDDMLRSLHEK  324



>ref|XP_006583682.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like isoform 
X2 [Glycine max]
Length=257

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 173/319 (54%), Positives = 211/319 (66%), Gaps = 63/319 (20%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PE+CVTGGTG IGSYLVK+LL+KG++VRTTVRNP ++EKVGFL EL GAKERL+ILK ++
Sbjct  2     PEFCVTGGTGFIGSYLVKALLEKGHTVRTTVRNPEDVEKVGFLTELSGAKERLRILKAEL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVL  730
             + EGS    FD V                          VKG   V  +A  ++V     
Sbjct  62    LVEGS----FDEV--------------------------VKGVDGVFHTASPVLVP----  87

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
                                         Y +   LWYAYAKT+AE+EAW+ A++N G++L
Sbjct  88    ----------------------------YDENVQLWYAYAKTIAEREAWRIAKEN-GMDL  118

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQN  370
             VVVN SFVVGP+L PQPTSTL LIL+IVKG+ GEYPN  VGFVHI D +  H+LAME   
Sbjct  119   VVVNPSFVVGPMLAPQPTSTLLLILSIVKGMKGEYPNTAVGFVHINDVIATHLLAMEDPK  178

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
              SGRLICS+TVAH+SQII MLR KYPSYPY  +CS++EGD++ H++D TKI +LG PPF 
Sbjct  179   TSGRLICSSTVAHWSQIIEMLRAKYPSYPYENRCSSQEGDNNPHNMDITKISQLGFPPFR  238

Query  189   TLSQMFDDCIHSFQQKGFL  133
             TL QMFDDCI SFQ+KGFL
Sbjct  239   TLEQMFDDCIKSFQEKGFL  257



>ref|XP_009115321.1| PREDICTED: tetraketide alpha-pyrone reductase 2 isoform X2 [Brassica 
rapa]
Length=294

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 204/320 (64%), Gaps = 30/320 (9%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGT  I S++VK+LLD GY VRTTVR+    EKV FLWELKGAKERLKI + D+ 
Sbjct  3     EYLVTGGTSFIASHVVKALLDFGYFVRTTVRDSSYEEKVRFLWELKGAKERLKIFEADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM--MVKRVV  733
              +GS +D   GVDGVFH AS + V  D N  + L D  + GT N++ S  K    VKR+V
Sbjct  63    VDGSFDDAVKGVDGVFHIASRISVCLDDNDLEKLADRDIYGTRNLMNSCEKSRNTVKRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSS + +RY +DAT+ SPL  SHW+DL+Y + +++WY YAKT+ E+EAW  A + + + 
Sbjct  123   LTSSSTSVRYSYDATKASPLKGSHWSDLEYFRSFSIWYGYAKTLVEKEAWLIAAEKN-LN  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVV  SF +GP                   ++   P          D   A ILAM+  
Sbjct  182   LVVVIPSFCIGP-------------------ILSPKPTN--------DVAAAQILAMKEP  214

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR+ICS++VAH+S+II ML+PKYP YP+ TKC +EEG D  HSLD  KI ELG   F
Sbjct  215   KASGRIICSSSVAHWSEIIEMLKPKYPLYPFETKCGSEEGRDMPHSLDTRKIHELGFGSF  274

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L++MFDDCI  FQ KG L
Sbjct  275   KSLAEMFDDCIKCFQDKGLL  294



>ref|XP_002992359.1| hypothetical protein SELMODRAFT_135301 [Selaginella moellendorffii]
 gb|EFJ06509.1| hypothetical protein SELMODRAFT_135301 [Selaginella moellendorffii]
Length=329

 Score =   299 bits (766),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 163/320 (51%), Positives = 215/320 (67%), Gaps = 5/320 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTGGTG I S++V+ LL +GY+V TT RNP +  KVGFLW+L GAKERL+I K D++E 
Sbjct  10    CVTGGTGYIASWIVRELLQRGYTVHTTARNPDDPAKVGFLWDLPGAKERLRIFKADLLEP  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVVLTS  724
             GS +    GV GV H A  VL+    + Q  L++ S  G LNVL S  K   + +VVLTS
Sbjct  70    GSFDAALSGVYGVIHVAGVVLIDPKDDPQLKLVETSTNGVLNVLGSCTKFSSIAKVVLTS  129

Query  723   SCSCIRYRH---DATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             SCS IRY H        S L+ES WT+  YC ++ LWY  AKT+AE+ AW +++ + GI 
Sbjct  130   SCSAIRYDHHHQTGKNDSLLDESSWTNPGYCSQHKLWYPLAKTLAERTAWDFSKLH-GIN  188

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVVN SF+VGPLL P PTST+ ++L ++KG I  YPN  VGFVHI+D V AH+LA E+ 
Sbjct  189   LVVVNPSFIVGPLLQPVPTSTILIVLGMLKGHIKLYPNMIVGFVHIQDVVAAHLLAYESP  248

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
             +A+GR ICS  VAH+ +++ MLR KYP YP  ++ S ++G D  H +   K+ +LGL  +
Sbjct  249   DAAGRYICSERVAHWREVLEMLRAKYPQYPLPSEPSQDQGQDIPHEMSAEKLKQLGLESY  308

Query  192   ATLSQMFDDCIHSFQQKGFL  133
               L +MFDDCI S + KGFL
Sbjct  309   QPLEKMFDDCIESLKLKGFL  328



>emb|CDX84988.1| BnaC05g20670D [Brassica napus]
Length=305

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 165/320 (52%), Positives = 215/320 (67%), Gaps = 19/320 (6%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EY VTGGT  I S++VK+LLD GY VRTTVR+  + E V FLWELKGAKERLKI + D+ 
Sbjct  3     EYLVTGGTSFIASHVVKALLDLGYFVRTTVRDSSDEENVRFLWELKGAKERLKIFEADLT  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM--MVKRVV  733
              +GS +D   GVDGVFH AS + V  D N    L D  + G  N++ S  K    V+R+V
Sbjct  63    VDGSFDDAVKGVDGVFHIASTISVCMDDNDLDLLADRDIYGIRNLMNSCEKSRNTVRRIV  122

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             LTSS + +RY +DAT+ SPL ESHW+DL+YC+ + +WY YAK++ E+E+W  A + + + 
Sbjct  123   LTSSSTSVRYSYDATKASPLKESHWSDLEYCRSFRIWYGYAKSLVEKESWLIAAEKN-LN  181

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVVV  SF +GP+L+P+PTS+  + L+I+KG+ GEY N R GFVHI+D   A ILAME  
Sbjct  182   LVVVIPSFCIGPILSPKPTSSPSIFLSIIKGVHGEYQNFRGGFVHIDDVAAAQILAMEEP  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
              ASGR+ICS++         ML+PKYP       C +EE  D  HSLD  KI ELG   F
Sbjct  242   KASGRIICSSS---------MLKPKYP-------CGSEEERDMPHSLDTRKIHELGFGSF  285

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L++MFDDCI  FQ+KG L
Sbjct  286   NSLAEMFDDCIKCFQEKGLL  305



>ref|XP_006412106.1| hypothetical protein EUTSA_v10025703mg [Eutrema salsugineum]
 gb|ESQ53559.1| hypothetical protein EUTSA_v10025703mg [Eutrema salsugineum]
Length=326

 Score =   275 bits (702),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 218/328 (66%), Gaps = 10/328 (3%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             +QAK K    CVTG +G + S+LVK LL  GY V  TVR+PG  +K+  LW+L+GAKERL
Sbjct  2     DQAKGK---VCVTGASGFLASWLVKRLLLDGYEVIGTVRDPGNEKKLAHLWKLEGAKERL  58

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-  754
             +++K D+ME+GS ++   G  GVFHTASPVL P   N ++ ++ P+++GTLNVL S RK 
Sbjct  59    RLVKADLMEDGSFDNAIMGCQGVFHTASPVLKPTS-NPEEEILKPAIEGTLNVLRSCRKN  117

Query  753   MMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               +KRVVLTSS S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK+ 
Sbjct  118   QSLKRVVLTSSSSTVRIRDDFDPKIPLDESVWTSVELCKRFQVWYALSKTLAEQAAWKFC  177

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             E+N GI+LV V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D  R 
Sbjct  178   EEN-GIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVART  236

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E + A GR ICS+ V    +++  L  +YPS P   +   E+ +   ++LD +KI
Sbjct  237   HILVFEHKAARGRYICSSNVVSLDELVSFLSTRYPSLPIPKRF--EKLNRLHYNLDTSKI  294

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LGL  F +L +MFDDCI SF ++G+L
Sbjct  295   RSLGL-KFKSLEEMFDDCIASFVEQGYL  321



>gb|EPS59559.1| hypothetical protein M569_15245 [Genlisea aurea]
Length=211

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 178/210 (85%), Gaps = 2/210 (1%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             EYCVTGG+G I +YL++SLL+KG +VR TVR+P +++KVGFLWEL GA+ERL+ILK D++
Sbjct  3     EYCVTGGSGFIAAYLIRSLLEKGCAVRATVRHPEDVDKVGFLWELNGARERLRILKADLL  62

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-MMVKRVVL  730
             +EGS ++  DGVDGVFHTASPV VP+  +++  LIDP +KGT+NVL S +K   VKRVVL
Sbjct  63    DEGSFDEAVDGVDGVFHTASPVFVPHGDDVKANLIDPCIKGTMNVLKSCKKSTTVKRVVL  122

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSSCS IRYR+D  + +PLNESHW+D +YCK +NLWYAYAKT AE+EAW++AE+N GI+L
Sbjct  123   TSSCSSIRYRYDIDENTPLNESHWSDPEYCKAHNLWYAYAKTTAEREAWRFAEEN-GIDL  181

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKG  460
             VVVN SFVVGPLL P+PTSTL LIL+I+KG
Sbjct  182   VVVNPSFVVGPLLGPKPTSTLLLILSIIKG  211



>gb|KFK30181.1| hypothetical protein AALP_AA7G228100 [Arabis alpina]
Length=326

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/328 (47%), Positives = 215/328 (66%), Gaps = 10/328 (3%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             +QAK K    CVTG +G + S+LVK LL +GY V  TVR+PG  +K+  LW+L+GAKERL
Sbjct  2     DQAKGK---VCVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKLAHLWKLEGAKERL  58

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-  754
             +++K D++EEGS ++   G  GVFHTASPVL P   N ++ ++ P+++GTLNVL S RK 
Sbjct  59    RLVKADLVEEGSFDNAIMGCQGVFHTASPVLKPTS-NPEEEILKPAIEGTLNVLRSCRKN  117

Query  753   MMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               +KRVVLTSS S +R R D     PL+ES WT  + CKR+ +WY  +KT+AEQ AWK+ 
Sbjct  118   QSLKRVVLTSSSSTVRIRDDFDPKIPLDESVWTSAELCKRFQIWYPLSKTLAEQAAWKFC  177

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             E+N GI+LV V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D  R 
Sbjct  178   EEN-GIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVART  236

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E + A GR ICS+ V    +++  L  +YPS P   +  N   +   + LD +KI
Sbjct  237   HILVFEHEAAQGRYICSSNVISLEELVSFLSTRYPSLPIPKRFENL--NRLHYDLDTSKI  294

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LGL  F +L +MFDDCI SF ++G+L
Sbjct  295   KSLGL-KFKSLEEMFDDCIASFVEQGYL  321



>ref|NP_195268.2| dihydroflavonol 4-reductase-like1 [Arabidopsis thaliana]
 sp|Q500U8.1|TKPR1_ARATH RecName: Full=Tetraketide alpha-pyrone reductase 1; AltName: 
Full=Protein DIHYDROFLAVONOL 4-REDUCTASE-LIKE 1 [Arabidopsis 
thaliana]
 gb|AAY34180.1| At4g35420 [Arabidopsis thaliana]
 gb|ABF74722.1| At4g35420 [Arabidopsis thaliana]
 gb|AEE86509.1| dihydroflavonol 4-reductase-like1 [Arabidopsis thaliana]
Length=326

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 217/328 (66%), Gaps = 10/328 (3%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             +QAK K    CVTG +G + S+LVK LL +GY V  TVR+PG  +K+  LW+L+GAKERL
Sbjct  2     DQAKGK---VCVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKLAHLWKLEGAKERL  58

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM  751
             +++K D+MEEGS ++   G  GVFHTASPVL P   N ++ ++ P+++GTLNVL S RK 
Sbjct  59    RLVKADLMEEGSFDNAIMGCQGVFHTASPVLKPTS-NPEEEILRPAIEGTLNVLRSCRKN  117

Query  750   -MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               +KRVVLTSS S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK++
Sbjct  118   PSLKRVVLTSSSSTVRIRDDFDPKIPLDESIWTSVELCKRFQVWYALSKTLAEQAAWKFS  177

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             E+N GI+LV V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D  R 
Sbjct  178   EEN-GIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVART  236

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HI+  E + A GR ICS+ V    +++  L  +YPS P   +   E+ +   +  D +KI
Sbjct  237   HIVVFEHEAAQGRYICSSNVISLEELVSFLSARYPSLPIPKRF--EKLNRLHYDFDTSKI  294

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LGL  F +L +MFDDCI S  ++G+L
Sbjct  295   QSLGL-KFKSLEEMFDDCIASLVEQGYL  321



>ref|XP_002867074.1| dihydroflavonol 4-reductase family [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43333.1| dihydroflavonol 4-reductase family [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 216/328 (66%), Gaps = 10/328 (3%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             +QAK+K    CVTG +G + S+LVK LL +GY V  TVR+PG  +K   LW+L+GAKERL
Sbjct  2     DQAKAK---VCVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKFAHLWKLEGAKERL  58

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARK  754
             +++K D+MEEGS ++   G  GVFHTASPVL P   N ++ ++ P+++GTLNVL S  + 
Sbjct  59    RLVKADLMEEGSFDNAIMGCQGVFHTASPVLKP-TSNPEEEILRPAIEGTLNVLRSCGKN  117

Query  753   MMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               +KRVVLTSS S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK+ 
Sbjct  118   PSLKRVVLTSSSSTVRIRDDFDPKIPLDESIWTSVELCKRFQVWYALSKTLAEQAAWKFC  177

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             E+N GI+LV V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D  R 
Sbjct  178   EEN-GIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVART  236

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E + A GR ICS+ V    +++  L  +YPS P   +   E+ +   ++ D +KI
Sbjct  237   HILVFEHEAAQGRYICSSNVISLEELVSFLSARYPSLPIPKRF--EKLNRLHYAFDTSKI  294

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LGL  F +L +MFDDCI S  ++G+L
Sbjct  295   QSLGL-KFKSLEEMFDDCIASLVEQGYL  321



>ref|XP_009109293.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Brassica 
rapa]
Length=326

 Score =   268 bits (685),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 215/328 (66%), Gaps = 10/328 (3%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             +Q K K    CVTG +G + S+LVK LL +GY V  TVR+PG  +K+  LW+L+GAKERL
Sbjct  2     DQTKGK---VCVTGASGFLASWLVKRLLLEGYEVTGTVRDPGNEKKLAHLWKLEGAKERL  58

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-  754
             +++K D+ME+GS ++   G  GVFHTASPVL P   N ++ ++ P+++GTLNVL S RK 
Sbjct  59    RLVKADLMEDGSFDNAIMGCHGVFHTASPVLKPTS-NPEEEILKPAIEGTLNVLRSCRKN  117

Query  753   MMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               +KRVVLTSS S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK+ 
Sbjct  118   QSLKRVVLTSSSSTVRIRDDFDPNIPLDESVWTSVELCKRFQVWYALSKTLAEQAAWKFC  177

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             E+N  I+LV V  SF+VGP L P   ST   +L ++KG   ++  + ++G++HI+D  R 
Sbjct  178   EEN-SIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYIHIDDVART  236

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E + A GR ICS+ V    +++  L  +YPS P   +   ++ +   + LD +KI
Sbjct  237   HILVFEQEAAKGRYICSSKVVSLEELVSFLSTRYPSLPIPKRF--KKLNRLHYDLDTSKI  294

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LGL  F  L +MFDDCI SF ++G+L
Sbjct  295   KSLGL-EFKPLEEMFDDCIASFVEQGYL  321



>ref|XP_010446925.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Camelina 
sativa]
Length=326

 Score =   268 bits (685),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 214/328 (65%), Gaps = 10/328 (3%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             +QAK      CVTG +G + S+LVK LL  GY V  TVR+PG  +K+  LW+L+GAKERL
Sbjct  2     DQAKGN---VCVTGASGFLASWLVKRLLLDGYEVIGTVRDPGNEKKLAHLWKLEGAKERL  58

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-  754
             +++K D+ME+GS ++   G  GVFHTASPVL P   N +  ++ P+++GTLNVL S RK 
Sbjct  59    RLVKADLMEDGSFDNAIMGCQGVFHTASPVLKP-TSNPEDEILRPAIEGTLNVLRSCRKN  117

Query  753   MMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               +KRVVLTSS S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK+ 
Sbjct  118   QSLKRVVLTSSSSTVRIRDDFDPKIPLDESVWTSVELCKRFQVWYALSKTLAEQAAWKFC  177

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             E+N GI+LV V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D  R 
Sbjct  178   EEN-GIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVART  236

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E + A GR ICS+ V    +++  L  +YPS P   +   E+ +   ++ + +KI
Sbjct  237   HILVFEHEAAQGRYICSSNVISLEELVSFLSTRYPSLPIPKRF--EKLNRLSYNFNTSKI  294

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LG   F +L +MFDDCI SF ++G+L
Sbjct  295   QSLGF-KFKSLEEMFDDCIASFVEQGYL  321



>ref|XP_010432286.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Camelina 
sativa]
Length=326

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 215/328 (66%), Gaps = 10/328 (3%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             +QAK K    CVTG +G + S+LVK LL  GY V  TVR+PG  +K+  LW+L+GAKERL
Sbjct  2     DQAKGK---VCVTGASGFLASWLVKRLLLDGYEVIGTVRDPGNEKKLAHLWKLEGAKERL  58

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-  754
             +++K D++E+GS ++   G  GVFHTASPVL P   N +  ++ P+++GTLNVL S RK 
Sbjct  59    RLVKADLVEDGSFDNAIMGCQGVFHTASPVLKPTS-NPEDEILRPAIEGTLNVLRSCRKN  117

Query  753   MMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               +KRVVLTSS S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK+ 
Sbjct  118   QSLKRVVLTSSSSTVRIRDDFDPNIPLDESVWTSVELCKRFQVWYALSKTLAEQAAWKFC  177

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             E+N GI+LV V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D  R 
Sbjct  178   EEN-GIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVART  236

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E + A GR ICS+ V    +++  L  +YPS P   +   E+ +   ++ + +KI
Sbjct  237   HILVFEHEAAQGRYICSSDVISLEELVSFLSTRYPSLPIPKRF--EKLNRLHYNFNTSKI  294

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LG   F +L +MFDDCI SF ++G+L
Sbjct  295   QSLGF-KFKSLEEMFDDCIASFVEQGYL  321



>ref|XP_006378487.1| hypothetical protein POPTR_0010s13520g [Populus trichocarpa]
 gb|ERP56284.1| hypothetical protein POPTR_0010s13520g [Populus trichocarpa]
Length=211

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVKSLL+KG++VR TVR+PG + KVGFL E  GAKERLKI K ++
Sbjct  2     PEYCVTGGTGFIAAYLVKSLLEKGHTVRITVRDPGNVRKVGFLQEFNGAKERLKIFKAEL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             +EEGS ++   GVDGVFH A+PVLVPY   IQ+TLIDP +KGTLNVL S  K   VKRVV
Sbjct  62    LEEGSFDEAIQGVDGVFHVAAPVLVPYSDRIQETLIDPCIKGTLNVLNSCLKASSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
              TSS S +RYR D  QI  LNESHW+D +YCKR+NLWYAYAKT+AE+EAW+ +++N GI+
Sbjct  122   FTSSSSTVRYRDDTPQIFSLNESHWSDTEYCKRHNLWYAYAKTVAEKEAWRVSKEN-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKG  460
             LV    SFVVGPLL P+P STL LI ++VKG
Sbjct  181   LVSFIPSFVVGPLLAPEPNSTLLLIQSVVKG  211



>ref|XP_010437474.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Camelina sativa]
Length=326

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/328 (45%), Positives = 215/328 (66%), Gaps = 10/328 (3%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             +QAK K    CVTG +G + S+LVK LL  GY V  TVR+PG  +K+  LW+L+GAKERL
Sbjct  2     DQAKGK---VCVTGASGFLASWLVKRLLLDGYEVIGTVRDPGNEKKLAHLWKLEGAKERL  58

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-  754
             +++K D+ME+GS ++   G  GVFHTASPV+ P   N +  ++ P+++ TLNVL S RK 
Sbjct  59    RLVKADLMEDGSFDNAIMGCQGVFHTASPVIKPTS-NPEDEILRPAIERTLNVLRSCRKN  117

Query  753   MMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               +KRVVLTSS S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK++
Sbjct  118   QSLKRVVLTSSSSTVRIRDDFDPKIPLDESVWTSVELCKRFQVWYALSKTLAEQAAWKFS  177

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             E+N GI+LV V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D  + 
Sbjct  178   EEN-GIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVAQT  236

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E + A GR ICS+ V    +++  L  +YPS P   +   E+ +   ++ + +KI
Sbjct  237   HILVFEHEAAQGRYICSSNVISLEELVSFLSTRYPSLPIPKRF--EKLNRLHYNFNTSKI  294

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LG   F +L +MFDDCI SF ++G+L
Sbjct  295   QSLGF-KFKSLEEMFDDCIASFVEQGYL  321



>ref|XP_010548188.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoform X2 [Tarenaya 
hassleriana]
Length=329

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 214/330 (65%), Gaps = 10/330 (3%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             MD++AK +    CVTG +G + S+LVK LL +GY V  TVR+PG  +K+  LW+L+GAKE
Sbjct  1     MDQEAKDR---VCVTGASGYLASWLVKRLLLEGYHVTGTVRDPGNEKKLAHLWKLEGAKE  57

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL+++K D+ME+GS +D      GVFHTASPVL P+  + Q+ ++ P+++GTLNVL S R
Sbjct  58    RLRLVKADLMEDGSFDDAIMECHGVFHTASPVLKPFS-DPQEEILKPAIEGTLNVLRSCR  116

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWK  580
             K   ++RVV+TSS S +R R D     PL+ES WT ++ C+   +WYA +KT+AEQ AWK
Sbjct  117   KNPSIRRVVITSSSSTVRIRDDFDPKVPLDESSWTSVELCQSLQIWYALSKTLAEQAAWK  176

Query  579   WAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAV  403
             +   N GI+LV V  +F++GP L P   ST   +L ++KG   ++  + R+G+VHI+D  
Sbjct  177   FCHDN-GIDLVTVLPAFLIGPSLPPDLCSTASDVLGLLKGETEKFQWHGRMGYVHIDDVA  235

Query  402   RAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCT  223
             R+HIL  E + A GR ICS+T+    ++I  L  +Y S P   +   E+ +   +  D +
Sbjct  236   RSHILVYEHKAAHGRYICSSTIVDLEELISFLSTRYASLPIPKRF--EKLNRLHYDFDTS  293

Query  222   KIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             KI  LG   F  L +MFDDC+ SF ++G+L
Sbjct  294   KIKSLGF-EFKPLEEMFDDCVASFFEQGYL  322



>emb|CDY24810.1| BnaA08g15000D [Brassica napus]
Length=317

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/328 (45%), Positives = 210/328 (64%), Gaps = 19/328 (6%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             +Q K K    CVTG +G + S+LVK LL +GY V  TVR+PG  +K+  LW+L+GAKERL
Sbjct  2     DQTKGK---VCVTGASGFLASWLVKRLLLEGYEVTGTVRDPGNEKKLAHLWKLEGAKERL  58

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-  754
             +++K D+ME+GS ++   G  GVFHTASP            ++ P+++GTLNVL S RK 
Sbjct  59    RLVKADLMEDGSFDNAIMGCHGVFHTASP----------DEILKPAIEGTLNVLRSCRKN  108

Query  753   MMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               +KRVVLTSS S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK+ 
Sbjct  109   QSLKRVVLTSSSSTVRIRDDFDPNIPLDESVWTSVELCKRFQVWYALSKTLAEQAAWKFC  168

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             E+N GI+LV V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D  R 
Sbjct  169   EEN-GIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVART  227

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E + A GR ICS+ V    +++  L  +YPS P   +   ++ +   + LD +KI
Sbjct  228   HILVFEQEAAKGRYICSSKVVSLEELVSFLSTRYPSLPIPKRF--KKLNRLHYDLDTSKI  285

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LGL  F  L +MFDDCI SF ++G+L
Sbjct  286   KSLGL-EFKPLEEMFDDCIASFVEQGYL  312



>ref|XP_009102146.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Brassica rapa]
Length=328

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 207/318 (65%), Gaps = 7/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL +GY V  TVR+PG  +K+  L +L+GAKERL+++K D+ME+
Sbjct  9     CVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKLAHLRKLEGAKERLRLVKADLMED  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-MMVKRVVLTS  724
             GS +    G  GVFHTASPVL P   N ++ ++ P+++GTLNVL S  K   +KRVVLTS
Sbjct  69    GSFDKAIMGCQGVFHTASPVLKPTS-NPEEEILKPAIEGTLNVLRSCMKNQSLKRVVLTS  127

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK+ E+N GI+LV 
Sbjct  128   SSSTVRIRDDFDPNIPLDESVWTSVELCKRFQVWYALSKTLAEQAAWKFCEEN-GIDLVT  186

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNA  367
             V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D    HIL  E + A
Sbjct  187   VLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVASTHILVFEHEAA  246

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR ICS+      +++  L  +YPS P   +   E+ +   +  D +KI  LGL  F +
Sbjct  247   QGRYICSSNFVSLEELVSFLSTRYPSLPIPKRF--EKLNRLHYDFDTSKIKSLGL-KFKS  303

Query  186   LSQMFDDCIHSFQQKGFL  133
             L +MFDDCI SF +KG+L
Sbjct  304   LEEMFDDCIASFVEKGYL  321



>ref|XP_008799152.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Phoenix dactylifera]
Length=329

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 204/321 (64%), Gaps = 5/321 (2%)
 Frame = -2

Query  1092  RPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGD  913
             R + CVTG +G I S+LVK LLD GY VR TVR+PG+ +K   LWEL+GAKERL+++K D
Sbjct  8     RGKVCVTGASGFIASWLVKRLLDSGYHVRGTVRDPGDYKKTSHLWELEGAKERLQLVKAD  67

Query  912   VMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-MMVKRV  736
             +MEEGS ++   G  GVFH ASPVL  +  + +  ++DP++ GTLNVL S +K   +KRV
Sbjct  68    LMEEGSFDEAVMGCKGVFHIASPVLKGHS-DPKVGILDPAINGTLNVLRSCKKNQALKRV  126

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             VLTSS S  R + D     PL+E+ W+ L+ CKR  LWY+ AK +AE+ AW++A++N+ I
Sbjct  127   VLTSSSSTARIKEDIDPKIPLDETSWSSLELCKRLQLWYSLAKILAEKAAWEFAKENN-I  185

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAME  379
             +LV V  +FV+GP L      T   +L +++G    +  + R+G+VHI+D  R HIL  E
Sbjct  186   DLVTVLPAFVIGPSLPRNLCLTASDVLGLLRGDNERFSLHGRMGYVHIDDVARCHILVYE  245

Query  378   AQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLP  199
                A GR +CS+TV    ++  +L  +YPS P      N  G+   +  D +KI +LG  
Sbjct  246   DAKAHGRYLCSSTVLDNHELAGILAKRYPSLPIPKSFKNYYGETPYYVFDTSKIQDLGF-  304

Query  198   PFATLSQMFDDCIHSFQQKGF  136
              F  + +MFDDCI S ++ G+
Sbjct  305   MFKGIEEMFDDCIRSLKEHGY  325



>emb|CDY41656.1| BnaC03g62280D [Brassica napus]
Length=317

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 208/328 (63%), Gaps = 19/328 (6%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             +Q K K    CVTG +G + S+LVK LL +GY V  TVR+PG  +K   LW+L+GAKERL
Sbjct  2     DQTKGK---VCVTGASGFLASWLVKRLLIEGYEVTGTVRDPGNEKKAAHLWKLEGAKERL  58

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-  754
             ++++ D+ME+GS ++   G  GVFHTASP          + ++ P+++GTLNVL S RK 
Sbjct  59    RLVEADLMEDGSFDNAIMGCHGVFHTASP----------EEILKPAIEGTLNVLRSCRKN  108

Query  753   MMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               +KRVVLTSS S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK+ 
Sbjct  109   QSLKRVVLTSSSSTVRIRDDFDPNIPLDESVWTSVELCKRFQVWYALSKTLAEQAAWKFC  168

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             E+N G++LV V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D  R 
Sbjct  169   EEN-GLDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVART  227

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E + A GR ICS+ V    +++  L   YPS P   +   E+ +   +  D +KI
Sbjct  228   HILVFEQEAAQGRYICSSKVVSLEELVSFLSTSYPSLPVPKRF--EKLNRLHYEFDTSKI  285

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LGL  F TL +MFDDCI SF ++G L
Sbjct  286   ESLGL-KFKTLEEMFDDCIASFVEQGHL  312



>emb|CDX75502.1| BnaA01g02000D [Brassica napus]
Length=319

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 145/318 (46%), Positives = 203/318 (64%), Gaps = 16/318 (5%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL +GY V  TVR+PG  +K+  LW L+GAKERL+++K D+ME+
Sbjct  9     CVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKLAHLWNLEGAKERLRLVKADLMED  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-MMVKRVVLTS  724
             GS +    G  GVFHTASP          + ++ P+++GTLNVL S  K   +KRVVLTS
Sbjct  69    GSFDKAIMGCQGVFHTASP----------EEILKPAIEGTLNVLRSCMKNQSLKRVVLTS  118

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK+ E+N GI+LV 
Sbjct  119   SSSTVRIRDDFDPNIPLDESVWTSVELCKRFQVWYALSKTLAEQAAWKFCEEN-GIDLVT  177

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNA  367
             V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D    HIL  E + A
Sbjct  178   VLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVASTHILVFEHEAA  237

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR ICS+ V    +++  L  +YPS P   +   E+ +   +  D +KI  LGL  F +
Sbjct  238   QGRYICSSNVVSLEELVSFLSTRYPSLPIPKRF--EKLNRLHYDFDTSKIKSLGL-KFKS  294

Query  186   LSQMFDDCIHSFQQKGFL  133
             L +MFDDCI SF +KG+L
Sbjct  295   LEEMFDDCIASFVEKGYL  312



>ref|XP_010548187.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoform X1 [Tarenaya 
hassleriana]
Length=360

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/359 (42%), Positives = 217/359 (60%), Gaps = 37/359 (10%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             MD++AK +    CVTG +G + S+LVK LL +GY V  TVR+PG  +K+  LW+L+GAKE
Sbjct  1     MDQEAKDR---VCVTGASGYLASWLVKRLLLEGYHVTGTVRDPGNEKKLAHLWKLEGAKE  57

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL+++K D+ME+GS +D      GVFHTASPVL P+  + Q+ ++ P+++GTLNVL S R
Sbjct  58    RLRLVKADLMEDGSFDDAIMECHGVFHTASPVLKPFS-DPQEEILKPAIEGTLNVLRSCR  116

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWK  580
             K   ++RVV+TSS S +R R D     PL+ES WT ++ C+   +WYA +KT+AEQ AWK
Sbjct  117   KNPSIRRVVITSSSSTVRIRDDFDPKVPLDESSWTSVELCQSLQIWYALSKTLAEQAAWK  176

Query  579   WAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAV  403
             +   N GI+LV V  +F++GP L P   ST   +L ++KG   ++  + R+G+VHI+D  
Sbjct  177   FCHDN-GIDLVTVLPAFLIGPSLPPDLCSTASDVLGLLKGETEKFQWHGRMGYVHIDDVA  235

Query  402   RAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGD---DSEH--  238
             R+HIL  E + A GR ICS+T+    ++I  L  +Y S P   + +  E D   +SEH  
Sbjct  236   RSHILVYEHKAAHGRYICSSTIVDLEELISFLSTRYASLPIPKRLALTERDLNPNSEHYP  295

Query  237   ------------------------SLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
                                       D +KI  LG   F  L +MFDDC+ SF ++G+L
Sbjct  296   ETICRHKSHLCYFFRFEKLNRLHYDFDTSKIKSLGF-EFKPLEEMFDDCVASFFEQGYL  353



>ref|XP_010932167.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Elaeis guineensis]
Length=424

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 145/352 (41%), Positives = 214/352 (61%), Gaps = 12/352 (3%)
 Frame = -2

Query  1182  IYKLVYISRGLN*STHIQIDRYMDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRT  1003
             IY  ++ +R      H  I  Y+ +     + + CVTG +G I S+LVK LLD GY VR 
Sbjct  78    IYTKLWCNRA---QVHFHI--YIMDMIPGTKGKVCVTGASGFIASWLVKRLLDSGYHVRG  132

Query  1002  TVRNPGELEKVGFLWELKGAKERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDH  823
             TVR+PG+ +K   LWEL+GA+ERL+++K D+MEEGS ++   G  GVFH ASPVL   DH
Sbjct  133   TVRDPGDYKKTSHLWELEGARERLQLVKADLMEEGSFDEAIMGCKGVFHIASPVL--RDH  190

Query  822   NIQKT-LIDPSVKGTLNVLTSARK-MMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDL  649
                K  ++DP++ GTLNVL S +K   +KRVVLTSS S +R + D     PL+E+ W+ L
Sbjct  191   TDPKVGILDPAINGTLNVLRSCKKSQALKRVVLTSSSSTVRIKEDINPKVPLDETSWSSL  250

Query  648   DYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAI  469
             + C+R  LWYA AK +AE+ AW++A +N+ I+LV V  +FV+GP L      T   +L +
Sbjct  251   ELCERLQLWYALAKILAEKAAWEFARENN-IDLVTVLPAFVIGPSLPHDLCLTASDVLGL  309

Query  468   VKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYP  292
             ++G    +  + R+G+VHI+D  R HIL  E   A GR +CS+ V    ++  ++  +YP
Sbjct  310   LRGDNERFSLHGRMGYVHIDDVARCHILVYEDAKAHGRYLCSSPVLDNHELAGIIAKRYP  369

Query  291   SYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGF  136
             S P   +  N  G    +  + +K+ +LG   F  + +MFDDCI S ++ G+
Sbjct  370   SLPIPKRFKNYYGKTPYYEFNTSKLQDLGF-MFRGIEEMFDDCIRSLKEHGY  420



>ref|XP_004236874.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Solanum lycopersicum]
Length=338

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 217/330 (66%), Gaps = 6/330 (2%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             ++E+  + + + CVTG +G + S+L+K LL  GY+V  TVR+PG  +KVG LW+L+GAKE
Sbjct  10    VEEENSNYKGKVCVTGASGFVASWLIKRLLLSGYNVIGTVRDPGNQKKVGHLWKLQGAKE  69

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL+++K ++ +EGS +D   G +GVFHTASPVL     ++   +++P+V GTLNVL S +
Sbjct  70    RLRLVKANLTDEGSFDDAIMGCEGVFHTASPVLGKATFDVTVEILNPAVDGTLNVLRSCK  129

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWK  580
             K   ++RVVLTSS S +R R +     PL+ES W+ +++CK++ +WY  +KT+AE+ AW+
Sbjct  130   KNPRLRRVVLTSSSSTVRVRDEIDPNIPLDESSWSSVEFCKKFKIWYVLSKTLAEKAAWE  189

Query  579   WAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAV  403
             + EQN+ I+LV +  SF++GP L P   ST   +L ++KG   ++  + R+G+VHI+D  
Sbjct  190   FCEQNN-IDLVTLLPSFIIGPSLPPDLCSTADDVLGLLKGKTDKFDFHGRMGYVHIDDVA  248

Query  402   RAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCT  223
              +HIL  E  +A GR +CS+ V   +Q++ +L  +YPS P   +   +E D   +  +  
Sbjct  249   LSHILVYEHPSAHGRYLCSSKVLDNNQLVSVLSERYPSLPIPKRF--KELDRPSYDFNTL  306

Query  222   KIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             K+  LG+  F ++ +MFDDC+  F ++G +
Sbjct  307   KLEGLGM-KFKSIEEMFDDCVTFFNERGLI  335



>ref|XP_010531309.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Tarenaya 
hassleriana]
Length=322

 Score =   253 bits (646),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 144/328 (44%), Positives = 210/328 (64%), Gaps = 11/328 (3%)
 Frame = -2

Query  1107  QAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLK  928
             QAK K    CVTG +G + S LVK LL +GY V  TVR+P   +K   LWE++GAKERL 
Sbjct  3     QAKGK---VCVTGASGYLASCLVKQLLLEGYHVVGTVRDPRNEKKHAHLWEMEGAKERLH  59

Query  927   ILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-  751
             ++K ++MEEG  ++   G +GVFHTASPVL  +  + Q  L+ P+++GTLNVL S +K  
Sbjct  60    LVKVELMEEGGFDEAIMGCEGVFHTASPVL-SHSSDPQAELLKPAIEGTLNVLRSCKKNP  118

Query  750   MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAE  571
              ++RVVLTSS S  R R D    +PL+ES WTD++ C+R  +WYA +KT++EQ AWK++ 
Sbjct  119   SLRRVVLTSSSSTARIRDDFDPNTPLDESSWTDVELCQRLQMWYALSKTLSEQAAWKFSR  178

Query  570   QNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIG--EYPNKRVGFVHIEDAVRA  397
             +N  I++V V  +FV+GP L    + T   +L ++KG     E+P +R+G+VHI+D  RA
Sbjct  179   ENR-IDIVTVLPAFVIGPSLPSHLSCTASDVLGLLKGETNKLEWP-ERMGYVHIDDVARA  236

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E + A GR +CS+ V    Q++ +   +YPS P  T    E+  +  +  + +KI
Sbjct  237   HILVYEHKAARGRYLCSSAVVGLDQLVSLFSARYPSLPIATT-RIEDTKELHYDYNTSKI  295

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LGL  F +L +MFDDC+ S  ++G+L
Sbjct  296   TSLGL-KFKSLEEMFDDCVTSLFEQGYL  322



>ref|XP_006360850.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Solanum 
tuberosum]
Length=338

 Score =   253 bits (647),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 134/328 (41%), Positives = 216/328 (66%), Gaps = 6/328 (2%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             E+  + + + CVTG +G + S+L+K LL  GY+V  TVR+PG  +KVG LW+L+GAKERL
Sbjct  12    EENSNYKGKVCVTGASGFVASWLIKRLLLSGYNVIGTVRDPGNQKKVGHLWKLQGAKERL  71

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM  751
             +++K ++ +EGS +D   G +GVFHTASPVL     ++   +++P+V GTLNVL S +K 
Sbjct  72    RLVKANLTDEGSFDDAIMGCEGVFHTASPVLGKATFDVTVEILNPAVDGTLNVLRSCKKN  131

Query  750   -MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               ++RVVLTSS S +R R +     PL+ES W+ +++CK++ +WY  +KT+AE+ AW++ 
Sbjct  132   PRLRRVVLTSSSSTVRVRDNIDPNIPLDESSWSSVEFCKKFEIWYVLSKTLAEKAAWEFC  191

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             EQN+ I+LV +  SF++GP L P   ST   +L ++KG   ++  + R+G+VHI+D   +
Sbjct  192   EQNN-IDLVTLLPSFIIGPSLPPDLCSTADDVLGLLKGKTDKFDFHGRMGYVHIDDVALS  250

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E  +A GR +CS+ V   +Q++ +L  +YPS P   +   +E D   +  +  K+
Sbjct  251   HILVYEHPSAHGRYLCSSKVLDNNQLVSVLSERYPSLPIPKRF--KELDRPSYDFNTLKL  308

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LG+  F ++ +MFDDC+  F+++G +
Sbjct  309   EGLGM-KFKSIEEMFDDCVTFFKERGLI  335



>ref|XP_010270635.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoform X1 [Nelumbo 
nucifera]
Length=360

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/338 (41%), Positives = 212/338 (63%), Gaps = 5/338 (1%)
 Frame = -2

Query  1140  THIQIDRYMDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFL  961
               I+   Y  EQ    + + CVTG +G + S+LVK LL  GY V+ TVR+PG  +KV  L
Sbjct  26    VRIETVDYQMEQTLDCKGKVCVTGASGFLASWLVKRLLLSGYHVKGTVRDPGNDKKVAHL  85

Query  960   WELKGAKERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGT  781
             W+LKGAKE+L+++K D+MEEGS +D   G DGVFHTASPV+ P   + +  ++DP++KGT
Sbjct  86    WQLKGAKEKLQLVKADLMEEGSFDDAIMGCDGVFHTASPVIGPIS-DPKAEILDPAIKGT  144

Query  780   LNVLTSARKM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKT  604
             LNVL S +K   ++RVVLTSS + +R R+D     PL+ES W+  + C+R  +WY  +K 
Sbjct  145   LNVLRSCKKNPFLRRVVLTSSSAAVRVRYDFDPKIPLDESSWSSEELCERLQVWYPLSKI  204

Query  603   MAEQEAWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVG  427
             +AE+ AW++A++N+ + L+ V  SFV+GP L     ST   IL ++KG   ++  + R+G
Sbjct  205   LAEKAAWEFAKENN-VNLITVLPSFVIGPSLPFDLCSTASDILHLLKGDSAKFSYHGRMG  263

Query  426   FVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDD  247
             +VHI+D    HIL  E  +A GR +CS+ V    ++  +L  +YP  P   +  +  GD 
Sbjct  264   YVHIDDVALCHILVYENISAQGRYLCSSKVLDNIELASLLAKRYPLLPIPKRFDSVFGDR  323

Query  246   SEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
               +  + +K+  LG   F ++ +MFDDC+ S +++G L
Sbjct  324   PYYEFNTSKLESLGF-KFKSIEEMFDDCVASLREQGHL  360



>emb|CDX69139.1| BnaC01g03140D [Brassica napus]
Length=319

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/328 (45%), Positives = 208/328 (63%), Gaps = 19/328 (6%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             +Q K K    CVTG +G + S+LVK LL +GY V  TVR+PG  +K+  L +L+GAKERL
Sbjct  2     DQPKGK---VCVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKLAHLRKLEGAKERL  58

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARK  754
             +++K D+ME+GS ++   G  GVFHTASP          + ++ P+++GTLNVL S  + 
Sbjct  59    RLVKADLMEDGSFDNAIMGCQGVFHTASP----------EEILKPAIEGTLNVLRSCGKN  108

Query  753   MMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               +KRVVLTSS S +R R D     PL+ES WT ++ CKR+ +WYA +KT+AEQ AWK+ 
Sbjct  109   ESLKRVVLTSSSSTVRIRDDFDPNIPLDESVWTSVELCKRFQVWYALSKTLAEQAAWKFC  168

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             E+N  I+LV V  SF+VGP L P   ST   +L ++KG   ++  + ++G+VHI+D  R 
Sbjct  169   EEN-SIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVART  227

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E + A GR ICS+ V    +++  L  +YPS P   +   E+ +   +  D +KI
Sbjct  228   HILVFEHEAAGGRYICSSNVVSLEELVSFLSTRYPSVPIPKRF--EKLNRLHYDFDTSKI  285

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LGL  F +L +MFDDCI SF +KG+L
Sbjct  286   KSLGL-KFKSLEEMFDDCIASFVEKGYL  312



>ref|XP_010270636.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoform X2 [Nelumbo 
nucifera]
Length=326

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/328 (42%), Positives = 209/328 (64%), Gaps = 5/328 (2%)
 Frame = -2

Query  1110  EQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERL  931
             EQ    + + CVTG +G + S+LVK LL  GY V+ TVR+PG  +KV  LW+LKGAKE+L
Sbjct  2     EQTLDCKGKVCVTGASGFLASWLVKRLLLSGYHVKGTVRDPGNDKKVAHLWQLKGAKEKL  61

Query  930   KILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM  751
             +++K D+MEEGS +D   G DGVFHTASPV+ P   + +  ++DP++KGTLNVL S +K 
Sbjct  62    QLVKADLMEEGSFDDAIMGCDGVFHTASPVIGPIS-DPKAEILDPAIKGTLNVLRSCKKN  120

Query  750   -MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWA  574
               ++RVVLTSS + +R R+D     PL+ES W+  + C+R  +WY  +K +AE+ AW++A
Sbjct  121   PFLRRVVLTSSSAAVRVRYDFDPKIPLDESSWSSEELCERLQVWYPLSKILAEKAAWEFA  180

Query  573   EQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRA  397
             ++N+ + L+ V  SFV+GP L     ST   IL ++KG   ++  + R+G+VHI+D    
Sbjct  181   KENN-VNLITVLPSFVIGPSLPFDLCSTASDILHLLKGDSAKFSYHGRMGYVHIDDVALC  239

Query  396   HILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI  217
             HIL  E  +A GR +CS+ V    ++  +L  +YP  P   +  +  GD   +  + +K+
Sbjct  240   HILVYENISAQGRYLCSSKVLDNIELASLLAKRYPLLPIPKRFDSVFGDRPYYEFNTSKL  299

Query  216   MELGLPPFATLSQMFDDCIHSFQQKGFL  133
               LG   F ++ +MFDDC+ S +++G L
Sbjct  300   ESLGF-KFKSIEEMFDDCVASLREQGHL  326



>ref|XP_006660279.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Oryza brachyantha]
Length=333

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 209/329 (64%), Gaps = 9/329 (3%)
 Frame = -2

Query  1104  AKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKI  925
             A + +   CVTG +G + S+LVK LL+ GY V  TVR+PG  +KVG LW L GAKERL++
Sbjct  2     ANTTKGRVCVTGASGFVASWLVKRLLESGYHVLGTVRDPGNHKKVGHLWNLAGAKERLEL  61

Query  924   LKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-M  748
             ++ D++EEGS +D     +GVFHTASPV+   D N + T++D ++ GTLNVL S +K   
Sbjct  62    VRADLLEEGSFDDAVMACEGVFHTASPVITETDSN-KATILDSAINGTLNVLRSCKKNPS  120

Query  747   VKRVVLTSSCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKW  577
             +KRVVLTSS S +R + D   + P   L+E+ W+ +++C+   +WYA AKT+AE+ AW++
Sbjct  121   LKRVVLTSSSSTVRLK-DEADLPPNASLDETSWSSMEFCESLQIWYAIAKTLAEKAAWEF  179

Query  576   AEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVR  400
             A++N GI+LV V  +FVVGP L+ + + T   +L + +G   ++    R+G+VHI+D   
Sbjct  180   AKEN-GIDLVAVLPTFVVGPNLSHELSPTSTDVLGLFQGETTKFTVYGRMGYVHIDDVAI  238

Query  399   AHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTK  220
              HILA E   A+GR IC++ V   ++++ +L  ++PSYP         G+ + +     K
Sbjct  239   CHILAYETARAAGRYICNSAVLDVNELLALLARRFPSYPIPKSLPCVYGEQT-YDFSTAK  297

Query  219   IMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             + ELG+  F  + +MFDD + S +  G L
Sbjct  298   VRELGMMKFRDVEEMFDDAVESLRAHGHL  326



>ref|XP_002462592.1| hypothetical protein SORBIDRAFT_02g028700 [Sorghum bicolor]
 gb|EER99113.1| hypothetical protein SORBIDRAFT_02g028700 [Sorghum bicolor]
Length=329

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 134/324 (41%), Positives = 205/324 (63%), Gaps = 5/324 (2%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G I S+L+K LL+ GY V  TVR+PG  +K   LW+L GAKERL+I++
Sbjct  4     SNKGKVCVTGASGFIASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKERLQIVR  63

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              D++EEGS ++     DGVFHTASPVL   D + ++  + P+V GTLNVL S +K   +K
Sbjct  64    ADLLEEGSFDNAVMDCDGVFHTASPVLAKSDSSSKEETLVPAVNGTLNVLRSCKKNPFLK  123

Query  741   RVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQND  562
             RVVLTSS S +R R D      L+E+ W+ +  C++  LWYA AK  AE+ AW++A++N+
Sbjct  124   RVVLTSSSSAVRIRDDDQPNISLDETTWSSVPLCEKMQLWYALAKVFAEKAAWEFAKENN  183

Query  561   GIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHILA  385
              I+LV V  SFV+GP L+ +   T   +L + +G    + +  R+G+VHI+D   +HIL 
Sbjct  184   -IDLVTVLPSFVIGPSLSHELCVTASDVLGLFQGDTARFSSYGRMGYVHIDDVASSHILV  242

Query  384   MEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELG  205
              E  +A+GR +CS+ V    +++ +L  +YP +P   + ++  G  S + L+ +K+  LG
Sbjct  243   YETPHATGRYLCSSVVLDNDELVSLLAKRYPVFPIPRRLNSPYGKQS-YQLNTSKLQGLG  301

Query  204   LPPFATLSQMFDDCIHSFQQKGFL  133
                F  + +MFDDC+ S + +G L
Sbjct  302   F-KFRGVQEMFDDCVQSLKDQGHL  324



>ref|XP_006849855.1| hypothetical protein AMTR_s00022p00057010 [Amborella trichopoda]
 gb|ERN11436.1| hypothetical protein AMTR_s00022p00057010 [Amborella trichopoda]
Length=320

 Score =   248 bits (633),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 138/321 (43%), Positives = 207/321 (64%), Gaps = 14/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL  GY+V  TVR+PG  +KVG L EL+ AKERL+++K D++EE
Sbjct  9     CVTGASGYLASWLVKKLLLLGYNVIGTVRDPGNYKKVGHLLELESAKERLQLVKADLLEE  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA-RKMMVKRVVLTS  724
             GS +  FDG  GVFH ASP++V  D +++  ++DP+V GTLNVL    R   +KRVVLTS
Sbjct  69    GSFDQAFDGCHGVFHVASPIVVA-DLDLKTEILDPAVNGTLNVLRCCKRNPSIKRVVLTS  127

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S + +R R D     PL+ES W+ +  C++  +WYA +KT+AE+ AWK+AE+N GI+LV 
Sbjct  128   STAAVRARDDFDPSIPLDESSWSSVQLCQKLKVWYALSKTLAERAAWKFAEEN-GIDLVT  186

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP----NKRVGFVHIEDAVRAHILAMEA  376
             V  SF++GP L    ++T   +LA++K   G+ P    + R+G+VHI+D    H+L  E 
Sbjct  187   VLPSFIIGPSLPRDLSATASNVLALLK---GDSPISLRDGRMGYVHIDDVACCHVLVYED  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               A GR +CS+T+    ++   L+ +YP+   LT  S  +     + L+  K+  LG   
Sbjct  244   AKAKGRYLCSSTILENYELTSFLKERYPN---LTISSFGKHPRPYYELNTFKLENLGF-T  299

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F ++ +MFDDC+ S +++G+L
Sbjct  300   FRSIEEMFDDCVESLKEQGYL  320



>ref|XP_002523596.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF38791.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=328

 Score =   248 bits (633),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 142/327 (43%), Positives = 209/327 (64%), Gaps = 10/327 (3%)
 Frame = -2

Query  1107  QAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLK  928
             Q+K K    CVTG +G + S+L+K LL  GY V  TVR+PG  +K+  LW+L+GAKERL+
Sbjct  3     QSKGK---VCVTGASGFLASWLIKRLLLSGYDVIGTVRDPGNEKKLAHLWKLEGAKERLQ  59

Query  927   ILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-  751
             ++K D+ME GS +D   G  GVFHTASPV+ P   + +  ++ P+V+GTLNVL+S +K  
Sbjct  60    LVKADLMEMGSFDDAIFGCHGVFHTASPVIKPTT-DPKAEILKPAVEGTLNVLSSCKKNP  118

Query  750   MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAE  571
              +KR+VLTSS S IR R D     PL+ES W+ ++ C+R  +WY  +KT+AE+ AW++  
Sbjct  119   FMKRMVLTSSSSTIRAREDIDPKVPLDESSWSSVELCERLQIWYVLSKTLAEKAAWEFCN  178

Query  570   QNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAH  394
              N GI+LV V  SFV+GP L P   ST+  +L ++KG   ++  + R+G+VHI+D    H
Sbjct  179   DN-GIDLVTVLPSFVIGPSLPPDLCSTVSDVLGLLKGETDKFQWHGRMGYVHIDDVALCH  237

Query  393   ILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIM  214
             IL  E +NA GR ICS+T+   ++++  L  +YPS     +   E+ D   +  + +K+ 
Sbjct  238   ILVYEQENARGRYICSSTILDNNELVSFLSARYPSLSIPKRF--EQLDRPYYEFNTSKLK  295

Query  213   ELGLPPFATLSQMFDDCIHSFQQKGFL  133
              LG   F ++ QMFDDCI S  ++G L
Sbjct  296   SLGF-KFKSIHQMFDDCIASLIEQGHL  321



>emb|CDP14491.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   248 bits (633),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 142/325 (44%), Positives = 205/325 (63%), Gaps = 7/325 (2%)
 Frame = -2

Query  1092  RPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGD  913
             R + CVTG +G + S+L+K LL  GY V  TVR+P   +KV  LW L+GAKERL ++KGD
Sbjct  5     RGKVCVTGASGFLASWLIKRLLLSGYRVTGTVRDPENAKKVAHLWRLEGAKERLVLVKGD  64

Query  912   VMEEGSMEDGFDGVDGVFHTASPVL---VPYDHNIQKTLIDPSVKGTLNVLTSARKM-MV  745
             +MEEGS +D   G +GVFHTASPVL          +  ++ P+V+GTLNVL S +K   +
Sbjct  65    LMEEGSFDDAIMGCEGVFHTASPVLGRPASDPKACKAEILKPAVEGTLNVLRSCKKNPFL  124

Query  744   KRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQN  565
             KRVVLTSS S +R R D     PL+ES W+    C+R  +WY  +KT+AE+ AWK+ E+N
Sbjct  125   KRVVLTSSSSTVRAREDFDPNVPLDESSWSSEILCERLKIWYVLSKTLAEKAAWKFCEEN  184

Query  564   DGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHIL  388
             + I+LV V  SFV+GP L P+  ST   +L ++KG   ++  + R+G+VHI+D    HIL
Sbjct  185   E-IDLVTVLPSFVIGPSLPPELCSTAADVLGLLKGETQKFEWHGRMGYVHIDDVALCHIL  243

Query  387   AMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMEL  208
               E +NA GR +CS+TV    ++  +L   YP+ P + K  ++  +   + L+ +K+  L
Sbjct  244   VYERRNAQGRYLCSSTVLDNDELASILSATYPALP-IPKRFHKLDNRPSYDLNTSKLEGL  302

Query  207   GLPPFATLSQMFDDCIHSFQQKGFL  133
             G   F ++ +MFDDCI S  ++G L
Sbjct  303   GFKNFRSIREMFDDCIASLVEQGHL  327



>ref|XP_004957228.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Setaria 
italica]
Length=329

 Score =   248 bits (632),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 135/324 (42%), Positives = 201/324 (62%), Gaps = 5/324 (2%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G I S+L+K LL+ GY V  TVR+PG  +KV  LW+L GAKERL+I++
Sbjct  4     SNKGKVCVTGASGFIASWLIKQLLESGYHVVGTVRDPGNRQKVAHLWKLPGAKERLQIVR  63

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              D++EE S ++     DGVFHTASPVL   D + ++  + P+V GTLNVL S +K   +K
Sbjct  64    ADLLEEESFDEAVMSCDGVFHTASPVLAKSDSSSKEATLVPAVNGTLNVLRSCKKNPFLK  123

Query  741   RVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQND  562
             RVVLTSS S +R R DA     L+E+ W+ +  C++  LWY  AK  AE+ AW++A++N 
Sbjct  124   RVVLTSSSSAVRIRDDAQPNISLDETIWSSVPLCEKMQLWYGLAKVFAEKAAWEFAKEN-  182

Query  561   GIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILA  385
             GI+LV V  SFV+GP L+ +   T   +L +++G    +    R+G+VHI+D   +HIL 
Sbjct  183   GIDLVTVLPSFVIGPSLSHELCVTASDVLGLLQGDTARFSCYGRMGYVHIDDVASSHILV  242

Query  384   MEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELG  205
              E   A+GR +CS+ V    +++  L  +YP +P   +     G  + + L+ +K+  LG
Sbjct  243   YETPEATGRYLCSSVVLDNDELVSFLAKRYPIFPIPRRLDKPYGKQT-YQLNTSKLQGLG  301

Query  204   LPPFATLSQMFDDCIHSFQQKGFL  133
                F  L +MFDDC+ S + +G L
Sbjct  302   F-KFRGLQEMFDDCVQSLKDQGHL  324



>ref|XP_006422368.1| hypothetical protein CICLE_v10028834mg [Citrus clementina]
 gb|ESR35608.1| hypothetical protein CICLE_v10028834mg [Citrus clementina]
Length=325

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 203/318 (64%), Gaps = 6/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL  GY V  TVR+PG   K+  LW L+GAKERL+I++ ++M+E
Sbjct  11    CVTGASGYLASWLVKRLLLAGYHVTGTVRDPGNERKLAHLWRLEGAKERLQIVRANLMDE  70

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
             GS +D  +G  GVFHTASPVL P   N +  +I+P+V GTLNVL S +K   ++RVVLTS
Sbjct  71    GSFDDAINGCQGVFHTASPVLKP-SSNPKAEIIEPAVNGTLNVLRSCQKNPSLRRVVLTS  129

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S +R R+D     PL+ES W+ +D C+   +WYA +K +AE+ AW++   N GI+LV 
Sbjct  130   SSSTVRIRYDFDSKIPLDESSWSSVDLCESLQIWYALSKILAEKAAWEFCGHN-GIDLVT  188

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNA  367
             +  SFV+GP L P   ST   +L ++KG   ++  + R+G+VHI+D    HIL  E QN+
Sbjct  189   ILPSFVIGPSLPPDLCSTASDVLGLLKGEKEKFQWHGRMGYVHIDDVALCHILVYEHQNS  248

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR +CS+TV   ++++ +L  +YP  P   +   E  D   +  + +K+  L    F +
Sbjct  249   HGRYLCSSTVVDNNELVSLLSTRYPLLPIPERF--ELLDRPYYEFNTSKLTSLLGFKFKS  306

Query  186   LSQMFDDCIHSFQQKGFL  133
             + +MFDDCI  F ++G+L
Sbjct  307   IEEMFDDCIAWFDEQGYL  324



>ref|XP_006486836.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Citrus 
sinensis]
Length=323

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 203/318 (64%), Gaps = 6/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL  GY V  TVR+PG   K+  LW L+GAKERL+I++ ++M+E
Sbjct  9     CVTGASGYLASWLVKRLLLAGYHVTGTVRDPGNERKLAHLWRLEGAKERLQIVRANLMDE  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
             GS +D  +G  GVFHTASPVL P   N +  +I+P+V GTLNVL S +K   ++RVVLTS
Sbjct  69    GSFDDAINGCQGVFHTASPVLKP-SSNPKAEIIEPAVNGTLNVLRSCQKNPSLRRVVLTS  127

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S +R R+D     PL+ES W+ +D C+   +WYA +K +AE+ AW++   N GI+LV 
Sbjct  128   SSSTVRIRYDFDSKIPLDESSWSSVDLCESLQIWYALSKILAEKAAWEFCGHN-GIDLVT  186

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNA  367
             +  SFV+GP L P   ST   +L ++KG   ++  + R+G+VHI+D    HIL  E QN+
Sbjct  187   ILPSFVIGPSLPPDLCSTASDVLGLLKGEKEKFQWHGRMGYVHIDDVALCHILVYEHQNS  246

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR +CS+TV   ++++ +L  +YP  P   +   E  D   +  + +K+  L    F +
Sbjct  247   HGRYLCSSTVVDNNELVSLLSTRYPLLPIPERF--ELLDRPYYEFNTSKLTSLLGFKFKS  304

Query  186   LSQMFDDCIHSFQQKGFL  133
             + +MFDDCI  F ++G+L
Sbjct  305   IEEMFDDCIAWFDEQGYL  322



>ref|XP_009386710.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Musa acuminata 
subsp. malaccensis]
Length=326

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/329 (42%), Positives = 205/329 (62%), Gaps = 7/329 (2%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             MDE + SK    CVTG +G + S+LVK LL  GY V  TVR+PG  +K+  LWEL+GAK+
Sbjct  1     MDEVSGSK-GRVCVTGASGYVASWLVKRLLQSGYHVIGTVRDPGGHKKLAHLWELEGAKD  59

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL+++K ++M+EGS +D   G +GVFHTASPV+V      +  ++DP+V GTLNVL S +
Sbjct  60    RLQLVKANLMDEGSFDDAVMGCEGVFHTASPVVVAMYPKAE--ILDPAVTGTLNVLRSCK  117

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWK  580
             K   ++RVVLTSS S IR R +     PL+E+ W+ ++ C+ + +WYA AK +AE+ AW+
Sbjct  118   KNPALRRVVLTSSSSAIRVRENVNPRLPLDETSWSSVELCQTFQMWYALAKVLAEKAAWE  177

Query  579   WAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAV  403
             +A++N  I+LV +  SF+VGP L      T+  +L +++G    +    R+G+VHI+D  
Sbjct  178   FAKENK-IDLVTLLPSFIVGPSLPHDLCLTVSDVLGLLRGEKDRFSAYGRMGYVHIDDVA  236

Query  402   RAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCT  223
               HIL  E  NA GR +CS+ V    ++  +L  +YPS P   +  N   +   +  D +
Sbjct  237   CCHILVYENDNAQGRYLCSSNVLDNHEVAALLANRYPSLPIPNRFHNYHAEIPRYQFDTS  296

Query  222   KIMELGLPPFATLSQMFDDCIHSFQQKGF  136
             K+ +LG   F    +MFDDCI S + +G+
Sbjct  297   KLRDLGF-KFKGTEEMFDDCIASLRTQGY  324



>ref|XP_008448150.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Cucumis melo]
Length=328

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 202/318 (64%), Gaps = 8/318 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G   S+LVK LL  GY V  TVR+PG ++KV  LW L+GAKERL+++K D+ME 
Sbjct  14    CVTGASGFFASWLVKRLLMSGYHVIGTVRDPGNVKKVEHLWRLEGAKERLRLVKADLMEP  73

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
             GS +D   G  GVFHTASPVL    H+  +TL +P+++GTLNVL S +K   ++RVVLTS
Sbjct  74    GSFDDAVIGCHGVFHTASPVL-DATHSKAETL-EPAIEGTLNVLHSCKKNPSLRRVVLTS  131

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S +R R D     PL+ES WT +  C+R  LWYA AKT+AE+ AW++  +N GI+LV 
Sbjct  132   SSSTVRVREDFDPKIPLDESSWTSVQLCERLKLWYALAKTLAEKAAWEFCNEN-GIDLVT  190

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHILAMEAQNA  367
             V  S ++GP L+     T  ++L ++KG    + +  RVG++HI+D   +HILA E ++A
Sbjct  191   VLPSVIIGPNLSRDLCYTASIVLGLLKGETEPFQSLGRVGYIHIDDVALSHILAFENKDA  250

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR ICS+ V   + +   L  +YP +P   K   E  +   +  + +KI +LG+  F  
Sbjct  251   QGRYICSSIVLEINDLASRLSSRYPLFPISKKF--EASNRPYYDYNMSKIEKLGM-KFKC  307

Query  186   LSQMFDDCIHSFQQKGFL  133
             + +MFDDCI S  ++G L
Sbjct  308   VEEMFDDCIASLLEQGHL  325



>ref|XP_008651868.1| PREDICTED: dihydroflavanoid reductase-like1 isoform X1 [Zea mays]
 tpg|DAA62088.1| TPA: dihydroflavonol-4-reductase [Zea mays]
Length=331

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 204/326 (63%), Gaps = 7/326 (2%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G + S+L+K LL+ GY V  TVR+PG  +K   LW+L GAKERL+I++
Sbjct  4     SSKGKVCVTGASGFVASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKERLQIVR  63

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              D++EEGS +      +GVFHTASPVL   D   ++  + P+V GTLNVL S +K   +K
Sbjct  64    ADLLEEGSFDSAVMACEGVFHTASPVLAKPDSTSKEETLVPAVNGTLNVLRSCKKNPFLK  123

Query  741   RVVLTSSCSCIRYRHDATQIS--PLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQ  568
             RVVLTSS S +R R D    S   L+E+ W+ +  C++ +LWYA AK  AE+ AW++A++
Sbjct  124   RVVLTSSSSAVRIRDDGQSSSNISLDETAWSSVPLCEKMHLWYALAKVFAEKAAWEFAKE  183

Query  567   NDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHI  391
             N GI+LV V  SFV+GP L+ +   T   +L + +G    + +  R+G+VHI+D   +HI
Sbjct  184   N-GIDLVTVLPSFVIGPSLSHELCVTASDVLGLFQGDTARFSSYGRMGYVHIDDVASSHI  242

Query  390   LAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIME  211
             L  EA  A+GR +CS+ V    +++  L  +YP +P   + ++  G  S + L+ +K+  
Sbjct  243   LVYEAPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNSPYGKQS-YQLNTSKLQG  301

Query  210   LGLPPFATLSQMFDDCIHSFQQKGFL  133
             LG   F  + +MFDDC+ S + +G L
Sbjct  302   LGF-KFRGVQEMFDDCVQSLKDQGHL  326



>ref|XP_009599462.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Nicotiana tomentosiformis]
Length=337

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 133/333 (40%), Positives = 214/333 (64%), Gaps = 6/333 (2%)
 Frame = -2

Query  1125  DRYMDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKG  946
             ++ ++E +   + + CVTG +G + S+L+K LL  GY V  TVR+PG  +KVG LW+L+G
Sbjct  6     NKNVEENSSKYKGKVCVTGASGFLASWLIKRLLLSGYHVIGTVRDPGNQKKVGHLWKLQG  65

Query  945   AKERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLT  766
             A ERL+++K ++ +EGS +D   G +GVFHTASPVL    +++   ++ P++ GTLNVL 
Sbjct  66    ANERLRLVKANLTDEGSFDDAIMGCEGVFHTASPVLGKPTYDLTAEILKPAIDGTLNVLR  125

Query  765   SARKM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQE  589
             S +K   +KRVVLTSS S  R R D     PL+ES W+ ++ CK + +WY  +KT+AE+ 
Sbjct  126   SCKKNPSLKRVVLTSSSSTARVRGDIDPNIPLDESSWSSVELCKSFEIWYVLSKTLAEKA  185

Query  588   AWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIE  412
             AW++ EQN+ I LV +  SF++GP L P+  ST   +L ++KG   ++  + R+G+V+I+
Sbjct  186   AWEFCEQNN-IHLVTLLPSFIIGPSLPPELCSTADDVLGLLKGRTDKFDWHGRMGYVYID  244

Query  411   DAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSL  232
             D   +HIL  E  +A GR +CS+ V   +Q++ +L  +YPS P   +   ++ D   +  
Sbjct  245   DVAISHILVYEHPDAHGRYLCSSKVLDNNQLVSILSERYPSLPIPKRF--KKLDRPHYEF  302

Query  231   DCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             +  K+  LG+  F ++ +MFDDC+  F++KG +
Sbjct  303   NTLKLENLGM-KFKSIEEMFDDCVAFFKEKGLI  334



>gb|ACG33357.1| dihydroflavonol-4-reductase [Zea mays]
Length=364

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 136/331 (41%), Positives = 206/331 (62%), Gaps = 7/331 (2%)
 Frame = -2

Query  1113  DEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKER  934
             +    S + + CVTG +G + S+L+K LL+ GY V  TVR+PG  +K   LW+L GAKER
Sbjct  32    ENMVTSSKGKVCVTGASGFVASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKER  91

Query  933   LKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK  754
             L+I++ D++EEGS +      +GVFHTASPVL   D   ++  + P+V GTLNVL S +K
Sbjct  92    LQIVRADLLEEGSFDSAVMACEGVFHTASPVLAKPDSTSKEDTLVPAVNGTLNVLRSCKK  151

Query  753   M-MVKRVVLTSSCSCIRYRHDATQIS--PLNESHWTDLDYCKRYNLWYAYAKTMAEQEAW  583
                +KRVVLTSS S +R R D  Q S   L+E+ W+ +  C++ +LWYA AK  AE+ AW
Sbjct  152   NPFLKRVVLTSSSSAVRIRDDGGQSSNISLDETTWSSVPLCEKMHLWYALAKVFAEKAAW  211

Query  582   KWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDA  406
             ++A++N GI+LV V  SFV+GP L+ +   T   +L + +G    + +  R+G+VHI+D 
Sbjct  212   EFAKEN-GIDLVTVLPSFVIGPSLSHELCVTASDVLGLFQGDTARFSSYGRMGYVHIDDV  270

Query  405   VRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDC  226
               +HIL  EA  A+GR +CS+ V    +++  L  +YP +P   + ++  G  S + L+ 
Sbjct  271   ASSHILVYEAPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNSPYGKQS-YQLNT  329

Query  225   TKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             +K+  LG   F  + +MFDDC+ S + +G L
Sbjct  330   SKLQGLGF-KFRGVQEMFDDCVQSLKDQGHL  359



>gb|ACG40388.1| dihydroflavonol-4-reductase [Zea mays]
Length=332

 Score =   246 bits (627),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 135/327 (41%), Positives = 204/327 (62%), Gaps = 8/327 (2%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G + S+L+K LL+ GY V  TVR+PG  +K   LW+L GAKERL+I++
Sbjct  4     SSKGKVCVTGASGFVASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKERLQIVR  63

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              D++EEGS +      +GVFHTASPVL   D   ++  + P+V GTLNVL S +K   +K
Sbjct  64    ADLLEEGSFDSAVMACEGVFHTASPVLAKPDSTSKEETLVPAVNGTLNVLRSCKKNPFLK  123

Query  741   RVVLTSSCSCIRYRHDATQIS---PLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAE  571
             RVVLTSS S +R R D  Q S    L+E+ W+ +  C++ +LWYA AK  AE+ AW++A+
Sbjct  124   RVVLTSSSSAVRIRDDGGQSSSNISLDETTWSSVPLCEKMHLWYALAKVFAEKAAWEFAK  183

Query  570   QNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAH  394
             +N GI+LV V  SFV+GP L+ +   T   +L + +G    + +  R+G+VHI+D   +H
Sbjct  184   EN-GIDLVTVLPSFVIGPSLSHELCVTASDVLGLFQGDTARFSSYGRMGYVHIDDVASSH  242

Query  393   ILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIM  214
             IL  E   A+GR +CS+ V    +++  L  +YP +P   + ++  G  S + L+ +K+ 
Sbjct  243   ILVYEVPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNSPYGKQS-YQLNTSKLQ  301

Query  213   ELGLPPFATLSQMFDDCIHSFQQKGFL  133
              LG   F  + +MFDDC+ S + +G L
Sbjct  302   GLGF-KFRGVQEMFDDCVQSLKDQGHL  327



>gb|AEZ53298.1| tetraketide alpha-pyrone reductase 1 [Nicotiana tabacum]
Length=337

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/333 (41%), Positives = 208/333 (62%), Gaps = 6/333 (2%)
 Frame = -2

Query  1125  DRYMDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKG  946
             ++ ++  +   R + CVTG +G + S+L+K LL  GY V  TVR+PG   KVG LW L+G
Sbjct  6     NKNVEVNSSKYRGKVCVTGASGFLASWLIKRLLLSGYHVIGTVRDPGNQNKVGHLWRLQG  65

Query  945   AKERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLT  766
             AKERL ++K ++ +EGS +D   G DGVFHTASPVL    +++   ++ P++ GTLNVL 
Sbjct  66    AKERLHLVKANLTDEGSFDDAIMGCDGVFHTASPVLGKPTYDLTAEILKPAIDGTLNVLR  125

Query  765   SARKM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQE  589
             S +K   +KRVVLTSS S  R R D     PL+ES W+ ++ CK + +WY  +KT+AE+ 
Sbjct  126   SCKKNPSLKRVVLTSSSSTARVRDDIDPNIPLDESSWSSVELCKSFEIWYVLSKTLAEKA  185

Query  588   AWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIE  412
             AW++  QN+ I LV +  SF++GP L P   ST   +L ++KG   ++  + R+G+VHI+
Sbjct  186   AWEFCGQNN-IHLVTLLPSFIIGPSLPPDLCSTADDVLGLLKGKTDKFDWHGRMGYVHID  244

Query  411   DAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSL  232
             D   +HIL  E  +A GR +CS+ V   +Q++ +L  +YPS P   +   ++ D   +  
Sbjct  245   DVALSHILVYEHPDAHGRYLCSSKVLDNNQLVSILSERYPSLPIPKRF--KKLDRPHYEF  302

Query  231   DCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             +  K+  LG+  F ++ +MFDDC+  F+ KG +
Sbjct  303   NTLKLENLGM-KFKSIEEMFDDCVAFFKDKGLI  334



>ref|XP_009776908.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Nicotiana sylvestris]
Length=337

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/327 (42%), Positives = 207/327 (63%), Gaps = 7/327 (2%)
 Frame = -2

Query  1107  QAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLK  928
              +K KR + CVTG +G + S+L+K LL  GY V  TVR+PG   KVG LW L+GAKERL 
Sbjct  13    SSKYKR-KVCVTGASGFLASWLIKRLLLSGYHVIGTVRDPGNQNKVGHLWRLQGAKERLH  71

Query  927   ILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-  751
             ++K ++ +EGS +D   G DGVFHTASPVL    +++   ++ P++ GTLNVL S +K  
Sbjct  72    LVKANLTDEGSFDDAIMGCDGVFHTASPVLGKPTYDLTAEILKPAIDGTLNVLRSCKKNP  131

Query  750   MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAE  571
              +KRVVLTSS S  R R D     PL+ES W+ ++ C+++ +WY  +KT+AE+ AW++  
Sbjct  132   SLKRVVLTSSSSTARVRDDIDPNIPLDESSWSSVELCQKFEIWYVLSKTLAEKAAWEFCG  191

Query  570   QNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAH  394
             QN+ I LV +  SF++GP L P   ST   +L ++KG   ++  + R+G+VHI+D   +H
Sbjct  192   QNN-IHLVTLLPSFIIGPSLPPDLCSTADDVLGLLKGKTDKFDWHGRMGYVHIDDVALSH  250

Query  393   ILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIM  214
             IL  E  +A GR +CS+ V   +Q++ +L  +YPS P   +   ++ D   +  +  K+ 
Sbjct  251   ILVYEHPDAHGRYLCSSKVLDNNQLVSILSERYPSLPIPKRF--KKLDRPHYEFNTLKLE  308

Query  213   ELGLPPFATLSQMFDDCIHSFQQKGFL  133
              LG+  F ++ +MFDDC+  F+ KG +
Sbjct  309   NLGM-KFKSIEEMFDDCVAFFKDKGLI  334



>ref|NP_001105644.1| dihydroflavanoid reductase-like1 [Zea mays]
 gb|AAK52955.1|AF366295_1 dihydro-flavanoid reductase-like protein [Zea mays]
Length=331

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/326 (41%), Positives = 204/326 (63%), Gaps = 7/326 (2%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G + S+L+K LL+ GY V  TVR+PG  +K   LW+L GAKERL+I++
Sbjct  4     SSKGKVCVTGASGFVASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKERLQIVR  63

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              +++EEGS +      +GVFHTASPVL   D   ++  + P+V GTLNVL S +K   +K
Sbjct  64    ANLLEEGSFDSAVMACEGVFHTASPVLAKPDSTSKEDTLVPAVNGTLNVLRSCKKNPFLK  123

Query  741   RVVLTSSCSCIRYRHDATQIS--PLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQ  568
             RVVLTSS S +R R D  Q S   L+E+ W+ +  C++ +LWYA AK  AE+ AW++A++
Sbjct  124   RVVLTSSSSAVRIRDDGGQSSNISLDETTWSSVPLCEKMHLWYALAKVFAEKAAWEFAKE  183

Query  567   NDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHI  391
             N GI+LV V  SFV+GP L+ +   T   +L + +G    + +  R+G+VHI+D   +HI
Sbjct  184   N-GIDLVTVLPSFVIGPSLSHELCVTASDVLGLFQGDTARFSSYGRMGYVHIDDVASSHI  242

Query  390   LAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIME  211
             L  E   A+GR +CS+ V    +++  L  +YP +P   + ++  G  S + L+ +K+  
Sbjct  243   LVYEVPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNSPYGKQS-YQLNTSKLQG  301

Query  210   LGLPPFATLSQMFDDCIHSFQQKGFL  133
             LG   F  + +MFDDC+ S + +G L
Sbjct  302   LGF-KFRGVQEMFDDCVQSLKDQGHL  326



>ref|XP_002983967.1| hypothetical protein SELMODRAFT_119444 [Selaginella moellendorffii]
 gb|EFJ14979.1| hypothetical protein SELMODRAFT_119444 [Selaginella moellendorffii]
Length=338

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 147/336 (44%), Positives = 207/336 (62%), Gaps = 13/336 (4%)
 Frame = -2

Query  1116  MDEQAKSKRPEY-CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAK  940
             M E A+S   E  CVTG  G + S LVK LL++GY VR TVR+PG  +KV  L  L GA 
Sbjct  1     MGEAAQSSPGELVCVTGANGFLASCLVKCLLERGYYVRATVRDPGNADKVSHLLRLPGAS  60

Query  939   ERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-  763
             ERL++ + D++ EGS +D   G  GVFHTASPV           +I P+V GTLNVL S 
Sbjct  61    ERLELREADLLTEGSFDDVVRGCRGVFHTASPVTAFTVDPEVLEMIAPAVNGTLNVLKSC  120

Query  762   ARKMMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAW  583
             A+   V+RVVLTSS S IR+  +    S L+++ W+  D+C++Y +WY  AKT+AE+ AW
Sbjct  121   AKAPSVRRVVLTSSTSAIRFMPEMPFNSVLDDTSWSSEDFCRKYKMWYYLAKTVAERRAW  180

Query  582   KWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGE------YPNKRVGFV  421
             ++AE+N+ ++LV V  SFVVGP+L    +ST   +L ++KG + +      YP  R+G+V
Sbjct  181   EFAEKNN-LDLVTVLPSFVVGPVLPKNLSSTALDVLGLLKGTLCDAKKFSIYP--RMGYV  237

Query  420   HIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSE  241
             H+ED   AHIL MEA  A GR ICS+TV    ++  +L  +YP +   TK   E      
Sbjct  238   HVEDVALAHILVMEAPGARGRYICSSTVMDNDKLGELLAMRYPQFKVPTKFP-ESYKSKY  296

Query  240   HSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             ++LD +K+ +LGL  F ++  MFDDC+ +F  +G  
Sbjct  297   YTLDTSKLEKLGL-KFRSVEDMFDDCLENFYHRGLF  331



>ref|XP_004290099.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Fragaria 
vesca subsp. vesca]
Length=329

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 143/332 (43%), Positives = 212/332 (64%), Gaps = 10/332 (3%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             MD+  +SK    CVTG +G + S+L+K LL  GY V  TVR+PG  +K+  LW L+GAKE
Sbjct  1     MDQNLESKG-RVCVTGASGFLASWLIKRLLLSGYHVTGTVRDPGNQKKLAHLWRLEGAKE  59

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL+++K D++EEGS +D   G  GVFH+ASPVL P   + +K ++DP++KGTLNVL S +
Sbjct  60    RLRLVKADLVEEGSFDDAILGCHGVFHSASPVLKP-SSDPKKEILDPAIKGTLNVLRSCK  118

Query  756   KM-MVKRVVLTSSCSCIRYR--HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEA  586
             K   ++RVVLTSS S +R R   D     PL+ES W+ ++ C++  +WY  +K +AE+ A
Sbjct  119   KNPSLRRVVLTSSTSAVRVRAGDDFDPNIPLDESSWSSVELCEKLQIWYPLSKILAEKAA  178

Query  585   WKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIED  409
             W++ + N GI+LV V  +FV+GP L P   ST   IL ++KG   ++  + R+G+VHI+D
Sbjct  179   WEFCKAN-GIDLVSVLPTFVIGPSLPPDLCSTASDILGLLKGETEKFNWHGRMGYVHIDD  237

Query  408   AVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLD  229
                 HIL  E ++A GR IC++TV   +++  +L  +YPS P   +   EE +   + L 
Sbjct  238   VALCHILVYEHESAHGRYICNSTVLDNNELASLLCTRYPSLPIPERF--EELERPHYDLS  295

Query  228   CTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
              +K+  LG   F T+ +MFDDCI S  ++G L
Sbjct  296   TSKLKSLGF-KFKTIQEMFDDCIASLVEQGHL  326



>ref|NP_001141357.1| uncharacterized protein LOC100273448 [Zea mays]
 gb|ACG34664.1| dihydroflavonol-4-reductase [Zea mays]
 tpg|DAA48040.1| TPA: dihydroflavonol-4-reductase [Zea mays]
Length=334

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/329 (42%), Positives = 205/329 (62%), Gaps = 10/329 (3%)
 Frame = -2

Query  1104  AKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKI  925
             A + + + CVTG +G I S+LVK LL+ GY V  TVR+PG  +KVG LW L+GAKERL++
Sbjct  2     ANTAKGKVCVTGASGFIASWLVKRLLESGYHVLGTVRDPGNGKKVGHLWGLEGAKERLQL  61

Query  924   LKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-M  748
             ++ D++EEGS +D     +GVFHTASPV+     N ++ ++D ++ GT+NVL S +K   
Sbjct  62    VRADLLEEGSFDDAVMACEGVFHTASPVVT--GSNSKEEMLDSAINGTMNVLRSCKKNPS  119

Query  747   VKRVVLTSSCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKW  577
             +KRVVLTSS S +R + D   + P   L+ES W+ +++C+   +WYA AK +AE+ AW++
Sbjct  120   LKRVVLTSSSSTVRIK-DEADLPPNVLLDESSWSSIEFCESLQIWYAVAKILAEKAAWEF  178

Query  576   AEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVR  400
             A ++  I+LV V  +FVVGP L+P+   T   +L + +G  G++    R+G+VHI+D  R
Sbjct  179   AGEHR-IDLVTVLPTFVVGPTLSPELGPTASDVLGLFQGETGKFTTYGRMGYVHIDDVAR  237

Query  399   AHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTK  220
              H+LA EA  A GR ICS  V     +  +L  ++P+YP         G+ S +  D +K
Sbjct  238   CHMLAYEAAGARGRYICSAAVLDCGDLAALLARRFPAYPVPRSLPRAYGEQS-YGFDTSK  296

Query  219   IMELGLPPFATLSQMFDDCIHSFQQKGFL  133
                LGL  F  + +MFDD + SF   G L
Sbjct  297   ARALGLAEFKGVEEMFDDAVASFIGHGHL  325



>gb|EYU23972.1| hypothetical protein MIMGU_mgv1a009951mg [Erythranthe guttata]
Length=326

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 203/318 (64%), Gaps = 6/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G + S+L+K LL  GY V  TVR+PG+  KVG LW+L GAKERL+++K D+M E
Sbjct  11    CVTGAAGFVASWLIKRLLLSGYHVTGTVRDPGDNGKVGHLWKLAGAKERLRLVKADLMVE  70

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
             GS +    G  GVFHTASPVL     + +  ++ P++ GTLNVL S +K   +KRVVLTS
Sbjct  71    GSFDAAIMGCHGVFHTASPVLGLPKSDPKSEILQPAIDGTLNVLRSCKKNPSLKRVVLTS  130

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S IR R D     PL+ES W+  + C+R  +WY  +KT+AE+ AWK+ E+N  I+L+ 
Sbjct  131   SSSTIRARDDFDPHVPLDESSWSCEELCERLKIWYVLSKTLAEKAAWKFCEENK-IDLIT  189

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNA  367
             +  SFVVGP L P   ST   IL ++KG   ++  + R+G+VHI+D   +HIL  E ++A
Sbjct  190   ILPSFVVGPSLPPLLCSTASDILGLLKGETEKFQWHGRMGYVHIDDVASSHILLYENESA  249

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR ICS+ V    ++  +L  +YP+ P   +   E+ + + + LD +K+  LG+  F +
Sbjct  250   KGRYICSSRVVDNDELAAILLAQYPTLPIPKRF--EKLERAYYELDVSKLRGLGM-KFRS  306

Query  186   LSQMFDDCIHSFQQKGFL  133
             + +MFDDC+ S  ++G++
Sbjct  307   IEEMFDDCVQSLTKQGYI  324



>gb|AFC36879.1| tetraketide alpha-pyrone reductase 1 [Nicotiana tabacum]
Length=337

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 133/333 (40%), Positives = 210/333 (63%), Gaps = 6/333 (2%)
 Frame = -2

Query  1125  DRYMDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKG  946
             ++ ++E +   + + CVTG +G + S+L+K LL  GY V  TVR+PG   KVG LW L+G
Sbjct  6     NKNVEENSSKYKGKVCVTGASGFLASWLIKRLLLSGYHVIGTVRDPGNQNKVGHLWRLQG  65

Query  945   AKERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLT  766
             AKERL ++K ++ +EGS +D   G DGVFHTASPVL    +++   ++ P++ GTLNVL 
Sbjct  66    AKERLHLVKANLTDEGSFDDAIMGCDGVFHTASPVLGKPTYDLTAEILKPAIDGTLNVLR  125

Query  765   SARKM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQE  589
             S +K   +KRVVLTSS S  R R D     PL+ES W+ ++ C+++ +WY  +KT+AE+ 
Sbjct  126   SCKKNPSLKRVVLTSSSSTARVRDDIDPNIPLDESSWSSVELCQKFEIWYVLSKTLAEKA  185

Query  588   AWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIE  412
             AW++  QN+ I LV +  SF++GP L P+  ST   +L ++KG   ++  + R+G+V+I+
Sbjct  186   AWEFCGQNN-IHLVTLLPSFIIGPSLPPELCSTADDVLGLLKGRTDKFDWHGRMGYVYID  244

Query  411   DAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSL  232
             D    HIL  E  +A GR +CS+ V   +Q++ +L  +YPS P   +   ++ D   +  
Sbjct  245   DVAICHILVYEHPDAHGRYLCSSKVLDNNQLVPILSERYPSLPIPKRF--KKLDRPHYEF  302

Query  231   DCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             +  K+  LG+  F ++ +MFDDC+  F+ KG +
Sbjct  303   NTLKLENLGM-KFKSIEEMFDDCVAFFKDKGLI  334



>ref|XP_003578347.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Brachypodium 
distachyon]
Length=347

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 140/339 (41%), Positives = 210/339 (62%), Gaps = 12/339 (4%)
 Frame = -2

Query  1137  HIQIDRYMDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLW  958
             H Q++R +     S + + CVTG +G + S+LVK LL+ GY V  TVR+PG+  KV  LW
Sbjct  12    HYQLERMVS----STKGKVCVTGASGFVASWLVKRLLESGYHVLGTVRDPGDRRKVAHLW  67

Query  957   ELKGAKERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTL  778
             +L GA ERL++++ D+MEEGS +D     +GVFHTASPVL   D N ++  + P++ GTL
Sbjct  68    KLPGANERLQLVRADLMEEGSFDDAVMACEGVFHTASPVLAKSDSNCKEATLGPAINGTL  127

Query  777   NVLTSARKM-MVKRVVLTSSCSCIRYRHDATQISPL--NESHWTDLDYCKRYNLWYAYAK  607
             NVL S +K   +KRV+LTSS S +R R D TQ   L  +E+ W+ +  C++  LWYA AK
Sbjct  128   NVLRSCKKNPFLKRVILTSSSSAVRIR-DETQHPQLSWDETIWSSVPLCEKLQLWYALAK  186

Query  606   TMAEQEAWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRV  430
               AE+ A  +A +N  I+LV V  SFV+GP L+ +  +T   IL +++G    +    R+
Sbjct  187   IFAEKAALDFAREN-SIDLVSVLPSFVIGPSLSHELCTTASDILGLLQGDTDRFTLYGRM  245

Query  429   GFVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGD  250
             G+VHI+D  R+HIL  E   A GR +CS+ V   ++++ +L  ++P +P   + +N  G 
Sbjct  246   GYVHIDDVARSHILVYETPEAMGRYLCSSVVLDNTELVGLLAKQFPVFPIPRRLNNPYGK  305

Query  249   DSEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
              S + L+ +K+  LG   F  L +MFDDC+ S + +G L
Sbjct  306   QS-YQLNTSKLQGLGF-KFKGLREMFDDCVESLKDQGHL  342



>dbj|BAK06753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 136/338 (40%), Positives = 212/338 (63%), Gaps = 10/338 (3%)
 Frame = -2

Query  1137  HIQIDRYMDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLW  958
             H Q +R +     S + + CVTG +G + S+L+K LL+ GY V  TVR+PG  +KVG LW
Sbjct  4     HFQFERMVS----STKGKVCVTGASGFLASWLIKRLLECGYHVIGTVRDPGNRKKVGHLW  59

Query  957   ELKGAKERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTL  778
             +L GA ERL++++ D++EEGS +D     +GVFH ASPVL   D N ++  + P++ GTL
Sbjct  60    KLPGANERLQLVRADLLEEGSFDDAVMACEGVFHIASPVLGKSDSNCKEATLGPAINGTL  119

Query  777   NVLTSARKM-MVKRVVLTSSCSCIRYRHDATQISPL-NESHWTDLDYCKRYNLWYAYAKT  604
             NVL S +K   +KRVVLTSS S +R R +  Q   L +E+ W+ +  C++  LWYA AK 
Sbjct  120   NVLRSCKKSPFLKRVVLTSSSSAVRIRDETQQPELLWDETTWSSVPLCEKLQLWYALAKV  179

Query  603   MAEQEAWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVG  427
              AE+ A  +A++N+ I+LV V  SFV+GP L+ +  +T   IL +++G    + +  R+G
Sbjct  180   FAEKAALDFAKENN-IDLVTVLPSFVIGPSLSHELCTTASDILGLLQGDTDRFTSYGRMG  238

Query  426   FVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDD  247
             +VHI+D  R+HIL  E   A GR +CS+ V   ++++ +L  ++P +P   + SN  G  
Sbjct  239   YVHIDDVARSHILVYETPEARGRYLCSSVVLDNNELVGLLTKQFPVFPIPRRLSNPYGKQ  298

Query  246   SEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             + + L+ +K+  LGL  F  + +MF+DC+ S + +G L
Sbjct  299   A-YQLNTSKLQGLGL-KFKGVQEMFNDCVESLKDQGHL  334



>ref|XP_004139985.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Cucumis 
sativus]
 ref|XP_004171590.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Cucumis 
sativus]
 gb|KGN46632.1| hypothetical protein Csa_6G116160 [Cucumis sativus]
Length=328

 Score =   243 bits (619),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 136/318 (43%), Positives = 200/318 (63%), Gaps = 8/318 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G   S+LVK LL  GY V  TVR+PG ++KV  LW L+GAKERL+++K D+ME 
Sbjct  14    CVTGASGFFASWLVKRLLMSGYHVVGTVRDPGNVKKVEHLWRLEGAKERLRLVKADLMEP  73

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-MMVKRVVLTS  724
             GS +D   G  GVFHTASPVL    H+ +  +++P+++GTLNVL S +K + ++RVVLTS
Sbjct  74    GSFDDAVMGCHGVFHTASPVL-DATHS-KAEMLEPAIEGTLNVLHSCKKNLSLRRVVLTS  131

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S +R R D     PL+ES WT +  C+R  LWYA AKT+AE+ AW++  +N G++LV 
Sbjct  132   SSSTVRVREDFDPKIPLDESSWTSVQLCERLKLWYALAKTLAEKAAWEFCNEN-GMDLVT  190

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHILAMEAQNA  367
             V  S ++GP L+     T   +L +++G    + +  RVG++HI+D   +HILA E ++A
Sbjct  191   VLPSMIIGPSLSRDLCYTASSVLGLLRGETEPFQSLGRVGYIHIDDVALSHILAFENKDA  250

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR ICS+ V     +   L  +YP +P   +   E  +   +  + +KI +LG+     
Sbjct  251   QGRYICSSIVLEIDDLASRLSSRYPLFPISKRF--EASNRPYYDYNMSKIEKLGM-KLKC  307

Query  186   LSQMFDDCIHSFQQKGFL  133
             + +MFDDCI S  ++G L
Sbjct  308   VEEMFDDCIASLLEQGHL  325



>ref|XP_010028888.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Eucalyptus grandis]
 gb|KCW55714.1| hypothetical protein EUGRSUZ_I01552 [Eucalyptus grandis]
Length=330

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/330 (42%), Positives = 208/330 (63%), Gaps = 10/330 (3%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             MD + K K    CVTG  G + S+L K LL  GY V  TVR+PG  +KV  LW+L+GAKE
Sbjct  1     MDSEYKGK---VCVTGAAGYLASWLTKRLLLSGYHVVGTVRDPGNKKKVAHLWKLEGAKE  57

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL+++K D+M+EGS +D   G +GVFHTASPVL P   + +  +++P+++GTLNVL S +
Sbjct  58    RLRLVKADLMKEGSFDDAIMGCEGVFHTASPVLKP-SRDPKAKILEPAIEGTLNVLRSCK  116

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWK  580
             K   ++RVVLTSS S +R R D     PL+ES W+ ++ C+R  +WY  +KT+AE+ AW+
Sbjct  117   KNPNLRRVVLTSSSSTVRARDDIDPNVPLDESTWSSIELCERLQIWYVLSKTLAEKAAWE  176

Query  579   WAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAV  403
             + ++N  I+LV V  +F++GP L P   ST   +L ++KG   ++  + R+G+VHI+D  
Sbjct  177   FCDENK-IDLVTVLPAFLIGPSLPPVLCSTASDVLGLLKGETEKFQWHGRMGYVHIDDVA  235

Query  402   RAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCT  223
             R H+L  E ++A  R ICS  V   ++++  L  +YPS P   +   E  D   +  + +
Sbjct  236   RCHVLVYEERSACRRYICSAVVLDNNELVSFLSSRYPSLPVPRRF--EPLDRPYYEYNTS  293

Query  222   KIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             K+  LG   F ++ +MFDDC+ S  ++G L
Sbjct  294   KLKSLGF-EFKSVEEMFDDCLASLVEQGHL  322



>ref|XP_010690599.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Beta vulgaris 
subsp. vulgaris]
Length=329

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/335 (40%), Positives = 209/335 (62%), Gaps = 13/335 (4%)
 Frame = -2

Query  1122  RYMDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGA  943
             + MD++    + + CVTG +G + S+LVK LL  GY V  TVR+PG+++K+  LW L+GA
Sbjct  3     KKMDQKKDEIKGKVCVTGASGFLASWLVKRLLSSGYFVIGTVRDPGDVKKLEHLWRLEGA  62

Query  942   KERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS  763
             KERLK++K D+ME+GS ++   G +GVFHTASPV      + +  +++P+++GTLNVL S
Sbjct  63    KERLKLVKADLMEQGSFDEAVWGCEGVFHTASPV-AGTKKDPKAEILEPAIRGTLNVLES  121

Query  762   ARKM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEA  586
              +K   ++RVVLTSS S +R R D     PL+ES W+  + C+R+ +WYA +K  AE+ A
Sbjct  122   CKKNPSLRRVVLTSSSSTVRIREDIDPSIPLDESVWSSTELCERFQVWYALSKIQAEKAA  181

Query  585   WKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIED  409
             W++ ++N+ I+LV +  +FV+GP L     ST   +L + +G   ++  + R+G++HI+D
Sbjct  182   WEFCKENN-IDLVTILPAFVIGPSLPSNLCSTASDVLGLFQGQTNKFEFHGRMGYIHIDD  240

Query  408   AVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPY---LTKCSNEEGDDSEH  238
                 HIL  E + A GR +CS+TV    ++   L  +YPSYP     TK      D   +
Sbjct  241   IALCHILVYEREEAHGRYLCSSTVMEHYELASFLASRYPSYPIPRGFTKL-----DRPYY  295

Query  237   SLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             + + +KI  LG   F  + +MFDDC++S   +G L
Sbjct  296   TYNTSKIENLGF-KFKPIEEMFDDCVNSLITQGHL  329



>ref|XP_008382751.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Malus domestica]
Length=329

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/332 (42%), Positives = 211/332 (64%), Gaps = 10/332 (3%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             MD + +SK  + CVTG +G + S+L+K LL  GY V  TVR+PG  +K+  LW L+GAKE
Sbjct  1     MDRKLESKS-KVCVTGASGFLASWLIKRLLLSGYHVTGTVRDPGNEKKLAHLWXLEGAKE  59

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL+++K D+MEEGS +D   G  GVFH+ASPVL P   + +  +++P+V+GTLNVL S +
Sbjct  60    RLRLVKADLMEEGSFDDAILGCHGVFHSASPVLKP-SSDPKTEILEPAVEGTLNVLRSCK  118

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQIS--PLNESHWTDLDYCKRYNLWYAYAKTMAEQEA  586
             K   ++RVVLTSS S +R R D    S  PL+E  W+ ++ C+   +WY  +K +AE+ A
Sbjct  119   KNPXLRRVVLTSSSSAVRVRPDGDFSSNVPLDEXSWSSVELCETLQIWYPLSKILAEKAA  178

Query  585   WKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIED  409
             W + ++N GI+LV +  SFV+GP L P   ST   +L ++KG   ++  + R+G+VHI+D
Sbjct  179   WDFCKEN-GIDLVTILPSFVIGPSLPPDLCSTASDVLGLLKGETEKFKWHGRMGYVHIDD  237

Query  408   AVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLD  229
                 HIL  E ++A GR +CS+TV   +++  +L  +YPS P   +   E+     + ++
Sbjct  238   VAXCHILVYEHESAHGRYLCSSTVLDNNELASLLSARYPSLPIPARF--EQLGRPHYEMN  295

Query  228   CTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
              +K+  LG   F ++ +MFDDCI S  ++G L
Sbjct  296   TSKMESLGF-KFKSIQEMFDDCIASLVEQGHL  326



>ref|XP_008235846.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Prunus 
mume]
Length=337

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 211/332 (64%), Gaps = 11/332 (3%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             MD++ +S +   CVTG +G + S+L+K LL  GY V  TVR+PG  +K+  LW L+GA+E
Sbjct  9     MDQKLESGK--VCVTGASGFLASWLIKRLLLSGYHVTGTVRDPGNQKKLAHLWRLEGARE  66

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL+++K D+MEEGS +D   G  GVFH+ASPVL P   + +  +++P+V+GTLNVL S +
Sbjct  67    RLRLVKADLMEEGSFDDAILGCHGVFHSASPVLKPLS-DPKTEILEPAVEGTLNVLRSCK  125

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQIS--PLNESHWTDLDYCKRYNLWYAYAKTMAEQEA  586
             K   ++RVVLTSS + +R R D    S  PL+ES W+ +++CK   +WY   K +AE+ A
Sbjct  126   KNPSLRRVVLTSSSTAVRVRPDEDFDSNIPLDESSWSSVEFCKTLQIWYPLPKILAEKAA  185

Query  585   WKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIED  409
             W + ++  GI+LV V  SFV+G  L P   +T   +L ++KG   ++  + R+G+VHI+D
Sbjct  186   WDFCKEY-GIDLVTVLPSFVIGQSLPPDLCATASDVLGLLKGETEKFKWHGRMGYVHIDD  244

Query  408   AVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLD  229
                 HIL  E ++A+GR +CS+TV   +++  +L  +YPS P   +   E+     + L+
Sbjct  245   VALCHILVYEHESANGRYLCSSTVLDNNELASLLSKQYPSLPIPKRF--EQLGRPRYDLN  302

Query  228   CTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
              +K+  LG   F T+ +MFDDCI S  ++G L
Sbjct  303   TSKLKSLGF-KFKTIQEMFDDCIASLVEQGHL  333



>gb|EYU23973.1| hypothetical protein MIMGU_mgv1a009951mg [Erythranthe guttata]
Length=321

 Score =   239 bits (611),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 202/318 (64%), Gaps = 11/318 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G + S+L+K LL  GY V  TVR+PG+  KVG LW+L GAKERL+++K D+M E
Sbjct  11    CVTGAAGFVASWLIKRLLLSGYHVTGTVRDPGDNGKVGHLWKLAGAKERLRLVKADLMVE  70

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
             GS +    G  GVFHTASPVL      + K+   P++ GTLNVL S +K   +KRVVLTS
Sbjct  71    GSFDAAIMGCHGVFHTASPVL-----GLPKSDPKPAIDGTLNVLRSCKKNPSLKRVVLTS  125

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S IR R D     PL+ES W+  + C+R  +WY  +KT+AE+ AWK+ E+N  I+L+ 
Sbjct  126   SSSTIRARDDFDPHVPLDESSWSCEELCERLKIWYVLSKTLAEKAAWKFCEENK-IDLIT  184

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNA  367
             +  SFVVGP L P   ST   IL ++KG   ++  + R+G+VHI+D   +HIL  E ++A
Sbjct  185   ILPSFVVGPSLPPLLCSTASDILGLLKGETEKFQWHGRMGYVHIDDVASSHILLYENESA  244

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR ICS+ V    ++  +L  +YP+ P   +   E+ + + + LD +K+  LG+  F +
Sbjct  245   KGRYICSSRVVDNDELAAILLAQYPTLPIPKRF--EKLERAYYELDVSKLRGLGM-KFRS  301

Query  186   LSQMFDDCIHSFQQKGFL  133
             + +MFDDC+ S  ++G++
Sbjct  302   IEEMFDDCVQSLTKQGYI  319



>gb|EEC84809.1| hypothetical protein OsI_31879 [Oryza sativa Indica Group]
Length=330

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/326 (41%), Positives = 207/326 (63%), Gaps = 8/326 (2%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G + S+L+K LL+ GY V  TVR+P   EKV  LW L  AKERL++++
Sbjct  4     SSKGKVCVTGASGFVASWLIKRLLEAGYHVIGTVRDPSNREKVSHLWRLPSAKERLQLVR  63

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              D+MEEGS +D     +GVFHTASPVL   D N ++ ++ P++ GTLNVL S +K   +K
Sbjct  64    ADLMEEGSFDDAVMACEGVFHTASPVLAKSDSNCKEEMLVPAINGTLNVLKSCKKNPFLK  123

Query  741   RVVLTSSCSCIRYRHDAT--QISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQ  568
             RVVLTSS S +R R ++   +IS L+E+ W+ +  C++  LWYA AK  AE+ AW++A++
Sbjct  124   RVVLTSSSSTVRIRDESKHPEIS-LDETIWSSVALCEKLQLWYALAKISAEKAAWEFAKE  182

Query  567   NDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHI  391
             N+ I+LV V  SFV+GP L+ + + T   IL +++G    + +  R+G+VHI+D    HI
Sbjct  183   NN-IDLVTVLPSFVIGPSLSHELSVTASDILGLLQGDTDRFISYGRMGYVHIDDVASCHI  241

Query  390   LAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIME  211
             L  EA  A+GR +C++ V   ++++ +L  ++P +P      N     S + L+ +KI +
Sbjct  242   LVYEAPQATGRYLCNSVVLDNNELVALLAKQFPIFPIPRSLRNPYEKQS-YELNTSKIQQ  300

Query  210   LGLPPFATLSQMFDDCIHSFQQKGFL  133
             LG   F  + +MF DC+ S + +G L
Sbjct  301   LGF-KFKGVQEMFGDCVESLKDQGHL  325



>dbj|BAK08080.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 208/329 (63%), Gaps = 11/329 (3%)
 Frame = -2

Query  1104  AKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKI  925
             A + + + CVTG +G + S+LVK LL+ GY V  TVR+PG  +KV  LW L GAKERL++
Sbjct  2     ANTSKGKVCVTGASGFVASWLVKRLLESGYHVLGTVRDPGNQKKVAHLWNLAGAKERLEL  61

Query  924   LKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-M  748
             ++ D++EEGS +D     +GVFHTASP++   D   ++ ++D ++ GTLNVL S +K   
Sbjct  62    VRADLLEEGSFDDAVMACEGVFHTASPIITNADS--KEEMLDSAINGTLNVLRSCKKNPF  119

Query  747   VKRVVLTSSCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKW  577
             +KRVVLTSS S +R R D  +  P   L+E+ W+ +++C+   +WYA AK +AE+ AW++
Sbjct  120   LKRVVLTSSSSTVRLR-DEAEFPPNVLLDETSWSSVEFCESIQIWYAVAKILAEKSAWEF  178

Query  576   AEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVR  400
             A++N+ I+LV V  +FVVGP L+P    T   +L + KG   ++    R+G+VHI+D   
Sbjct  179   AKENN-IDLVAVLPTFVVGPNLSPVLGPTASDVLGLFKGETEKFTIFGRMGYVHIDDVAS  237

Query  399   AHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTK  220
              HIL  E  +A GR IC++ V    +++ +L  ++PS+P      N  G+ + +  + +K
Sbjct  238   CHILVYETADAKGRYICNSAVLGSDELVALLAKRFPSFPIPKSLPNIYGEQT-YGYNTSK  296

Query  219   IMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             I +LGL  F  + +MFDD + S +  G+L
Sbjct  297   IRKLGL-EFRGVEEMFDDSVKSLKAHGYL  324



>gb|EEE68992.1| hypothetical protein OsJ_27928 [Oryza sativa Japonica Group]
Length=330

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/333 (41%), Positives = 209/333 (63%), Gaps = 13/333 (4%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             M+   K K    CVTG +G + S+LVK LL+ GY V  TVR+PG  +KVG LW L GAKE
Sbjct  1     MENTTKGK---VCVTGASGYVASWLVKRLLESGYHVLGTVRDPGNHKKVGHLWNLTGAKE  57

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL++++ D++EEGS +D     +GVFHTASPV+   D + +  ++D ++ GTLNVL S +
Sbjct  58    RLELVRADLLEEGSFDDAVMACEGVFHTASPVITETDSS-KAAVLDSAINGTLNVLRSCK  116

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQE  589
             K   +KRVVLTSS S +R + D   + P   L+E+ W+ +++C+   +WYA AKT+AE+ 
Sbjct  117   KNPSLKRVVLTSSSSTVRLK-DEADLPPNVLLDETSWSSMEFCESLQIWYAIAKTLAEKA  175

Query  588   AWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIE  412
             AW++A++N GI+LV V  +FVVGP L+ + + T   +L + +G   ++    R+G+VHI+
Sbjct  176   AWEFAKEN-GIDLVAVLPTFVVGPNLSHELSPTTTDVLGLFQGETTKFTMYGRMGYVHID  234

Query  411   DAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSL  232
             D    HIL  E   A+GR IC++ V   ++++ +L  ++PSYP         G+ + +  
Sbjct  235   DVASCHILLYETPRAAGRYICNSAVLDVNELVTLLARRFPSYPIPKSLPCVYGEQT-YGF  293

Query  231   DCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
                K+ ELG+  F  + +MFDD + S +  G+L
Sbjct  294   STAKVRELGM-KFRDVEEMFDDAVDSLRAHGYL  325



>ref|XP_011024587.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Populus euphratica]
Length=329

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 197/318 (62%), Gaps = 7/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL  GY V  TVR+P   +KV  LW L+GAKERL+++K D+MEE
Sbjct  9     CVTGASGYLASWLVKRLLLSGYHVTGTVRDPENEKKVAHLWRLEGAKERLRLVKADLMEE  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA-RKMMVKRVVLTS  724
             GS +D      GVFHTASPVL P   + +  +++P++ GTLNVL S  R   +KRV+LTS
Sbjct  69    GSFDDAIMECRGVFHTASPVLKP-SSDPKAEILEPAIDGTLNVLRSCKRNPSLKRVILTS  127

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S +R R D     PL+ES W+ ++ C+R  +WYA +KT+AE+ AW++   N GI+L+ 
Sbjct  128   SSSTLRVRDDFDSNIPLDESSWSSVELCERLQIWYALSKTLAEKAAWEFCNGN-GIDLIT  186

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNA  367
             V  SFV+GP L+P   ST   +L ++ G   ++  + R+G+VHI+D    HIL  E + A
Sbjct  187   VLPSFVIGPSLSPDLCSTASDVLGLLTGESEKFQWHGRMGYVHIDDVALCHILVYEDETA  246

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR +CS+ V    ++   L  +YPS P   +   E+     +  D T++  LG   F  
Sbjct  247   GGRYLCSSIVLDNDELASFLSQRYPSLPIPKRF--EQLKRPYYEFDTTRLERLGF-KFKP  303

Query  186   LSQMFDDCIHSFQQKGFL  133
             + +MFDDCI SF ++G L
Sbjct  304   IQEMFDDCIASFVEQGHL  321



>ref|XP_006661385.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Oryza brachyantha]
Length=358

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/326 (41%), Positives = 207/326 (63%), Gaps = 8/326 (2%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G + S+L+K LL+ GY V  TVR+PG  +KV  LW L GA ERL++++
Sbjct  32    SSKGKVCVTGASGFVASWLIKRLLEAGYHVIGTVRDPGNHKKVSHLWRLPGANERLQLVR  91

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              D++EEGS +D     +G+FH ASPVL   D N ++  + P++ GTLNVL S +K   +K
Sbjct  92    ADLLEEGSFDDAVMACEGIFHIASPVLSKSDSNCKEETLIPAINGTLNVLRSCKKNPFLK  151

Query  741   RVVLTSSCSCIRYRHDA--TQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQ  568
             RVVLTSS S +R R +    QIS L+E+ W+ +  C++  LWYA AK  AE+ AW++A++
Sbjct  152   RVVLTSSSSAVRIRDEIKHAQIS-LDETVWSSVPLCEKLQLWYALAKISAEKAAWEFAKE  210

Query  567   NDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHI  391
             N+ I+LV V  SFV+GP L+ + + T   IL +++G    + +  R+G+VHI+D    HI
Sbjct  211   NN-IDLVTVLPSFVIGPSLSHELSVTAADILGLLQGDTQRFSSYGRMGYVHIDDVASCHI  269

Query  390   LAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIME  211
             L  E   A+GR +C++ V   ++++ +L  ++P +P   +  +  G  S + L+ +KI E
Sbjct  270   LVYETPQATGRYLCNSVVLDNNELVALLAKQFPVFPVPRRLRSPYGKQS-YQLNTSKIQE  328

Query  210   LGLPPFATLSQMFDDCIHSFQQKGFL  133
             LGL  F  + +MF DC+ S + +G L
Sbjct  329   LGL-KFKGVEEMFGDCVESLKNQGHL  353



>ref|XP_004973909.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Setaria 
italica]
Length=336

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/329 (41%), Positives = 205/329 (62%), Gaps = 10/329 (3%)
 Frame = -2

Query  1104  AKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKI  925
             A + + + CVTG +G I S+LVK LL+ GY V  TVR+PG  +KVG LW+L+GA+ERL++
Sbjct  2     ANTAKGKVCVTGASGFIASWLVKRLLESGYHVLGTVRDPGNHKKVGHLWDLEGARERLEL  61

Query  924   LKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-M  748
             ++ D++EEGS +D     +GVFHTASP+L   D   Q  +++ ++ GTLNVL S +K  +
Sbjct  62    VRADLLEEGSFDDAVMACEGVFHTASPILTKSDSKEQ--MLNSAINGTLNVLRSCKKNPL  119

Query  747   VKRVVLTSSCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKW  577
             +KRVVLTSS S +R + D   + P   L+E+ W+ ++YC+   +WYA AK +AE+ AW +
Sbjct  120   LKRVVLTSSSSTVRIK-DEADLPPNVLLDETSWSSIEYCESLQIWYAVAKILAEKAAWGF  178

Query  576   AEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVR  400
             A+++  I+LV V  +FV+GP L+P+   T   +L + +G  G++    R+G+VHI+D   
Sbjct  179   AKEHK-IDLVTVLPTFVIGPSLSPELGPTASDVLGLFQGETGKFTVYGRMGYVHIDDVAS  237

Query  399   AHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTK  220
              HILA EA  A GR IC+  V     +  +L  ++PSYP      N  G+ S +  D +K
Sbjct  238   CHILAYEAAGAQGRYICNAVVLDCGDLAALLARRFPSYPIPKSLPNIYGEQS-YDYDTSK  296

Query  219   IMELGLPPFATLSQMFDDCIHSFQQKGFL  133
                LG+  +  + +MFDD + S    G L
Sbjct  297   ARALGMRGYKGVEEMFDDAVESLVGHGHL  325



>ref|XP_002960169.1| hypothetical protein SELMODRAFT_74610 [Selaginella moellendorffii]
 gb|EFJ37708.1| hypothetical protein SELMODRAFT_74610 [Selaginella moellendorffii]
Length=338

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 145/336 (43%), Positives = 206/336 (61%), Gaps = 13/336 (4%)
 Frame = -2

Query  1116  MDEQAKSKRPEY-CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAK  940
             M E A+S   E  CVTG  G + S LVK LL++GY VR TVR+ G  +KV  L  L GA 
Sbjct  1     MGEAAQSSPGELVCVTGANGFLASCLVKCLLERGYYVRATVRDLGNADKVSHLLRLPGAS  60

Query  939   ERLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-  763
             ERL++ + D++ EGS +D   G   VFHTASPV           +I P+V GTLNVL S 
Sbjct  61    ERLELREADLLTEGSFDDVVRGCRRVFHTASPVTAFTVDPEVLEMIAPAVNGTLNVLKSC  120

Query  762   ARKMMVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAW  583
             A+   V+RVVLTSS S IR+  +    S L+++ W+  D+C++Y +WY  AKT+AE++AW
Sbjct  121   AKSPSVRRVVLTSSTSAIRFMPEMPSNSVLDDTSWSSEDFCRKYKMWYYLAKTVAERKAW  180

Query  582   KWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGE------YPNKRVGFV  421
             ++AE+N+ ++LV V  SFVVGP+L    +ST   +L ++KG + +      YP  R+G+V
Sbjct  181   EFAEKNN-LDLVTVLPSFVVGPVLPKNLSSTALDVLGLLKGTVCDVKKFSIYP--RMGYV  237

Query  420   HIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSE  241
             H+ED   AHIL MEA  A GR ICS+TV    ++  +L  +YP +   TK   E      
Sbjct  238   HVEDVALAHILVMEAPGARGRYICSSTVMDNDKLGELLAMRYPQFNVPTKFP-ESYKSKY  296

Query  240   HSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             ++LD +K+ +LGL  F ++  MFDDC+ +F  +G  
Sbjct  297   YTLDTSKLEKLGL-KFRSVEDMFDDCLENFYHRGLF  331



>dbj|BAC78578.1| dihydroflavonol reductase [Oryza sativa Japonica Group]
 gb|EEE69972.1| hypothetical protein OsJ_29865 [Oryza sativa Japonica Group]
Length=330

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 133/326 (41%), Positives = 207/326 (63%), Gaps = 8/326 (2%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G + S+L+K LL+ GY V  TVR+P   +KV  LW L  AKERL++++
Sbjct  4     SSKGKVCVTGASGFVASWLIKRLLEAGYHVIGTVRDPSNRDKVSHLWRLPSAKERLQLVR  63

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              D+MEEGS +D     +GVFHTASPVL   D N ++ ++ P++ GTLNVL S +K   +K
Sbjct  64    ADLMEEGSFDDAVMACEGVFHTASPVLAKSDSNCKEEMLVPAINGTLNVLKSCKKNPFLK  123

Query  741   RVVLTSSCSCIRYRHDAT--QISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQ  568
             RVVLTSS S +R R ++   +IS L+E+ W+ +  C++  LWYA AK  AE+ AW++A++
Sbjct  124   RVVLTSSSSTVRIRDESKHPEIS-LDETIWSSVALCEKLQLWYALAKISAEKAAWEFAKE  182

Query  567   NDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHI  391
             N+ I+LV V  SFV+GP L+ + + T   IL +++G    + +  R+G+VHI+D    HI
Sbjct  183   NN-IDLVTVLPSFVIGPSLSHELSVTASDILGLLQGDTDRFISYGRMGYVHIDDVASCHI  241

Query  390   LAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIME  211
             L  EA  A+GR +C++ V   ++++ +L  ++P +P      N     S + L+ +KI +
Sbjct  242   LVYEAPQATGRYLCNSVVLDNNELVALLAKQFPIFPIPRSLRNPYEKQS-YELNTSKIQQ  300

Query  210   LGLPPFATLSQMFDDCIHSFQQKGFL  133
             LG   F  + +MF DC+ S + +G L
Sbjct  301   LGF-KFKGVQEMFGDCVESLKDQGHL  325



>emb|CDY42108.1| BnaA09g28520D [Brassica napus]
Length=235

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 167/233 (72%), Gaps = 3/233 (1%)
 Frame = -2

Query  825  HNIQKTLIDPSVKGTLNVLTSARKM--MVKRVVLTSSCSCIRYRHDATQISPLNESHWTD  652
            ++  + L D  + GT N++ S  K    VKR+VLTSS + +RY +DAT+ SPL  SHW+D
Sbjct  4    YSFLEKLADRDIYGTRNLMNSCEKSRNTVKRIVLTSSSTSVRYSYDATKASPLKGSHWSD  63

Query  651  LDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLA  472
            L+Y + +++WY YAKT+ E+EAW  A + + + LVVV  SF +GP+L+P+PTS+  + L+
Sbjct  64   LEYFRSFSIWYGYAKTLVEKEAWLIAAEKN-LNLVVVIPSFCIGPILSPKPTSSPSIFLS  122

Query  471  IVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYP  292
            I+KG+ GEYPN R GFVHI+D   A ILAM+   ASGR+ICS++VAH+S+II ML+PKYP
Sbjct  123  IIKGVHGEYPNFRGGFVHIDDVAAAQILAMKEPKASGRIICSSSVAHWSEIIEMLKPKYP  182

Query  291  SYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             YP+ TKC +EEG D  HSLD  KI ELG   F +L +MFDDCI  F+ KG L
Sbjct  183  LYPFETKCGSEEGRDMPHSLDTRKIHELGFRSFKSLPEMFDDCIKCFKDKGLL  235



>ref|XP_007200400.1| hypothetical protein PRUPE_ppa008548mg [Prunus persica]
 gb|EMJ01599.1| hypothetical protein PRUPE_ppa008548mg [Prunus persica]
Length=327

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 138/332 (42%), Positives = 209/332 (63%), Gaps = 11/332 (3%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             MD++ +S +   CVTG +G + S+L+K LL  GY V  TVR+PG  +K+  LW L+GA+E
Sbjct  1     MDQKLESGK--VCVTGASGFLASWLIKRLLLSGYHVTGTVRDPGNQKKLAHLWRLEGARE  58

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL+++K D+MEEGS +D   G  GVFH+ASPVL P   + +  +++P+V+GTLNVL S +
Sbjct  59    RLRLVKADLMEEGSFDDAILGCHGVFHSASPVLKP-SSDPKTEILEPAVEGTLNVLRSCK  117

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQIS--PLNESHWTDLDYCKRYNLWYAYAKTMAEQEA  586
             K   ++RVVLTSS S +R R D    S  PL+ES W+ +  C+   +WY  +K +AE+ A
Sbjct  118   KNPSLRRVVLTSSSSAVRVRPDEDFDSNIPLDESSWSSVKICETLQIWYPLSKILAEKAA  177

Query  585   WKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIED  409
             W + ++N GI+LV V  SFV+GP L     ST   +L ++KG   ++  + R+G+VHI+D
Sbjct  178   WDFCKEN-GIDLVTVLPSFVIGPCLPSDLCSTASDVLGLLKGETEKFKWHGRMGYVHIDD  236

Query  408   AVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLD  229
                 HI   E ++A GR +CS+TV   +++  +L  +YPS P   +   E+     + L+
Sbjct  237   VALCHISVYEHESAHGRYLCSSTVLDNNELASLLSRQYPSLPIPKRF--EQLGRPRYDLN  294

Query  228   CTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
              +K+  LG   F T+ +MFDDCI S  ++G L
Sbjct  295   TSKLKSLGF-KFKTIQEMFDDCIASLVEQGHL  325



>ref|XP_001772000.1| predicted protein [Physcomitrella patens]
 gb|EDQ63261.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 139/333 (42%), Positives = 200/333 (60%), Gaps = 8/333 (2%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             M    +  +   CVTG TG + S+L+K LL  GY VR  VR+P   EK   LW L GAKE
Sbjct  1     MGHSTEKSKGTVCVTGATGFVASWLIKCLLQDGYRVRGAVRDPENYEKAAHLWALSGAKE  60

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-A  760
             RL+++KGD++ EGS +    G +GVFHTA+  LV    + +  ++DP++ GTLNVL S A
Sbjct  61    RLQLVKGDLLVEGSYDAAVAGCEGVFHTAA-ALVRIKSDPKAEMLDPTILGTLNVLHSCA  119

Query  759   RKMMVKRVVLTSSCSCIRYRHDATQ---ISPLNESHWTDLDYCKRYNLWYAYAKTMAEQE  589
             +   +KRVVLTSS + +R+R D  Q   ++ L+E  W+ + +C +Y +WY+ AK ++EQE
Sbjct  120   KSTTLKRVVLTSSTAAVRFRDDLEQPGAVTYLDEYSWSSIFFCTKYQIWYSLAKILSEQE  179

Query  588   AWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIE  412
             AWK+A  +  I+LVVV  SFV+GP L    + T Q I  ++ GL   +  + R+G+VH++
Sbjct  180   AWKFAFLH-SIDLVVVLPSFVIGPCLPYPLSKTAQDICDLLNGLCRNFGIHGRMGYVHVD  238

Query  411   DAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSL  232
             D  RAHIL  E  +A GR ICS   A   +++  L  +YP     TK ++E      + L
Sbjct  239   DVARAHILVYETPSAQGRYICSAQEATPQELVQYLADRYPHLQISTKFNDELPKMPYYKL  298

Query  231   DCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             + TK+  LGL     L  MFDDCI   ++KG L
Sbjct  299   NTTKLQRLGL-NCKPLDVMFDDCISFLEEKGLL  330



>ref|XP_011080359.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=323

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 209/320 (65%), Gaps = 11/320 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+  VR+  + +K   L  L GAKERL+++K ++++E
Sbjct  5     CVTGASGYIASWLVKFLLQRGYTVKACVRDLNDPKKTEHLLALDGAKERLQLIKANLLDE  64

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLTS  724
             GS +   DG DGVFHTASP   P D N Q  LIDP++KGTLNVL S A+   VKRVVLT+
Sbjct  65    GSFDAAVDGCDGVFHTASPFHDPGD-NPQAELIDPALKGTLNVLGSCAKSPSVKRVVLTA  123

Query  723   SCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             S   + Y ++ T +SP   ++E+ W+DLD+C+R   WY+ +KT+AEQ AWK+A++  GI+
Sbjct  124   SVGSV-YVNERT-LSPEVVIDETWWSDLDFCRRTQQWYSLSKTLAEQAAWKFAKEK-GID  180

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             L+V+N S V+GP+L P   ++  +IL+++ G    Y N+  G V+++D   AHILA E  
Sbjct  181   LIVINPSLVIGPILQPTLNTSSAVILSMLNG-AETYLNRTYGVVNVKDVANAHILAFENP  239

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
             +A+GR I + +VAHFS+++ +LR  YP+ P   KC +++     H L   K   +G+  F
Sbjct  240   SANGRYILAESVAHFSRLVEILRELYPTLPIPEKCEDDKFAPM-HQLSREKAESIGV-EF  297

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              +L +   + + S  +K FL
Sbjct  298   ISLRESLKETVESLIEKKFL  317



>gb|AAD24584.3|AF134807_1 putative dihydroflavonol reductase [Oryza sativa]
Length=330

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/326 (41%), Positives = 206/326 (63%), Gaps = 8/326 (2%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G + S+L+K LL+ GY V  TVR+P   EKV  LW L  AKERL++++
Sbjct  4     SSKGKVCVTGASGFVASWLIKRLLEAGYHVIGTVRDPSNREKVSHLWRLPSAKERLQLVR  63

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              D+MEEGS +D     +GVFHTASPVL   D N ++ ++ P++ GTLNVL S +K   +K
Sbjct  64    ADLMEEGSFDDAVMACEGVFHTASPVLAKSDSNCKEEMLVPAINGTLNVLKSCKKNPFLK  123

Query  741   RVVLTSSCSCIRYRHDAT--QISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQ  568
             RVVLTSS S +R   ++   +IS L+E+ W+ +  C++  LWYA AK  AE+ AW++A++
Sbjct  124   RVVLTSSSSTVRIMDESKHPEIS-LDETIWSSVALCEKLQLWYALAKISAEKAAWEFAKE  182

Query  567   NDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHI  391
             N+ I+LV V  SFV+GP L+ + + T   IL +++G    + +  R+G+VHI+D    HI
Sbjct  183   NN-IDLVTVLPSFVIGPSLSHELSVTASDILGLLQGDTDRFISYGRMGYVHIDDVASCHI  241

Query  390   LAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIME  211
             L  EA  A+GR +C++ V   ++++ +L  ++P +P      N     S + L+ +KI +
Sbjct  242   LVYEAPQATGRYLCNSVVLDNNELVALLAKQFPIFPIPRSLRNPYEKQS-YELNTSKIQQ  300

Query  210   LGLPPFATLSQMFDDCIHSFQQKGFL  133
             LG   F  + +MF DC+ S + +G L
Sbjct  301   LGF-KFKGVQEMFGDCVESLKDQGHL  325



>ref|NP_001063545.1| Os09g0493500 [Oryza sativa Japonica Group]
 dbj|BAF25459.1| Os09g0493500 [Oryza sativa Japonica Group]
Length=366

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/326 (41%), Positives = 207/326 (63%), Gaps = 8/326 (2%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G + S+L+K LL+ GY V  TVR+P   +KV  LW L  AKERL++++
Sbjct  40    SSKGKVCVTGASGFVASWLIKRLLEAGYHVIGTVRDPSNRDKVSHLWRLPSAKERLQLVR  99

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              D+MEEGS +D     +GVFHTASPVL   D N ++ ++ P++ GTLNVL S +K   +K
Sbjct  100   ADLMEEGSFDDAVMACEGVFHTASPVLAKSDSNCKEEMLVPAINGTLNVLKSCKKNPFLK  159

Query  741   RVVLTSSCSCIRYRHDAT--QISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQ  568
             RVVLTSS S +R R ++   +IS L+E+ W+ +  C++  LWYA AK  AE+ AW++A++
Sbjct  160   RVVLTSSSSTVRIRDESKHPEIS-LDETIWSSVALCEKLQLWYALAKISAEKAAWEFAKE  218

Query  567   NDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHI  391
             N+ I+LV V  SFV+GP L+ + + T   IL +++G    + +  R+G+VHI+D    HI
Sbjct  219   NN-IDLVTVLPSFVIGPSLSHELSVTASDILGLLQGDTDRFISYGRMGYVHIDDVASCHI  277

Query  390   LAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIME  211
             L  EA  A+GR +C++ V   ++++ +L  ++P +P      N     S + L+ +KI +
Sbjct  278   LVYEAPQATGRYLCNSVVLDNNELVALLAKQFPIFPIPRSLRNPYEKQS-YELNTSKIQQ  336

Query  210   LGLPPFATLSQMFDDCIHSFQQKGFL  133
             LG   F  + +MF DC+ S + +G L
Sbjct  337   LGF-KFKGVQEMFGDCVESLKDQGHL  361



>ref|XP_008651870.1| PREDICTED: dihydroflavanoid reductase-like1 isoform X2 [Zea mays]
Length=325

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/326 (41%), Positives = 201/326 (62%), Gaps = 13/326 (4%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G + S+L+K LL+ GY V  TVR+P  L      W+L GAKERL+I++
Sbjct  4     SSKGKVCVTGASGFVASWLIKRLLESGYHVVGTVRDPAHL------WKLPGAKERLQIVR  57

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              D++EEGS +      +GVFHTASPVL   D   ++  + P+V GTLNVL S +K   +K
Sbjct  58    ADLLEEGSFDSAVMACEGVFHTASPVLAKPDSTSKEETLVPAVNGTLNVLRSCKKNPFLK  117

Query  741   RVVLTSSCSCIRYRHDATQIS--PLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQ  568
             RVVLTSS S +R R D    S   L+E+ W+ +  C++ +LWYA AK  AE+ AW++A++
Sbjct  118   RVVLTSSSSAVRIRDDGQSSSNISLDETAWSSVPLCEKMHLWYALAKVFAEKAAWEFAKE  177

Query  567   NDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHI  391
             N GI+LV V  SFV+GP L+ +   T   +L + +G    + +  R+G+VHI+D   +HI
Sbjct  178   N-GIDLVTVLPSFVIGPSLSHELCVTASDVLGLFQGDTARFSSYGRMGYVHIDDVASSHI  236

Query  390   LAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIME  211
             L  EA  A+GR +CS+ V    +++  L  +YP +P   + ++  G  S + L+ +K+  
Sbjct  237   LVYEAPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNSPYGKQS-YQLNTSKLQG  295

Query  210   LGLPPFATLSQMFDDCIHSFQQKGFL  133
             LG   F  + +MFDDC+ S + +G L
Sbjct  296   LGF-KFRGVQEMFDDCVQSLKDQGHL  320



>ref|XP_011088719.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Sesamum indicum]
Length=335

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 199/320 (62%), Gaps = 6/320 (2%)
 Frame = -2

Query  1086  EYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVM  907
             + CVTG  G + S+LVK LL  GY V  TVR+P + +KVG L  L+GA+ERL++++ ++M
Sbjct  9     KVCVTGAAGFVASWLVKRLLLSGYHVVGTVRDPDDEKKVGHLKRLEGARERLELVRAELM  68

Query  906   EEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARK-MMVKRVVL  730
               GS +    G DGVFHTASPV+     + +  ++ P++ GTLNVL S +K   ++RVVL
Sbjct  69    VPGSFDAPITGCDGVFHTASPVIGLPKSDPKAEILQPAIDGTLNVLRSCKKNPSLRRVVL  128

Query  729   TSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             TSS S +R R D     PLNES W+  + C + NLWYA +KT+AE+ AWK+ E N  I+L
Sbjct  129   TSSSSTVRARDDFDSALPLNESSWSSEELCHKLNLWYALSKTLAERAAWKFCEDNK-IDL  187

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQ  373
             V +  SFV+GP L P   ST   +L  ++G   ++  + R+G+VHI+D   +HIL  E +
Sbjct  188   VTLLPSFVIGPSLPPLLCSTASDVLGFLRGETEKFQWHGRMGYVHIDDVALSHILLYENE  247

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
             NA GR +CS+TV    Q+  +L  +YP+ P   +    + D   + LD +K+  LG+  F
Sbjct  248   NAKGRYLCSSTVLDNHQLAAILSARYPTLPIPKRFV--KLDRPHYELDTSKLKGLGM-QF  304

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              ++ +MFDDC+ S   +G L
Sbjct  305   RSIQEMFDDCVESLTAQGHL  324



>ref|XP_002283345.2| PREDICTED: tetraketide alpha-pyrone reductase 1 [Vitis vinifera]
 emb|CBI37707.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 197/318 (62%), Gaps = 7/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL  GY V  TVR+PG  +K+  LW L+GA+ERL +++ D+MEE
Sbjct  8     CVTGASGFLASWLVKRLLLSGYHVTGTVRDPGNDKKLAHLWRLEGARERLTLVRADLMEE  67

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
             GS +    G  GVFHTASPV+        + L+ P+V+GTLNVL S +K   ++RVVLTS
Sbjct  68    GSFDKAIMGCHGVFHTASPVMGSAADPKAEILV-PAVEGTLNVLRSCKKNPSLRRVVLTS  126

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S  R R D     PL+ES W+ ++ C+   +WYA +K +AE+ AW++ ++N GI+LV 
Sbjct  127   SSSAARVRDDFDPKIPLDESSWSSVELCESLQIWYALSKVLAEKAAWEFCKEN-GIDLVT  185

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNA  367
             V  SFV+GP L P   ST   +L ++KG   ++  N R+G+VHI+D    HIL  E +NA
Sbjct  186   VLPSFVIGPSLPPDLCSTASDVLGLLKGETEKFKWNGRMGYVHIDDVALCHILVYEHENA  245

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR +C++ V   + +  +L  +YPS P   +   +  D   +  + +K+  LG   F +
Sbjct  246   HGRYLCNSAVVDNNVLASLLSARYPSLPVPKRF--DALDRPYYEFNTSKLQSLGF-KFKS  302

Query  186   LSQMFDDCIHSFQQKGFL  133
             + +MFDDC+ S  +KG L
Sbjct  303   IQEMFDDCVASLVEKGHL  320



>ref|XP_004509912.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Cicer arietinum]
 ref|XP_004509913.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Cicer arietinum]
Length=324

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 137/321 (43%), Positives = 203/321 (63%), Gaps = 13/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+VR T+R+P   +KV  L +L GAKERL++ K D++EE
Sbjct  10    CVTGASGFIASWIVKFLLQRGYTVRGTLRDPSNPKKVDHLLKLDGAKERLQLFKADLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPV-LVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLT  727
             GS +   +G DGVFHTASPV  V  D  ++  LIDP++KGTLNVL S AR   VKRV+LT
Sbjct  70    GSFDSAIEGCDGVFHTASPVRFVVNDPQVE--LIDPALKGTLNVLKSCARSPSVKRVILT  127

Query  726   SSCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             SS S +++   +  I+P   ++E+ ++D D+C+   LWY  +KT+AE  AWK+  +N+ I
Sbjct  128   SSVSAVKF--SSRPITPEVVVDETWFSDPDFCRESELWYTLSKTLAEAAAWKFVNENN-I  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++VV+N S VVGPLL P+   +++ IL ++ G+   +PN   G++ ++D   AHILA E 
Sbjct  185   DMVVINPSMVVGPLLQPEINESVEPILNLINGV--PFPNNAFGWLDVKDVADAHILAYEI  242

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +A+GR   +  V H+S+I  +LR  YP+     KC N+E     + L   K   LG+  
Sbjct  243   ASANGRYCLAERVVHYSEIARILRDLYPTIQISDKCVNDEPYVPPYQLSKEKANSLGV-K  301

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + SF++K  L
Sbjct  302   FTPLEVSLKETVESFREKNIL  322



>ref|XP_008235844.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Prunus 
mume]
Length=335

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 209/332 (63%), Gaps = 11/332 (3%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             MD++ +S +   CVTG +G + S+L+K LL  G  V  TVR+PG  +K+  LW L+GAKE
Sbjct  9     MDQKLESGK--VCVTGASGFLASWLIKRLLLSGNHVTGTVRDPGNQKKLAHLWRLEGAKE  66

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL+++K D+MEEGS +D   G  GVFH+ASPVL P   + +  +++P+V+GTLNVL S +
Sbjct  67    RLRLVKADLMEEGSFDDAILGCHGVFHSASPVLKP-SSDPKTEILEPAVEGTLNVLRSCK  125

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQIS--PLNESHWTDLDYCKRYNLWYAYAKTMAEQEA  586
             K   ++RVVLTSS + +R R D    S  PL+ES W+ ++ C+   +WY  +K +AE+ A
Sbjct  126   KNPSLRRVVLTSSSTAVRVRPDEDFDSNIPLDESSWSSVELCETLQIWYPLSKILAEKAA  185

Query  585   WKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIED  409
             W + ++  GI+LV V  SFV+GP L P   ST   +L ++KG   ++  + R+G+VHI+D
Sbjct  186   WDFCKEY-GIDLVTVLPSFVIGPCLPPDLCSTASDVLGLLKGETEKFKWHGRMGYVHIDD  244

Query  408   AVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLD  229
                 HI   E ++A GR +CS+TV   +++  +L  +YPS P   +   E+     + L+
Sbjct  245   VALCHISVYEHESAHGRYLCSSTVLDNNELASLLSKQYPSLPIPKRF--EQLGRPRYDLN  302

Query  228   CTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
              +K+  LG   F T+ +MFDDCI S  ++G L
Sbjct  303   TSKLKSLGF-KFKTIQEMFDDCIASLVEQGHL  333



>ref|XP_004486774.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Cicer arietinum]
Length=333

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/318 (41%), Positives = 200/318 (63%), Gaps = 6/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+L+K LL  GY V  TVR+ G+ +KV  LW+L+GAKERLK+++ D+ME+
Sbjct  11    CVTGASGFLASWLIKRLLLSGYHVIGTVRDLGKHKKVEHLWKLEGAKERLKLVQADLMEQ  70

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
              S ++   G  GVFH ASPVL    ++ +  +++P+V+GTLNVL S RK   + RVVL S
Sbjct  71    NSFDNAILGCKGVFHIASPVLNHKSNDPKSEILEPAVQGTLNVLRSCRKNPALVRVVLAS  130

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S +R R+D     PL+ES W+ L+ C+    WY  +K +AE+ AW++ ++N GI+LV 
Sbjct  131   SSSAVRVRNDFDPNIPLDESSWSSLELCENLQAWYPMSKILAEKAAWEYCKEN-GIDLVT  189

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNA  367
             +  SF++GP L P   ST   +L ++KG    +  + R+G+VHI+D    HIL  E + +
Sbjct  190   ILPSFIIGPSLPPDLCSTASDVLGLLKGETERFQWHGRMGYVHIDDVALCHILLYEDKAS  249

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR +CS+T+     ++ ML  +YP+ P   +   ++ D   + LD  K+  LG   F +
Sbjct  250   HGRYLCSSTIMENDDLVAMLATRYPALPIPKRF--QKLDRPHYELDTEKLRSLGF-KFKS  306

Query  186   LSQMFDDCIHSFQQKGFL  133
             + +MF+DCI SF ++G L
Sbjct  307   VEEMFEDCIASFVEQGHL  324



>gb|EPS73655.1| hypothetical protein M569_01100 [Genlisea aurea]
Length=359

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/297 (43%), Positives = 185/297 (62%), Gaps = 5/297 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G + S+L+K LL  GY V  TVR+PG+ EKV  LW L+GAKERL+++  D+  E
Sbjct  7     CVTGAAGFVASWLIKRLLSAGYHVVGTVRDPGDAEKVAHLWRLEGAKERLRLVAADLTAE  66

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDH-NIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLT  727
             GS +D   G  GVFHTASPV+   D  + +  ++ P+V GTLNVL S +K   ++RVVLT
Sbjct  67    GSFDDAIAGCRGVFHTASPVVGVEDGCDPESRILRPAVDGTLNVLRSCKKNEALRRVVLT  126

Query  726   SSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             SS S +R R+D     PL+ES W+  D C+R  +WYA +KT+AE+ AW++ ++N+ I+LV
Sbjct  127   SSSSAVRARNDFDPAIPLDESSWSSEDLCRRLKIWYALSKTLAEKAAWRFCDENN-IDLV  185

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQN  370
              V  SF++GP L    +ST   +L ++KG    +  + R+G+VHI+D   AHI+  E  N
Sbjct  186   TVLASFIIGPSLPSHLSSTSSDVLGLLKGETQRFQMHGRMGYVHIDDVALAHIMVYEKDN  245

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDD-SEHSLDCTKIMELGL  202
             A GR ICS+ V    ++  +L  +YP+ P   +     G   S +  D +K+  LG+
Sbjct  246   AEGRYICSSAVLENDELAAILSHRYPTLPIPRRFEKAAGHRASGYEFDTSKLKRLGM  302



>gb|KDP22108.1| hypothetical protein JCGZ_25939 [Jatropha curcas]
Length=409

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 133/321 (41%), Positives = 203/321 (63%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ +VRNP + +KV  L  L+GA+ERL++ K +++EE
Sbjct  94    CVTGASGYIASWLVKFLLLRGYTVKASVRNPDDPKKVEHLTALEGAQERLQLFKANLLEE  153

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             GS +   +G +GVFHTASP      H++   Q  LIDP+VKGTLNVL S AR   VKRVV
Sbjct  154   GSFDAAIEGCEGVFHTASPFF----HDVTDPQTELIDPAVKGTLNVLNSCARTPSVKRVV  209

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ ++D ++CK   LWY  +KT+AE  AWK+A++ D I
Sbjct  210   LTSSIAAVNYNGKPRTPEVVVDETWFSDPEFCKENKLWYVVSKTLAEDAAWKFAKEKD-I  268

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG +  +PN   G+V+++D   AHI A E 
Sbjct  269   DLVAINPAMVIGPLLQPTLNTSAAAVLSLMKG-VQTFPNATFGWVNVKDVANAHIQAFEI  327

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR     TVAH+S+++  LR  YP + +  KC++++     + +   K   LG+  
Sbjct  328   PSASGRYCLVETVAHYSKVVDTLRELYPDFQFPEKCADDKPYVPTYEVSKEKAKRLGI-D  386

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S ++KGF+
Sbjct  387   FIPLKVSIKETVESLKEKGFI  407



>gb|AGS57528.1| cinnamyl alcohol dehydrogenase 1 [Plagiochasma appendiculatum]
Length=326

 Score =   229 bits (585),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 198/320 (62%), Gaps = 8/320 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
              VTG  G I S++VK LL++GY+VR TVRNP +  K+G L EL GAKERL + K D++ E
Sbjct  10    VVTGANGFIASWIVKLLLERGYTVRGTVRNPDDKAKLGHLLELSGAKERLILYKADLLSE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVVLTS  724
             G+ ++   GVDG+FHTASP       + ++ LI P+VKGTLNVL SA     VKRVVLTS
Sbjct  70    GAYDEVVQGVDGIFHTASPFFFKGITDPEEQLISPAVKGTLNVLESAATAKSVKRVVLTS  129

Query  723   SCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             S + + Y ++  +  P   ++ES WTDLD+CK    WY  +KT+AE+ AW +  ++   +
Sbjct  130   STASVVYNYN--KKGPDVVVDESWWTDLDFCKEIKFWYHLSKTIAEKSAWDFV-KDKHFD  186

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LVV+N + VVGP+L+    ++ ++IL ++ G + EY N  +G+V+++D   AH+LA E  
Sbjct  187   LVVLNPAMVVGPMLSYTLNTSSEIILDLLSGAMKEYHNAAMGYVNVKDTALAHVLAYETP  246

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
             +A GR I S  V H   ++ +L+ K P YP  +K +       ++ L   K  +LG+  F
Sbjct  247   SAEGRYILSDKVLHSEDVVEILKEKAPGYPIPSKMAGTGPKAPKYVLSTEKAQKLGI-QF  305

Query  192   ATLSQMFDDCIHSFQQKGFL  133
              ++     + I S ++KG+L
Sbjct  306   TSVEDSIAESIVSLKEKGYL  325



>ref|XP_002444755.1| hypothetical protein SORBIDRAFT_07g027340 [Sorghum bicolor]
 gb|EES14250.1| hypothetical protein SORBIDRAFT_07g027340 [Sorghum bicolor]
Length=335

 Score =   230 bits (586),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 129/329 (39%), Positives = 207/329 (63%), Gaps = 10/329 (3%)
 Frame = -2

Query  1104  AKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKI  925
             A + + + CVTG +G I S+L+K LL+ GY V  TVR+PG  +KVG LW L+GAKERL++
Sbjct  2     ASTGKGKVCVTGASGFIASWLIKRLLESGYHVLGTVRDPGNHKKVGHLWVLEGAKERLQL  61

Query  924   LKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-M  748
             ++ D++EEGS +D     +GVFHTASPV+   D   ++ +++ ++ GTLNVL S +K   
Sbjct  62    VRADLLEEGSFDDAVMACEGVFHTASPVITKSDS--KEEMLNSAINGTLNVLRSCKKNPS  119

Query  747   VKRVVLTSSCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKW  577
             ++RVVLTSS + +R + D   + P   L+E+ W+ ++YC+   +WYA AK +AE+ AW++
Sbjct  120   LRRVVLTSSSATVRIK-DEADLPPNVLLDETSWSSIEYCESLQIWYAVAKILAEKAAWEF  178

Query  576   AEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVR  400
             A+++  I+LV V  +FV+GP L+P+ + T   +L + +G   ++    R+G+VHI+D  R
Sbjct  179   AKEHR-IDLVTVLPTFVIGPNLSPELSPTASDVLGLFQGETVKFTVYGRMGYVHIDDVAR  237

Query  399   AHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTK  220
              HILA E+  A GR IC+  V     ++ +L  ++P+YP      +  G+ + +  D +K
Sbjct  238   CHILAYESAGAHGRYICNAAVLCCGDLVALLARRFPAYPIPRSLPSVYGEQT-YGFDTSK  296

Query  219   IMELGLPPFATLSQMFDDCIHSFQQKGFL  133
                LGL     + +MFDD + S +  G L
Sbjct  297   ARALGLVDLKGVEEMFDDAVDSLRGHGHL  325



>gb|KHG03033.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Gossypium arboreum]
Length=327

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 199/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S LVK LL +GY+V+ +VR+P +  K   L  L+GA+ERLK+ K +++EE
Sbjct  10    CVTGASGYIASCLVKHLLLRGYTVKASVRDPSDPRKTQHLLALEGAEERLKLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             GS + G +G DGVFHTAS    P+ H++   Q  L+DP+VKGTLNVL S A    VKRVV
Sbjct  70    GSFDSGVEGCDGVFHTAS----PFYHDVTDPQAELLDPAVKGTLNVLNSCANTPSVKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++ES +TD +YCK   LWY  +KT+AE  AWK+A++  G+
Sbjct  126   LTSSIAAVTYNGKPRTPDVVVDESWFTDPEYCKNLKLWYVVSKTIAEDSAWKFAKEK-GL  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++VVVN + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  185   DMVVVNPAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEI  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR      VAH S+++ ML   YPS+    KC++++     + +   K   LG+  
Sbjct  244   PSASGRYCLVERVAHCSEVVKMLSELYPSFQLPEKCADDKPYVPTYQVSKEKAKTLGI-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S ++KGF+
Sbjct  303   FTPLDVSLKETVESLKEKGFV  323



>ref|XP_006365621.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum tuberosum]
Length=328

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 194/318 (61%), Gaps = 6/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ +VR+P + +K   L  L GAKERL + K +++EE
Sbjct  9     CVTGASGYIASWLVKFLLHRGYTVKASVRDPNDPKKTQHLLSLGGAKERLHLFKANLLEE  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLTS  724
             GS +   DG +GVFHTASP       + Q  L+DP+VKGTLN+L S A+   VKRVVLTS
Sbjct  69    GSFDAVVDGCEGVFHTASPFYYSVT-DPQAELLDPAVKGTLNLLGSCAKAPSVKRVVLTS  127

Query  723   SCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             S + + Y     T    ++ES WT  DYCK   LWY  +KT+AE  AWK+ ++  GI++V
Sbjct  128   SIAAVAYSGQPRTPEVVVDESWWTSPDYCKEKQLWYVLSKTLAEDAAWKFVKEK-GIDMV  186

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNA  367
             VVN + V+GPLL P   ++   +L++V G    YPN   G+V+++D   AHILA E  +A
Sbjct  187   VVNPAMVIGPLLQPTLNTSSAAVLSLVNG-AETYPNSSFGWVNVKDVANAHILAFENPSA  245

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
             +GR +    VAH+S I+ +LR  YP+     KC+++      + +   K   LG+  F T
Sbjct  246   NGRYLMVERVAHYSDILKILRDLYPTMQLPEKCADDNPLMQNYQVSREKAKSLGV-EFTT  304

Query  186   LSQMFDDCIHSFQQKGFL  133
             L +   + + S ++K F 
Sbjct  305   LEESIKETVESLKEKKFF  322



>ref|XP_003597698.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AES67949.1| dihydroflavonol reductase [Medicago truncatula]
Length=330

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/318 (40%), Positives = 196/318 (62%), Gaps = 6/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+L+K LL  GY V  TVR+ G+ +KV  LW+L+GA ERLK+++ D+MEE
Sbjct  6     CVTGASGFLASWLIKRLLLSGYHVIGTVRDLGKKQKVEHLWKLEGATERLKLVQADLMEE  65

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
              S ++   G  GVFH ASPVL    ++ +  +++P+V+GTLNVL S RK   + RVVL S
Sbjct  66    NSFDNAIMGCKGVFHIASPVLNHISNDPKAEILEPAVQGTLNVLRSCRKNPALVRVVLAS  125

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S +R R D     P++ES W+ L+ C++   WY  +KT+AE+ AW + ++N GI+LV 
Sbjct  126   SSSAVRVRADFDPNIPIDESSWSSLELCEKLQAWYPMSKTLAEKAAWDYCKEN-GIDLVT  184

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNA  367
             +  SF++GP L     ST   +L + KG   ++  + R+G+VHI+D    HIL  E + +
Sbjct  185   ILPSFIIGPNLPTDLCSTASDVLGLFKGETEKFQWHGRMGYVHIDDVALCHILLYENKAS  244

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR +CS+ +     ++ ML  +YP +P   +   ++ D   + L+  K+  LG   F +
Sbjct  245   DGRYLCSSKIMDNDDLVGMLANRYPGFPIPKRF--KKLDRPHYELNTGKLESLGF-KFKS  301

Query  186   LSQMFDDCIHSFQQKGFL  133
             + +MFDDC  SF ++G L
Sbjct  302   VEEMFDDCFASFVEQGHL  319



>ref|XP_003598007.1| CCP [Medicago truncatula]
 gb|AES68258.1| cinnamyl-alcohol dehydrogenase-like protein [Medicago truncatula]
Length=322

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 202/320 (63%), Gaps = 10/320 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LV+ LL +GY+V+ TVR+P + +K+  L +L+GAKERL++ K +++E+
Sbjct  7     CVTGASGYIASWLVRYLLHRGYTVKATVRDPSDPKKINHLVKLEGAKERLQLFKANLLEQ  66

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDH--NIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVL  730
             G+ +    G  GVFHTASP    Y H  + Q  LIDP++ GTLNVL S A+  ++KRVVL
Sbjct  67    GAFDSAVQGCHGVFHTASPF---YHHVKDPQAELIDPALNGTLNVLKSCAKSPLLKRVVL  123

Query  729   TSSCSCIRYRHDA-TQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             TSS + + Y     T    ++E+ +TD D+C + NLWYA +KT+AE+ AWK+ ++N+ I+
Sbjct  124   TSSAAAVAYNEKPRTPDVVVDETWFTDADFCAKLNLWYAVSKTLAEEAAWKFVKENN-ID  182

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             +V +N + V+GPLL P   ++   IL ++ G    +PN  +G+V+++D   AHILA E  
Sbjct  183   MVTINPAMVIGPLLQPVLNTSAAAILNLING-TQTFPNSTLGWVYVKDVANAHILAYENA  241

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
             +ASGR     +VAH+S+I+ +LR  YPS     KC++++     +     K   LG+  +
Sbjct  242   SASGRHCLVESVAHYSEIVKILRELYPSLQLPEKCADDKPYVPTYQFSKEKATSLGI-EY  300

Query  192   ATLSQMFDDCIHSFQQKGFL  133
               L     + + S ++K F+
Sbjct  301   TPLEVSIKETVESLKEKKFV  320



>ref|NP_001234823.1| phenylacetaldehyde reductase [Solanum lycopersicum]
 gb|ABR15768.1| phenylacetaldehyde reductase [Solanum lycopersicum]
Length=328

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 193/318 (61%), Gaps = 6/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL  GY+V+ +VR+P + +K   L  L GAKERL + K +++EE
Sbjct  9     CVTGASGYIASWLVKFLLHSGYNVKASVRDPNDPKKTQHLLSLGGAKERLHLFKANLLEE  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLTS  724
             GS +   DG +GVFHTASP       + Q  L+DP+VKGTLN+L S A+   VKRVVLTS
Sbjct  69    GSFDAVVDGCEGVFHTASPFYYSVT-DPQAELLDPAVKGTLNLLGSCAKAPSVKRVVLTS  127

Query  723   SCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             S + + Y     T    ++ES WT  DYCK   LWY  +KT+AE  AWK+ ++  GI++V
Sbjct  128   SIAAVAYSGQPRTPEVVVDESWWTSPDYCKEKQLWYVLSKTLAEDAAWKFVKEK-GIDMV  186

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNA  367
             VVN + V+GPLL P   ++   +L++V G    YPN   G+V+++D   AHILA E  +A
Sbjct  187   VVNPAMVIGPLLQPTLNTSSAAVLSLVNG-AETYPNSSFGWVNVKDVANAHILAFENPSA  245

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
             +GR +    VAH+S I+ +LR  YP+     KC+++      + +   K   LG+  F T
Sbjct  246   NGRYLMVERVAHYSDILKILRDLYPTMQLPEKCADDNPLMQNYQVSKEKAKSLGI-EFTT  304

Query  186   LSQMFDDCIHSFQQKGFL  133
             L +   + + S ++K F 
Sbjct  305   LEESIKETVESLKEKKFF  322



>ref|XP_007150619.1| hypothetical protein PHAVU_005G167400g [Phaseolus vulgaris]
 gb|ESW22613.1| hypothetical protein PHAVU_005G167400g [Phaseolus vulgaris]
Length=323

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 197/319 (62%), Gaps = 9/319 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+L+K LL  GY V  TVR+ G+ +K  +LW L+GA ERL++++ D+MEE
Sbjct  6     CVTGASGFLASWLIKRLLSSGYHVTGTVRDLGKQKKYEYLWSLEGATERLQLVQADLMEE  65

Query  900   GSMEDGFDGVDGVFHTASPVL-VPYDHNIQKTLIDPSVKGTLNVLTSARK-MMVKRVVLT  727
             GS ++   G  GVFH ASPVL +  D   Q  +++P+VKGTLNVL S RK   + RVVLT
Sbjct  66    GSFDNAIMGCKGVFHVASPVLSIISDPKTQ--ILEPAVKGTLNVLRSCRKNAALGRVVLT  123

Query  726   SSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             SS S +R R D     PL+ES W+ L++C++   WYA +K  AE+ AW++  +N GI+LV
Sbjct  124   SSSSTLRIRDDFDPNIPLDESSWSSLEFCEKLQAWYAMSKIEAERAAWEFCREN-GIDLV  182

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQN  370
              V  SF++GP L P   ST   +L ++KG    +    R+G+VHI+D     IL  E + 
Sbjct  183   TVLPSFIIGPSLPPSLCSTASDVLGLLKGETKRFQLLGRMGYVHIDDVALCQILVYEDEG  242

Query  369   ASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFA  190
             + GR +CS+ V +   +  +L  +YP+     +   E+ D +++ L+  K+  LG   F 
Sbjct  243   SHGRYLCSSVVMNEDDLAALLANRYPTLSISPRF--EKVDRAQYQLNTQKLKSLGF-KFK  299

Query  189   TLSQMFDDCIHSFQQKGFL  133
             ++ +MFDDCI S  ++G L
Sbjct  300   SIEEMFDDCIASLAKQGHL  318



>ref|XP_010557405.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Tarenaya hassleriana]
Length=336

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 189/317 (60%), Gaps = 9/317 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S+LVK LLD+GY+V+ TVRNP E  K   L ELKGAKERL + + D+++ 
Sbjct  15    CVTGAGGFIASWLVKLLLDRGYTVKGTVRNP-EDPKNAHLMELKGAKERLTLCRADLLDY  73

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S+++   G  GVFHTASPV      +  + +++P+V GT NV+ +A +  VKR V TSS
Sbjct  74    QSLKEAIQGCHGVFHTASPVT-----DDPEKMVEPAVNGTRNVIEAAAEARVKRAVFTSS  128

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
                +    +      ++E  W+DLDYCK    WY YAKT+AEQ AW+ A++  G++LVVV
Sbjct  129   IGTVYMNPNRDPDGLVDEHCWSDLDYCKNTKNWYCYAKTVAEQVAWEVAKER-GVDLVVV  187

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N   V+GPLL P   ++   IL  + G    Y N    +VH+EDA  AH+L  E+ +ASG
Sbjct  188   NPVLVIGPLLQPTVNASTVHILKYLTGSAKTYANLAQAYVHVEDAALAHVLVFESPSASG  247

Query  360   RLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSE-HSLDCTKIMELGLPPFATL  184
             R IC+ +  H  +++ +L   +P YP  TKCS+E+    + +     KI ELGL  F  +
Sbjct  248   RYICAESSLHRGEVVDILSKFFPEYPIPTKCSDEKNPRVKPYKFSNDKIRELGL-EFVPV  306

Query  183   SQMFDDCIHSFQQKGFL  133
              Q   D + S Q+ G L
Sbjct  307   RQSLYDTVRSLQEMGHL  323



>gb|EYU31375.1| hypothetical protein MIMGU_mgv1a010032mg [Erythranthe guttata]
Length=324

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 129/324 (40%), Positives = 198/324 (61%), Gaps = 18/324 (6%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ +VR+P + +K   L  L GAKERL+++K +++EE
Sbjct  5     CVTGASGYIASWLVKFLLQRGYAVKASVRDPHDPKKTQHLLALDGAKERLQLIKANLLEE  64

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             GS +   DG DGVFHTAS    P+ H +   Q  LIDP++KGTLNVL S A+   +KRVV
Sbjct  65    GSFDSVVDGCDGVFHTAS----PFYHGVTDPQTELIDPALKGTLNVLGSCAKTPSIKRVV  120

Query  732   LTSSCSCIRYRHDA-TQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ W+D + C+    WY  +KT+AE+ AWK+ ++  GI
Sbjct  121   LTSSVAAVAYNSKPRTPEVVVDETWWSDPEICREMQQWYVLSKTLAEEAAWKFVKEK-GI  179

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGE---YPNKRVGFVHIEDAVRAHILA  385
             ++V +N + V+G    P    TL    A + GLI +   YPN   G+++++D   AHILA
Sbjct  180   DMVTINPAMVIG----PLLQPTLNTSSAAILGLINDAETYPNSTFGWINVKDVANAHILA  235

Query  384   MEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELG  205
              E  +ASGR     +VAH+S+I+++LR  YP+Y    KC++++    ++ +   K   LG
Sbjct  236   FENTSASGRYCLVESVAHYSEIVNVLRELYPTYQLPEKCADDKPFVPKYQVSKEKAKSLG  295

Query  204   LPPFATLSQMFDDCIHSFQQKGFL  133
             +  F TL +   + + S ++K   
Sbjct  296   V-EFTTLKEGIKETVESLKEKNLF  318



>ref|XP_006379787.1| hypothetical protein POPTR_0008s13800g [Populus trichocarpa]
 gb|ERP57584.1| hypothetical protein POPTR_0008s13800g [Populus trichocarpa]
Length=329

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/322 (41%), Positives = 196/322 (61%), Gaps = 15/322 (5%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL  GY V  TVR+P   +KV  LW L+GAKERL+++K D+MEE
Sbjct  9     CVTGASGYLASWLVKRLLLSGYHVTGTVRDPENEKKVAHLWRLEGAKERLRLVKADLMEE  68

Query  900   GSMEDGFDGVDGVFHTASPVL----VPYDHNIQKTLIDPSVKGTLNVLTSA-RKMMVKRV  736
             GS +D      GVFHTASP +    +P+       +++P+++GTLNVL S  R   +KRV
Sbjct  69    GSFDDAIMECRGVFHTASPFIYIATLPF-----AEILEPAIEGTLNVLRSCKRNPSLKRV  123

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             +LTSS S +R R D     PL ES W+ ++ C+R  +WYA +KT+AE+ AW++   N GI
Sbjct  124   ILTSSSSTLRVRDDFDSNIPLEESSWSSVELCERLQIWYALSKTLAEKAAWEFCNGN-GI  182

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAME  379
             +L+ V  SFV+GP L+P   ST   +L ++ G   ++  + R+G+VHI+D   +HIL  E
Sbjct  183   DLITVLPSFVIGPSLSPDLCSTATDVLGLLTGESEKFHWHGRMGYVHIDDVALSHILVYE  242

Query  378   AQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLP  199
              + A GR +CS+ V    ++   L  +YPS P   +   E+     +  + +++  LG  
Sbjct  243   DETAGGRYLCSSIVLDNDELASFLSQRYPSLPIPKRF--EQLKRPYYEFNTSRLERLGF-  299

Query  198   PFATLSQMFDDCIHSFQQKGFL  133
              F  + +MFDDCI S  ++G L
Sbjct  300   KFKPIQEMFDDCIASLVEQGHL  321



>dbj|BAD09991.1| putative dihydroflavonol reductase [Oryza sativa Japonica Group]
Length=361

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 135/363 (37%), Positives = 209/363 (58%), Gaps = 42/363 (12%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             M+   K K    CVTG +G + S+LVK LL+ GY V  TVR+PG  +KVG LW L GAKE
Sbjct  1     MENTTKGK---VCVTGASGYVASWLVKRLLESGYHVLGTVRDPGNHKKVGHLWNLTGAKE  57

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHN---------------------  820
             RL++++ D++EEGS +D     +GVFHTASPV+   D +                     
Sbjct  58    RLELVRADLLEEGSFDDAVMACEGVFHTASPVITETDSSKACYTNCEDHFHPAIMRLSFL  117

Query  819   ---------IQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTSSCSCIRYRHDATQISP--  676
                      +   ++D ++ GTLNVL S +K   +KRVVLTSS S +R + D   + P  
Sbjct  118   SWNSDLRCHLVAAVLDSAINGTLNVLRSCKKNPSLKRVVLTSSSSTVRLK-DEADLPPNV  176

Query  675   -LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVVNLSFVVGplltpqp  499
              L+E+ W+ +++C+   +WYA AKT+AE+ AW++A++N GI+LV V  +FVVGP L+ + 
Sbjct  177   LLDETSWSSMEFCESLQIWYAIAKTLAEKAAWEFAKEN-GIDLVAVLPTFVVGPNLSHEL  235

Query  498   tstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQ  322
             + T   +L + +G   ++    R+G+VHI+D    HIL  E   A+GR IC++ V   ++
Sbjct  236   SPTTTDVLGLFQGETTKFTMYGRMGYVHIDDVASCHILLYETPRAAGRYICNSAVLDVNE  295

Query  321   IIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQK  142
             ++ +L  ++PSYP         G+ + +     K+ ELG+  F  + +MFDD + S +  
Sbjct  296   LVTLLARRFPSYPIPKSLPCVYGEQT-YGFSTAKVRELGM-KFRDVEEMFDDAVDSLRAH  353

Query  141   GFL  133
             G+L
Sbjct  354   GYL  356



>ref|XP_002311546.2| dihydroflavonol 4-reductase family protein [Populus trichocarpa]
 gb|EEE88913.2| dihydroflavonol 4-reductase family protein [Populus trichocarpa]
Length=320

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 192/318 (60%), Gaps = 16/318 (5%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL  GY V  TVR+P   +KV  LW L+GAKERL+++K D+MEE
Sbjct  9     CVTGASGYLASWLVKRLLLSGYHVTGTVRDPENEKKVAHLWRLEGAKERLRLVKADLMEE  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSA-RKMMVKRVVLTS  724
             GS +D      GVFHTASP            +++P+++GTLNVL S  R   +KRV+LTS
Sbjct  69    GSFDDAIMECRGVFHTASPA----------EILEPAIEGTLNVLRSCKRNPSLKRVILTS  118

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S +R R D     PL ES W+ ++ C+R  +WYA +KT+AE+ AW++   N GI+L+ 
Sbjct  119   SSSTLRVRDDFDSNIPLEESSWSSVELCERLQIWYALSKTLAEKAAWEFCNGN-GIDLIT  177

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAMEAQNA  367
             V  SFV+GP L+P   ST   +L ++ G   ++  + R+G+VHI+D   +HIL  E + A
Sbjct  178   VLPSFVIGPSLSPDLCSTATDVLGLLTGESEKFHWHGRMGYVHIDDVALSHILVYEDETA  237

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
              GR +CS+ V    ++   L  +YPS P   +   E+     +  + +++  LG   F  
Sbjct  238   GGRYLCSSIVLDNDELASFLSQRYPSLPIPKRF--EQLKRPYYEFNTSRLERLGF-KFKP  294

Query  186   LSQMFDDCIHSFQQKGFL  133
             + +MFDDCI S  ++G L
Sbjct  295   IQEMFDDCIASLVEQGHL  312



>gb|AFK38743.1| unknown [Medicago truncatula]
Length=323

 Score =   224 bits (570),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 202/321 (63%), Gaps = 13/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+VR TVR+P   +KV  L +L GAKERL++ K D++EE
Sbjct  9     CVTGASGFIASWIVKFLLQRGYTVRATVRDPSNPKKVDHLLKLDGAKERLQLFKADLLEE  68

Query  900   GSMEDGFDGVDGVFHTASPV-LVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLT  727
             GS +   +G DGVFHTASPV  V  D  ++  LIDP++KGTLNVL S A+   VKRVVLT
Sbjct  69    GSFDSVVEGCDGVFHTASPVRFVVNDPQVE--LIDPALKGTLNVLKSCAKSTSVKRVVLT  126

Query  726   SSCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             SS + + +  D    +P   ++E+ +++ D+C+   LWY  +KT+AE  AWK+  +N+ I
Sbjct  127   SSNAAVSF--DTRPKNPEVVVDETWFSNPDFCRESKLWYVLSKTLAEAAAWKFVNENN-I  183

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V GPLL P+   +++ IL ++ G+   +PNK +G+V+++D   AHI A E 
Sbjct  184   DMVSLNPTMVAGPLLQPEVNESVEPILNLINGI--PFPNKAIGWVNVKDVANAHIHAYEI  241

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR + +  V H+S++  +LR  YP+ P   KC ++      + +   K    G+  
Sbjct  242   ASASGRCLLAERVVHYSELAMILRDLYPTLPISDKCEDDGPYMPTYQISKEKAKSFGI-E  300

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + SF++K F+
Sbjct  301   FTPLEISLKETVESFREKKFI  321



>ref|XP_010102362.1| hypothetical protein L484_015311 [Morus notabilis]
 gb|EXB93323.1| hypothetical protein L484_015311 [Morus notabilis]
Length=328

 Score =   224 bits (571),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 199/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ +VR+P + +K   L  L GAKERL++ K D++EE
Sbjct  13    CVTGASGYIASWLVKFLLQRGYTVKASVRDPNDQKKTAHLTSLDGAKERLQLFKADLLEE  72

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             GS ++  +G +GVFHTAS    P+ H++   Q+ L+DP+VKGTLNVL S A+   VKRVV
Sbjct  73    GSFDNAIEGSEGVFHTAS----PFYHDVKDPQEELLDPAVKGTLNVLNSCAKSSSVKRVV  128

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ ++D D CK    WY  +KT+AE  AWK+ ++  GI
Sbjct  129   LTSSIAAVSYNGKPRTPDVIVDETWFSDPDICKELKQWYWLSKTLAEDAAWKFVKEK-GI  187

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   IL ++ G    + N  VG+V+++D   AHILA E 
Sbjct  188   DLVTINPALVIGPLLQPTLNTSAAAILNLING-AQTFLNLTVGWVNVKDVANAHILAYEV  246

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR     +VAH+S+I+ +LR  YPS P   KC++++     + +   K   LG+  
Sbjct  247   PSASGRYCLVESVAHYSEIVRLLRELYPSLPLPEKCADDKLFMPTYQVSKEKATSLGI-D  305

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S ++K F+
Sbjct  306   FIPLKTGLKETVESLKEKQFV  326



>ref|XP_003546537.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
1 [Glycine max]
 gb|KHM98728.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=332

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 195/320 (61%), Gaps = 7/320 (2%)
 Frame = -2

Query  1092  RPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGD  913
             R   CVTG +G + S+L+K LL  GY V  TVR+ G+ +K  +LW L+GA ERL++++ D
Sbjct  6     RGRVCVTGASGFLASWLIKRLLLSGYHVIGTVRDLGKKKKYEYLWSLEGATERLQLVQAD  65

Query  912   VMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRV  736
             +MEEGS ++   G  GVFH ASPVL     + +  +++P+VKGTLNVL S  +   + RV
Sbjct  66    LMEEGSFDNAIMGCKGVFHVASPVLNTIS-DPKSEILEPAVKGTLNVLRSCGKNPALGRV  124

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             VLTSS S +R R D    +PL+ES W+ L+ C++   WYA AKT AE+ AW++ ++  GI
Sbjct  125   VLTSSSSTLRLRDDFDPNTPLDESSWSSLEICEKLQAWYAMAKTQAERAAWEYCKEK-GI  183

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAME  379
              LV V  SF++GP L P   ST   +L ++KG    +    R+G+VHI+D     IL  E
Sbjct  184   NLVTVLPSFIIGPSLPPNLCSTASDVLGLLKGETKRFQLLGRMGYVHIDDVALCQILVYE  243

Query  378   AQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLP  199
              +++ GR +CS+TV     +  +L  +YP+ P   +   E+ D   + L+  K+  LG  
Sbjct  244   NEDSHGRYLCSSTVMGEDDLASLLANRYPTLPISKRF--EKLDRPHYELNTGKLRSLGF-  300

Query  198   PFATLSQMFDDCIHSFQQKG  139
              F ++ +MFDDCI S  ++G
Sbjct  301   KFKSVEEMFDDCIASLVKQG  320



>ref|XP_007131544.1| hypothetical protein PHAVU_011G022100g [Phaseolus vulgaris]
 gb|ESW03538.1| hypothetical protein PHAVU_011G022100g [Phaseolus vulgaris]
Length=323

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 193/319 (61%), Gaps = 8/319 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+VR TVR+PG  +KV  L  L GAKERL + K D++EE
Sbjct  8     CVTGASGYIASWIVKFLLQRGYTVRATVRDPGNPKKVSHLVNLDGAKERLHLFKADLLEE  67

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLTS  724
             GS +   +G DGVFHTASPV    + N Q  LIDP+VKGTLNVL S A+   VKRVVLTS
Sbjct  68    GSFDSVVEGCDGVFHTASPVRFVVN-NPQAELIDPAVKGTLNVLKSCAKSPSVKRVVLTS  126

Query  723   SCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             S S +       T  + L+E+ ++D D C+   LWY+ +KT+AE  AWK+  +N+ I++V
Sbjct  127   SVSAVALNGRPKTPETVLDETWFSDPDVCRELELWYSLSKTLAEDAAWKFVNENN-IDMV  185

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNA  367
             V+N + V G LL  +   +++ IL ++ G    + NK  G+V ++D   AHILA E  +A
Sbjct  186   VINPTMVAGTLLQAEINESVEQILNLING--KPFQNKCFGWVDVKDVANAHILAYEIASA  243

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKI-MELGLPPFA  190
             SGR   S  V H+S++  +LR  YP+     KC  +E     + +   K   ELG+    
Sbjct  244   SGRYCLSERVIHYSELATILRDLYPTLQIPDKCEVDEAYIPTYQISTDKAKKELGI-ELI  302

Query  189   TLSQMFDDCIHSFQQKGFL  133
              L   F + + SF++K  +
Sbjct  303   PLEVSFRETVESFREKKLV  321



>ref|XP_003628601.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AET03077.1| cinnamyl alcohol dehydrogenase [Medicago truncatula]
Length=323

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/320 (41%), Positives = 202/320 (63%), Gaps = 11/320 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+VR TVR+P   +KV  L +L GAKERL++ K D++EE
Sbjct  9     CVTGASGFIASWIVKFLLQRGYTVRATVRDPSNPKKVDHLLKLDGAKERLQLFKADLLEE  68

Query  900   GSMEDGFDGVDGVFHTASPV-LVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLT  727
             GS +   +G DGVFHTASPV  V  D  ++  LIDP++KGTLNVL S A+   VKRVVLT
Sbjct  69    GSFDSVVEGCDGVFHTASPVRFVVNDPQVE--LIDPALKGTLNVLKSCAKSTSVKRVVLT  126

Query  726   SSCSCIRY--RHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             SS + + +  R    ++  ++E+ +++ D+C+   LWY  +KT+AE  AWK+  +N+ I+
Sbjct  127   SSNAAVSFNTRPKNPEVV-VDETWFSNPDFCRESKLWYVLSKTLAEAAAWKFVNENN-ID  184

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             +V +N + V GPLL P+   +++ IL ++ G+   +PNK +G+V+++D   AHI A E  
Sbjct  185   MVSLNPTMVAGPLLQPEVNESVEPILNLINGI--PFPNKAIGWVNVKDVANAHIHAYEIA  242

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
             +ASGR + +  V H+S++  +LR  YP+ P   KC ++      + +   K    G+  F
Sbjct  243   SASGRCLLAERVVHYSELAMILRDLYPTLPISDKCEDDGPYMPTYQISKEKAKSFGI-EF  301

Query  192   ATLSQMFDDCIHSFQQKGFL  133
               L     + + SF++K F+
Sbjct  302   TPLEISLKETVESFREKKFI  321



>gb|ACN40591.1| unknown [Picea sitchensis]
Length=323

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/326 (39%), Positives = 194/326 (60%), Gaps = 22/326 (7%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G IGS++V+ LL++GYSV  T+++ G  ++   L  ++GAKERLK+ K D+M+ 
Sbjct  6     CVTGASGFIGSWVVRLLLERGYSVHATIQDLGNWKETKHLEAMEGAKERLKLFKMDLMDY  65

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S++D  DG  GVFH A P  +    + QK L+DP +KGT+NVL +A K  VKRVVLTSS
Sbjct  66    QSIQDAIDGCSGVFHLAMPNTIDAVEDPQKQLLDPGIKGTINVLEAAHKAKVKRVVLTSS  125

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
              S I          PL+E+ WTDLDYC+   +WY  AKT+AE+ AW ++++  G+ +V +
Sbjct  126   VSAIIPNPKWPAGKPLDENCWTDLDYCRENGIWYTVAKTLAEKAAWDFSKEK-GLNVVAI  184

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N    +GP+L P   ++L +I+ +++G   EY N  +G  H++D  +A IL  E  +ASG
Sbjct  185   NPGTALGPILPPDMNASLAMIVKLLQGNKEEYRNFFMGCAHVKDIAKAQILLYETPSASG  244

Query  360   RLICSTTVAHFSQIIHMLRPKYPSY----------PYLTKCSNEEGDDSEHSLDCTKIME  211
             R +C  ++AH+S    +    YP Y          P L +  N             K+++
Sbjct  245   RHLCVESIAHWSDFAELTAKLYPEYNVHKFTGVTQPGLVRVKNAS----------KKLID  294

Query  210   LGLPPFATLSQMFDDCIHSFQQKGFL  133
             LGL  F ++ ++  DC+ + ++KGFL
Sbjct  295   LGL-QFTSMEEIIKDCVSTLREKGFL  319



>ref|XP_006341347.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform X2 [Solanum tuberosum]
Length=332

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 132/317 (42%), Positives = 191/317 (60%), Gaps = 9/317 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S+LVK LL+KGY+VR TVRNP +  K G L EL+GAKERL +L+ D+++ 
Sbjct  10    CVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDD-PKNGHLKELEGAKERLILLRADLLDY  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S+ +   G DGVFHTASPV      +  + +++P+V GT NV+T+A +  V RVV TSS
Sbjct  69    QSLREAIYGCDGVFHTASPVT-----DDPEQMVEPAVIGTKNVITAAAEAKVGRVVFTSS  123

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
                +    +      ++E+ W+DLD+CK    WY Y KT+AE+ AW  A +  G++LVV+
Sbjct  124   IGTVYMDPNRAPDKVVDETCWSDLDFCKNTKNWYCYGKTVAEKTAWDEAREK-GVDLVVI  182

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N   V+GPLL P   +++  IL  + G    Y N    +VH++D   AHIL  EA +ASG
Sbjct  183   NPVLVLGPLLQPTVNASVLHILKYLTGSAKTYANSTQAYVHVKDVALAHILLYEAPSASG  242

Query  360   RLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSE-HSLDCTKIMELGLPPFATL  184
             R IC+ +V H   ++ +L   +P YP  TKCS+E    ++ +     K+ +LGL  F  +
Sbjct  243   RYICAESVLHRGDVVEILAKFFPEYPIPTKCSDETRPRAKPYKFTNQKLKDLGL-EFTPV  301

Query  183   SQMFDDCIHSFQQKGFL  133
              Q   + + S Q+KG L
Sbjct  302   KQCLYETVKSLQEKGHL  318



>ref|XP_011080432.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=332

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 191/318 (60%), Gaps = 6/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY V+ +VR+P + +K   L  L GAKERL ++K D++E+
Sbjct  5     CVTGASGYIASWLVKFLLQRGYIVKASVRDPNDPKKTQHLLALDGAKERLHLIKADLLEQ  64

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLTS  724
             GS +   DG DGVFHTASPV      + Q  LIDP++KGTLNVL S A+   VKRVVLTS
Sbjct  65    GSFDAVVDGCDGVFHTASPVKF-ASTDPQGELIDPALKGTLNVLGSCAKTPSVKRVVLTS  123

Query  723   SCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             S + I       T    L+E+ W+D ++CK+   WY  +KT+AE  AWK+ ++  G+++V
Sbjct  124   SIAAILANGKPRTPELVLDETWWSDPEFCKQTQQWYLLSKTLAEDAAWKFVKEK-GMDMV  182

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNA  367
              +N S V+GPLL P   ++   IL ++ G    YPN   G+V+++D   AHILA E   A
Sbjct  183   AINPSMVIGPLLQPTLNTSSAAILNLMNG-AKTYPNAAYGWVNVKDVANAHILAFENPTA  241

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
             +GR   +  VAHFSQ++ +LR  YP++    KC+++        +   +   LG+  F  
Sbjct  242   NGRYCMTNRVAHFSQVVKILRELYPTFQLPEKCADDNPLAPTFQVSKERAKSLGV-EFTP  300

Query  186   LSQMFDDCIHSFQQKGFL  133
             L +   + + S  +K F 
Sbjct  301   LEETIKETVESLMEKNFF  318



>ref|XP_006306213.1| hypothetical protein CARUB_v10011885mg [Capsella rubella]
 gb|EOA39111.1| hypothetical protein CARUB_v10011885mg [Capsella rubella]
Length=333

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 128/321 (40%), Positives = 200/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GA+ERLK+ K +++EE
Sbjct  18    CVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANLLEE  77

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG +GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL+S  K   VKRVV
Sbjct  78    GSFDSAIDGCEGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVV  133

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++ES + D +YC+   LWY  +KT+AE  AWK+AE+ND +
Sbjct  134   LTSSIAAVAFNGMPRTPETIVDESWFADPEYCRASKLWYVLSKTLAENAAWKFAEEND-L  192

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  193   QLVSINPAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  251

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               A+GR      VAH+S+++++L+  YP +    KC++E+     + +   K   LG+  
Sbjct  252   PTANGRYCLVERVAHYSEVVNILQDLYPDFLLPEKCADEKIYIPTYKVSKEKAESLGV-E  310

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S + KGF+
Sbjct  311   FVPLEVSIKETVESLRDKGFI  331



>ref|XP_010479624.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=333

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 127/321 (40%), Positives = 199/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GA+ERLK+ K +++EE
Sbjct  18    CVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANLLEE  77

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG +GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL+S  K   VKRVV
Sbjct  78    GSFDSAIDGCEGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVV  133

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++ES + D +YC+   LWY  +KT+AE  AWK+AE+ND +
Sbjct  134   LTSSIAAVAFNGMPRTPDTIVDESWFADPEYCRASKLWYVLSKTLAENAAWKFAEEND-L  192

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  193   QLVSINPAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  251

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               A+GR      VAH+S+++++L   YP +    +C++E+     + +   K   LG+  
Sbjct  252   PTANGRYCLVERVAHYSEVVNILNDLYPEFQLPERCADEKIYIPTYKVSKEKAESLGV-E  310

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S + KGF+
Sbjct  311   FVPLEVSIKETVESLRDKGFI  331



>ref|XP_009144901.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Brassica 
rapa]
Length=325

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 127/321 (40%), Positives = 198/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GAKERL++ K +++EE
Sbjct  10    CVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAKERLQLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG  GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL++  K   VKRVV
Sbjct  70    GSFDSAIDGCQGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSTCLKTPSVKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++ES + D +YC+   LWY  +KT+AE  AWK+A++ND +
Sbjct  126   LTSSIASVAFNGMPRTPETIVDESWFADPEYCRAAKLWYVLSKTLAENAAWKFAKEND-L  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  185   QLVSINAAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               A+GR      VAH+S+++++L   YP +    KC++E+     + +   K   LG+  
Sbjct  244   PTANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIYIPTYKVSKEKAESLGV-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S Q KGF+
Sbjct  303   FVPLEVSIKETVESLQDKGFI  323



>gb|ACG40042.1| hypothetical protein [Zea mays]
Length=332

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 129/327 (39%), Positives = 194/327 (59%), Gaps = 8/327 (2%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + +  VTG +G + S+L+K LL+ GY V  TVR+PG  +K   LW+L GAKERL+I++
Sbjct  4     SSKGKVYVTGASGFVASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKERLQIVR  63

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVK  742
              D++EEGS +      +GVFHTASPVL   D   ++  + P+V GTLNVL S +K   +K
Sbjct  64    ADLLEEGSFDSAVMACEGVFHTASPVLAKPDSTSKEETLVPAVNGTLNVLRSCKKNPFLK  123

Query  741   RVVLTSSCSCIRYRHDATQIS---PLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAE  571
             RVVLTSS S +R R D  Q S    L+E+ W+ +  C++ +LWYA AK  AE+ AW++A+
Sbjct  124   RVVLTSSSSAVRIRDDGGQSSSNISLDETTWSSVPLCEKMHLWYALAKVFAEKAAWEFAK  183

Query  570   QNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN-KRVGFVHIEDAVRAH  394
             +N GI+LV V  SFV+GP L+ +   T   +L + +G    + +  R           +H
Sbjct  184   EN-GIDLVTVLPSFVIGPSLSHELCVTASDVLGLFQGDTARFSSYGRWDTSTSTTFASSH  242

Query  393   ILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIM  214
             IL  E   A+GR +CS+ V    +++  L  +YP +P   + +   G  S + L+ +K+ 
Sbjct  243   ILVYEVPQAAGRYLCSSVVLDNDELVSSLAKRYPIFPIPRRLNTPYGKQS-YQLNTSKLQ  301

Query  213   ELGLPPFATLSQMFDDCIHSFQQKGFL  133
              LG   F  + +MFDDC+ S + +G L
Sbjct  302   GLGF-KFRGVQEMFDDCVQSLKDQGHL  327



>ref|XP_009795334.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana sylvestris]
Length=323

 Score =   221 bits (564),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 201/321 (63%), Gaps = 14/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ TVR+P + +K   L  L GAKERL + K +++EE
Sbjct  7     CVTGASGYIASWLVKFLLQRGYTVKATVRDPNDPKKTDHLTSLDGAKERLHLFKANLLEE  66

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             G+ +   DG +GVFHTAS    P+ H +   Q  LIDP++KGTLNVL S A+   ++RVV
Sbjct  67    GAFDAVVDGCEGVFHTAS----PFYHAVKDPQAELIDPALKGTLNVLGSVAKTPSIRRVV  122

Query  732   LTSSCSCIRY--RHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDG  559
             LTSS + + +  +  A ++  ++E+ W+D D+C+   LWY  +KT+AE  AWK+ ++   
Sbjct  123   LTSSVAAVAFNGKPRAPEVV-VDETWWSDPDFCRESQLWYVLSKTLAEDAAWKFVKEK-A  180

Query  558   IELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAME  379
             I++V +N + V+G LL P   ++   +L ++ G    YPN  +G+V+++D   AHILA E
Sbjct  181   IDMVTINPAMVIGSLLQPTLNTSCAAVLQLING-AETYPNATLGWVNVKDVALAHILAFE  239

Query  378   AQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLP  199
               +A+GR +    VAH+S+++ +LR  YP+     KC +++    ++ ++  +  +LG+ 
Sbjct  240   NPSANGRYLMVEAVAHYSELVKILREHYPTMKLPEKCVDDKPFPPKYQVNIERAKQLGV-  298

Query  198   PFATLSQMFDDCIHSFQQKGF  136
              F  L++   + + S ++K F
Sbjct  299   EFTPLAENIKETVESLKEKKF  319



>ref|XP_010461970.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=325

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 127/321 (40%), Positives = 199/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GA+ERLK+ K +++EE
Sbjct  10    CVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG +GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL+S  K   VKRVV
Sbjct  70    GSFDSAIDGCEGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++ES + D +YC+   LWY  +KT+AE  AWK+AE+N+ +
Sbjct  126   LTSSIAAVAFNGMPRTPETIVDESWFADPEYCRASKLWYVLSKTLAENAAWKFAEENE-L  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  185   QLVSINPAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               A+GR      VAH+S+++++L   YP +    KC++E+     + +   K   LG+  
Sbjct  244   PTANGRYCLVERVAHYSEVVNILNDLYPEFQLPEKCADEKIYIPTYKVSKEKAESLGV-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S + KGF+
Sbjct  303   FVPLEVSIKETVESLRDKGFI  323



>ref|XP_006427617.1| hypothetical protein CICLE_v10026012mg [Citrus clementina]
 gb|ESR40857.1| hypothetical protein CICLE_v10026012mg [Citrus clementina]
Length=338

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 193/319 (61%), Gaps = 11/319 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S++VK LL+KGYSV+ TVRNP +  K   L EL+GAKERL + K D+++ 
Sbjct  15    CVTGAAGFIASWIVKFLLEKGYSVKGTVRNPDD-PKNAHLRELEGAKERLALCKADLLDY  73

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S+++ F+G DGVFHTASPV      +  + +++P+V GT NV+ +A +  V+RVV TSS
Sbjct  74    ESLKEAFNGCDGVFHTASPVT-----DDPEKMLEPAVIGTKNVIVAAAEAKVRRVVFTSS  128

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
                +    + +    ++E  W+DL+YCK    WY YAKT+AE+ AW+ A+   G++LVVV
Sbjct  129   IGTVYMDPNRSPDIVVDEHCWSDLEYCKNTKNWYCYAKTVAEKAAWEEAKAR-GLDLVVV  187

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N   V+G LL P   +++  IL  + G +  Y N   G+V + D   AHIL  E  +ASG
Sbjct  188   NPMLVIGTLLQPTVNASIIHILKYLTGSVKTYANSVQGYVDVRDVALAHILVYETPSASG  247

Query  360   RLIC--STTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSE-HSLDCTKIMELGLPPFA  190
             R IC  S ++ H  +++ +L   +P YP  TKC +E+   ++ +     KI +LGL  F 
Sbjct  248   RYICADSDSIIHRGEVVEILAKFFPEYPIPTKCKDEKSPRAKPYKYSNQKIKDLGL-KFT  306

Query  189   TLSQMFDDCIHSFQQKGFL  133
              + Q   D + S Q+KG L
Sbjct  307   PVRQCLYDSVKSLQEKGHL  325



>ref|XP_006393056.1| hypothetical protein EUTSA_v10011653mg [Eutrema salsugineum]
 gb|ESQ30342.1| hypothetical protein EUTSA_v10011653mg [Eutrema salsugineum]
Length=325

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 128/321 (40%), Positives = 198/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GA+ERLK+ K +++EE
Sbjct  10    CVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG  GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL+S  K   VKRVV
Sbjct  70    GSFDSAIDGCQGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSSCMKTSSVKRVV  125

Query  732   LTSSCSCIRYRH-DATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++ES + D +YC+   LWY  +KT+AE  AWK+A++ND I
Sbjct  126   LTSSIAAVAFNGVPRTPETIVDESWFADPEYCRASKLWYVLSKTLAENAAWKFAKEND-I  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  185   QLVSINPAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               A+GR      VAH+S+++++L   YP +    KC++E+     + +   K   LG+  
Sbjct  244   PTANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIYIPTYKVSKEKAESLGV-D  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S + KGF+
Sbjct  303   FVPLEVSIKETVESLRDKGFI  323



>ref|XP_006378485.1| hypothetical protein POPTR_0010s13520g [Populus trichocarpa]
 ref|XP_006378486.1| hypothetical protein POPTR_0010s13520g [Populus trichocarpa]
 gb|ERP56282.1| hypothetical protein POPTR_0010s13520g [Populus trichocarpa]
 gb|ERP56283.1| hypothetical protein POPTR_0010s13520g [Populus trichocarpa]
Length=201

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 122/156 (78%), Gaps = 1/156 (1%)
 Frame = -2

Query  1089  PEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDV  910
             PEYCVTGGTG I +YLVKSLL+KG++VR TVR+PG + KVGFL E  GAKERLKI K ++
Sbjct  2     PEYCVTGGTGFIAAYLVKSLLEKGHTVRITVRDPGNVRKVGFLQEFNGAKERLKIFKAEL  61

Query  909   MEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             +EEGS ++   GVDGVFH A+PVLVPY   IQ+TLIDP +KGTLNVL S  K   VKRVV
Sbjct  62    LEEGSFDEAIQGVDGVFHVAAPVLVPYSDRIQETLIDPCIKGTLNVLNSCLKASSVKRVV  121

Query  732   LTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNL  625
              TSS S +RYR D  QI  LNESHW+D +YCKR+N+
Sbjct  122   FTSSSSTVRYRDDTPQIFSLNESHWSDTEYCKRHNV  157



>ref|XP_002513513.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF48916.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=402

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 198/318 (62%), Gaps = 7/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L GA+ERL++ K D++EE
Sbjct  88    CVTGASGYIASWIVKFLLQRGYTVKASVRDPNDPRKTEHLRSLDGAEERLQLFKADLLEE  147

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLTS  724
             GS +   +G  GVFHTASP    +D    + LIDP+VKGTLNVL S A+   VKRVVLTS
Sbjct  148   GSFDAAVEGCRGVFHTASPFY--HDITDPQELIDPAVKGTLNVLNSCAKTPSVKRVVLTS  205

Query  723   SCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             S + + Y     T    ++E+ ++D D+C+   LWY  +KT+AE  AWK+A++  G++LV
Sbjct  206   SIAAVAYNGKPRTPEVVVDETWFSDPDFCRESKLWYVVSKTLAEDAAWKFAKEK-GLDLV  264

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNA  367
              +N + VVGPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E  +A
Sbjct  265   AINPAMVVGPLLQPTLNTSAAAVLSLLKG-ANTFPNASFGWVNVKDVANAHIQAFEIPSA  323

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
             SGR      VAH+S+++++ R  YP + +  KC++E+     + +   K   LG+  F  
Sbjct  324   SGRHCLVERVAHYSEVVNITRELYPDFQFPEKCADEKPYVPTYQVSKEKAKGLGI-DFIP  382

Query  186   LSQMFDDCIHSFQQKGFL  133
             L+    + + S ++KGF+
Sbjct  383   LNVSLKETVESLKEKGFI  400



>ref|NP_001242322.1| uncharacterized protein LOC100809326 [Glycine max]
 gb|ACU21505.1| unknown [Glycine max]
Length=325

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 130/321 (40%), Positives = 193/321 (60%), Gaps = 14/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S++VK LL++GY+VR TVRNP +  KV  L +L+GAKERL + K D++ E
Sbjct  10    CVTGAAGYIASWIVKFLLERGYTVRATVRNPNDHTKVEHLLKLEGAKERLHLFKADLLGE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
              S +   +G DGVFHTASP ++    + Q  L+DP+VKGTLNVL S  K   VKRV+LTS
Sbjct  70    NSFDSIVEGCDGVFHTASPFIINV-KDPQADLLDPAVKGTLNVLKSCVKSPSVKRVILTS  128

Query  723   SCSCIRY--RHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             S + + Y  R  + ++  ++E+ W+D DYC+   LWY  +KT+AE  AWK+A++ND ++L
Sbjct  129   SVAAVAYNKRPKSPEVV-VDETWWSDPDYCRELKLWYLLSKTLAEDAAWKFAKEND-LDL  186

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIG---EYPNKRVGFVHIEDAVRAHILAME  379
             VVVN + VVG    P   + L    AI+  LI     + N   G+++++D   AHI A E
Sbjct  187   VVVNPAMVVG----PLLQAELNTSAAIILNLINGSETFSNDTYGWINVKDVANAHIQAYE  242

Query  378   AQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLP  199
               +ASGR      VAH+S++  +LR +YP+Y    K ++++       +   K   LG+ 
Sbjct  243   IASASGRYCLVERVAHYSELARILRDRYPTYQIPEKSADDKPYVPTFQVSKEKAKTLGI-  301

Query  198   PFATLSQMFDDCIHSFQQKGF  136
              F  L     + + + ++K F
Sbjct  302   EFIPLEVSLRETVETLKEKNF  322



>ref|XP_010534743.1| PREDICTED: cinnamoyl-CoA reductase 1 [Tarenaya hassleriana]
Length=325

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/321 (40%), Positives = 197/321 (61%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GA ERLK+ K +++EE
Sbjct  10    CVTGASGYIASWIVKLLLIRGYTVKASVRDPNDPRKTEHLLALEGASERLKLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG +GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL S  K   VKRVV
Sbjct  70    GSFDSAIDGCEGVFHTAS----PFYHDVKDPQVELLDPAVKGTINVLNSCLKTSSVKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++E+ + D DYC+   LWY  +KT+AE  AWK+A++ND +
Sbjct  126   LTSSIAAVAFNGKPRTPETVVDETWFADPDYCRAAKLWYVLSKTLAEDAAWKFAKEND-M  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  185   QLVSINPAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +A+GR      VAH+S+++ +L   YP +    KC++E+     + +   K   LG+  
Sbjct  244   PSANGRYCLVERVAHYSEVVDILHKLYPDFQLPEKCADEKQYIPTYKVSKEKAESLGI-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S + KGF+
Sbjct  303   FVPLEVSIKETVESLKDKGFI  323



>ref|XP_009107209.1| PREDICTED: cinnamoyl-CoA reductase 1 [Brassica rapa]
 emb|CDY65726.1| BnaAnng20950D [Brassica napus]
 emb|CDY03618.1| BnaC03g68770D [Brassica napus]
Length=325

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 198/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GA+ERL++ K +++EE
Sbjct  10    CVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLQLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG  GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL++  K   VKRVV
Sbjct  70    GSFDSAIDGCQGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSTCLKTPSVKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++E+ + D DYC+   LWY  +KT+AE  AWK+A++ND +
Sbjct  126   LTSSIAAVAFNGMPRTPDTIVDETWFADPDYCRAAKLWYVLSKTLAENAAWKFAKEND-M  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  185   QLVSINAAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               A+GR      VAH+S+++++L   YP +    KC++E+     + +   K   LG+  
Sbjct  244   PEANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIFIPTYKVSKEKAESLGV-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S Q KGF+
Sbjct  303   FVPLEVSIKETVESLQDKGFI  323



>ref|XP_010500717.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=333

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/321 (40%), Positives = 199/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GA+ERLK+ K +++EE
Sbjct  18    CVTGASGYIASWIVKLLLLRGYTVKASVRDPSDPRKTEHLLALEGAEERLKLFKANLLEE  77

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG +GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL+S  K   VKRVV
Sbjct  78    GSFDSAIDGCEGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVV  133

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++ES + D +YC+   LWY  +KT+AE  AWK+AE+N+ +
Sbjct  134   LTSSIAAVAFNGMPRTPETIVDESWFADPEYCRASKLWYVLSKTLAENAAWKFAEENE-L  192

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  193   QLVSINPAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  251

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               A+GR      VAH+S+++++L   YP +    KC++E+     + +   K   LG+  
Sbjct  252   PTANGRYCLVERVAHYSEVVNILNDLYPEFQLPEKCADEKIYIPTYKVSKEKAESLGV-E  310

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S + KGF+
Sbjct  311   FVPLEVSIKETVESLRDKGFI  331



>ref|XP_009618541.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana tomentosiformis]
Length=323

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 198/320 (62%), Gaps = 12/320 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ TVR+P + +K   L  L GAKERL + K +++EE
Sbjct  7     CVTGSSGYIASWLVKFLLQRGYTVKATVRDPSDPKKTDHLTSLDGAKERLHLFKANLLEE  66

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             G+ +   DG +GVFHTAS    P+ H +   Q  LIDP++KGTLNVL S A+   ++RVV
Sbjct  67    GAFDAVVDGCEGVFHTAS----PFYHGVKDPQAELIDPALKGTLNVLGSVAKTPSIRRVV  122

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T    ++E+ W+D D+C+   LWY  +KT+AE  AWK+ ++   I
Sbjct  123   LTSSVAAVAFNGKPRTPEVVVDETWWSDPDFCRESQLWYVLSKTLAEDAAWKFVKEK-AI  181

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V+G LL P   ++   +L ++ G    YPN  +G+V+++D   AHILA E 
Sbjct  182   DMVTINPAMVIGGLLQPILNTSCAAVLQLING-AETYPNATLGWVNVKDVALAHILAFEN  240

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +A+GR +    VAH+S+++ +LR  YP+     KC +++    ++ ++  +  +LG+  
Sbjct  241   PSANGRYLMVEAVAHYSELVKILREHYPTMKLPEKCVDDKPFPPKYQVNIERAKQLGV-E  299

Query  195   FATLSQMFDDCIHSFQQKGF  136
             F  L++   + + S ++K F
Sbjct  300   FTPLAESIKETVESLKEKKF  319



>ref|XP_009114927.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Brassica rapa]
Length=325

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 199/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GA+ERL++ K +++EE
Sbjct  10    CVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLQLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG  GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL++  K   VKRVV
Sbjct  70    GSFDSAIDGCQGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSTCLKTPSVKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++ES + D +YC+   LWY  +KT+AE  AWK+A++ND +
Sbjct  126   LTSSIAAVAFNGMPRTPDTIVDESWFADPEYCRAAKLWYVLSKTLAENAAWKFAKEND-M  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  185   QLVSINAAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +A+GR      VAH+S+++++L   YP +    KC++E+     + +   K   LG+  
Sbjct  244   PDANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIFIPTYKVSKEKAESLGV-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S Q KGF+
Sbjct  303   FVPLEVSIKETVESLQDKGFI  323



>gb|KEH19926.1| cinnamyl alcohol dehydrogenase [Medicago truncatula]
Length=324

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 203/321 (63%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNP-GELEKVGFLWELKGAKERLKILKGDVME  904
             CVTG +G I S++VK LL +GY+VR TVR+P G  +KV  L +L GAKERL++ K D++E
Sbjct  9     CVTGASGFIASWIVKFLLQRGYTVRATVRDPTGNPKKVDHLLKLDGAKERLQLFKADLLE  68

Query  903   EGSMEDGFDGVDGVFHTASPV-LVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVL  730
             EGS +   +G DGVFHTASPV  V  D  ++  LIDP++KGTLNVL S A+   VKRVVL
Sbjct  69    EGSFDSVVEGCDGVFHTASPVRFVVNDPQVE--LIDPALKGTLNVLKSCAKSTSVKRVVL  126

Query  729   TSSCSCIRY--RHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             TSS + + +  R    ++  ++E+ +++ D+C+   LWY  +KT+AE  AWK+  +N+ I
Sbjct  127   TSSNAAVSFNTRPKNPEVV-VDETWFSNPDFCRESKLWYVLSKTLAEAAAWKFVNENN-I  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V GPLL P+   +++ IL ++ G+   +PNK +G+V+++D   AHI A E 
Sbjct  185   DMVSLNPTMVAGPLLQPEVNESVEPILNLINGI--PFPNKAIGWVNVKDVANAHIHAYEI  242

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR + +  V H+S++  +LR  YP+ P   KC ++      + +   K    G+  
Sbjct  243   ASASGRCLLAERVVHYSELAMILRDLYPTLPISDKCEDDGPYMPTYQISKEKAKSFGI-E  301

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + SF++K F+
Sbjct  302   FTPLEISLKETVESFREKKFI  322



>ref|XP_008382526.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Malus domestica]
Length=327

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 131/331 (40%), Positives = 207/331 (63%), Gaps = 10/331 (3%)
 Frame = -2

Query  1116  MDEQAKSKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKE  937
             MDE+ +SK  + CVTG +G + S L+K LL  GY V  TVR+ G  + +  LW+L+GAKE
Sbjct  1     MDEKLESK-GKVCVTGASGYLASCLIKRLLLSGYHVIGTVRDLGNQKXLAHLWKLEGAKE  59

Query  936   RLKILKGDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSAR  757
             RL++++ D+M+E S +D   G  GVFH+ASPVL     + ++ +++P+++GTLNVL S +
Sbjct  60    RLRLVEADLMKECSFDDAILGCHGVFHSASPVLKKPSSDPKREVLEPAIEGTLNVLRSCK  119

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQIS--PLNESHWTDLDYCKRYNLWYAYAKTMAEQEA  586
             K   ++RVVLTSS + +R R D    S   L+ES W+ +++C+R  LWY  +K +AE+ A
Sbjct  120   KNPSLRRVVLTSSSTALRNRPDEDLASCVKLDESSWSSVEHCQRLQLWYPLSKVLAEKAA  179

Query  585   WKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDA  406
               + ++N GI+LV V  ++V+GP L+P    T   +L+++KG    Y   R+G+VHI+D 
Sbjct  180   GDFCKEN-GIDLVTVLPAWVIGPSLSPDLCLTASRVLSLLKGDTVWY--GRMGYVHIDDV  236

Query  405   VRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDC  226
                HIL  E ++A GR +CS+TV    ++  +L  +YPS P   +   ++     +  D 
Sbjct  237   ALCHILVYEHESAHGRYLCSSTVLDNDELASLLSMRYPSLPIAKRL--KQVSRPYYEFDT  294

Query  225   TKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             +K+  LG   F ++ +MFDDCI S  ++G L
Sbjct  295   SKLQSLGF-KFKSIQEMFDDCIDSLVEQGHL  324



>ref|XP_009592182.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana tomentosiformis]
Length=322

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/318 (41%), Positives = 191/318 (60%), Gaps = 6/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ +VR+P + +K   L  L GAKERL + K +++EE
Sbjct  9     CVTGASGYIASWLVKFLLQRGYTVKASVRDPNDPKKTQHLLSLGGAKERLHLFKANLLEE  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLTS  724
             GS +   DG +GVFHTASP       + Q  L+DP+VKGTLN+L S A+   VKRVVLTS
Sbjct  69    GSFDAVVDGCEGVFHTASPFYYSVT-DPQAELLDPAVKGTLNLLGSCAKAPSVKRVVLTS  127

Query  723   SCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             S + + Y     T    ++ES WT  DYC+   LWY  +KT+AE  AWK+ ++  GI++V
Sbjct  128   SIAAVAYSGQPRTPEVVVDESWWTSPDYCREKQLWYVLSKTLAEDAAWKFVKEK-GIDMV  186

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNA  367
              +N + V+GPLL P   ++   +L +V G    YPN   G+V+++D   AHILA E  +A
Sbjct  187   AINPAMVIGPLLQPTLNTSSGAVLNLVNG-AETYPNSTFGWVNVKDVANAHILAFENPSA  245

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
             +GR +    VAH+S I+ +LR  YP+     KC+++      + +   +   LG+  F  
Sbjct  246   NGRYLMVERVAHYSDILKILRDLYPTMRLPEKCADDNPLMQNYQVSKERAKNLGV-KFTP  304

Query  186   LSQMFDDCIHSFQQKGFL  133
             L +   + + S ++K F 
Sbjct  305   LEESIKETVESLKEKRFF  322



>gb|KHN20640.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=325

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/321 (40%), Positives = 193/321 (60%), Gaps = 14/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S++VK LL++GY+VR TVRNP +  KV  L +L+GAKERL + K D++ E
Sbjct  10    CVTGAAGYIASWIVKFLLERGYTVRATVRNPNDHTKVEHLLKLEGAKERLHLFKADLLGE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
              S +   +G DGVFHTASP ++    + Q  L+DP+VKGTLNVL S  K   VKRV+LTS
Sbjct  70    NSFDSIVEGCDGVFHTASPFIINV-KDPQADLLDPAVKGTLNVLKSCVKSPSVKRVILTS  128

Query  723   SCSCIRY--RHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIEL  550
             S + + Y  R  + ++  ++E+ W+D DYC+   LWY  +KT+AE  AWK+A++ND ++L
Sbjct  129   SVAAVAYNKRPKSPEVV-VDETWWSDPDYCRELKLWYLLSKTLAEDAAWKFAKEND-LDL  186

Query  549   VVVNLSFVVGplltpqptstlqliLAIVKGLIG---EYPNKRVGFVHIEDAVRAHILAME  379
             VVVN + VVG    P   + L    AI+  LI     + N   G+++++D   AHI A E
Sbjct  187   VVVNPAMVVG----PLLQAELNTSAAIILNLINGSETFSNDTYGWINVKDVANAHIQAYE  242

Query  378   AQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLP  199
               +ASGR      VAH+S++  +LR +YP+Y    K ++++       +   K   LG+ 
Sbjct  243   IASASGRYCLVERVAHYSELARILRDQYPTYQIPEKSADDKPYVPTFQVSKEKAKTLGI-  301

Query  198   PFATLSQMFDDCIHSFQQKGF  136
              F  L     + + + ++K F
Sbjct  302   EFIPLEVSLRETVETLKEKNF  322



>gb|KFK35854.1| hypothetical protein AALP_AA4G045500 [Arabis alpina]
Length=325

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/321 (40%), Positives = 198/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GA+ERLK+ K +++EE
Sbjct  10    CVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG  GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL+S  K   VKRVV
Sbjct  70    GSFDSAIDGCQGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++ES + D DYC+   LWY  +KT+AE  AW +A++ND +
Sbjct  126   LTSSIAAVAFNGMPRTPDTIVDESWFADPDYCRASKLWYVLSKTLAENSAWTFAKEND-M  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  185   QLVSINPAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +A+GR      VAH+S+++++L   YP +    KC++E+     + +   K   LG+  
Sbjct  244   PDANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIFIPTYKVSKEKAESLGV-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S + KGF+
Sbjct  303   FVPLEVSIKETVESLRDKGFI  323



>ref|XP_003531735.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Glycine max]
Length=333

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/317 (41%), Positives = 189/317 (60%), Gaps = 9/317 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S+LVK LL+KGY+VR TVRNP +  K G L EL+G KERL + K D+ + 
Sbjct  15    CVTGAGGFIASWLVKHLLEKGYTVRGTVRNPDD-PKNGHLKELEGGKERLTLHKVDLFDI  73

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S+++  +G  GVFHTASPV      +  + +++P+V GT NV+T+A +  V+RVV TSS
Sbjct  74    DSIKEALNGCHGVFHTASPVT-----DNPEEMVEPAVNGTKNVITAAAEAKVRRVVFTSS  128

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
                +    + ++ + ++ES W+DL+YCK    WY Y KT+AEQ AW  A++  G++LVVV
Sbjct  129   IGTVYMDPNTSRDALVDESFWSDLEYCKNTKNWYCYGKTVAEQTAWDVAKER-GVDLVVV  187

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N   V+GPLL P   ++   IL  + G    Y N    ++H+ D   AHIL  E  +ASG
Sbjct  188   NPVLVIGPLLQPTINASTIHILKYLTGSAKTYVNATQAYIHVRDVALAHILVYETPSASG  247

Query  360   RLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDD-SEHSLDCTKIMELGLPPFATL  184
             R IC+ +  H  +++ +L   +P YP  TKCS+E+      +     K+ +LGL  F  +
Sbjct  248   RYICAESSLHRGELVEILAKFFPEYPIPTKCSDEKNPRVKPYIFSNQKLKDLGL-EFTPV  306

Query  183   SQMFDDCIHSFQQKGFL  133
              Q   D + + Q+ G L
Sbjct  307   KQCLYDTVKNLQENGHL  323



>emb|CDY22576.1| BnaC05g24140D [Brassica napus]
Length=325

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/321 (40%), Positives = 198/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GA ERL++ K +++EE
Sbjct  10    CVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAAERLQLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG  GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL++  K   VKRVV
Sbjct  70    GSFDSAIDGCQGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSTCLKTPSVKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++ES + D +YC+   LWY  +KT+AE  AWK+A++ND +
Sbjct  126   LTSSIAAVAFNGMPRTPDTIVDESWFADPEYCRAAKLWYVLSKTLAENAAWKFAKEND-M  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  185   QLVSINAAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +A+GR      VAH+S+++++L   YP +    KCS+E+     + +   K   LG+  
Sbjct  244   PDANGRYCLVERVAHYSEVVNILHDLYPDFQLPQKCSDEKIFIPTYKVSKEKAEFLGV-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S Q KGF+
Sbjct  303   FVPLEVSIKETVESLQDKGFI  323



>pdb|4QTZ|A Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydrogenase 
2
Length=321

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 199/320 (62%), Gaps = 12/320 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LV+ LL +GY+V+ TVR+P + +KV  L +L GAKERL++ K +++EE
Sbjct  6     CVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLEE  65

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             G+ +    G  GVFHTAS    P+ H++   Q  LIDP++KGTLNVL S A+   +KRVV
Sbjct  66    GAFDSVVQGCHGVFHTAS----PFYHDVKDPQAELIDPALKGTLNVLNSCAKSPSLKRVV  121

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ +TD D+C + NLWY  +KT+AE+ AWK+ ++N+ I
Sbjct  122   LTSSIAAVAYNGKPRTPDVVVDETWFTDADFCAKSNLWYVVSKTLAEEAAWKFVKENN-I  180

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V+GPLL P   ++   IL ++ G    +PN   G+V+++D   AHILA E 
Sbjct  181   DMVTINPAMVIGPLLQPVLNTSAAAILNLING-AQTFPNASFGWVNVKDVANAHILAYEN  239

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR      VAH+S+++ +LR  YPS     KC++++     + +   K   LGL  
Sbjct  240   ASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGL-E  298

Query  195   FATLSQMFDDCIHSFQQKGF  136
             +  L     + + S ++K F
Sbjct  299   YTPLEVSIKETVESLKEKKF  318



>ref|XP_003598002.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AES68253.1| cinnamyl-alcohol dehydrogenase-like protein [Medicago truncatula]
Length=326

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 199/320 (62%), Gaps = 12/320 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LV+ LL +GY+V+ TVR+P + +KV  L +L GAKERL++ K +++EE
Sbjct  11    CVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLEE  70

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             G+ +    G  GVFHTAS    P+ H++   Q  LIDP++KGTLNVL S A+   +KRVV
Sbjct  71    GAFDSVVQGCHGVFHTAS----PFYHDVKDPQAELIDPALKGTLNVLNSCAKSPSLKRVV  126

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ +TD D+C + NLWY  +KT+AE+ AWK+ ++N+ I
Sbjct  127   LTSSIAAVAYNGKPRTPDVVVDETWFTDADFCAKSNLWYVVSKTLAEEAAWKFVKENN-I  185

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V+GPLL P   ++   IL ++ G    +PN   G+V+++D   AHILA E 
Sbjct  186   DMVTINPAMVIGPLLQPVLNTSAAAILNLING-AQTFPNASFGWVNVKDVANAHILAYEN  244

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR      VAH+S+++ +LR  YPS     KC++++     + +   K   LGL  
Sbjct  245   ASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGL-E  303

Query  195   FATLSQMFDDCIHSFQQKGF  136
             +  L     + + S ++K F
Sbjct  304   YTPLEVSIKETVESLKEKKF  323



>ref|NP_175552.2| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAY78648.1| putative cinnamyl-alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AEE32665.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=325

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 199/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GA+ERLK+ K +++EE
Sbjct  10    CVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG +GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL+S  K   VKRVV
Sbjct  70    GSFDSAIDGCEGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++E+ + D DYC+   LWY  +KT+AE  AWK+A++N+ +
Sbjct  126   LTSSIAAVAFNGMPRTPETIVDETWFADPDYCRASKLWYVLSKTLAENAAWKFAKENN-L  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  185   QLVSINPAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +A GR      VAH+S+++++L   YP +    KC++E+     + +   K   LG+  
Sbjct  244   PDADGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIYIPTYKVSKEKAESLGV-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S + KGF+
Sbjct  303   FVPLEVSIKETVESLRDKGFI  323



>ref|XP_006493352.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Citrus sinensis]
Length=338

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 192/319 (60%), Gaps = 11/319 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S++VK LL+KGYSV+ TVRNP +  K   L EL+GAKERL + K D+++ 
Sbjct  15    CVTGAAGFIASWIVKFLLEKGYSVKGTVRNPDD-PKNAHLRELEGAKERLALCKADLLDY  73

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S+++ F+G DGVFHTASPV      +  + +++P+V GT NV+ +A +  V+RVV TSS
Sbjct  74    ESLKEAFNGCDGVFHTASPVT-----DDPEKMLEPAVIGTKNVIVAAAEAKVRRVVFTSS  128

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
                +    + +    ++E  W+DL+YCK    WY YAKT+AE+ AW+ A+   G++LVVV
Sbjct  129   IGTVYMDPNRSPDIVVDEHCWSDLEYCKNTKNWYCYAKTVAEKAAWEEAKAR-GLDLVVV  187

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N   V+G LL P   +++  IL  + G +  Y N   G+V + D   AHIL  E  +ASG
Sbjct  188   NPMLVIGTLLQPTVNASIIHILKYLTGSVKTYANSVQGYVDVRDVALAHILVYETPSASG  247

Query  360   RLIC--STTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSE-HSLDCTKIMELGLPPFA  190
             R IC  S ++ H  +++  L   +P YP  TKC +E+   ++ +     KI +LGL  F 
Sbjct  248   RYICADSDSIIHRGEVVETLTKFFPEYPIPTKCKDEKSPRAKPYKYSNHKIKDLGL-KFT  306

Query  189   TLSQMFDDCIHSFQQKGFL  133
              + Q   D + S Q+KG L
Sbjct  307   PVRQCLYDSVKSLQEKGHL  325



>ref|XP_007043128.1| Dihydroflavonol 4-reductase-like1 [Theobroma cacao]
 gb|EOX98959.1| Dihydroflavonol 4-reductase-like1 [Theobroma cacao]
Length=357

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 136/342 (40%), Positives = 202/342 (59%), Gaps = 30/342 (9%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL  GY V  TVR+PG  +K+  LW L+GAKERL++++ +++EE
Sbjct  9     CVTGASGFLASWLVKRLLLSGYHVIGTVRDPGNEKKLAHLWRLEGAKERLRLVRAELLEE  68

Query  900   GSMEDGFDGVDGVFHTASPVLVP-YDH----------NI-QKTLIDPSVKGTLNVLTSAR  757
             GS +D   G  GVFHTASPV+ P +D           NI    +++P+VKGT+NVL S +
Sbjct  69    GSFDDAIMGCQGVFHTASPVIKPSFDPKACSSIFGLLNICMAEILEPAVKGTVNVLRSCK  128

Query  756   KM-MVKRVVLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYN-------------LWY  619
             K   ++RVVLTSS + +R R+D     PL+ES W+ ++ C+                +WY
Sbjct  129   KNPSLRRVVLTSSSAAVRARNDIDPKVPLDESSWSSIELCEMLQFLPEHDNGGALQKIWY  188

Query  618   AYAKTMAEQEAWKWAEQNDGIELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPN  439
             A +KT AE+ AW++  +N  I+LV +  SFV+GP L P   ST   +LA++KG      +
Sbjct  189   ALSKTQAEKAAWEFCNENK-IDLVTILPSFVLGPCLPPDLCSTASDVLALLKGETEIKWH  247

Query  438   KRVGFVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNE  259
              R+G+VHI+D    HIL  E + A+GR +CS+TV    ++  +L  +YPS     +   E
Sbjct  248   GRMGYVHIDDVALCHILVYEHEAANGRYLCSSTVIDNDELAAILSARYPSLTVPKR--FE  305

Query  258   EGDDSEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             + D   +  + +KI  LG   F  + +M DDCI S  ++G L
Sbjct  306   DVDRPYYEFNTSKIRSLGF-NFRPIEEMLDDCIESLVEQGHL  346



>emb|CDY43911.1| BnaA05g15210D [Brassica napus]
Length=325

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 197/321 (61%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P +  K   L  L+GAKERL++ K +++EE
Sbjct  10    CVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAKERLQLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG  GVFHTAS    P+ H++   Q  L+DP+VKGT+NVL++  K   VKRVV
Sbjct  70    GSFDSAIDGCQGVFHTAS----PFYHDVKDPQAELLDPAVKGTINVLSTCLKTPSVKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T  + ++E+ + D  YC+   LWY  +KT+AE  AWK+A++ND +
Sbjct  126   LTSSIASVAFNGMPRTPETIVDETWFADPGYCRAAKLWYVLSKTLAENAAWKFAKEND-L  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L+++KG    +PN   G+V+++D   AHI A E 
Sbjct  185   QLVSINAAMVIGPLLQPTLNTSAAAVLSLIKG-AQTFPNATFGWVNVKDVANAHIQAFEN  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               A+GR      VAH+S+++++L   YP +    KC++E+     + +   K   LG+  
Sbjct  244   PTANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIYIPTYKVSKEKAESLGV-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S Q KGF+
Sbjct  303   FVPLEVSIKETVESLQDKGFI  323



>gb|AAX83110.1| alcohol dehydrogenase-like protein [Ocimum basilicum]
Length=325

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 129/321 (40%), Positives = 195/321 (61%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL KGY+V+ +VR+P + +K   L  L GAKERL ++K ++++E
Sbjct  10    CVTGASGFIASWLVKFLLQKGYTVKASVRDPNDPKKTEHLLALDGAKERLCLMKANLLDE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG +GVFHTAS    P+ H +   Q  LIDP++KGTLNVL S  K   VK++V
Sbjct  70    GSFDSIVDGCEGVFHTAS----PFYHAVKDPQAELIDPALKGTLNVLGSCVKTSSVKKIV  125

Query  732   LTSSCSCIRY-RHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ W+D + CK+  LWY  +KT+AE  AWK+ ++ D I
Sbjct  126   LTSSIAAVAYCGKPRTPEVIVDETWWSDPEICKQMQLWYVLSKTLAEDAAWKFVKEKD-I  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V+GPLL P   ++   IL ++ G    YPN   G+++++D   AHILA E 
Sbjct  185   DMVAINPAMVIGPLLQPTLNTSAAAILNLING-AETYPNSSFGWINVKDVAHAHILAFEN  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR      VAHFS+++ +LR  YP+Y    KC++++     + +   K   LGL  
Sbjct  244   ASASGRYCLVERVAHFSEVVKILRGLYPTYKLPEKCADDKPFVPIYQVSKEKAKSLGL-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L +   + +   ++K F 
Sbjct  303   FTPLEEGIKETVERLKEKNFF  323



>ref|XP_003543630.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoformX1 [Glycine 
max]
 gb|KHN32639.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=331

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 193/320 (60%), Gaps = 7/320 (2%)
 Frame = -2

Query  1092  RPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGD  913
             R   CVTG +G + S+L+K LL  GY V  TVR+ G+ +K  +LW L+GA ERL++++ D
Sbjct  6     RGRVCVTGASGFLASWLIKRLLLSGYHVIGTVRDLGKQKKYEYLWCLEGATERLQLVQAD  65

Query  912   VMEEGSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRV  736
             +MEE S ++   G  GVFH ASPVL     + +  +++P+VKGTLNVL S  K   + RV
Sbjct  66    LMEESSFDNAIMGCKGVFHVASPVLNTIS-DPKSEILEPAVKGTLNVLRSCGKNPALCRV  124

Query  735   VLTSSCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             VLTSS S +R R D    +PL+ES W+ L+ C++   WYA AKT AE+ AW++  +N GI
Sbjct  125   VLTSSSSTLRLRDDFDPNTPLDESSWSSLEICEKLQAWYAMAKTQAERAAWEYCIEN-GI  183

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYP-NKRVGFVHIEDAVRAHILAME  379
              LV V  SF++GP L P   ST   +L ++KG    +    R+G+VHI+D     IL  E
Sbjct  184   NLVTVLPSFIIGPSLPPNLCSTASDVLGLLKGETKRFQLLGRMGYVHIDDVALCQILVYE  243

Query  378   AQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLP  199
              + + GR +CS+TV     +  +L  +YP+ P   +   E+ D   + L+  K+  LG  
Sbjct  244   NEGSHGRYLCSSTVMDEDDLAALLANRYPTLPISKRF--EKLDRPNYELNTGKLRSLGF-  300

Query  198   PFATLSQMFDDCIHSFQQKG  139
              F ++ +MFDDCI S  ++G
Sbjct  301   NFKSVEEMFDDCIASLVKQG  320



>gb|AFK47262.1| unknown [Medicago truncatula]
Length=326

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 198/320 (62%), Gaps = 12/320 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LV+ LL +GY+V+ TVR+P + +KV  L +L GAKERL++ K +++EE
Sbjct  11    CVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLEE  70

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             G+ +    G  GVFHTAS    P+ H++   Q  LIDP++KGTLNVL S A+   +KRVV
Sbjct  71    GAFDSVVQGCHGVFHTAS----PFYHDVKDPQAELIDPALKGTLNVLNSCAKSPSLKRVV  126

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    + E+ +TD D+C + NLWY  +KT+AE+ AWK+ ++N+ I
Sbjct  127   LTSSIAAVAYNGKPRTPDVVVGETWFTDADFCAKSNLWYVVSKTLAEEAAWKFVKENN-I  185

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V+GPLL P   ++   IL ++ G    +PN   G+V+++D   AHILA E 
Sbjct  186   DMVTINPAMVIGPLLQPVLNTSAAAILNLING-AQTFPNASFGWVNVKDVANAHILAYEN  244

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR      VAH+S+++ +LR  YPS     KC++++     + +   K   LGL  
Sbjct  245   ASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGL-E  303

Query  195   FATLSQMFDDCIHSFQQKGF  136
             +  L     + + S ++K F
Sbjct  304   YTPLEVSIKETVESLKEKKF  323



>ref|XP_003529771.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Glycine max]
Length=332

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 187/317 (59%), Gaps = 9/317 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S+LVK LL+KGY+VR TVRNP +  K G L EL+G KERL + K D+ + 
Sbjct  14    CVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDD-PKNGHLKELEGGKERLTLHKVDLFDI  72

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S++    G  GVFHTASPV      +  + +++P+VKGT NV+ +A +  V+RVV TSS
Sbjct  73    ASIKAALHGCHGVFHTASPVT-----DNPEEMVEPAVKGTKNVIIAAAEAKVRRVVFTSS  127

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
                +    + ++ + ++ES W+DL+YCK    WY Y KT+AEQ AW  A++  G++LVVV
Sbjct  128   IGTVYMDPNTSRDALVDESFWSDLEYCKNTKNWYCYGKTVAEQAAWDVAKER-GVDLVVV  186

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N   V+GPLL P   ++   IL  + G    Y N    +VH+ D   AHIL  E  +ASG
Sbjct  187   NPVLVIGPLLQPTINASTIHILKYLTGSAKTYVNATQAYVHVRDVALAHILVYETPSASG  246

Query  360   RLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDD-SEHSLDCTKIMELGLPPFATL  184
             R IC+ +  H  +++ +L   +P YP  TKCS+E+      +     K+ +LGL  F  +
Sbjct  247   RFICAESSLHRGELVEILAKFFPEYPIPTKCSDEKNPRVKPYIFSNQKLKDLGL-EFTPV  305

Query  183   SQMFDDCIHSFQQKGFL  133
              Q   D + + Q+ G L
Sbjct  306   KQCLYDTVKNLQENGHL  322



>ref|XP_002977011.1| hypothetical protein SELMODRAFT_175949 [Selaginella moellendorffii]
 gb|EFJ22121.1| hypothetical protein SELMODRAFT_175949 [Selaginella moellendorffii]
Length=327

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 126/318 (40%), Positives = 193/318 (61%), Gaps = 5/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LLD+GY VR TVR+  +  +   L  L GA+ERL++++ D++++
Sbjct  9     CVTGASGFIASFLVKLLLDRGYKVRGTVRSLTDPSRTSHLRGLPGAEERLELVEADLLKD  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLTS  724
             G+  D      GVFHTASP  +    + ++ LI P+V+GTLNVL + +R   V +VV+TS
Sbjct  69    GAFNDVVKDCQGVFHTASPFFLAGVTDPERQLIQPAVQGTLNVLEACSRSPSVAKVVVTS  128

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S + + Y    T  + ++ES ++D DYC+    WY  +KT+AEQEAWK+A++  G+ LV 
Sbjct  129   STAAVAYNPKRTPDTVVDESCFSDPDYCREMKAWYILSKTLAEQEAWKFAKEK-GLNLVT  187

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNAS  364
             +N + V+GPLL P   ++ ++IL ++ G    Y N  +G+V + D   AH+LA E  NAS
Sbjct  188   INPAMVIGPLLQPTLNTSCEIILKLINGSKTHYSNACLGWVGVGDVAEAHLLAYENPNAS  247

Query  363   GRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCS-NEEGDDSEHSLDCTKIM-ELGLPPFA  190
             GR +C   VAH+  ++  LR  YP YP  T+C  N     + +++   K+  ELGL  F 
Sbjct  248   GRYLCVERVAHYEDVVETLRKLYPEYPIPTECEDNGSPKATPYAISTRKLQEELGL-RFH  306

Query  189   TLSQMFDDCIHSFQQKGF  136
             +L     +C+ S +   F
Sbjct  307   SLEHNLKECVESLKLNHF  324



>ref|XP_009758397.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana sylvestris]
Length=322

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 191/317 (60%), Gaps = 9/317 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S+LVK LL+KGY+VR TVRNP +  K   L EL+GAKERL + + D+++ 
Sbjct  10    CVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDD-AKNSHLRELEGAKERLTLCRADLLDY  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S+ +   G DGVFHTASPV      +  + +++P+V GT NV+T+A +  V+RVV TSS
Sbjct  69    QSLREAIYGCDGVFHTASPVT-----DDPEQMVEPAVIGTKNVVTAAAEAKVQRVVFTSS  123

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
                +    +      ++E+ W+DLD+CK    WY Y KT+AEQ AW+ +++  G++LVV+
Sbjct  124   IGTVYMDPNRAPDKVVDETCWSDLDFCKNTKNWYCYGKTIAEQTAWEMSKEK-GVDLVVI  182

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N   V+GPLL P   +++  IL  + G    Y N    +VH++D   AHIL  E  +ASG
Sbjct  183   NPVLVLGPLLQPTVNASVLHILKYLTGSAKTYANSVQAYVHVKDVALAHILIYETPSASG  242

Query  360   RLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSE-HSLDCTKIMELGLPPFATL  184
             R IC+ +V H   ++ +L   +P YP  TKCS+E    ++ +     K+ +LGL  F  +
Sbjct  243   RYICAESVLHRGDVVEILAKFFPEYPIPTKCSDETRPRAKPYKFTNQKLKDLGL-EFTPV  301

Query  183   SQMFDDCIHSFQQKGFL  133
              Q   + + + Q+KG L
Sbjct  302   KQCLYETVKNLQEKGHL  318



>ref|XP_010673664.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673665.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=330

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 201/320 (63%), Gaps = 9/320 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL+ GY+V  TVR+P +  K+  L  L+GAKERL + K D++EE
Sbjct  11    CVTGASGYIASWLVKLLLNHGYTVHATVRDPNDEVKIVHLLNLEGAKERLHLFKADLLEE  70

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
             GS +    G  GVFHTASPVL     + Q  ++DP+VKGTLNVLTS +K   V+RVVLTS
Sbjct  71    GSFDSAISGCHGVFHTASPVLFTVK-DPQADVLDPAVKGTLNVLTSCKKFPSVRRVVLTS  129

Query  723   SCSCIRY--RHDATQISPLNESHWTDLDYCKRYN-LWYAYAKTMAEQEAWKWAEQNDGIE  553
             S + + +  +  A ++  ++ES  +D + CK  + +WY  +KT+AE  AWK+ ++N GI+
Sbjct  130   SMAAVLFTGKPRAPEVV-VDESWISDPELCKESSIMWYTLSKTLAEDAAWKFVKEN-GID  187

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             ++ +N + VVGP+L P   S++  IL ++ G    YPN   G+VH++D   AHILA E +
Sbjct  188   MISINPAMVVGPMLQPSLNSSVAPILNLING-AETYPNAAFGWVHVKDVATAHILAFEVR  246

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
             +ASGR I + TVAH S+I+ +L+  YP+     KC++++     + +   K   LG+  +
Sbjct  247   SASGRYILAETVAHCSEIVKILQELYPALTLPDKCADDKPLAPTYQVSKEKAKSLGI-NY  305

Query  192   ATLSQMFDDCIHSFQQKGFL  133
               L     + + + ++KG +
Sbjct  306   IPLKVSLKETVENLKEKGLV  325



>ref|XP_010102363.1| hypothetical protein L484_015312 [Morus notabilis]
 gb|EXB93324.1| hypothetical protein L484_015312 [Morus notabilis]
Length=328

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 130/321 (40%), Positives = 197/321 (61%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ +VR+P + +K   L  L GAKERL++ K D++EE
Sbjct  13    CVTGASGYIASWLVKFLLQRGYTVKASVRDPNDQKKTAHLTSLDGAKERLQLFKADLLEE  72

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             GS +   +G +GVFHTAS    P+ H++   +  L+DP+VKGTLNVL S A+   VKRVV
Sbjct  73    GSFDSVIEGSEGVFHTAS----PFYHDVKDPEAELLDPAVKGTLNVLNSCAKSSSVKRVV  128

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ ++D D CK    WY  +KT+AE  AWK+ ++  GI
Sbjct  129   LTSSIAAVSYNGKPRTPDVIVDETWFSDPDICKELKQWYVLSKTLAEDAAWKFVKEK-GI  187

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   IL ++ G    + N  +G+V+++D   AHILA E 
Sbjct  188   DLVTMNPAMVIGPLLQPTLNTSAAAILNLING-AQTFLNFTLGWVNVKDVANAHILAYEV  246

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR     +VAH+S+I+ +LR  YPS P   KC++++     + +   K   LG+  
Sbjct  247   PSASGRYCLVESVAHYSEIVRLLRELYPSLPLPEKCADDKLFMPTYQVSKEKATSLGI-D  305

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S ++K F+
Sbjct  306   FIPLKTGLKETVESLKEKQFV  326



>gb|ACJ85556.1| unknown [Medicago truncatula]
Length=326

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 199/320 (62%), Gaps = 12/320 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LV+ LL +GY+V+ TVR+P + +KV  L +L GAKERL++ K +++EE
Sbjct  11    CVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLEE  70

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKT---LIDPSVKGTLNVLTS-ARKMMVKRVV  733
             G+ +    G  GVFHTAS    P+ H+++     LIDP++KGTLNVL S A+   +KRVV
Sbjct  71    GAFDSVVQGCHGVFHTAS----PFYHDVKDPRAELIDPALKGTLNVLNSCAKSSSLKRVV  126

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ +TD D+C + NLWY  +KT+AE+ AWK+ ++N+ I
Sbjct  127   LTSSIAAVAYNGKPRTPDVVVDETWFTDADFCAKSNLWYVVSKTLAEEAAWKFVKENN-I  185

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V+GPLL P   ++   IL ++ G    +PN   G+V+++D   AHILA E 
Sbjct  186   DMVTINPAMVIGPLLQPVLNTSAAAILNLING-AQTFPNASFGWVNVKDVANAHILAYEN  244

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR      VAH+S+++ +LR  YPS     KC++++     + +   K   LGL  
Sbjct  245   ASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGL-E  303

Query  195   FATLSQMFDDCIHSFQQKGF  136
             +  L     + + S ++K F
Sbjct  304   YTPLEVSIKETVESLKEKKF  323



>ref|XP_011073328.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=332

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 189/317 (60%), Gaps = 9/317 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G + S+LVK LL+KGYSVR TVRNP +  K   L EL+GA+ERL + + D+ + 
Sbjct  10    CVTGAGGFVASWLVKLLLEKGYSVRGTVRNPDD-PKNSHLRELEGAEERLILCRADLNDY  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S+++  +G DGVFHTASPV      +  + +++P+V G  NV+ +A +  V RVVLTSS
Sbjct  69    QSLQEAINGCDGVFHTASPVT-----DDPEEMVEPAVNGARNVIRAAAEAKVSRVVLTSS  123

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
                I    +      ++E+ W+DL++CK    WY Y K +AEQ AW  AE+  G++LVV+
Sbjct  124   IGAIYMDPNRDPDKVVDETCWSDLEFCKNTKNWYCYGKAVAEQAAWDTAEEF-GVDLVVI  182

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N   V+GPLL     +++  IL  + G    Y N    +VH++D   AHIL  EA  ASG
Sbjct  183   NPVLVLGPLLQRTVNASVLHILKYLTGSAKTYANSIQAYVHVKDVALAHILLFEAPAASG  242

Query  360   RLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSE-HSLDCTKIMELGLPPFATL  184
             R +C+ +V H S+++ +L   +P YP  +KCS+E+    + +     K+ ELGL  F  +
Sbjct  243   RHLCAESVLHRSEVVEILAKFFPEYPIPSKCSDEKNPRKKAYKFSNQKLKELGL-EFTPV  301

Query  183   SQMFDDCIHSFQQKGFL  133
              Q   D + S ++KG L
Sbjct  302   KQCLYDTVKSLEEKGHL  318



>ref|NP_001274901.1| cinnamoyl CoA reductase [Solanum tuberosum]
 gb|AAN71761.1| cinnamoyl CoA reductase [Solanum tuberosum]
Length=332

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 190/317 (60%), Gaps = 9/317 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S+LVK LL+KGY+VR TVRNP +  K G L EL+GAKERL +L+ D+++ 
Sbjct  10    CVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDD-PKNGHLKELEGAKERLILLRADLLDY  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S+ +   G DGVFHTASPV      +  + +++P+V GT NV+T+A +  V RVV TSS
Sbjct  69    QSLREAIYGCDGVFHTASPVT-----DDPEQMVEPAVIGTKNVITAAAEAKVGRVVFTSS  123

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
                +    +      ++E+ W+DL +CK    WY Y KT+AE+ AW  A +  G++LVV+
Sbjct  124   IGTVYMDPNRAPDKVVDETCWSDLGFCKNTKNWYCYGKTVAEKTAWDEAREK-GVDLVVI  182

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N   V+GPLL P   +++  IL  + G    Y N    +VH++D   AHIL  EA +ASG
Sbjct  183   NPVLVLGPLLQPTVNASVLHILKYLTGSAKTYANSIQAYVHVKDVALAHILLYEAPSASG  242

Query  360   RLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSE-HSLDCTKIMELGLPPFATL  184
             R IC+ +V H   ++ +L   +P YP  TKCS+E    ++ +     K+ +LGL  F  +
Sbjct  243   RYICAESVLHRGDVVEILAKFFPEYPIPTKCSDETRPRAKPYKFTNQKLKDLGL-GFTPV  301

Query  183   SQMFDDCIHSFQQKGFL  133
              Q   + + S Q+KG L
Sbjct  302   KQCLYETVKSLQEKGHL  318



>ref|XP_002517788.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF44595.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=324

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 190/318 (60%), Gaps = 6/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTGG+G IGS+L+K LL KGY+V+ TVR+P + +K   L  L GAKERL + K D++ E
Sbjct  9     CVTGGSGYIGSWLIKHLLQKGYTVKATVRDPSDSKKTDHLLALDGAKERLHLFKADLLAE  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMM-VKRVVLTS  724
             GS +   DG DGVFH+ASPVL     + Q  LIDP++KGTLNVL S  K+  VKRVV+TS
Sbjct  69    GSFDSVVDGCDGVFHSASPVLFSAT-DPQTELIDPAIKGTLNVLKSCAKVKSVKRVVITS  127

Query  723   SCSCI-RYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             S + + R R   T    ++E+ ++D + CK   +WYA +KT+AE+ AW +A++N  I+LV
Sbjct  128   SMAAVLRSRRPLTADVVVDETWYSDPEVCKELKVWYALSKTLAEEAAWNFAKEN-AIDLV  186

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNA  367
              +N ++V+GP+L P   S++++IL ++KG    YPN       I D V  HI A E  +A
Sbjct  187   TINPTYVIGPMLQPTLNSSVEMILNLIKG-AETYPNAYYSSADIRDVVDVHIQAFEVPSA  245

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
             SGR      V H+S+++ ++   YP+     KC   +       +   K   LG+  +  
Sbjct  246   SGRYCVVPNVLHYSEVVKIIHEHYPTLHLPEKCDETQLLSPSFKVSNEKAKSLGI-NYIP  304

Query  186   LSQMFDDCIHSFQQKGFL  133
                     I S ++KGFL
Sbjct  305   FEVTLKGTIESLKEKGFL  322



>pdb|4QUK|A Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydrogenase 
2 Mutant K169a
Length=319

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 198/320 (62%), Gaps = 12/320 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LV+ LL +GY+V+ TVR+P + +KV  L +L GAKERL++ K +++EE
Sbjct  4     CVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLEE  63

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             G+ +    G  GVFHTAS    P+ H++   Q  LIDP++KGTLNVL S A+   +KRVV
Sbjct  64    GAFDSVVQGCHGVFHTAS----PFYHDVKDPQAELIDPALKGTLNVLNSCAKSPSLKRVV  119

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ +TD D+C + NLWY  + T+AE+ AWK+ ++N+ I
Sbjct  120   LTSSIAAVAYNGKPRTPDVVVDETWFTDADFCAKSNLWYVVSATLAEEAAWKFVKENN-I  178

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V+GPLL P   ++   IL ++ G    +PN   G+V+++D   AHILA E 
Sbjct  179   DMVTINPAMVIGPLLQPVLNTSAAAILNLING-AQTFPNASFGWVNVKDVANAHILAYEN  237

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR      VAH+S+++ +LR  YPS     KC++++     + +   K   LGL  
Sbjct  238   ASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGL-E  296

Query  195   FATLSQMFDDCIHSFQQKGF  136
             +  L     + + S ++K F
Sbjct  297   YTPLEVSIKETVESLKEKKF  316



>ref|NP_001234297.1| cinnamoyl-CoA reductase [Solanum lycopersicum]
 gb|AAY41880.1| cinnamoyl-CoA reductase [Solanum lycopersicum]
Length=332

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 132/317 (42%), Positives = 190/317 (60%), Gaps = 9/317 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S+LVK LL+KGY+VR TVRNP +  K G L EL+GAKERL +L+ D+++ 
Sbjct  10    CVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDD-SKNGHLKELEGAKERLILLRADLLDY  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S+ +   G DGVFHTASPV      +  + +++P+V GT NV+T+A +  V+RVV TSS
Sbjct  69    QSLREAIYGCDGVFHTASPVT-----DDPEQMVEPAVIGTKNVITAAAETKVRRVVFTSS  123

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
                +    +      ++E+ W+DLDYCK    WY Y KT+AE+ A   A +  G++LVV+
Sbjct  124   IGTVYMDPNRAPDKVVDETCWSDLDYCKNTKNWYCYGKTVAEKTARDEAREK-GVDLVVI  182

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N   V+GPLL P   +++  IL  + G    Y N    +VH++D   AHIL  EA +ASG
Sbjct  183   NPVLVLGPLLQPTVNASVLHILKYLTGSAKTYANSIQAYVHVKDVALAHILLYEAPSASG  242

Query  360   RLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSE-HSLDCTKIMELGLPPFATL  184
             R IC+  V H   ++ +L   +P YP  TKCS+E    ++ +     K+ +LGL  F  +
Sbjct  243   RYICAERVLHRGDVVEILAKFFPEYPIPTKCSDETRPRAKPYIFTNQKLKDLGL-EFTPV  301

Query  183   SQMFDDCIHSFQQKGFL  133
              Q   + + S Q+KG L
Sbjct  302   KQCLYETVKSLQEKGHL  318



>gb|EPS73808.1| alcohol dehydrogenase-like protein, partial [Genlisea aurea]
Length=322

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 130/320 (41%), Positives = 194/320 (61%), Gaps = 10/320 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL +GY VR +VR+P + +K   L  L GAKERL +LK +++E 
Sbjct  4     CVTGASGFVASWLVKLLLQRGYVVRASVRDPNDPKKTEHLTSLDGAKERLTLLKANLLEN  63

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
             GS +   +G +GVFHTASP       + Q  LIDP+VKGTLNVL S  K   VKRVVLTS
Sbjct  64    GSFDSVVEGCEGVFHTASP-FFHTTTDPQVELIDPAVKGTLNVLGSCVKFPSVKRVVLTS  122

Query  723   SCSCIRYRHDATQISP---LNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIE  553
             S + + Y  +A   +P   ++E+ W+D + C+++  WY  +KT+AE  AWK+A++  GI+
Sbjct  123   SIAAVAY--NAKPRTPDVVVDETWWSDPEICRKFEQWYVLSKTLAEDAAWKFAKEK-GID  179

Query  552   LVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQ  373
             LV +N + V+GP+L P   ++   IL ++ G    +PN   G+++++D   AHILA E  
Sbjct  180   LVTINPAMVIGPMLQPSLNTSSAAILNLING-AETFPNTTFGWINVKDVALAHILAYEDP  238

Query  372   NASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPF  193
             +A+GR      VAH S+I+ +LR  YPS     KC++E+     + +   K   LG+  F
Sbjct  239   SANGRYCLVEKVAHASEIVKILRDLYPSLKLPEKCADEKPFVPTYQVSKGKANSLGV-EF  297

Query  192   ATLSQMFDDCIHSFQQKGFL  133
               L Q   + + S ++K F 
Sbjct  298   TPLEQGVKETVESLKEKNFF  317



>gb|EMT20121.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Aegilops tauschii]
Length=364

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 134/359 (37%), Positives = 207/359 (58%), Gaps = 40/359 (11%)
 Frame = -2

Query  1098  SKRPEYCVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILK  919
             S + + CVTG +G + S+L+K LL+ GY V  TVR+PG  +KVG LW+L GA ERL++++
Sbjct  4     STKGKVCVTGASGFLASWLIKRLLECGYHVIGTVRDPGNRKKVGHLWKLPGANERLQLVR  63

Query  918   GDVMEEGSMEDGFDGVDGVFHTASPVLVPYDHNI--------------------------  817
              D++EEGS +D     +GVFH ASPVL   D N                           
Sbjct  64    ADLLEEGSFDDAVMACEGVFHIASPVLGKSDSNCKACCICFQHSLYYHYHAMYLNMIFIS  123

Query  816   QKTLIDPSVKGTLNVLTSARKM-MVKRVVLTSSCSCIRYRHDATQISPL-NESHWTDLDY  643
             Q+  + P++ GTLNVL S +K   +KRVVLTSS S +R R +  Q   L +E+ W+ +  
Sbjct  124   QEATLGPAINGTLNVLRSCKKSPFLKRVVLTSSSSAVRIRDETQQPELLWDETTWSSVPL  183

Query  642   CKRYN--------LWYAYAKTMAEQEAWKWAEQNDGIELVVVNLSFVVGplltpqptstl  487
             C++          LWYA AK  AE+ A  +A++N+ I+LV V  SFV+GP L+ +  +T 
Sbjct  184   CEKLQFLFYAPKKLWYALAKVFAEKAALDFAKENN-IDLVTVLPSFVIGPSLSHELCTTA  242

Query  486   qliLAIVKGLIGEYPN-KRVGFVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHM  310
               IL +++G    + +  R+G+VHI+D  R+HIL  E   A GR +CS+ V   ++++ +
Sbjct  243   SDILGLLQGDTDRFTSYGRMGYVHIDDVARSHILVYETPEARGRYLCSSVVLDNNELVGL  302

Query  309   LRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
             L  ++P +P   + SN  G  + + L+ +K+  LGL  F  + +MF+DC+ S + +G L
Sbjct  303   LTKQFPVFPIPRRLSNPYGKQA-YQLNTSKLQGLGL-KFKGVQEMFNDCVESLKAQGHL  359



>emb|CAN78571.1| hypothetical protein VITISV_020578 [Vitis vinifera]
Length=377

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 136/350 (39%), Positives = 197/350 (56%), Gaps = 39/350 (11%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G + S+LVK LL  GY V  TVR+PG  +K+  LW L+GA+ERL +++ D+MEE
Sbjct  4     CVTGASGFLASWLVKRLLLSGYHVTGTVRDPGNDKKLAHLWRLEGARERLTLVRADLMEE  63

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKM-MVKRVVLTS  724
             GS +    G  GVFHTASPV+        + L+ P+V+GTLNVL S +K   ++RVVLTS
Sbjct  64    GSFDKAIMGCHGVFHTASPVMGSAADPKAEILV-PAVEGTLNVLRSCKKNPSLRRVVLTS  122

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S S  R R D     PL+ES W+ ++ C+   +WYA +K +AE+ AW++ ++N GI+LV 
Sbjct  123   SSSAARVRDDFDPKIPLDESSWSSVELCESLQIWYALSKVLAEKAAWEFCKEN-GIDLVT  181

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIG------------------EYP--------  442
             V  SFV+GP L P   ST   +L ++KG                     EY         
Sbjct  182   VLPSFVIGPSLPPDLCSTASDVLGLLKGSWSLFIPITIIYVRKYRNGKIEYKSVDLKQTG  241

Query  441   -------NKRVGFVHIEDAVRAHILAMEAQNASGRLICSTTVAHFSQIIHMLRPKYPSYP  283
                    N R+G+VHI+D    HIL  E +NA GR +C++ V   + +  +L  +YPS P
Sbjct  242   ETEKFKWNGRMGYVHIDDVALCHILVYEHENAHGRYLCNSAVVDNNVLASLLSARYPSLP  301

Query  282   YLTKCSNEEGDDSEHSLDCTKIMELGLPPFATLSQMFDDCIHSFQQKGFL  133
                +   +  D   +  + +K+  LG   F ++ +MFDDC+ S  +KG L
Sbjct  302   VPKRF--DALDRPYYEFNTSKLQSLGF-KFKSIQEMFDDCVASLVEKGHL  348



>ref|XP_009374930.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Pyrus x bretschneideri]
Length=325

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/321 (39%), Positives = 196/321 (61%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ ++R+P +  K   L  L GA++RL++ K +++EE
Sbjct  10    CVTGASGYIASWLVKLLLQRGYTVKASIRDPNDPTKTEHLHALDGAQDRLQLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             GS +   +G +GVFHTAS    P+ H++   +  L++P+VKGTLNVL S A+   +KRVV
Sbjct  70    GSFDSAVEGCEGVFHTAS----PFYHDVTDPKAELLEPAVKGTLNVLNSCAKSPSIKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ +TD D CK   LWY  +KT+AE  AWK+ ++  GI
Sbjct  126   LTSSIAAVAYNGKPRTPDVVIDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEK-GI  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L ++KG    +PN   G+++++D   AHI A E+
Sbjct  185   DLVTINPAMVIGPLLQPTLNTSAAAVLNVIKG-ARTFPNASFGWINVKDVANAHIQAFES  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               A GR     TVAHFS+++ +LR  YP+     KC++++     + +   K   LG+  
Sbjct  244   PTAGGRYCLVETVAHFSEVVRILRELYPTLQLPEKCADDKPFVPTYQVSKEKAKSLGV-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S ++KGF+
Sbjct  303   FIPLDVSLKETVESLKEKGFV  323



>ref|XP_006446146.1| hypothetical protein CICLE_v10015912mg [Citrus clementina]
 ref|XP_006470636.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Citrus sinensis]
 gb|ESR59386.1| hypothetical protein CICLE_v10015912mg [Citrus clementina]
 gb|KDO61219.1| hypothetical protein CISIN_1g020326mg [Citrus sinensis]
Length=327

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 198/321 (62%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ +VR+P + +K G L  L GA ERL++ K +++EE
Sbjct  12    CVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTGHLLALDGASERLQLFKANLLEE  71

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   DG DGVFHTAS    P+ H++   Q  L+DP+VKGT+NVL S  K   +KRVV
Sbjct  72    GSYDSVVDGCDGVFHTAS----PFYHDVKDPQVELLDPAVKGTVNVLNSCAKFPSIKRVV  127

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ ++D + CK+  LWY  +KT+AE  AWK+A++   I
Sbjct  128   LTSSMAAVAYNGKPRTPDVVVDETWFSDPEVCKQSKLWYVLSKTLAEDAAWKFAKEK-SI  186

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V+GPLL P   ++   +L+++KG    YPN  +G+V+++D   AHI A E 
Sbjct  187   DMVTINPAMVIGPLLQPTLNTSAAAVLSLIKG-AQTYPNATLGWVNVKDVANAHIQAFEV  245

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR      V H+S++++ +   YP++    KC++++     + +   K   LG+  
Sbjct  246   PSASGRYCLVERVLHYSKLVNTVHELYPTFELPEKCADDKPYVPTYQVSKEKAKNLGI-E  304

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + I S ++KGF+
Sbjct  305   FIPLEVSLKETIESLKEKGFV  325



>gb|ACF17647.1| putative cinnamoyl-CoA reductase [Capsicum annuum]
Length=334

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/317 (41%), Positives = 187/317 (59%), Gaps = 9/317 (3%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG  G I S+LVK LL KGY+VR TVRNP +  K   L EL+GAKERL + + D+++ 
Sbjct  10    CVTGAGGFIASWLVKILLQKGYTVRGTVRNPDD-PKNSHLRELEGAKERLTLCRADLLDY  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTSARKMMVKRVVLTSS  721
              S+ +   G DGVFHTASPV      +  + +++P+V GT NV+T+A +  V RVV TSS
Sbjct  69    QSLREAIYGCDGVFHTASPVT-----DDPEQMVEPAVIGTKNVITAAAEAKVGRVVFTSS  123

Query  720   CSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVVV  541
                +    D      ++E+ W+DLD+CK    WY Y K +AE+ AW  A +  G++LVV+
Sbjct  124   IGAVYMDPDRATEKVVDETCWSDLDFCKNTKNWYCYGKMVAEKTAWDEAREK-GVDLVVI  182

Query  540   NLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNASG  361
             N   V+GPLL P   +++  IL  + G    Y N    +VH++D   AHIL  E ++ASG
Sbjct  183   NPVLVLGPLLQPTVNASVLHILKYLTGSAKTYANSVQAYVHVKDVALAHILVYETRSASG  242

Query  360   RLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSE-HSLDCTKIMELGLPPFATL  184
             R IC+ +V H   ++ +L   +P YP  TKCS+E    ++ +     K+ +LGL  F  +
Sbjct  243   RYICAESVLHRGDVVEILAKFFPEYPIPTKCSDETRPRAKPYKFSNQKLKDLGL-EFTPV  301

Query  183   SQMFDDCIHSFQQKGFL  133
              Q   + + S Q+KG L
Sbjct  302   KQCLYETVKSLQEKGHL  318



>emb|CDP09262.1| unnamed protein product [Coffea canephora]
Length=324

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/321 (40%), Positives = 195/321 (61%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ +VR+  + +KV  L  L GAKERL++ K +++EE
Sbjct  5     CVTGASGYIASWLVKFLLQRGYTVKASVRDLNDPKKVEHLLALDGAKERLQLFKANLLEE  64

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             GS +   DG DGVFH AS    P+ H +   Q  LIDP++KGTLNVL S A+   VKRVV
Sbjct  65    GSFDAAIDGCDGVFHMAS----PFYHTVTDPQAELIDPALKGTLNVLGSCAKSPSVKRVV  120

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + +     T    ++E+ W+  ++CK+  LWY  +KT+AE  AWK+ ++  G+
Sbjct  121   LTSSIAAVAFNGKPRTPDVVVDETWWSLPEFCKQTKLWYVLSKTLAEDAAWKFVKEK-GL  179

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V+GPLL P   ++   IL ++ G    +PN  +G+V ++D   AHILA E 
Sbjct  180   DMVTINPAMVIGPLLQPTLNTSAAAILNLING-AETFPNSSMGWVDVKDVANAHILAFEN  238

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR      V H+S+++ +LR  YPS     KC++++     + +   K   LGL  
Sbjct  239   PSASGRYCLVERVVHYSEVVKILREIYPSSKLPEKCADDKPFVPTYQVSKEKAKSLGL-E  297

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  + Q   + + S ++K FL
Sbjct  298   FIPVEQSIKETVESLKEKNFL  318



>dbj|BAQ20438.1| 2-phenylethanol [Rosa hybrid cultivar]
Length=322

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/321 (40%), Positives = 191/321 (60%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ +VRNP +  K   L  L GAKERL++ K D++EE
Sbjct  7     CVTGASGYIASWLVKLLLQRGYTVKASVRNPNDPTKTEHLLALDGAKERLQLFKADLLEE  66

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARK-MMVKRVV  733
             GS +   +G +GVFHTAS    P+ H++   +  L+DP+VKGTLNVL S  K   +KRVV
Sbjct  67    GSFDSAVEGCEGVFHTAS----PFYHDVTDPKAELLDPAVKGTLNVLNSCSKSTSIKRVV  122

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ +TD D CK   LWY  +KT+AE  AWK+ ++  GI
Sbjct  123   LTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEK-GI  181

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V+GPLL P   ++   IL I+KG    YPN   G+V+++D   AH+ A E 
Sbjct  182   DMVTINPAMVIGPLLQPTLNTSAAAILNIIKG-ARTYPNASFGWVNVKDVANAHVQAFEI  240

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR      VAHF++++ ++   YP      KCS+++     + +   K   LG+  
Sbjct  241   PSASGRYCLVERVAHFTEVLQIIHELYPDLQLPEKCSDDKPFVPTYQVSKEKAKSLGI-E  299

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + I S ++K  +
Sbjct  300   FIPLDISLKETIESLKEKSIV  320



>ref|XP_006365623.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum tuberosum]
Length=320

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 196/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ TVR+P + +K   L  L GA+ERL + K +++EE
Sbjct  7     CVTGASGYIASWLVKFLLQRGYTVKATVRDPNDKKKTDHLTSLDGAEERLHLFKANLLEE  66

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLTS  724
             GS +   +G +GVFHTASP  +    + Q  LIDP++KGTLNVL S A+   V+RVVLTS
Sbjct  67    GSFDAVVEGCEGVFHTASPFYLGV-KDPQAELIDPALKGTLNVLESVAKTPSVRRVVLTS  125

Query  723   SCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             S + + +     T    ++E+ W+D D+C+   LWY  +KT+AE  AWK+ ++    ++V
Sbjct  126   SVAAVAFNGKPRTPEVVVDETWWSDPDFCRESQLWYVLSKTLAEDAAWKFVKEK-AFDMV  184

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNA  367
              +N + V+G LL P   ++   IL ++ G    YPN  +G+V+++D   AHILA E  +A
Sbjct  185   TINPAMVIGSLLQPTLNTSAAAILQLLNG-SETYPNSTLGWVNVKDVALAHILAFENPSA  243

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
             +GR +   +VAH+S+I+ +LR  YP+     KC++++     + ++  +  +LG+  F  
Sbjct  244   NGRYLMVESVAHYSEIVKILRELYPTMKLPEKCADDKPFTPMYQVNIERAKKLGI-EFIP  302

Query  186   LSQMFDDCIHSFQQKGF  136
             L++   +   S ++K F
Sbjct  303   LAESLKETAESLKEKKF  319



>ref|XP_002980750.1| hypothetical protein SELMODRAFT_154000 [Selaginella moellendorffii]
 gb|EFJ18401.1| hypothetical protein SELMODRAFT_154000 [Selaginella moellendorffii]
Length=327

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 192/318 (60%), Gaps = 5/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LLD+GY VR TVR+  +  +   L  L GA+ERL++++ D++++
Sbjct  9     CVTGASGFIASFLVKLLLDRGYKVRGTVRSLTDPSRTSHLRGLPGAEERLELVEADLLKD  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLTS  724
             G+  D      GVFHTASP  +    + ++ LI P+V+GTLNVL + +R   V +VV+TS
Sbjct  69    GAFNDVVKDCQGVFHTASPFFLAGVADPERQLIQPAVQGTLNVLEACSRSPSVAKVVVTS  128

Query  723   SCSCIRYRHDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELVV  544
             S + + Y    T  + ++ES ++D DYC+    WY  +KT+AEQEAWK+A++  G+ LV 
Sbjct  129   STAAVAYNPKRTPDTVVDESCFSDPDYCREMKAWYILSKTLAEQEAWKFAKEK-GLNLVT  187

Query  543   VNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNAS  364
             +N + V+GPLL P   ++ ++IL ++ G    Y N  +G+V + D   AH+LA E  NAS
Sbjct  188   INPAMVIGPLLQPTLNTSCEIILKLINGSKTHYSNACLGWVGVGDVAEAHLLAYENPNAS  247

Query  363   GRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCS-NEEGDDSEHSLDCTKIM-ELGLPPFA  190
             GR +C   V H+  ++  LR  YP YP  T+C  N     + +++   K+  ELGL  F 
Sbjct  248   GRYLCVERVTHYEDVVETLRKLYPEYPIPTECEDNGSPKATPYAISTRKLQEELGL-RFH  306

Query  189   TLSQMFDDCIHSFQQKGF  136
             +L     +C+ S +   F
Sbjct  307   SLEHNLKECVESLKLNHF  324



>gb|AAY26021.2| cinnamyl alcohol dehydrogenase [Eucommia ulmoides]
Length=322

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 188/318 (59%), Gaps = 6/318 (2%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+VR TVR+P + +K   L  L+GA ERL + K +++E+
Sbjct  9     CVTGASGFIASWIVKFLLQRGYTVRATVRDPNDPKKTEHLRTLEGASERLHLFKAELLED  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNIQKTLIDPSVKGTLNVLTS-ARKMMVKRVVLTS  724
             G+ +   DG DGVFHTASP     D N QK LIDP+VKG++NVL S A+   VKRVVLTS
Sbjct  69    GAFDAVVDGTDGVFHTASPFFYNTD-NPQKDLIDPAVKGSVNVLGSCAKSPSVKRVVLTS  127

Query  723   SCSCIRYRHDATQISPLNESHW-TDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGIELV  547
             S + +           + +  W +D+++C +  LWY  +KT+AE+ AWK+A++  G++LV
Sbjct  128   SVAAVAINSRPKNPDVVVDETWHSDVEFCTQRKLWYVLSKTLAEEAAWKFAKEK-GLDLV  186

Query  546   VVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEAQNA  367
              +N + V+GPLL P   ++   IL  + G    Y N  +G++ + +   AHI A E  +A
Sbjct  187   TINPAMVIGPLLQPSLNTSASAILNFLNG-AKTYSNSSMGWIDVRNVANAHIQAFEIPSA  245

Query  366   SGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPPFAT  187
             +GR      VAH+S+I+ +LR  YP+ P   KC+++        +   K   LG+  F  
Sbjct  246   NGRYCLVERVAHYSEIVQILRNHYPTLPLPEKCADDNPFQPTFQVSKEKAKSLGI-EFIP  304

Query  186   LSQMFDDCIHSFQQKGFL  133
             L     D + S ++K F 
Sbjct  305   LEVSIKDTVESLKEKKFF  322



>ref|XP_008363357.1| PREDICTED: cinnamoyl-CoA reductase 1 [Malus domestica]
Length=325

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/321 (39%), Positives = 197/321 (61%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ ++R+P +  K   L  L GA++RL++ K +++EE
Sbjct  10    CVTGASGYIASWLVKLLLQRGYTVKASIRDPNDPTKTEHLHALDGAQDRLQLFKANLLEE  69

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             GS +   +G +GVFHTAS    P+ H++   +  L++P+VKGTLNVL S A+   +KRVV
Sbjct  70    GSFDSAVEGCEGVFHTAS----PFYHDVTDPKAELLEPAVKGTLNVLNSCAKSPSIKRVV  125

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ +TD D CK   LWY  +KT+AE  AWK+ ++  GI
Sbjct  126   LTSSIAAVAYNGKPRTPDVVIDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEK-GI  184

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             +LV +N + V+GPLL P   ++   +L ++KG    +PN   G+++++D   AHI A E+
Sbjct  185   DLVTINPAMVIGPLLQPTLNTSAAAVLNVIKG-ARTFPNASFGWINVKDVANAHIQAFES  243

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
               ASGR     TVAHFS+++ +LR  +P+     KC++++     + +   K   LG+  
Sbjct  244   PTASGRYCLVETVAHFSEVVRILRELHPTLQLPEKCADDKPFVPTYQVSKEKAKXLGV-E  302

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + + S ++KGF+
Sbjct  303   FIPLDVSLKETVESLKEKGFV  323



>ref|XP_011090120.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=328

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 195/322 (61%), Gaps = 14/322 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S++VK LL +GY+V+ +VR+P + +K   L  L GAKERL +LK +++EE
Sbjct  9     CVTGASGYIASWIVKFLLQRGYTVKASVRDPNDPKKTQHLLSLDGAKERLHLLKANLLEE  68

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDH---NIQKTLIDPSVKGTLNVLTS-ARKMMVKRVV  733
             GS +   +G  GVFHTAS    P+ H   N Q  LIDP++KGTLNVL S A+   +KRVV
Sbjct  69    GSFDSVVEGCVGVFHTAS----PFYHAVTNPQAELIDPALKGTLNVLASCAKTPSIKRVV  124

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++ES W++ + CK    WY  +KT+AE  AWK+ ++  GI
Sbjct  125   LTSSVAAVAYNGKPRTPEVVVDESWWSNPELCKEMQQWYVLSKTLAEDAAWKFVKEK-GI  183

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGE-YPNKRVGFVHIEDAVRAHILAME  379
             ++V +N + V+GPLL P   ++   IL ++ G  GE YPN   G+++++D   AHILA E
Sbjct  184   DMVTINPAMVIGPLLQPTLNTSCAAILNLING--GETYPNSTFGWINVKDVANAHILAFE  241

Query  378   AQNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLP  199
               +A+GR      VAHFS+++ +LR  YPS     KC +++     + +   K   LG+ 
Sbjct  242   NPSANGRYCLVEKVAHFSEVVKILRELYPSLKLPEKCGDDKPFVPTYQVSKEKAKALGV-  300

Query  198   PFATLSQMFDDCIHSFQQKGFL  133
              F +L +   + + S ++K F 
Sbjct  301   VFTSLEEGIKETVESLKEKNFF  322



>gb|AHC29025.1| phenylacetaldehyde reductase [Rosa rugosa]
Length=322

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 129/321 (40%), Positives = 191/321 (60%), Gaps = 12/321 (4%)
 Frame = -2

Query  1080  CVTGGTGLIGSYLVKSLLDKGYSVRTTVRNPGELEKVGFLWELKGAKERLKILKGDVMEE  901
             CVTG +G I S+LVK LL +GY+V+ +VRNP +  K   L  L GAKERL++ K D++EE
Sbjct  7     CVTGASGYIASWLVKLLLQRGYTVKASVRNPNDPTKTEHLLALDGAKERLQLFKADLLEE  66

Query  900   GSMEDGFDGVDGVFHTASPVLVPYDHNI---QKTLIDPSVKGTLNVLTSARKM-MVKRVV  733
             GS +   +G +GVFHTAS    P+ H++   +  L+DP+VKGTLNVL S  K   +KRVV
Sbjct  67    GSFDSVVEGCEGVFHTAS----PFYHDVTDPKAELLDPAVKGTLNVLNSCSKSPSIKRVV  122

Query  732   LTSSCSCIRYR-HDATQISPLNESHWTDLDYCKRYNLWYAYAKTMAEQEAWKWAEQNDGI  556
             LTSS + + Y     T    ++E+ +TD D CK   LWY  +KT+AE  AWK  ++  GI
Sbjct  123   LTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESKLWYVLSKTLAEDAAWKLVKEK-GI  181

Query  555   ELVVVNLSFVVGplltpqptstlqliLAIVKGLIGEYPNKRVGFVHIEDAVRAHILAMEA  376
             ++V +N + V+GPLL P   ++   IL I+KG    YPN   G+++++D   AH+ A E 
Sbjct  182   DMVTINPAMVIGPLLQPTLNTSAAAILNIIKG-ARTYPNASFGWINVKDVANAHVQAFEI  240

Query  375   QNASGRLICSTTVAHFSQIIHMLRPKYPSYPYLTKCSNEEGDDSEHSLDCTKIMELGLPP  196
              +ASGR      VAHF++++ ++   YP      KCS+++     + +   K   LG+  
Sbjct  241   PSASGRYCLVERVAHFTEVLQIIHELYPDLQLPEKCSDDKPFVPTYQVSKEKAKSLGI-E  299

Query  195   FATLSQMFDDCIHSFQQKGFL  133
             F  L     + I S ++K F+
Sbjct  300   FIPLDISLKETIESLKEKSFV  320



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3120901688334