BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9244_g2_i1 len=548 path=[526:0-547]

Length=548
                                                                      Score     E

ref|XP_006381354.1|  permease family protein                            239   8e-73   
ref|XP_011018838.1|  PREDICTED: uracil permease                         237   2e-71   
ref|XP_002519429.1|  Uracil permease, putative                          234   3e-70   Ricinus communis
ref|XP_002264940.2|  PREDICTED: uncharacterized permease C29B12.14c     233   1e-69   Vitis vinifera
emb|CAN65774.1|  hypothetical protein VITISV_030411                     233   1e-69   Vitis vinifera
ref|XP_003625746.1|  Uracil transporter-like protein                    232   2e-69   
ref|XP_010098848.1|  putative allantoin permease                        227   5e-68   
ref|XP_007203844.1|  hypothetical protein PRUPE_ppa018778m2g            220   1e-67   
ref|XP_010683987.1|  PREDICTED: uncharacterized permease C29B12.14c     226   2e-67   
ref|XP_010241649.1|  PREDICTED: uncharacterized permease C29B12.14c     224   1e-66   
gb|ACU15224.1|  unknown                                                 214   2e-66   Glycine max [soybeans]
ref|XP_009341474.1|  PREDICTED: uncharacterized permease C29B12.14c     224   3e-66   
emb|CDP15312.1|  unnamed protein product                                223   6e-66   
ref|XP_006354397.1|  PREDICTED: uncharacterized permease C29B12.1...    223   6e-66   
gb|KCW89306.1|  hypothetical protein EUGRSUZ_A01597                     221   7e-66   
ref|XP_004246596.1|  PREDICTED: uncharacterized permease C29B12.14c     222   8e-66   
ref|XP_011094562.1|  PREDICTED: uncharacterized permease C29B12.14c     221   1e-65   
ref|XP_008366653.1|  PREDICTED: uncharacterized permease C29B12.1...    222   1e-65   
ref|XP_004494100.1|  PREDICTED: probable allantoin permease-like        221   3e-65   
ref|XP_009586794.1|  PREDICTED: uncharacterized permease C29B12.14c     221   3e-65   
ref|XP_009780325.1|  PREDICTED: uncharacterized permease C29B12.14c     221   3e-65   
gb|EYU41577.1|  hypothetical protein MIMGU_mgv1a003893mg                221   3e-65   
ref|XP_010050301.1|  PREDICTED: uncharacterized permease C29B12.14c     221   3e-65   
ref|XP_008241348.1|  PREDICTED: uncharacterized permease C29B12.14c     221   5e-65   
ref|XP_007027529.1|  Allantoin permease                                 219   1e-64   
ref|XP_003590437.1|  Uracil transporter-like protein                    218   4e-64   
ref|XP_006428387.1|  hypothetical protein CICLE_v10011424mg             216   2e-63   
ref|XP_006493005.1|  PREDICTED: uncharacterized permease C29B12.1...    215   3e-63   
ref|XP_004304328.1|  PREDICTED: probable allantoin permease-like        216   3e-63   
ref|XP_003542570.1|  PREDICTED: uncharacterized permease C29B12.1...    215   5e-63   
gb|KHN48224.1|  Putative allantoin permease                             215   5e-63   
ref|XP_010543900.1|  PREDICTED: uracil permease                         215   5e-63   
gb|EPS64628.1|  hypothetical protein M569_10151                         213   8e-63   
gb|KHN36454.1|  Putative allantoin permease                             214   9e-63   
ref|XP_006290075.1|  hypothetical protein CARUB_v10003714mg             213   5e-62   
ref|XP_010423698.1|  PREDICTED: uncharacterized permease C29B12.1...    213   6e-62   
ref|XP_010490841.1|  PREDICTED: uncharacterized permease C29B12.1...    211   2e-61   
ref|XP_007145286.1|  hypothetical protein PHAVU_007G226300g             212   2e-61   
ref|XP_004513980.1|  PREDICTED: probable allantoin permease-like        210   2e-61   
gb|AAL25608.1|  At5g03555/C415EPL23M                                    208   5e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568122.2|  nucleobase:cation symporter-1                         209   9e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80874.1|  BnaC03g01280D                                          208   2e-60   
ref|XP_009130766.1|  PREDICTED: uracil permease                         208   2e-60   
ref|XP_002873103.1|  permease, cytosine/purines, uracil, thiamine...    208   3e-60   
emb|CDY11257.1|  BnaA03g00930D                                          211   4e-60   
ref|XP_008442760.1|  PREDICTED: uncharacterized permease C29B12.14c     206   1e-59   
ref|XP_006398809.1|  hypothetical protein EUTSA_v10015725mg             207   1e-59   
gb|KDP29210.1|  hypothetical protein JCGZ_16599                         202   1e-59   
emb|CDP15313.1|  unnamed protein product                                203   2e-59   
ref|XP_010452235.1|  PREDICTED: uncharacterized permease C29B12.1...    206   2e-59   
ref|XP_008803457.1|  PREDICTED: uracil permease                         201   2e-58   
ref|XP_009411552.1|  PREDICTED: uracil permease-like                    201   1e-57   
ref|XP_004137857.1|  PREDICTED: probable allantoin permease-like        199   6e-57   
ref|XP_010918592.1|  PREDICTED: uracil permease-like                    197   5e-56   
ref|XP_006826231.1|  hypothetical protein AMTR_s00132p00084290          193   2e-55   
ref|XP_009382393.1|  PREDICTED: uracil permease-like                    188   4e-53   
ref|XP_008780405.1|  PREDICTED: uncharacterized permease C29B12.1...    187   8e-53   
ref|XP_002970317.1|  hypothetical protein SELMODRAFT_93539              184   6e-52   
ref|XP_001758782.1|  predicted protein                                  185   6e-52   
ref|XP_010926634.1|  PREDICTED: uracil permease-like                    180   2e-50   
ref|XP_002978480.1|  hypothetical protein SELMODRAFT_52432              180   2e-50   
emb|CBI30184.3|  unnamed protein product                                179   4e-50   
ref|XP_010926587.1|  PREDICTED: uncharacterized permease C29B12.1...    179   5e-50   
ref|XP_009383594.1|  PREDICTED: uracil permease-like                    173   2e-47   
ref|NP_001136535.1|  hypothetical protein                               172   5e-47   Zea mays [maize]
ref|XP_004953391.1|  PREDICTED: uracil permease-like                    171   8e-47   
ref|XP_003570071.1|  PREDICTED: uracil permease                         171   1e-46   
ref|XP_002454506.1|  hypothetical protein SORBIDRAFT_04g032390          171   2e-46   Sorghum bicolor [broomcorn]
ref|XP_001694932.1|  predicted protein                                  169   4e-46   Chlamydomonas reinhardtii
ref|XP_002499820.1|  Nucleobase:Cation symporter-1 family               167   3e-45   Micromonas commoda
ref|WP_006970062.1|  nitrate reductase                                  164   2e-44   
gb|KIG14653.1|  Cytosine/purine/uracil/thiamine/allantoin permeas...    164   2e-44   
dbj|BAJ85216.1|  predicted protein                                      163   6e-44   
gb|KDO49313.1|  hypothetical protein CISIN_1g009276mg                   163   6e-44   
ref|XP_001774040.1|  predicted protein                                  164   7e-44   
gb|EAZ24114.1|  hypothetical protein OsJ_07854                          161   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047676.1|  Os02g0666700                                       161   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571352.2|  PREDICTED: uracil permease-like                    161   3e-43   
ref|XP_006647657.1|  PREDICTED: uracil permease-like                    160   7e-43   
ref|XP_004955137.1|  PREDICTED: uracil permease-like                    160   9e-43   
ref|XP_010926588.1|  PREDICTED: uncharacterized permease C29B12.1...    156   2e-41   
gb|KIE31602.1|  nitrate reductase                                       149   2e-40   
ref|WP_012791087.1|  nitrate reductase                                  151   2e-39   
ref|WP_012762387.1|  nitrate reductase                                  150   3e-39   
ref|WP_037028829.1|  nitrate reductase                                  149   4e-39   
ref|WP_004631013.1|  NCS1 nucleoside transporter-like protein           149   4e-39   
ref|WP_009241132.1|  MULTISPECIES: nitrate reductase                    149   4e-39   
ref|WP_024972435.1|  nitrate reductase                                  149   5e-39   
ref|WP_039374193.1|  nitrate reductase                                  149   5e-39   
ref|WP_033301195.1|  nitrate reductase                                  149   5e-39   
ref|WP_027680949.1|  nitrate reductase                                  149   5e-39   
ref|XP_009413587.1|  PREDICTED: uracil permease-like                    149   7e-39   
emb|CEA06602.1|  cytosine/purines uracil thiamine allantoin permease    149   9e-39   
ref|WP_026345479.1|  nitrate reductase                                  148   1e-38   
ref|WP_030058208.1|  MULTISPECIES: nitrate reductase                    147   3e-38   
ref|WP_037899368.1|  hypothetical protein                               147   3e-38   
ref|WP_039597787.1|  nitrate reductase                                  147   3e-38   
ref|WP_009541210.1|  Cytosine/purine/uracil/thiamine/allantoin pe...    147   5e-38   
ref|WP_021195082.1|  nitrate reductase                                  146   6e-38   
ref|WP_024975201.1|  nitrate reductase                                  146   6e-38   
ref|WP_007820219.1|  MULTISPECIES: nitrate reductase                    146   7e-38   
ref|WP_009664992.1|  nitrate reductase                                  146   8e-38   
gb|EYF01165.1|  Cytosine/purine/uracil/thiamine/allantoin permeas...    145   9e-38   
ref|WP_005622429.1|  MULTISPECIES: nitrate reductase                    145   1e-37   
ref|WP_007416470.1|  nitrate reductase                                  145   1e-37   
ref|WP_037828596.1|  nitrate reductase                                  145   1e-37   
gb|KDV22935.1|  nitrate reductase                                       145   2e-37   
ref|WP_024089188.1|  nitrate reductase                                  145   2e-37   
ref|WP_027865934.1|  nitrate reductase                                  145   2e-37   
ref|WP_039191935.1|  nitrate reductase                                  145   2e-37   
ref|WP_030597529.1|  nitrate reductase                                  145   2e-37   
ref|WP_036248407.1|  nitrate reductase                                  145   2e-37   
ref|WP_036212012.1|  nitrate reductase                                  145   2e-37   
ref|WP_030551685.1|  nitrate reductase                                  145   2e-37   
ref|WP_039174195.1|  nitrate reductase                                  144   2e-37   
ref|WP_039151889.1|  nitrate reductase                                  144   2e-37   
ref|WP_033349372.1|  nitrate reductase                                  144   3e-37   
ref|WP_035352426.1|  nitrate reductase                                  144   3e-37   
ref|WP_038123221.1|  nitrate reductase                                  144   3e-37   
ref|WP_033962221.1|  nitrate reductase                                  139   3e-37   
ref|WP_027234184.1|  nitrate reductase                                  144   4e-37   
ref|WP_014747975.1|  nitrate reductase                                  144   4e-37   
ref|WP_011349351.1|  nitrate reductase                                  144   4e-37   
ref|WP_030667610.1|  nitrate reductase                                  144   5e-37   
ref|WP_019921514.1|  nitrate reductase                                  144   5e-37   
ref|WP_017926992.1|  nitrate reductase                                  144   5e-37   
ref|WP_008558295.1|  nitrate reductase                                  144   5e-37   
gb|EIZ04902.1|  cytosine/purines transporter                            144   5e-37   
ref|WP_030997041.1|  nitrate reductase                                  144   6e-37   
ref|WP_019296439.1|  MULTISPECIES: nitrate reductase                    143   6e-37   
ref|WP_037029285.1|  nitrate reductase                                  143   7e-37   
ref|WP_023528765.1|  hypothetical protein                               143   7e-37   
ref|WP_008512194.1|  nitrate reductase                                  143   7e-37   
ref|WP_034184953.1|  nitrate reductase                                  143   8e-37   
ref|WP_027792247.1|  nitrate reductase                                  143   8e-37   
gb|KIG01941.1|  NCS1 nucleoside transporter family                      143   9e-37   
gb|EEE04686.1|  permease, cytosine/purine, uracil, thiamine, alla...    143   9e-37   Burkholderia multivorans CGD2
gb|EJO56588.1|  NCS1 nucleoside transporter family protein              143   9e-37   
ref|WP_031357236.1|  nitrate reductase                                  143   9e-37   
ref|WP_030551196.1|  nitrate reductase                                  143   1e-36   
ref|WP_035956975.1|  nitrate reductase                                  142   1e-36   
ref|WP_017878537.1|  nitrate reductase                                  142   1e-36   
ref|WP_035947438.1|  nitrate reductase                                  142   1e-36   
ref|WP_035489664.1|  nitrate reductase                                  142   1e-36   
ref|WP_012217802.1|  nitrate reductase                                  142   1e-36   
ref|WP_006402885.1|  nitrate reductase                                  142   1e-36   
ref|WP_011537686.1|  nitrate reductase                                  142   2e-36   
ref|WP_030276685.1|  nitrate reductase                                  142   2e-36   
ref|WP_034209424.1|  nitrate reductase                                  142   2e-36   
ref|WP_027786236.1|  nitrate reductase                                  142   2e-36   
gb|KER68989.1|  nitrate reductase                                       142   2e-36   
ref|WP_016643091.1|  putative allantoin permease                        142   2e-36   
ref|WP_012337197.1|  nitrate reductase                                  142   2e-36   
ref|WP_030211204.1|  nitrate reductase                                  142   2e-36   
ref|WP_006485642.1|  nitrate reductase                                  142   2e-36   
ref|WP_006498605.1|  nitrate reductase                                  142   2e-36   
ref|XP_005850521.1|  hypothetical protein CHLNCDRAFT_16619              141   2e-36   
ref|WP_030320092.1|  nitrate reductase                                  142   2e-36   
ref|WP_039343221.1|  nitrate reductase                                  142   2e-36   
ref|WP_034203769.1|  nitrate reductase                                  142   2e-36   
ref|WP_014251142.1|  nitrate reductase                                  142   2e-36   
ref|WP_027811375.1|  nitrate reductase                                  142   2e-36   
ref|WP_027807589.1|  nitrate reductase                                  142   2e-36   
ref|WP_027234034.1|  nitrate reductase                                  142   2e-36   
ref|WP_011545787.1|  nitrate reductase                                  142   2e-36   
dbj|BAO89220.1|  NCS1 nucleoside transporter family                     142   2e-36   
ref|WP_023476504.1|  Hydantoin permease                                 142   2e-36   
ref|WP_020598644.1|  nitrate reductase                                  142   2e-36   
ref|WP_034175572.1|  nitrate reductase                                  142   2e-36   
ref|WP_023545632.1|  nitrate reductase                                  142   3e-36   
ref|WP_031403033.1|  MULTISPECIES: nitrate reductase                    142   3e-36   
gb|EAY67321.1|  Cytosine/uracil/thiamine/allantoin permease             142   3e-36   Burkholderia cenocepacia PC184
ref|WP_021156781.1|  putative pyrimidine permease in reductive pa...    142   3e-36   
ref|WP_018059551.1|  nitrate reductase                                  141   3e-36   
ref|WP_035172284.1|  nitrate reductase                                  141   3e-36   
ref|WP_012204711.1|  nitrate reductase                                  141   3e-36   
ref|WP_013803149.1|  nitrate reductase                                  141   3e-36   
ref|WP_034363133.1|  nitrate reductase                                  141   3e-36   
ref|WP_007621753.1|  probable allantoin permease                        141   4e-36   
ref|WP_005668392.1|  NCS1 nucleoside transporter                        141   4e-36   
ref|WP_012829627.1|  nitrate reductase                                  141   5e-36   
ref|WP_017236814.1|  nitrate reductase                                  141   5e-36   
ref|WP_034190668.1|  nitrate reductase                                  141   5e-36   
ref|WP_038455498.1|  nitrate reductase                                  141   5e-36   
ref|WP_033202978.1|  nitrate reductase                                  141   5e-36   
ref|WP_038495967.1|  nitrate reductase                                  141   5e-36   
ref|WP_036623138.1|  nitrate reductase                                  141   5e-36   
ref|WP_034391912.1|  nitrate reductase                                  141   5e-36   
ref|WP_016453019.1|  NCS1 family nucleobase:cation symporter-1          140   6e-36   
ref|WP_004922926.1|  nitrate reductase                                  141   6e-36   
ref|WP_028937214.1|  nitrate reductase                                  140   6e-36   
ref|WP_016445279.1|  NCS1 family nucleobase:cation symporter-1          140   6e-36   
ref|WP_011689268.1|  nitrate reductase                                  140   6e-36   
ref|WP_030361834.1|  MULTISPECIES: nitrate reductase                    141   6e-36   
ref|WP_037746885.1|  nitrate reductase                                  140   6e-36   
ref|WP_008353715.1|  MULTISPECIES: nitrate reductase                    140   6e-36   
ref|WP_027766324.1|  nitrate reductase                                  140   7e-36   
ref|WP_018837061.1|  MULTISPECIES: hypothetical protein                 140   7e-36   
ref|WP_031037832.1|  nitrate reductase                                  140   8e-36   
gb|AHE55156.1|  hypothetical protein NX02_17405                         140   9e-36   
ref|WP_018424467.1|  nitrate reductase                                  140   9e-36   
ref|WP_037699705.1|  nitrate reductase                                  140   9e-36   
ref|WP_027197450.1|  nitrate reductase                                  140   1e-35   
ref|WP_029967589.1|  nitrate reductase                                  140   1e-35   
ref|WP_036229714.1|  nitrate reductase                                  140   1e-35   
ref|WP_006052531.1|  nitrate reductase                                  140   1e-35   
ref|WP_035528032.1|  nitrate reductase                                  140   1e-35   
ref|WP_010098710.1|  nitrate reductase                                  140   1e-35   
ref|WP_020739459.1|  nitrate reductase                                  139   1e-35   
gb|EGD03153.1|  NCS1 nucleoside transporter                             140   1e-35   
ref|WP_030692920.1|  nitrate reductase                                  140   1e-35   
ref|WP_027762087.1|  nitrate reductase                                  140   2e-35   
ref|WP_012400927.1|  nitrate reductase                                  139   2e-35   
ref|WP_020651513.1|  nitrate reductase                                  139   2e-35   
ref|WP_020065408.1|  MULTISPECIES: nitrate reductase                    139   2e-35   
ref|WP_035929679.1|  nitrate reductase                                  139   2e-35   
ref|WP_027799882.1|  nitrate reductase                                  139   2e-35   
ref|WP_028368802.1|  nitrate reductase                                  139   2e-35   
ref|WP_020374427.1|  nitrate reductase                                  139   2e-35   
ref|WP_037769652.1|  nitrate reductase                                  139   2e-35   
ref|WP_005309616.1|  nitrate reductase                                  139   2e-35   
ref|WP_035615462.1|  nitrate reductase                                  139   2e-35   
dbj|GAK32569.1|  putative allantoin permease                            139   2e-35   
ref|WP_006379653.1|  NCS1 nucleoside transporter family protein         139   2e-35   
ref|WP_014265872.1|  nitrate reductase                                  139   2e-35   
ref|WP_026178932.1|  nitrate reductase                                  139   2e-35   
ref|WP_014216769.1|  nitrate reductase                                  139   2e-35   
ref|WP_023559909.1|  nitrate reductase                                  139   3e-35   
ref|WP_028219055.1|  nitrate reductase                                  139   3e-35   
ref|WP_008445576.1|  NCS1 nucleoside transporter family protein         139   3e-35   
ref|WP_037621536.1|  nitrate reductase                                  139   3e-35   
ref|WP_024016987.1|  cytosine/purines uracil thiamine allantoin p...    139   3e-35   
ref|WP_020746626.1|  cytosine/purines uracil thiamine allantoin p...    139   3e-35   
ref|WP_012372088.1|  nitrate reductase                                  139   3e-35   
ref|WP_006760705.1|  nitrate reductase                                  139   3e-35   
ref|WP_006753680.1|  nitrate reductase                                  139   3e-35   
ref|WP_035842580.1|  nitrate reductase                                  139   3e-35   
ref|WP_032787170.1|  nitrate reductase                                  139   4e-35   
ref|WP_013589008.1|  nitrate reductase                                  139   4e-35   
ref|WP_011660850.1|  nitrate reductase                                  139   4e-35   
ref|WP_010395100.1|  nitrate reductase                                  139   4e-35   
ref|WP_034782401.1|  nitrate reductase                                  138   4e-35   
ref|WP_035825024.1|  nitrate reductase                                  138   4e-35   
ref|WP_034754573.1|  nitrate reductase                                  138   4e-35   
ref|WP_030722701.1|  nitrate reductase                                  139   4e-35   
ref|WP_028812947.1|  nitrate reductase                                  138   4e-35   
ref|WP_027770376.1|  nitrate reductase                                  138   4e-35   
ref|WP_006128646.1|  MULTISPECIES: nitrate reductase                    138   4e-35   
ref|WP_015003268.1|  nitrate reductase                                  138   4e-35   
ref|WP_030585433.1|  nitrate reductase                                  138   4e-35   
ref|WP_012433674.1|  nitrate reductase                                  138   5e-35   
ref|WP_025253983.1|  nitrate reductase                                  138   5e-35   
ref|WP_011747439.1|  nitrate reductase                                  138   5e-35   
ref|WP_037780572.1|  nitrate reductase                                  138   5e-35   
ref|WP_032775421.1|  nitrate reductase                                  138   5e-35   
ref|WP_028100796.1|  nitrate reductase                                  138   5e-35   
ref|WP_003965138.1|  nitrate reductase                                  138   5e-35   
ref|WP_030814422.1|  nitrate reductase                                  138   5e-35   
ref|WP_025099591.1|  MULTISPECIES: nitrate reductase                    138   5e-35   
ref|WP_032767865.1|  nitrate reductase                                  138   5e-35   
ref|WP_030704166.1|  nitrate reductase                                  138   5e-35   
ref|WP_012378398.1|  nitrate reductase                                  138   5e-35   
ref|WP_010064049.1|  cytosine/purines/uracil/thiamine/ allantoin ...    138   6e-35   
ref|WP_007585507.1|  MULTISPECIES: nitrate reductase                    138   6e-35   
ref|WP_018547026.1|  nitrate reductase                                  138   6e-35   
ref|WP_030420620.1|  nitrate reductase                                  138   6e-35   
ref|WP_035546746.1|  nitrate reductase                                  138   6e-35   
ref|WP_020744328.1|  cytosine/purines uracil thiamine allantoin p...    138   6e-35   
ref|WP_017590263.1|  nitrate reductase                                  138   6e-35   
ref|WP_035990463.1|  nitrate reductase                                  138   7e-35   
ref|WP_013690530.1|  nitrate reductase                                  138   7e-35   
ref|WP_035513185.1|  nitrate reductase                                  138   7e-35   
ref|WP_030101615.1|  nitrate reductase                                  138   7e-35   
ref|WP_032753889.1|  nitrate reductase                                  138   7e-35   
ref|WP_015068120.1|  cytosine/purines uracil thiamine allantoin p...    137   7e-35   
ref|WP_031126202.1|  nitrate reductase                                  138   7e-35   
ref|WP_015612428.1|  Integral membrane transporter                      138   7e-35   
ref|WP_019062018.1|  nitrate reductase                                  138   7e-35   
ref|WP_028200388.1|  nitrate reductase                                  137   7e-35   
ref|WP_032794948.1|  nitrate reductase                                  137   8e-35   
gb|EHM23818.1|  putative cytosine/purines/uracil/thiamine/allanto...    137   8e-35   
ref|WP_018433726.1|  nitrate reductase                                  137   8e-35   
ref|WP_028801904.1|  nitrate reductase                                  137   8e-35   
ref|WP_036925480.1|  nitrate reductase                                  137   8e-35   
ref|WP_020603429.1|  nitrate reductase                                  137   8e-35   
ref|WP_013568929.1|  nitrate reductase                                  137   9e-35   
ref|WP_034194335.1|  nitrate reductase                                  137   1e-34   
ref|WP_013093997.1|  nitrate reductase                                  137   1e-34   
ref|WP_036046374.1|  nitrate reductase                                  137   1e-34   
ref|WP_014725529.1|  nitrate reductase                                  137   1e-34   
gb|KIF77603.1|  nitrate reductase                                       137   1e-34   
ref|WP_027741116.1|  nitrate reductase                                  137   1e-34   
ref|WP_015037458.1|  nitrate reductase                                  137   1e-34   
ref|WP_011879670.1|  nitrate reductase                                  137   1e-34   
ref|WP_018623224.1|  nitrate reductase                                  137   1e-34   
ref|WP_020416599.1|  nitrate reductase                                  137   1e-34   
ref|WP_025598838.1|  nitrate reductase                                  137   1e-34   
ref|WP_035481411.1|  nitrate reductase                                  137   1e-34   
ref|WP_008829522.1|  MULTISPECIES: nitrate reductase                    137   1e-34   
ref|WP_019576965.1|  nitrate reductase                                  137   1e-34   
ref|WP_027212119.1|  nitrate reductase                                  137   1e-34   
ref|WP_005158711.1|  Cytosine/purine/uracil/thiamine/allantoin pe...    137   1e-34   
ref|WP_008917646.1|  nitrate reductase                                  137   1e-34   
ref|WP_033825525.1|  nitrate reductase                                  137   1e-34   
ref|WP_037647313.1|  nitrate reductase                                  137   1e-34   
ref|WP_020666220.1|  nitrate reductase                                  137   1e-34   
ref|WP_013338676.1|  nitrate reductase                                  137   1e-34   
ref|WP_025356178.1|  nitrate reductase                                  137   1e-34   
ref|WP_027931587.1|  nitrate reductase                                  137   2e-34   
ref|WP_037889555.1|  nitrate reductase                                  137   2e-34   
ref|WP_028363535.1|  nitrate reductase                                  137   2e-34   
ref|WP_036019982.1|  nitrate reductase                                  137   2e-34   
ref|WP_037874697.1|  nitrate reductase                                  137   2e-34   
ref|WP_010983387.1|  nitrate reductase                                  137   2e-34   
ref|WP_039231252.1|  nitrate reductase                                  137   2e-34   
ref|WP_014950772.1|  nitrate reductase                                  137   2e-34   
ref|WP_030084194.1|  MULTISPECIES: nitrate reductase                    137   2e-34   
ref|WP_039228655.1|  nitrate reductase                                  137   2e-34   
ref|WP_030929361.1|  nitrate reductase                                  136   2e-34   
ref|WP_030662042.1|  nitrate reductase                                  136   2e-34   
ref|WP_039216371.1|  nitrate reductase                                  136   2e-34   
ref|WP_014977448.1|  nitrate reductase                                  136   2e-34   
ref|WP_035804249.1|  nitrate reductase                                  136   2e-34   
ref|WP_027477830.1|  nitrate reductase                                  136   2e-34   
ref|WP_021025783.1|  nitrate reductase                                  136   2e-34   
ref|WP_031183621.1|  nitrate reductase                                  136   2e-34   
ref|WP_027946517.1|  nitrate reductase                                  136   2e-34   
ref|WP_011489095.1|  nitrate reductase                                  136   3e-34   
ref|WP_035501492.1|  nitrate reductase                                  136   3e-34   
ref|WP_013593408.1|  nitrate reductase                                  136   3e-34   
ref|WP_037642507.1|  nitrate reductase                                  136   3e-34   
ref|WP_019521820.1|  MULTISPECIES: nitrate reductase                    136   3e-34   
ref|WP_033273803.1|  nitrate reductase                                  136   3e-34   
ref|WP_035208347.1|  nitrate reductase                                  136   3e-34   
ref|WP_037979627.1|  nitrate reductase                                  136   3e-34   
ref|WP_035225243.1|  nitrate reductase                                  136   3e-34   
ref|WP_036176895.1|  hypothetical protein                               135   4e-34   
ref|WP_006602174.1|  nitrate reductase                                  135   4e-34   
ref|WP_030562646.1|  nitrate reductase                                  135   4e-34   
ref|WP_027794983.1|  nitrate reductase                                  135   4e-34   
gb|EWM12442.1|  NCS1 family nucleobase:cation symporter-1               135   4e-34   
ref|WP_030350554.1|  nitrate reductase                                  135   4e-34   
ref|WP_015656764.1|  putative allantoin permease                        135   4e-34   
ref|WP_024883914.1|  nitrate reductase                                  135   4e-34   
ref|WP_018514763.1|  nitrate reductase                                  135   5e-34   
ref|WP_039596029.1|  nitrate reductase                                  135   5e-34   
ref|WP_020629404.1|  nitrate reductase                                  135   5e-34   
ref|WP_007181161.1|  nitrate reductase                                  135   5e-34   
ref|WP_031060667.1|  nitrate reductase                                  135   5e-34   
ref|WP_026116946.1|  nitrate reductase                                  135   5e-34   
ref|WP_017981222.1|  nitrate reductase                                  135   5e-34   
ref|WP_030211946.1|  nitrate reductase                                  135   5e-34   
ref|WP_016354508.1|  NCS1 nucleoside transporter family                 135   5e-34   
ref|WP_031061611.1|  nitrate reductase                                  135   5e-34   
ref|WP_038572235.1|  nitrate reductase                                  135   5e-34   
ref|WP_033279419.1|  nitrate reductase                                  135   5e-34   
gb|KFG09309.1|  nitrate reductase                                       129   5e-34   
ref|WP_017751030.1|  nitrate reductase                                  135   6e-34   
ref|WP_006135027.1|  MULTISPECIES: cytosine/purines/uracil/thiami...    135   6e-34   
ref|WP_021194212.1|  nitrate reductase                                  135   6e-34   
ref|WP_037659505.1|  nitrate reductase                                  135   6e-34   
ref|WP_014285388.1|  nitrate reductase                                  135   6e-34   
ref|WP_037737683.1|  nitrate reductase                                  135   7e-34   
gb|KFG72819.1|  nitrate reductase                                       135   7e-34   
ref|WP_039657227.1|  nitrate reductase                                  135   7e-34   
ref|WP_013523518.1|  MULTISPECIES: nitrate reductase                    135   7e-34   
ref|WP_037342810.1|  nitrate reductase                                  135   7e-34   
ref|WP_028424648.1|  nitrate reductase                                  135   8e-34   
ref|WP_028228287.1|  nitrate reductase                                  135   8e-34   
ref|WP_007034842.1|  cytosine/purines/uracil/thiamine/allantoin p...    135   8e-34   
ref|WP_020278740.1|  NCS1 nucleoside transporter                        135   8e-34   
ref|WP_038517089.1|  nitrate reductase                                  135   8e-34   
ref|WP_034316379.1|  nitrate reductase                                  135   8e-34   
ref|WP_031073862.1|  nitrate reductase                                  135   9e-34   
ref|WP_015451688.1|  putative permease                                  134   9e-34   
ref|WP_031410108.1|  nitrate reductase                                  134   1e-33   
ref|WP_030809650.1|  nitrate reductase                                  134   1e-33   
ref|WP_012999651.1|  nitrate reductase                                  134   1e-33   
ref|WP_019985115.1|  nitrate reductase                                  134   1e-33   
ref|WP_039648208.1|  nitrate reductase                                  134   1e-33   
ref|WP_009191429.1|  nitrate reductase                                  134   1e-33   
ref|WP_037528213.1|  nitrate reductase                                  134   1e-33   
ref|WP_016332447.1|  nucleobase:cation symporter-1, NCS1 family         134   1e-33   
gb|EKE09765.1|  hypothetical protein ACD_16C00111G0009                  134   1e-33   
ref|WP_016722135.1|  nitrate reductase                                  134   1e-33   
ref|WP_028852940.1|  nitrate reductase                                  134   1e-33   
ref|WP_018530760.1|  nitrate reductase                                  134   2e-33   
ref|WP_008546312.1|  nitrate reductase                                  134   2e-33   
ref|WP_020393317.1|  nitrate reductase                                  134   2e-33   
ref|WP_030048097.1|  nitrate reductase                                  134   2e-33   
ref|WP_039394993.1|  nitrate reductase                                  134   2e-33   
ref|WP_005482263.1|  transporter                                        134   2e-33   
ref|WP_037902586.1|  hypothetical protein                               134   2e-33   
ref|WP_018561190.1|  nitrate reductase                                  134   2e-33   
gb|KFE62731.1|  Cytosine/purine/uracil/thiamine/allantoin permeas...    134   2e-33   
ref|WP_013206308.1|  nitrate reductase                                  134   2e-33   
gb|KFU78249.1|  nitrate reductase                                       134   2e-33   
ref|WP_031046621.1|  nitrate reductase                                  134   2e-33   
ref|WP_037673806.1|  nitrate reductase                                  134   2e-33   
ref|WP_013212803.1|  nitrate reductase                                  134   2e-33   
ref|WP_018561015.1|  nitrate reductase                                  134   2e-33   
ref|WP_030609399.1|  nitrate reductase                                  134   2e-33   
ref|WP_014175481.1|  nitrate reductase                                  133   2e-33   
ref|WP_030349037.1|  nitrate reductase                                  133   2e-33   
ref|WP_021322069.1|  nitrate reductase                                  133   2e-33   
ref|WP_028400065.1|  nitrate reductase                                  133   2e-33   
ref|WP_011230915.1|  MULTISPECIES: nitrate reductase                    133   2e-33   
ref|WP_020943114.1|  integral membrane transporter                      133   3e-33   
ref|WP_037581879.1|  nitrate reductase                                  133   3e-33   
ref|WP_020749041.1|  putative permease transmembrane protein            133   3e-33   
ref|WP_014049356.1|  MULTISPECIES: nitrate reductase                    133   3e-33   
ref|WP_037926473.1|  nitrate reductase                                  133   3e-33   
ref|WP_033010115.1|  nitrate reductase                                  133   3e-33   
ref|WP_014195598.1|  MULTISPECIES: nitrate reductase                    133   3e-33   
ref|WP_018090435.1|  nitrate reductase                                  133   3e-33   
ref|WP_035282904.1|  nitrate reductase                                  133   3e-33   
ref|WP_003091120.1|  cytosine/purines/uracil/thiamine/allantoin p...    133   3e-33   
gb|EWC61640.1|  Cytosine/purine/uracil/thiamine/allantoin permeas...    133   3e-33   
ref|WP_030968690.1|  MULTISPECIES: nitrate reductase                    133   3e-33   
ref|WP_037703933.1|  nitrate reductase                                  133   4e-33   
ref|WP_017598596.1|  nitrate reductase                                  133   4e-33   
ref|WP_037607105.1|  nitrate reductase                                  133   4e-33   
ref|WP_030947022.1|  nitrate reductase                                  133   4e-33   
ref|WP_037310533.1|  nitrate reductase                                  133   4e-33   
ref|WP_037702511.1|  nitrate reductase                                  133   4e-33   
ref|WP_037958741.1|  nitrate reductase                                  133   4e-33   
ref|WP_019718039.1|  nitrate reductase                                  132   4e-33   
ref|WP_011001182.1|  nitrate reductase                                  132   5e-33   
ref|WP_028921273.1|  nitrate reductase                                  132   5e-33   
ref|WP_030428395.1|  nitrate reductase                                  132   5e-33   
ref|WP_030178683.1|  nitrate reductase                                  132   5e-33   
ref|WP_035560915.1|  nitrate reductase                                  132   5e-33   
gb|AJE43208.1|  nitrate reductase                                       132   5e-33   
ref|WP_029310965.1|  nitrate reductase                                  132   5e-33   
ref|WP_037861154.1|  nitrate reductase                                  132   5e-33   
ref|WP_020645719.1|  nitrate reductase                                  132   5e-33   
ref|WP_012102747.1|  nitrate reductase                                  132   5e-33   
ref|WP_030203450.1|  nitrate reductase                                  132   5e-33   
ref|WP_009293357.1|  NCS1 nucleoside transporter family protein         132   6e-33   
ref|WP_019328588.1|  nitrate reductase                                  132   6e-33   
ref|WP_037706378.1|  nitrate reductase                                  132   6e-33   
ref|WP_030613099.1|  nitrate reductase                                  132   6e-33   
ref|WP_020125518.1|  nitrate reductase                                  132   6e-33   
ref|WP_003263885.1|  nitrate reductase                                  132   6e-33   
ref|WP_010355046.1|  nitrate reductase                                  132   7e-33   
ref|WP_014617305.1|  nitrate reductase                                  132   7e-33   
ref|WP_033320171.1|  nitrate reductase                                  132   7e-33   
ref|WP_033529848.1|  nitrate reductase                                  132   7e-33   
ref|WP_039568031.1|  nitrate reductase                                  132   7e-33   
ref|WP_030264693.1|  nitrate reductase                                  132   7e-33   
ref|WP_030789013.1|  nitrate reductase                                  132   7e-33   
ref|WP_014787271.1|  nitrate reductase                                  132   7e-33   
ref|WP_015430411.1|  cytosine/purines uracil thiamine allantoin p...    127   8e-33   
gb|KDN22949.1|  nitrate reductase                                       132   8e-33   
ref|WP_003268471.1|  nitrate reductase                                  132   8e-33   
ref|WP_026881671.1|  nitrate reductase                                  132   8e-33   
ref|WP_030978037.1|  nitrate reductase                                  132   8e-33   
ref|WP_030580853.1|  nitrate reductase                                  132   8e-33   
ref|WP_024027069.1|  NCS1 nucleoside transporter family protein         132   9e-33   
ref|WP_031035695.1|  nitrate reductase                                  132   9e-33   
ref|WP_037759759.1|  nitrate reductase                                  132   9e-33   
ref|WP_020133391.1|  nitrate reductase                                  132   9e-33   
ref|WP_030645315.1|  MULTISPECIES: nitrate reductase                    132   1e-32   
ref|WP_030313253.1|  nitrate reductase                                  132   1e-32   
ref|WP_003251413.1|  MULTISPECIES: nitrate reductase                    132   1e-32   
ref|WP_031118299.1|  nitrate reductase                                  132   1e-32   
ref|WP_020119086.1|  nitrate reductase                                  132   1e-32   
ref|WP_031029898.1|  MULTISPECIES: nitrate reductase                    132   1e-32   
ref|WP_007202872.1|  nitrate reductase                                  132   1e-32   
ref|WP_030916706.1|  nitrate reductase                                  132   1e-32   
ref|WP_030991526.1|  nitrate reductase                                  132   1e-32   
ref|WP_027416703.1|  nitrate reductase                                  131   1e-32   
ref|WP_030896741.1|  nitrate reductase                                  131   1e-32   
ref|WP_007385789.1|  nitrate reductase                                  131   1e-32   
ref|WP_030242354.1|  MULTISPECIES: nitrate reductase                    131   1e-32   
ref|WP_035044432.1|  nitrate reductase                                  131   1e-32   
ref|WP_013578661.1|  nitrate reductase                                  131   1e-32   
ref|WP_003996629.1|  putative Allantoin permease                        131   1e-32   
ref|WP_026576267.1|  nitrate reductase                                  131   1e-32   
gb|AHY45353.1|  NCS1 nucleoside transporter family                      131   1e-32   
ref|WP_033268212.1|  nitrate reductase                                  131   1e-32   
ref|WP_029181105.1|  nitrate reductase                                  131   1e-32   
ref|WP_014461541.1|  nitrate reductase                                  131   1e-32   
ref|WP_030605996.1|  nitrate reductase                                  131   2e-32   
gb|EZQ13929.1|  nitrate reductase                                       131   2e-32   
ref|WP_037780175.1|  nitrate reductase                                  131   2e-32   
ref|WP_030984082.1|  nitrate reductase                                  131   2e-32   
ref|WP_031109745.1|  nitrate reductase                                  131   2e-32   
ref|WP_030843975.1|  nitrate reductase                                  131   2e-32   
ref|WP_030040829.1|  nitrate reductase                                  131   2e-32   
ref|WP_033309224.1|  nitrate reductase                                  131   2e-32   
ref|WP_031136527.1|  nitrate reductase                                  131   2e-32   
gb|EPD67545.1|  NCS1 nucleoside transporter                             131   2e-32   
ref|WP_031475628.1|  nitrate reductase                                  131   2e-32   
ref|WP_036015174.1|  nitrate reductase                                  130   2e-32   
ref|WP_003444477.1|  hypothetical protein                               130   2e-32   
ref|WP_020579578.1|  nitrate reductase                                  130   2e-32   
ref|WP_037409293.1|  nitrate reductase                                  130   3e-32   
ref|WP_027817205.1|  nitrate reductase                                  130   3e-32   
ref|WP_031084501.1|  nitrate reductase                                  130   3e-32   



>ref|XP_006381354.1| permease family protein [Populus trichocarpa]
 gb|ERP59151.1| permease family protein [Populus trichocarpa]
Length=507

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -2

Query  481  SLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELG  302
            S +D  L Q  PDP+L +D+LKPTTP +RTYSGWEMASLWIGLVVGVPS+YLAGSLV+LG
Sbjct  7    SRNDPKLDQFEPDPTLTNDDLKPTTPAERTYSGWEMASLWIGLVVGVPSYYLAGSLVDLG  66

Query  301  MSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVAC  122
            M+WWQG+ATVVAANII  + LIL GHPGTRYGI FPVLARS+FGI GAHIPTLLR+LV C
Sbjct  67   MAWWQGIATVVAANIILLVPLILTGHPGTRYGISFPVLARSSFGIRGAHIPTLLRALVGC  126

Query  121  GWYGIQTWIGGEAIFILLPKTIKDSSFSPACFLAW  17
            GWYGI+TWIGGEAIFILLP+ IK++S S + FL W
Sbjct  127  GWYGIETWIGGEAIFILLPQFIKENS-SCSQFLPW  160



>ref|XP_011018838.1| PREDICTED: uracil permease [Populus euphratica]
Length=564

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 141/170 (83%), Gaps = 5/170 (3%)
 Frame = -2

Query  514  AESHSQIIP---SGSLDDDPLV-QDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVV  347
            A  +S++ P   S S  +DP V Q  PDP+L +D+LKPTTP +RT SGWEMASLWIGL V
Sbjct  49   ARRYSRLTPMASSQSSRNDPKVDQFEPDPTLTNDDLKPTTPAERTCSGWEMASLWIGLAV  108

Query  346  GVPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGI  167
            GVPS+YLAGSLV+LGM+WWQG+ATVVAANII  + LIL GHPGTRYGI FPVLARS+FGI
Sbjct  109  GVPSYYLAGSLVDLGMAWWQGIATVVAANIILLVPLILTGHPGTRYGISFPVLARSSFGI  168

Query  166  SGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDSSFSPACFLAW  17
             GAHIPTLLR+LV CGWYGI+TWIGGEAIFILLP+ IK++S S + FL W
Sbjct  169  RGAHIPTLLRALVGCGWYGIETWIGGEAIFILLPQFIKENS-SCSQFLPW  217



>ref|XP_002519429.1| Uracil permease, putative [Ricinus communis]
 gb|EEF42843.1| Uracil permease, putative [Ricinus communis]
Length=566

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 131/155 (85%), Gaps = 5/155 (3%)
 Frame = -2

Query  502  SQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLA  323
            SQ   S   D+       PDP+L +D+LKPTTP QRT+SGWEMASLWIGLVVGVPS+YLA
Sbjct  65   SQYYKSSEFDEF-----EPDPTLTNDDLKPTTPSQRTFSGWEMASLWIGLVVGVPSYYLA  119

Query  322  GSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTL  143
            GSLV+LGM+WWQG+ATVV ANII  + L+L GHPGTRYGI FPVLARS+FGI GAHIPT+
Sbjct  120  GSLVDLGMAWWQGIATVVTANIILLVPLVLTGHPGTRYGISFPVLARSSFGIHGAHIPTI  179

Query  142  LRSLVACGWYGIQTWIGGEAIFILLPKTIKDSSFS  38
            LR+LV CGWYGI+TWIGGEAIF+LLPK IK+SS+S
Sbjct  180  LRALVGCGWYGIETWIGGEAIFVLLPKVIKESSWS  214



>ref|XP_002264940.2| PREDICTED: uncharacterized permease C29B12.14c [Vitis vinifera]
Length=563

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
             P P+L +D+LKPT P QRT+SGWEMASLW+GLVVGVPS+YLAGSLVELGM+WWQG+ATV
Sbjct  74   EPHPTLTNDDLKPTAPHQRTFSGWEMASLWVGLVVGVPSYYLAGSLVELGMAWWQGIATV  133

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
            VAANII  + L+L GHPGTRYGI FPVLARSAFGI GAH+PTLLR+LV CGWYGI+TWIG
Sbjct  134  VAANIILLVPLVLTGHPGTRYGISFPVLARSAFGIRGAHLPTLLRALVGCGWYGIETWIG  193

Query  91   GEAIFILLPKTIKDSSFSPACFLAW  17
            GEAIF+LLPKTIK SS S   FL W
Sbjct  194  GEAIFLLLPKTIKQSSLSQ--FLPW  216



>emb|CAN65774.1| hypothetical protein VITISV_030411 [Vitis vinifera]
Length=563

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
             P P+L +D+LKPT P QRT+SGWEMASLW+GLVVGVPS+YLAGSLVELGM+WWQG+ATV
Sbjct  74   EPHPTLTNDDLKPTAPHQRTFSGWEMASLWVGLVVGVPSYYLAGSLVELGMAWWQGIATV  133

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
            VAANII  + L+L GHPGTRYGI FPVLARSAFGI GAH+PTLLR+LV CGWYGI+TWIG
Sbjct  134  VAANIILLVPLVLTGHPGTRYGISFPVLARSAFGIRGAHLPTLLRALVGCGWYGIETWIG  193

Query  91   GEAIFILLPKTIKDSSFSPACFLAW  17
            GEAIF+LLPKTIK SS S   FL W
Sbjct  194  GEAIFLLLPKTIKQSSLSQ--FLPW  216



>ref|XP_003625746.1| Uracil transporter-like protein [Medicago truncatula]
 gb|AES81964.1| cytosine/purine uracil thiamine allantoin permease [Medicago 
truncatula]
Length=560

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 133/163 (82%), Gaps = 12/163 (7%)
 Frame = -2

Query  460  VQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGV  281
            V+  PDP+L +D+LKPTTP QRT+SG+EMASLW+GLVVGVPS+YLAGSLV+LGM+WWQG+
Sbjct  73   VEIEPDPTLTNDDLKPTTPSQRTFSGFEMASLWVGLVVGVPSYYLAGSLVDLGMAWWQGI  132

Query  280  ATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQT  101
            ATVVAAN+I  + LIL GHPGTRYGI FPVLARS+FGI GAHIPTLLR+LV CGWYGI+T
Sbjct  133  ATVVAANMILFVPLILTGHPGTRYGISFPVLARSSFGIHGAHIPTLLRALVGCGWYGIET  192

Query  100  WIGGEAIFILLPKTIKDSSFSPA------------CFLAWHVC  8
            WIGGE IF+LLP +IK S+ S +            CFLA+ V 
Sbjct  193  WIGGETIFLLLPNSIKQSTLSKSLPWLGTSPLEFFCFLAFMVV  235



>ref|XP_010098848.1| putative allantoin permease [Morus notabilis]
 gb|EXB75936.1| putative allantoin permease [Morus notabilis]
Length=505

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DPSL +D+LKPTT  QR++SGWEMASLW+GLVVGVPS+YLAGSLVELGM+WWQG+ATVV 
Sbjct  16   DPSLTNDDLKPTTDSQRSFSGWEMASLWVGLVVGVPSYYLAGSLVELGMAWWQGIATVVC  75

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I    L+L GHPGTRYGIPFPVLARS+FGI GAH+PTLLR+LV CGWYGI+TWIGGE
Sbjct  76   ANLILLFPLVLTGHPGTRYGIPFPVLARSSFGIRGAHVPTLLRALVGCGWYGIETWIGGE  135

Query  85   AIFILLPKTIKDSS  44
            AIF+LLP +IK+SS
Sbjct  136  AIFLLLPNSIKNSS  149



>ref|XP_007203844.1| hypothetical protein PRUPE_ppa018778m2g, partial [Prunus persica]
 gb|EMJ05043.1| hypothetical protein PRUPE_ppa018778m2g, partial [Prunus persica]
Length=297

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 129/157 (82%), Gaps = 5/157 (3%)
 Frame = -2

Query  508  SHSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFY  329
            + +Q  PS   D+        DP+L +D+LKPTT  QRT+S WE+ASLW+GLVVGVP++Y
Sbjct  2    ASTQHNPSPKFDEF-----ESDPTLTNDDLKPTTLDQRTFSRWELASLWVGLVVGVPTYY  56

Query  328  LAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIP  149
            LAGSLV+LGM+WWQG+ATVVAANII  + L+L GHPGT+YGI FPVLARS+FGI GAHIP
Sbjct  57   LAGSLVDLGMAWWQGIATVVAANIILLVPLVLTGHPGTKYGISFPVLARSSFGIYGAHIP  116

Query  148  TLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDSSFS  38
            TLLR+LV CGWYGI+TWIGGEAIFILLP +IK SS S
Sbjct  117  TLLRALVGCGWYGIETWIGGEAIFILLPNSIKQSSLS  153



>ref|XP_010683987.1| PREDICTED: uncharacterized permease C29B12.14c [Beta vulgaris 
subsp. vulgaris]
Length=564

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = -2

Query  508  SHSQIIPSGSLDDDPLVQDNP---DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVP  338
            S S +    S++  P  Q +    DP+LI+++LKPTT  QRT+SGWEMASLWIGLVVGVP
Sbjct  56   SASSLRSMASINPIPDTQTDEFEADPTLINNDLKPTTSSQRTFSGWEMASLWIGLVVGVP  115

Query  337  SFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGA  158
            S+YLAGSLVELGM+WWQG+ATVVAAN+I  + L+L G PGTRYGI FPVLARS+FGI GA
Sbjct  116  SYYLAGSLVELGMAWWQGIATVVAANLILLVPLVLTGEPGTRYGISFPVLARSSFGIRGA  175

Query  157  HIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDSSFS  38
            H+PTLLR+LV CGWYGI+TWIGGEAIF+LLP +IK SS S
Sbjct  176  HVPTLLRALVGCGWYGIETWIGGEAIFLLLPNSIKQSSLS  215



>ref|XP_010241649.1| PREDICTED: uncharacterized permease C29B12.14c [Nelumbo nucifera]
Length=562

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 127/151 (84%), Gaps = 5/151 (3%)
 Frame = -2

Query  475  DDDPLVQDN-----PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            DD P  Q +      D  L +D+LKPTTP QRT+SGWEMASLW+GLVVGVPS+YLAGSLV
Sbjct  65   DDRPSPQSSFKDLEQDGGLTNDDLKPTTPQQRTFSGWEMASLWVGLVVGVPSYYLAGSLV  124

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
            +LGM+WWQG+ATVVAANII  L L+L GHPGTRYGI FPVLARSAFGI GAHIPTLLR+L
Sbjct  125  DLGMAWWQGIATVVAANIILLLPLVLTGHPGTRYGISFPVLARSAFGIRGAHIPTLLRAL  184

Query  130  VACGWYGIQTWIGGEAIFILLPKTIKDSSFS  38
            V CGW+GI+TWIGGEAIF+LLP  +K +SF+
Sbjct  185  VGCGWFGIETWIGGEAIFLLLPSPLKQTSFA  215



>gb|ACU15224.1| unknown [Glycine max]
Length=223

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  454  DNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVAT  275
            ++ DP+L +++LKPTTP QRT+SG+E+ASLW+GLVVGVPS+YLAGSLV+LGM+WWQG+AT
Sbjct  80   ESDDPTLTNEDLKPTTPSQRTFSGFEIASLWVGLVVGVPSYYLAGSLVDLGMAWWQGIAT  139

Query  274  VVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWI  95
            VVAAN+I  + L+L GH GTRYGI FPVL RS+FGI+GAH+PTL+R+L+ CGWYGI++WI
Sbjct  140  VVAANMILLVPLVLTGHAGTRYGISFPVLVRSSFGINGAHVPTLIRALIGCGWYGIESWI  199

Query  94   GGEAIFILLPKTIKDSS  44
            GGEAIF+LLPK +K+++
Sbjct  200  GGEAIFLLLPKAMKEAT  216



>ref|XP_009341474.1| PREDICTED: uncharacterized permease C29B12.14c [Pyrus x bretschneideri]
Length=574

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 126/151 (83%), Gaps = 3/151 (2%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            PS + D+    +   DP+L +D+LKPT P QRT+S WEMA LWIGLVVGVP++YLAGSLV
Sbjct  75   PSPNFDE---FEFESDPTLTNDDLKPTRPDQRTFSKWEMACLWIGLVVGVPTYYLAGSLV  131

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
            +LGM+WWQG+ATVVAANII  + LIL GHPGT+YGI FPVLARS+FGI GAHIPTLLR+L
Sbjct  132  DLGMAWWQGIATVVAANIILLVPLILTGHPGTKYGISFPVLARSSFGIHGAHIPTLLRAL  191

Query  130  VACGWYGIQTWIGGEAIFILLPKTIKDSSFS  38
            V CGWYGI+TWIGGEAIFILLP +IK S  S
Sbjct  192  VGCGWYGIETWIGGEAIFILLPNSIKQSYMS  222



>emb|CDP15312.1| unnamed protein product [Coffea canephora]
Length=585

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            PDP+L +D+LKPT  GQRT+SG EMA+LWIGLVVGVPS+YLAGSLV+LGM+WWQG+ATVV
Sbjct  97   PDPTLTNDDLKPTASGQRTFSGLEMATLWIGLVVGVPSYYLAGSLVDLGMAWWQGIATVV  156

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
            AANII  + LIL GHPGTRYGI FPVLARS+FGI GAHIPTLLR+LV CGWYGI++WIGG
Sbjct  157  AANIILLVPLILTGHPGTRYGISFPVLARSSFGIRGAHIPTLLRALVGCGWYGIESWIGG  216

Query  88   EAIFILLPKTIKDSSFS  38
            EAIF+LLP+ +K S+ S
Sbjct  217  EAIFLLLPEAVKQSALS  233



>ref|XP_006354397.1| PREDICTED: uncharacterized permease C29B12.14c-like [Solanum 
tuberosum]
Length=566

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  457  QDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVA  278
            + +PDPSL +D+LKPT+  QR +SGWEMASLWIGLVVGVPS+YLAGSLV+LGMSWWQG+A
Sbjct  78   EFHPDPSLTNDDLKPTSIDQRNFSGWEMASLWIGLVVGVPSYYLAGSLVDLGMSWWQGIA  137

Query  277  TVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTW  98
             VV AN++T + LIL G PGT++GI FPVLARS+FGI GAHIPTLLR+LV CGWYGI+TW
Sbjct  138  IVVLANLVTLVPLILIGQPGTKFGISFPVLARSSFGIRGAHIPTLLRALVGCGWYGIETW  197

Query  97   IGGEAIFILLPKTIKDSSFSPA  32
            IGGEAIF+LLPK +K+SS S +
Sbjct  198  IGGEAIFLLLPKVVKNSSLSQS  219



>gb|KCW89306.1| hypothetical protein EUGRSUZ_A01597 [Eucalyptus grandis]
Length=501

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 129/157 (82%), Gaps = 12/157 (8%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
             PDP+L +D+L+PTTP +RT+SGWEMASLWIGLVVGVP++YLAGSLV+LGM+WWQG+ATV
Sbjct  78   EPDPTLTNDDLRPTTPSERTFSGWEMASLWIGLVVGVPTYYLAGSLVDLGMAWWQGIATV  137

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
            VAAN I  + L+L GHPG +YG+PFPVLARS+FG+ GAH+P LLR+LV CGWYGI+TWIG
Sbjct  138  VAANAILLVPLVLTGHPGAKYGVPFPVLARSSFGVRGAHVPALLRALVGCGWYGIETWIG  197

Query  91   GEAIFILLPKTIKDSSFSP------------ACFLAW  17
            GEAIF+LLP ++K S+ S             ACF+A+
Sbjct  198  GEAIFLLLPGSLKQSALSQPWPWLGTSPLEFACFIAF  234



>ref|XP_004246596.1| PREDICTED: uncharacterized permease C29B12.14c [Solanum lycopersicum]
Length=564

 Score =   222 bits (566),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 126/147 (86%), Gaps = 3/147 (2%)
 Frame = -2

Query  472  DDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSW  293
            DD   + +PDP+L +D+LKPT+  QR +SGWEM+SLWIGLVVGVPS+YLAGSLV+LGMSW
Sbjct  73   DD---EFHPDPTLTNDDLKPTSIDQRNFSGWEMSSLWIGLVVGVPSYYLAGSLVDLGMSW  129

Query  292  WQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWY  113
            WQG+A VV AN+IT L L+L G PGT++GI FPVLARS+FGI GAHIPTLLR+LV CGWY
Sbjct  130  WQGIAIVVLANLITLLPLVLIGQPGTKFGISFPVLARSSFGIRGAHIPTLLRALVGCGWY  189

Query  112  GIQTWIGGEAIFILLPKTIKDSSFSPA  32
            GI+TWIGGEAIF+LLPK +KDS  S +
Sbjct  190  GIETWIGGEAIFLLLPKVVKDSHLSQS  216



>ref|XP_011094562.1| PREDICTED: uncharacterized permease C29B12.14c [Sesamum indicum]
Length=561

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 137/180 (76%), Gaps = 12/180 (7%)
 Frame = -2

Query  511  ESHSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSF  332
            +S+S ++   S         +PDP+L +D+LKPTT  QRT+SG EMASLW+GLVVGVPS+
Sbjct  51   QSNSAMVKRWSKPISQFDDFDPDPTLANDDLKPTTSAQRTFSGLEMASLWVGLVVGVPSY  110

Query  331  YLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHI  152
            YLAGSLV+LGM+WWQG+A VVAAN+I    LIL GHPGTR+GI FPVLARS+FGI GAHI
Sbjct  111  YLAGSLVDLGMAWWQGIAVVVAANLILLFPLILTGHPGTRFGISFPVLARSSFGIRGAHI  170

Query  151  PTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDSSFSP------------ACFLAWHVC  8
            PTLLR+LV CGWYGI++WIGGEAIF+LLP+ I++S+F+             ACF+ + V 
Sbjct  171  PTLLRALVGCGWYGIESWIGGEAIFLLLPRIIEESTFAKPLSWLGTSPLEFACFITFWVA  230



>ref|XP_008366653.1| PREDICTED: uncharacterized permease C29B12.14c-like [Malus domestica]
Length=574

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP+L +D+LKPT P QRT+S WEMA LWIGLVVGVP++YLAGSLV+LGM+WWQG+ATVVA
Sbjct  87   DPTLTNDDLKPTRPDQRTFSKWEMACLWIGLVVGVPTYYLAGSLVDLGMAWWQGIATVVA  146

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            ANII  + LIL GHPGT+YGI FPVLARS+FGI GAHIPTLLR+LV CGWYGI+TWIGGE
Sbjct  147  ANIILLVPLILTGHPGTKYGISFPVLARSSFGIHGAHIPTLLRALVGCGWYGIETWIGGE  206

Query  85   AIFILLPKTIKDSSFS  38
            AIFILLP +IK S  S
Sbjct  207  AIFILLPNSIKQSYMS  222



>ref|XP_004494100.1| PREDICTED: probable allantoin permease-like [Cicer arietinum]
Length=569

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 126/156 (81%), Gaps = 12/156 (8%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            PDP+L +D+LKPTTP QRT+S  EMA LW+GLVVGVPS+YLAGSLV+LGM+WWQG+ATVV
Sbjct  80   PDPTLSNDDLKPTTPSQRTFSRMEMAGLWVGLVVGVPSYYLAGSLVDLGMAWWQGIATVV  139

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
             AN+I  + L+L GHPGTRYGI FPVLARS+FGI GAHIPTLLR+LV CGWYGI++WIGG
Sbjct  140  VANMILFVPLVLTGHPGTRYGISFPVLARSSFGIHGAHIPTLLRALVGCGWYGIESWIGG  199

Query  88   EAIFILLPKTIKDSSFSPA------------CFLAW  17
            EAIF+LLP +IK ++ S              CFLA+
Sbjct  200  EAIFLLLPNSIKQTTLSKCLPWLGTSPLEFFCFLAF  235



>ref|XP_009586794.1| PREDICTED: uncharacterized permease C29B12.14c [Nicotiana tomentosiformis]
Length=579

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 126/159 (79%), Gaps = 5/159 (3%)
 Frame = -2

Query  511  ESHSQIIPSGSLDDD-----PLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVV  347
              ++ + P  S DD            PDPSL +D+LKPTT  QR +SGWEMASLWIGLVV
Sbjct  65   RCNNTLSPMASSDDQSHFISQFDDFQPDPSLTNDDLKPTTTDQRNFSGWEMASLWIGLVV  124

Query  346  GVPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGI  167
            GVPS+YLAGSLV+LGM+WWQG+A VV AN+IT + LIL G PGT+YGI FP+LARS+FGI
Sbjct  125  GVPSYYLAGSLVDLGMAWWQGIAIVVIANLITLVPLILIGQPGTKYGISFPILARSSFGI  184

Query  166  SGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKD  50
             GAHIPTLLR+LV CGWYGI+TWIGGEAIF+LLPK IK+
Sbjct  185  RGAHIPTLLRALVGCGWYGIETWIGGEAIFLLLPKVIKE  223



>ref|XP_009780325.1| PREDICTED: uncharacterized permease C29B12.14c [Nicotiana sylvestris]
Length=579

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
             PDPSL +D+LKPTT  QR +SGWEMASLWIGLVVGVPS+YLAGSLV+LGM+WWQG+A V
Sbjct  90   QPDPSLTNDDLKPTTTDQRNFSGWEMASLWIGLVVGVPSYYLAGSLVDLGMAWWQGIAIV  149

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
            V AN+IT + LIL G PGT+YGI FP+LARS+FGI GAHIPTLLR+LV CGWYGI+TWIG
Sbjct  150  VIANLITLVPLILIGQPGTKYGISFPILARSSFGIKGAHIPTLLRALVGCGWYGIETWIG  209

Query  91   GEAIFILLPKTIKD  50
            GEAIF+LLPK IK+
Sbjct  210  GEAIFLLLPKVIKE  223



>gb|EYU41577.1| hypothetical protein MIMGU_mgv1a003893mg [Erythranthe guttata]
Length=557

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
             PDP+L +D+LKPTT  QRT++G EMASLW+GLVVGVP++YLAGSLV+LGM+WWQG+ATV
Sbjct  69   EPDPTLTNDDLKPTTSDQRTFTGLEMASLWVGLVVGVPTYYLAGSLVDLGMAWWQGIATV  128

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
            VAAN+I    L+L GHPGT+YGI FPVLARS+FGI GAHIPTLLR+LV CGWYGI+TWIG
Sbjct  129  VAANVILLFPLVLTGHPGTKYGISFPVLARSSFGIRGAHIPTLLRALVGCGWYGIETWIG  188

Query  91   GEAIFILLPKTIKDSSFS  38
            GEAIF+LLP+T+K S+ +
Sbjct  189  GEAIFLLLPETVKQSTLA  206



>ref|XP_010050301.1| PREDICTED: uncharacterized permease C29B12.14c [Eucalyptus grandis]
Length=567

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 129/157 (82%), Gaps = 12/157 (8%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
             PDP+L +D+L+PTTP +RT+SGWEMASLWIGLVVGVP++YLAGSLV+LGM+WWQG+ATV
Sbjct  78   EPDPTLTNDDLRPTTPSERTFSGWEMASLWIGLVVGVPTYYLAGSLVDLGMAWWQGIATV  137

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
            VAAN I  + L+L GHPG +YG+PFPVLARS+FG+ GAH+P LLR+LV CGWYGI+TWIG
Sbjct  138  VAANAILLVPLVLTGHPGAKYGVPFPVLARSSFGVRGAHVPALLRALVGCGWYGIETWIG  197

Query  91   GEAIFILLPKTIKDSSFSP------------ACFLAW  17
            GEAIF+LLP ++K S+ S             ACF+A+
Sbjct  198  GEAIFLLLPGSLKQSALSQPWPWLGTSPLEFACFIAF  234



>ref|XP_008241348.1| PREDICTED: uncharacterized permease C29B12.14c [Prunus mume]
Length=575

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 128/155 (83%), Gaps = 5/155 (3%)
 Frame = -2

Query  502  SQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLA  323
            +Q  PS   D+        DP+L +D+LKPTT  QRT+S WE+ASLW+GLVVGVP++YLA
Sbjct  74   TQHNPSPKFDEF-----ESDPTLTNDDLKPTTLDQRTFSRWELASLWVGLVVGVPTYYLA  128

Query  322  GSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTL  143
            GSLV+LGM+WWQG+ATVVAANII  + L+L GHPGT+YGI FPVLARS+FGI GAHIPTL
Sbjct  129  GSLVDLGMAWWQGIATVVAANIILLVPLVLTGHPGTKYGISFPVLARSSFGIYGAHIPTL  188

Query  142  LRSLVACGWYGIQTWIGGEAIFILLPKTIKDSSFS  38
            LR+LV CGWYGI+TWIGGEAIFILLP +IK SS S
Sbjct  189  LRALVGCGWYGIETWIGGEAIFILLPNSIKQSSLS  223



>ref|XP_007027529.1| Allantoin permease [Theobroma cacao]
 gb|EOY08031.1| Allantoin permease [Theobroma cacao]
Length=579

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
             PDP+L +D+LKPTTP QR +  WEMA LWIGLVVGVPS+YLAGSLV++GM+WWQG+ATV
Sbjct  90   EPDPTLTNDDLKPTTPSQRNFHWWEMACLWIGLVVGVPSYYLAGSLVDIGMAWWQGIATV  149

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
            VAAN+I    L+L GHPG +YGI FPVLARSAFGI GAH+PTLLR+LV CGWYGI++WIG
Sbjct  150  VAANLILLAPLVLTGHPGAKYGISFPVLARSAFGIRGAHVPTLLRALVGCGWYGIESWIG  209

Query  91   GEAIFILLPKTIKDSSFS  38
            GE IF+LLPK+IK+SS S
Sbjct  210  GEGIFLLLPKSIKESSLS  227



>ref|XP_003590437.1| Uracil transporter-like protein [Medicago truncatula]
 gb|AES60688.1| cytosine/purine uracil thiamine allantoin permease [Medicago 
truncatula]
Length=586

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  457  QDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVA  278
            +  PDPSL +++LKPTTP QRT+SG E+ASLWIGLVVGVPS+YLAGSLV+LGMSWWQG++
Sbjct  94   EFEPDPSLTNEDLKPTTPSQRTFSGLEIASLWIGLVVGVPSYYLAGSLVDLGMSWWQGIS  153

Query  277  TVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTW  98
            TVV ANII    LIL GH GT+YGI FPVLARS+FGI GAHIPTLLR+LV CGWYGI++W
Sbjct  154  TVVLANIILLFPLILTGHAGTKYGISFPVLARSSFGIHGAHIPTLLRALVGCGWYGIESW  213

Query  97   IGGEAIFILLPKTIKDSSF  41
            IGGEAIFILLP ++K+ +F
Sbjct  214  IGGEAIFILLPNSLKEITF  232



>ref|XP_006428387.1| hypothetical protein CICLE_v10011424mg [Citrus clementina]
 gb|ESR41627.1| hypothetical protein CICLE_v10011424mg [Citrus clementina]
Length=543

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 134/172 (78%), Gaps = 17/172 (10%)
 Frame = -2

Query  493  IPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSL  314
            + S   +DD      P  +L +++LKP+T  +RT+S WEMASLWIGLVVGVPS+YLAGSL
Sbjct  44   LSSTEFNDD----LEPHLTLRNEDLKPSTINERTFSWWEMASLWIGLVVGVPSYYLAGSL  99

Query  313  VELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRS  134
            V+LGM+WWQG+ATVVAAN+I  + L+L GHPGT+YGIPFPVLARS+FGI GAHIPTLLR+
Sbjct  100  VDLGMAWWQGIATVVAANVILLVPLVLTGHPGTKYGIPFPVLARSSFGIKGAHIPTLLRA  159

Query  133  LVACGWYGIQTWIGGEAIFILLPKTIKDSSF----------SP---ACFLAW  17
            LV CGWYGI+TWIGGEA+F+LLPK IK SS           SP   ACF+A+
Sbjct  160  LVGCGWYGIETWIGGEAVFLLLPKFIKQSSILSQSLPWLGTSPLEFACFIAF  211



>ref|XP_006493005.1| PREDICTED: uncharacterized permease C29B12.14c-like [Citrus sinensis]
Length=560

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 134/172 (78%), Gaps = 17/172 (10%)
 Frame = -2

Query  493  IPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSL  314
            + S   +DD      P  +L +++LKP+T  +RT+S WEMASLWIGLVVGVPS+YLAGSL
Sbjct  61   LSSTEFNDD----LEPHLTLRNEDLKPSTINERTFSWWEMASLWIGLVVGVPSYYLAGSL  116

Query  313  VELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRS  134
            V+LGM+WWQG+ATVVAAN+I  + L+L GHPGT+YGIPFPVLARS+FGI GAHIPTLLR+
Sbjct  117  VDLGMAWWQGIATVVAANVILLVPLVLTGHPGTKYGIPFPVLARSSFGIKGAHIPTLLRA  176

Query  133  LVACGWYGIQTWIGGEAIFILLPKTIKDSSF----------SP---ACFLAW  17
            LV CGWYGI+TWIGGEA+F+LLPK IK SS           SP   ACF+A+
Sbjct  177  LVGCGWYGIETWIGGEAVFLLLPKFIKQSSILSQSLPWLGTSPLEFACFIAF  228



>ref|XP_004304328.1| PREDICTED: probable allantoin permease-like [Fragaria vesca subsp. 
vesca]
Length=566

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 122/145 (84%), Gaps = 5/145 (3%)
 Frame = -2

Query  499  QIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAG  320
            Q  PS   DD        DP+L +D+LKPTTP QR++S WE+ASLWIGLVVGVP++YLAG
Sbjct  65   QSTPSPKFDDF-----EADPTLTNDDLKPTTPDQRSFSRWELASLWIGLVVGVPTYYLAG  119

Query  319  SLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLL  140
            SLV+LGM+WWQG+ATVVAANI+  + L+L GHPGT+YGI FPVLARS+FGI GAHIPTLL
Sbjct  120  SLVDLGMAWWQGIATVVAANIVLLVPLVLTGHPGTKYGISFPVLARSSFGIHGAHIPTLL  179

Query  139  RSLVACGWYGIQTWIGGEAIFILLP  65
            R+LV CGWYGI+TWIGGEAIF+LLP
Sbjct  180  RALVGCGWYGIETWIGGEAIFLLLP  204



>ref|XP_003542570.1| PREDICTED: uncharacterized permease C29B12.14c-like [Glycine 
max]
Length=572

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 132/169 (78%), Gaps = 12/169 (7%)
 Frame = -2

Query  487  SGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVE  308
            S S    P  +   DP+L +++LKPT P QRT+SG+E+ASLW+GLVVGVPS+YLAGSLV+
Sbjct  71   SSSYTAPPDFELESDPTLTNEDLKPTAPSQRTFSGFEIASLWVGLVVGVPSYYLAGSLVD  130

Query  307  LGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLV  128
            LGM+WWQG+ATVVAAN++  + L+L GH GTRYGI FPVL RS+FGI+GAHIPTL+R+L+
Sbjct  131  LGMAWWQGIATVVAANMVLLVPLVLTGHAGTRYGISFPVLVRSSFGINGAHIPTLIRALI  190

Query  127  ACGWYGIQTWIGGEAIFILLPKTIKDSSFSP------------ACFLAW  17
             CGWYGI++WIGGEAIF+LLPK +K++S S             ACFL +
Sbjct  191  GCGWYGIESWIGGEAIFLLLPKAMKETSLSQSLPWLGTSPLEFACFLVF  239



>gb|KHN48224.1| Putative allantoin permease [Glycine soja]
Length=572

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 132/169 (78%), Gaps = 12/169 (7%)
 Frame = -2

Query  487  SGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVE  308
            S S    P  +   DP+L +++LKPT P QRT+SG+E+ASLW+GLVVGVPS+YLAGSLV+
Sbjct  71   SSSYTAPPDFELESDPTLTNEDLKPTAPSQRTFSGFEIASLWVGLVVGVPSYYLAGSLVD  130

Query  307  LGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLV  128
            LGM+WWQG+ATVVAAN++  + L+L GH GTRYGI FPVL RS+FGI+GAHIPTL+R+L+
Sbjct  131  LGMAWWQGIATVVAANMVLLVPLVLTGHAGTRYGISFPVLVRSSFGINGAHIPTLIRALI  190

Query  127  ACGWYGIQTWIGGEAIFILLPKTIKDSSFSP------------ACFLAW  17
             CGWYGI++WIGGEAIF+LLPK +K++S S             ACFL +
Sbjct  191  GCGWYGIESWIGGEAIFLLLPKAMKETSLSQSLPWLGTSPLEFACFLVF  239



>ref|XP_010543900.1| PREDICTED: uracil permease [Tarenaya hassleriana]
Length=576

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = -2

Query  487  SGSLDDDPL--VQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSL  314
            S ++D D L   +   DPSL +D+LKPT P QRT+S WEMASLWIGLVVGVPS+YLAGSL
Sbjct  96   SSAVDSDELGFNESKLDPSLTNDDLKPTKPSQRTFSWWEMASLWIGLVVGVPSYYLAGSL  155

Query  313  VELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRS  134
            V+LGM+WWQG+ATVVAAN+I  + L+L   PGT YGI FPVLARS+FGI GA+IPTLLR+
Sbjct  156  VDLGMAWWQGIATVVAANVILLVPLVLTAQPGTMYGISFPVLARSSFGIRGANIPTLLRA  215

Query  133  LVACGWYGIQTWIGGEAIFILLPKTIKDSSFSPA  32
            LV CGWYGI+TWIGGEAIF+LLP  +K+S+ S +
Sbjct  216  LVGCGWYGIETWIGGEAIFLLLPSHLKNSALSES  249



>gb|EPS64628.1| hypothetical protein M569_10151, partial [Genlisea aurea]
Length=488

 Score =   213 bits (541),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
             PDP+L +DELKPT+P  R +SG E+ASLW+GLVVGVP++YLAGSLVELGM+WWQG+ATV
Sbjct  3    RPDPTLTNDELKPTSPEMRAFSGLELASLWVGLVVGVPTYYLAGSLVELGMAWWQGIATV  62

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
            V AN+I    LIL GHPG++YG+ FPVLARS+FGI GAHIPTLLR+LV CGWYGI+TWIG
Sbjct  63   VTANMILLFPLILTGHPGSKYGVSFPVLARSSFGIRGAHIPTLLRALVGCGWYGIETWIG  122

Query  91   GEAIFILLPKTIKDSSFS  38
            GEAIF+LLP   K SS +
Sbjct  123  GEAIFLLLPAAAKRSSLA  140



>gb|KHN36454.1| Putative allantoin permease [Glycine soja]
Length=571

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  454  DNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVAT  275
            ++ DP+L +++LKPTTP QRT+SG+E+ASLW+GLVVGVPS+YLAGSLV+LGM+WWQG+AT
Sbjct  80   ESDDPTLTNEDLKPTTPSQRTFSGFEIASLWVGLVVGVPSYYLAGSLVDLGMAWWQGIAT  139

Query  274  VVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWI  95
            VVAAN+I  + L+L GH GTRYGI FPVL RS+FGI+GAH+PTL+R+L+ CGWYGI++WI
Sbjct  140  VVAANMILLVPLVLTGHAGTRYGISFPVLVRSSFGINGAHVPTLIRALIGCGWYGIESWI  199

Query  94   GGEAIFILLPKTIKDSS  44
            GGEAIF+LLPK +K+++
Sbjct  200  GGEAIFLLLPKAMKEAT  216



>ref|XP_006290075.1| hypothetical protein CARUB_v10003714mg [Capsella rubella]
 gb|EOA22973.1| hypothetical protein CARUB_v10003714mg [Capsella rubella]
Length=583

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -2

Query  478  LDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGM  299
             DD    +   DPSL +D+LKPTTP QRT+S  +M+SLWIGLVVGVP++YLAGSLV+LGM
Sbjct  88   FDDLGYDESQFDPSLTNDDLKPTTPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSLVDLGM  147

Query  298  SWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACG  119
            +WWQG+ATVVAAN+I  + L+L   PGT YGI FPVLARS+FGI GAHIPTLLR+LV CG
Sbjct  148  AWWQGIATVVAANLILLVPLVLTAQPGTMYGISFPVLARSSFGIRGAHIPTLLRALVGCG  207

Query  118  WYGIQTWIGGEAIFILLPKTIKDSSFS  38
            WYGI+TWIGGEAIF+LLP  IK+S+ S
Sbjct  208  WYGIETWIGGEAIFLLLPGHIKNSALS  234



>ref|XP_010423698.1| PREDICTED: uncharacterized permease C29B12.14c-like [Camelina 
sativa]
Length=643

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  481  SLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELG  302
              +D    +   DPSL +DELKPTTP QRT+S  +M+SLWIGLVVGVP++YLAGSLV+LG
Sbjct  146  EFNDLDYDETQFDPSLTNDELKPTTPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSLVDLG  205

Query  301  MSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVAC  122
            M+WWQG+ATVVAAN+I  + L+L   PGT YGI FPVLARS+FGI GAHIPTLLR+LV C
Sbjct  206  MAWWQGIATVVAANLILLVPLVLTAQPGTMYGISFPVLARSSFGIRGAHIPTLLRALVGC  265

Query  121  GWYGIQTWIGGEAIFILLPKTIKDSSFS  38
            GWYGI+TWIGGEAIF+LLP  IK+S+ S
Sbjct  266  GWYGIETWIGGEAIFLLLPSHIKNSALS  293



>ref|XP_010490841.1| PREDICTED: uncharacterized permease C29B12.14c-like [Camelina 
sativa]
Length=593

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  481  SLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELG  302
              +D    +   DPSL +DELKPTTP QRT+S  +M+SLWIGLVVGVP++YLAGSLV+LG
Sbjct  96   EFNDLEYDESQFDPSLTNDELKPTTPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSLVDLG  155

Query  301  MSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVAC  122
            M+WWQG+ATVV AN+I  + L+L   PGT YGI FPVLARS+FGI GAHIPTLLR+LV C
Sbjct  156  MAWWQGIATVVTANLILLVPLVLTAQPGTMYGISFPVLARSSFGIRGAHIPTLLRALVGC  215

Query  121  GWYGIQTWIGGEAIFILLPKTIKDSSFS  38
            GWYGI+TWIGGEAIF+LLP  IK+S+ S
Sbjct  216  GWYGIETWIGGEAIFLLLPGHIKNSAMS  243



>ref|XP_007145286.1| hypothetical protein PHAVU_007G226300g [Phaseolus vulgaris]
 gb|ESW17280.1| hypothetical protein PHAVU_007G226300g [Phaseolus vulgaris]
Length=614

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 130/162 (80%), Gaps = 12/162 (7%)
 Frame = -2

Query  466  PLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQ  287
            P ++   DP+L +++LKPT   +RT+SG+E+ASLW+GLVVGVPS+YLAGSLV+LGM+WWQ
Sbjct  120  PDLEFEYDPTLTNEDLKPTAASERTFSGFEIASLWVGLVVGVPSYYLAGSLVDLGMAWWQ  179

Query  286  GVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGI  107
            G+ATVVAAN+I  + L+L GH GTRYGI FPVL RS+FGI GAHIPTLLR+LV CGWYGI
Sbjct  180  GIATVVAANMILLVPLVLTGHAGTRYGISFPVLVRSSFGIHGAHIPTLLRALVGCGWYGI  239

Query  106  QTWIGGEAIFILLPKTIKDSSFSP------------ACFLAW  17
            ++WIGGEAIF+LLPK++K++S S             ACFL +
Sbjct  240  ESWIGGEAIFLLLPKSMKEASLSQPLPWLGTSPLEFACFLVF  281



>ref|XP_004513980.1| PREDICTED: probable allantoin permease-like [Cicer arietinum]
Length=559

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = -2

Query  457  QDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVA  278
            +  PDP+L +++LKPT+  QRT+SG E+ASLW+GLVVGVPS+YLAGSLV+LGM+WWQG++
Sbjct  67   EFEPDPTLTNEDLKPTSQTQRTFSGLEIASLWVGLVVGVPSYYLAGSLVDLGMAWWQGIS  126

Query  277  TVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTW  98
            TVV AN+I  + L+L GH GT YGI FPVLARS+FGI GAHIPTLLR+L+ CGWYGI++W
Sbjct  127  TVVIANMILLVPLVLTGHAGTHYGISFPVLARSSFGIHGAHIPTLLRALIGCGWYGIESW  186

Query  97   IGGEAIFILLPKTIKD-SSFSPACFLAW  17
            IGGEAIFILLPK++K  SSFS   FL W
Sbjct  187  IGGEAIFILLPKSLKQVSSFS--NFLPW  212



>gb|AAL25608.1| At5g03555/C415EPL23M [Arabidopsis thaliana]
 gb|AAM67341.1| uracil transporter-like protein [Arabidopsis thaliana]
Length=502

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  481  SLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELG  302
             ++D    +   DPSL +D+LKPTTP QRT+S  +M+SLWIGLVVGVP++YLAGSLV+LG
Sbjct  5    EINDHGYDESQFDPSLTNDDLKPTTPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSLVDLG  64

Query  301  MSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVAC  122
            M+WWQG+ATVV AN+I  + L+L   PGT YGI FPVLARS+FGI GAHIPTLLR+LV C
Sbjct  65   MAWWQGIATVVTANLILLVPLVLTAQPGTLYGISFPVLARSSFGIRGAHIPTLLRALVGC  124

Query  121  GWYGIQTWIGGEAIFILLPKTIKDSSFS  38
            GWYGI+TWIGGEAIF+LLP  IK S+ S
Sbjct  125  GWYGIETWIGGEAIFLLLPGHIKKSALS  152



>ref|NP_568122.2| nucleobase:cation symporter-1 [Arabidopsis thaliana]
 emb|CAB83318.1| uracil transporter-like protein [Arabidopsis thaliana]
 gb|AED90625.1| nucleobase:cation symporter-1 [Arabidopsis thaliana]
Length=599

 Score =   209 bits (533),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  478  LDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGM  299
            ++D    +   DPSL +D+LKPTTP QRT+S  +M+SLWIGLVVGVP++YLAGSLV+LGM
Sbjct  103  INDHGYDESQFDPSLTNDDLKPTTPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSLVDLGM  162

Query  298  SWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACG  119
            +WWQG+ATVV AN+I  + L+L   PGT YGI FPVLARS+FGI GAHIPTLLR+LV CG
Sbjct  163  AWWQGIATVVTANLILLVPLVLTAQPGTLYGISFPVLARSSFGIRGAHIPTLLRALVGCG  222

Query  118  WYGIQTWIGGEAIFILLPKTIKDSSFS  38
            WYGI+TWIGGEAIF+LLP  IK S+ S
Sbjct  223  WYGIETWIGGEAIFLLLPGHIKKSALS  249



>emb|CDX80874.1| BnaC03g01280D [Brassica napus]
Length=587

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  472  DDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSW  293
            D    +   DP+L +D+LKPT P QRT+S  +M+SLWIGLVVGVP++YLAGSLV+LGM+W
Sbjct  90   DSGYDESEFDPTLTNDDLKPTKPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSLVDLGMAW  149

Query  292  WQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWY  113
            WQG+ATVVAAN+I  + L+L   PGT YGI FPVLARS+FGI GAHIPTLLR+LV CGWY
Sbjct  150  WQGIATVVAANLILLVPLVLTAQPGTMYGISFPVLARSSFGIRGAHIPTLLRALVGCGWY  209

Query  112  GIQTWIGGEAIFILLPKTIKDSSFS  38
            GI+TWIGGEAIF+LLP  IK+S+ S
Sbjct  210  GIETWIGGEAIFLLLPSHIKNSALS  234



>ref|XP_009130766.1| PREDICTED: uracil permease [Brassica rapa]
Length=584

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  472  DDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSW  293
            D    +   DP+L +D+LKPT P QRT+S  +M+SLWIGLVVGVP++YLAGSLV+LGM+W
Sbjct  93   DSGYDESQFDPTLTNDDLKPTKPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSLVDLGMAW  152

Query  292  WQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWY  113
            WQG+ATVVAAN+I  + L+L   PGT YGI FPVLARS+FGI GAHIPTLLR+LV CGWY
Sbjct  153  WQGIATVVAANLILLVPLVLTAQPGTMYGISFPVLARSSFGIRGAHIPTLLRALVGCGWY  212

Query  112  GIQTWIGGEAIFILLPKTIKDSSFS  38
            GI+TWIGGEAIF+LLP  IK+S+ S
Sbjct  213  GIETWIGGEAIFLLLPAHIKNSALS  237



>ref|XP_002873103.1| permease, cytosine/purines, uracil, thiamine, allantoin family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49362.1| permease, cytosine/purines, uracil, thiamine, allantoin family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=599

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -2

Query  475  DDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMS  296
            +D    +   DPSL +++LKPTTP QRT+S  +M+SLWIGLVVGVP++YLAGSLV+LGM+
Sbjct  104  NDFGFDESQFDPSLTNEDLKPTTPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSLVDLGMA  163

Query  295  WWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGW  116
            WWQG+ATVVAAN+I  + L+L   PGT YGI FPVLARS+FGI GAHIPTLLR+LV CGW
Sbjct  164  WWQGIATVVAANLILLVPLVLTAQPGTLYGISFPVLARSSFGIRGAHIPTLLRALVGCGW  223

Query  115  YGIQTWIGGEAIFILLPKTIKDSSFS  38
            YGI+TWIGGEAIF+LLP   K+S+ S
Sbjct  224  YGIETWIGGEAIFLLLPAHFKNSALS  249



>emb|CDY11257.1| BnaA03g00930D [Brassica napus]
Length=898

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  472  DDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSW  293
            D    +   DP+L +D+LKPT P QRT+S  +M+SLWIGLVVGVP++YLAGSLV+LGM+W
Sbjct  93   DSGYDESEFDPTLTNDDLKPTKPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSLVDLGMAW  152

Query  292  WQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWY  113
            WQG+ATVVAAN+I  + L+L   PGT YGI FPVLARS+FGI GAHIPTLLR+LV CGWY
Sbjct  153  WQGIATVVAANLILLVPLVLTAQPGTMYGISFPVLARSSFGIRGAHIPTLLRALVGCGWY  212

Query  112  GIQTWIGGEAIFILLPKTIKDSSFS  38
            GI+TWIGGEAIF+LLP  IK+S+ S
Sbjct  213  GIETWIGGEAIFLLLPSHIKNSALS  237



>ref|XP_008442760.1| PREDICTED: uncharacterized permease C29B12.14c [Cucumis melo]
Length=554

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 127/172 (74%), Gaps = 13/172 (8%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            P  S D +P  +D  +     D+L+PTT  QRT S  EMA LWIGL+VGVPS+YLAGSLV
Sbjct  57   PMASADANP-SEDTQNDDSGKDDLRPTTLEQRTLSWPEMALLWIGLIVGVPSYYLAGSLV  115

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
            +LGMSWWQG+ATVV AN +T + LIL GHPGT+YGI FPV ARS+FGI GAHIPTLLR+L
Sbjct  116  DLGMSWWQGIATVVVANAVTLIALILNGHPGTKYGISFPVFARSSFGIHGAHIPTLLRAL  175

Query  130  VACGWYGIQTWIGGEAIFILLPKTIKDSSFSP------------ACFLAWHV  11
            + CGWYGI+TWI GEAIF+LLP++IK SSFS              CFLA+ V
Sbjct  176  IGCGWYGIETWIAGEAIFLLLPESIKKSSFSQILPWLGTSPLAFTCFLAFWV  227



>ref|XP_006398809.1| hypothetical protein EUTSA_v10015725mg [Eutrema salsugineum]
 gb|ESQ40262.1| hypothetical protein EUTSA_v10015725mg [Eutrema salsugineum]
Length=608

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  478  LDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGM  299
             DD    +   DP+L +D+LKPT P QRT+S  +M+SLWIGLVVGVP++YLAGSLV+LGM
Sbjct  112  FDDFGYDESQFDPALTNDDLKPTKPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSLVDLGM  171

Query  298  SWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACG  119
            +WWQG+ATVVAAN+I  + L+L   PGT YGI FPVLARS+FGI GAHIPTL+R+LV CG
Sbjct  172  AWWQGIATVVAANLILLVPLVLTAQPGTMYGISFPVLARSSFGIRGAHIPTLVRALVGCG  231

Query  118  WYGIQTWIGGEAIFILLPKTIKDSSFS  38
            WYGI+TWIGGEAIF+LLP  +K+S+ S
Sbjct  232  WYGIETWIGGEAIFLLLPGHVKNSALS  258



>gb|KDP29210.1| hypothetical protein JCGZ_16599 [Jatropha curcas]
Length=400

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  457  QDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVA  278
            +   DP+L +++LKPTTP QRT+SG+EMASLWIGLVVGVPS+YLAGSLV+LGM+WWQG+A
Sbjct  15   EFESDPTLTNEDLKPTTPSQRTFSGYEMASLWIGLVVGVPSYYLAGSLVDLGMAWWQGIA  74

Query  277  TVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTW  98
            TVVAANII    L+L GHPGT YGIPFPVLARS FGI GAHIPTLLR+LV CGWYGI+TW
Sbjct  75   TVVAANIILLFPLVLIGHPGTHYGIPFPVLARSCFGIRGAHIPTLLRALVGCGWYGIETW  134

Query  97   IGGEAIF  77
            IG    F
Sbjct  135  IGANISF  141



>emb|CDP15313.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -2

Query  493  IPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSL  314
            IP     DD      P+ S+ SDELKPTT  QR++S  EM SLW+GLVVGVP++Y+AGSL
Sbjct  4    IPHQPRLDDADADTEPEHSIYSDELKPTTSHQRSFSWLEMGSLWVGLVVGVPAYYVAGSL  63

Query  313  VELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRS  134
            VELGM+WWQG+ TVV AN+I  + LIL G+ GT YGI FPVLARS+FGI GAH+P LLRS
Sbjct  64   VELGMAWWQGILTVVLANMILLIPLILTGYAGTLYGISFPVLARSSFGIRGAHVPALLRS  123

Query  133  LVACGWYGIQTWIGGEAIFILLPKTIKDSSFSPA  32
            L+ACGWYGI+TWIGG+ IF+LLP+T K+S+ S A
Sbjct  124  LIACGWYGIETWIGGQGIFLLLPQTAKESALSKA  157



>ref|XP_010452235.1| PREDICTED: uncharacterized permease C29B12.14c-like [Camelina 
sativa]
Length=596

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -2

Query  478  LDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGM  299
             +D    +   DPSL +DELKPTTP QRT+S  +M+SLWIGLVVGVP++YLAGSLV+LGM
Sbjct  100  FNDLEYDESQFDPSLTNDELKPTTPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSLVDLGM  159

Query  298  SWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACG  119
            +WWQG+ATVV AN+I  +TL+L   PGT YGI FPVLARS+FGI GAHIPTLLR+LV CG
Sbjct  160  AWWQGIATVVTANLILLVTLVLTAQPGTMYGIAFPVLARSSFGIHGAHIPTLLRALVGCG  219

Query  118  WYGIQTWIGGEAIFILLPKTIKDSSFS  38
            WYGI+TWIGGEAIF+LLP  IK+S+ S
Sbjct  220  WYGIETWIGGEAIFLLLPSHIKNSALS  246



>ref|XP_008803457.1| PREDICTED: uracil permease [Phoenix dactylifera]
Length=492

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -2

Query  430  SDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIIT  251
              +L PT P QRT+S W+MASLW+GLVVGVPS+YLAGSLV+LGM+WWQGVATVV AN I 
Sbjct  9    DSDLAPTPPSQRTFSAWDMASLWVGLVVGVPSYYLAGSLVDLGMAWWQGVATVVLANFIV  68

Query  250  SLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFIL  71
             + L+L   PGT+YGIPFPVLARSAFG+ GAH+PTLLR+LV CGWYGI+TWIGGEA+F+L
Sbjct  69   LVPLVLTAVPGTKYGIPFPVLARSAFGVRGAHVPTLLRALVGCGWYGIETWIGGEAVFLL  128

Query  70   LPKTIKDSSFSPA  32
            LP ++K SS +P+
Sbjct  129  LPPSLKASSSAPS  141



>ref|XP_009411552.1| PREDICTED: uracil permease-like [Musa acuminata subsp. malaccensis]
Length=555

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -2

Query  523  PSVAESHSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVG  344
            P ++  H+ I P  SL   P    +PD +    +L P     RT++ W+MASLW+GLVVG
Sbjct  49   PPLSFKHAPIRPLSSLLVVPKCSSDPDAATGGSDLAPVPVSARTFTAWDMASLWVGLVVG  108

Query  343  VPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGIS  164
            VP++YLAGSLV LGM+WWQGVATV  AN++    L+L G PGTRYG+PFPVLAR+AFG+ 
Sbjct  109  VPAYYLAGSLVNLGMAWWQGVATVFVANLVVLFPLVLTGVPGTRYGVPFPVLARAAFGVR  168

Query  163  GAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDSS  44
            GAH+PTLLR+LV CGWYGI+TWIGG+A+F+LLP  +K S+
Sbjct  169  GAHVPTLLRALVGCGWYGIETWIGGQAVFLLLPAALKSSA  208



>ref|XP_004137857.1| PREDICTED: probable allantoin permease-like [Cucumis sativus]
 ref|XP_004170590.1| PREDICTED: probable allantoin permease-like [Cucumis sativus]
 gb|KGN59030.1| hypothetical protein Csa_3G746620 [Cucumis sativus]
Length=555

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            P  S   +P  +D  +     ++L+PTT  QRT S  EMA LWIGL+VGVPS+YLAGSLV
Sbjct  57   PMASATANP-PEDTQNEDSGKEDLRPTTLEQRTLSWPEMALLWIGLIVGVPSYYLAGSLV  115

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
            +LGMSWWQG+ATVVAAN +T + LIL GHPGT+YGI FPV ARS+FGI GAHIPTLLR+L
Sbjct  116  DLGMSWWQGIATVVAANAVTLIALILNGHPGTKYGISFPVFARSSFGIHGAHIPTLLRAL  175

Query  130  VACGWYGIQTWIGGEAIFILLPKTIKDSSFS  38
            + CGWYGI+TWI GEAI +LLP++IK S+FS
Sbjct  176  IGCGWYGIETWIAGEAISLLLPQSIKKSAFS  206



>ref|XP_010918592.1| PREDICTED: uracil permease-like [Elaeis guineensis]
Length=603

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 118/148 (80%), Gaps = 8/148 (5%)
 Frame = -2

Query  487  SGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVE  308
            S  +DD  +  D+        +L PT P  RT+S W+MASLW+GLVVGVPS+YLAGSLV+
Sbjct  109  SADIDDGVIPTDS--------DLAPTPPSHRTFSAWDMASLWVGLVVGVPSYYLAGSLVD  160

Query  307  LGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLV  128
            LGM+WWQG+ATVV AN+I  + LIL   PGT++GIPFPVLARSAFG+ GAH+PTLLR+LV
Sbjct  161  LGMAWWQGIATVVLANLIVLIPLILTAVPGTKHGIPFPVLARSAFGVRGAHVPTLLRALV  220

Query  127  ACGWYGIQTWIGGEAIFILLPKTIKDSS  44
             CGWYGI+TWIGGEAIF+LLP ++K SS
Sbjct  221  GCGWYGIETWIGGEAIFLLLPPSLKTSS  248



>ref|XP_006826231.1| hypothetical protein AMTR_s00132p00084290 [Amborella trichopoda]
 gb|ERM93468.1| hypothetical protein AMTR_s00132p00084290 [Amborella trichopoda]
Length=510

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 12/153 (8%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+LKPTTP QRT+S  +  SLW+GLVVGVP++YLAGSLVELGM WWQG+ATVV AN
Sbjct  24   SLTNDDLKPTTPDQRTFSALDFGSLWVGLVVGVPTYYLAGSLVELGMVWWQGIATVVLAN  83

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + LIL GH GT YGI FPVLAR+AFGI GAH+PTLLR+LV CGW+GI+TWIGG+ +
Sbjct  84   VILIVPLILTGHAGTCYGISFPVLARAAFGIRGAHLPTLLRALVGCGWFGIETWIGGQTV  143

Query  79   FILLPKTIKDSSFSP------------ACFLAW  17
            F+LLP + + S ++             ACFL +
Sbjct  144  FLLLPLSFRQSPYAQTLPWLGTSLLEFACFLTF  176



>ref|XP_009382393.1| PREDICTED: uracil permease-like [Musa acuminata subsp. malaccensis]
Length=555

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -2

Query  427  DELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIITS  248
             +L P     RT++ W+M SLW+ LVVGVPS+YLAGSLV+LGM+WWQGVATVV AN+I  
Sbjct  84   SDLAPVPASARTFTAWDMGSLWVSLVVGVPSYYLAGSLVDLGMAWWQGVATVVLANLIVL  143

Query  247  LTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFILL  68
              L+L G PGTR+G+PFPVLAR+AFG+ GAH+PTLLR+LV CGW+GI+TWIGGEAIF+LL
Sbjct  144  FPLVLTGVPGTRHGVPFPVLARAAFGVRGAHVPTLLRALVGCGWFGIETWIGGEAIFLLL  203

Query  67   PKTIKDSS  44
            P  +K S+
Sbjct  204  PSALKQSA  211



>ref|XP_008780405.1| PREDICTED: uncharacterized permease C29B12.14c-like [Phoenix 
dactylifera]
Length=511

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 111/142 (78%), Gaps = 1/142 (1%)
 Frame = -2

Query  472  DDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSW  293
            DD L +  PD SL+  +L P    +RT + W++A LW+G+VV VPS+YLAGSLV+LGMSW
Sbjct  6    DDGL-ELEPDASLLGSDLSPVPASKRTLTRWDIALLWVGMVVNVPSYYLAGSLVDLGMSW  64

Query  292  WQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWY  113
            WQGVAT++  N I    LIL  HPGTRYGI FPVL RSAFG+ GAH+P LLR+LVACGW 
Sbjct  65   WQGVATIILGNTILLAPLILTAHPGTRYGIAFPVLLRSAFGVHGAHVPALLRALVACGWC  124

Query  112  GIQTWIGGEAIFILLPKTIKDS  47
            GI+TWIGG+AIF+LLP++I +S
Sbjct  125  GIETWIGGQAIFLLLPRSITNS  146



>ref|XP_002970317.1| hypothetical protein SELMODRAFT_93539 [Selaginella moellendorffii]
 gb|EFJ28447.1| hypothetical protein SELMODRAFT_93539 [Selaginella moellendorffii]
Length=512

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = -2

Query  454  DNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVAT  275
             NPDPSL S +L P     R  S W+M  LW+GLVVGVP++YLAGSLVELGM+WWQG+ T
Sbjct  23   SNPDPSLASQDLAPVCKEGRLLSSWDMTFLWLGLVVGVPNYYLAGSLVELGMAWWQGIGT  82

Query  274  VVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWI  95
            V+ AN+IT   L+LA HPGT+YGI FPVL R++FG+ GA++P LLR  VACGWYGI+TWI
Sbjct  83   VLLANVITYCILVLAAHPGTKYGISFPVLLRASFGVFGANVPALLRGFVACGWYGIETWI  142

Query  94   GGEAIFILLPKTIKDSSFS  38
            GGEAIF ++   +  + FS
Sbjct  143  GGEAIFRIVDVMLGKNRFS  161



>ref|XP_001758782.1| predicted protein [Physcomitrella patens]
 gb|EDQ76288.1| predicted protein [Physcomitrella patens]
Length=540

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -2

Query  454  DNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVAT  275
             NPD SL +++  PT P  R ++ W+MA LWIGLV+GVP++Y+AGSLVELGMSWW+G+ T
Sbjct  58   SNPDSSLFNEDFAPTMPADRIFTVWDMACLWIGLVIGVPTYYMAGSLVELGMSWWEGIVT  117

Query  274  VVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWI  95
            V   N++  + ++L GH GT++G+PFPVLAR++FGI GA++P+LLR+LVACGW+GIQTWI
Sbjct  118  VFIGNMVVLVPMVLIGHAGTKFGVPFPVLARASFGIRGANVPSLLRALVACGWFGIQTWI  177

Query  94   GGEAIFILLPKTIKDS  47
            GG+A+F LL  ++  S
Sbjct  178  GGQAVFQLLNASLNGS  193



>ref|XP_010926634.1| PREDICTED: uracil permease-like [Elaeis guineensis]
Length=504

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            + +++  PD SL+  +L      +RT + W +A LW  +VV VPS+YLAGSLV+LGMSWW
Sbjct  6    EDVLEFEPDASLLDSDLSQVPATKRTLTRWGIALLWFSMVVNVPSYYLAGSLVDLGMSWW  65

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            QGVAT++ AN I    LIL  HPGTRYGI FP+L RSAFG+ GAH+P LLR+LVACGW G
Sbjct  66   QGVATIILANTILLAPLILTAHPGTRYGISFPILLRSAFGVRGAHVPALLRALVACGWCG  125

Query  109  IQTWIGGEAIFILLPKTIKDSSFS  38
            I+TWIGG+AIF+LLP++I++S ++
Sbjct  126  IETWIGGQAIFLLLPRSIQNSWYA  149



>ref|XP_002978480.1| hypothetical protein SELMODRAFT_52432, partial [Selaginella moellendorffii]
 gb|EFJ20466.1| hypothetical protein SELMODRAFT_52432, partial [Selaginella moellendorffii]
Length=474

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DPSL S +L P     R  S W+M  LW+GLVVGVP++YLAGSLVELGM+WWQG+ TV+ 
Sbjct  1    DPSLASQDLAPVCKEGRLLSSWDMTFLWLGLVVGVPNYYLAGSLVELGMAWWQGIGTVLL  60

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+IT   L+LA HPGT+YGI FPVL R++FG+ GA++P LLR  VACGWYGI+TWIGGE
Sbjct  61   ANVITYCILVLAAHPGTKYGISFPVLLRASFGVFGANVPALLRGFVACGWYGIETWIGGE  120

Query  85   AIFILLPKTIKDSSFS  38
            AIF ++   +  + FS
Sbjct  121  AIFRIVDVMLGKNRFS  136



>emb|CBI30184.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 105/145 (72%), Gaps = 24/145 (17%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
             P P+L +D+LKPT P QRT+SG                      LVELGM+WWQG+ATV
Sbjct  74   EPHPTLTNDDLKPTAPHQRTFSG----------------------LVELGMAWWQGIATV  111

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
            VAANII  + L+L GHPGTRYGI FPVLARSAFGI GAH+PTLLR+LV CGWYGI+TWIG
Sbjct  112  VAANIILLVPLVLTGHPGTRYGISFPVLARSAFGIRGAHLPTLLRALVGCGWYGIETWIG  171

Query  91   GEAIFILLPKTIKDSSFSPACFLAW  17
            GEAIF+LLPKTIK SS S   FL W
Sbjct  172  GEAIFLLLPKTIKQSSLSQ--FLPW  194



>ref|XP_010926587.1| PREDICTED: uncharacterized permease C29B12.14c-like [Elaeis guineensis]
Length=504

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            + +++  P+ SL+   L P    +RT + W++A LW  +VV VP +YLAGSLV+LGMSWW
Sbjct  6    EDVLEFKPEASLLDSNLSPVPATKRTLTRWDIALLWFSMVVNVPCYYLAGSLVDLGMSWW  65

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            QGVAT++  N I    LIL  HPGTRYGI FP+L RSAFG+ GAH+P LLR+LVAC W G
Sbjct  66   QGVATIILGNTILLAPLILTAHPGTRYGISFPILLRSAFGVRGAHVPALLRALVACAWCG  125

Query  109  IQTWIGGEAIFILLPKTIKDSSFS  38
            I+TWIGG+AIF+LLP++IK+S ++
Sbjct  126  IETWIGGQAIFLLLPRSIKNSWYA  149



>ref|XP_009383594.1| PREDICTED: uracil permease-like [Musa acuminata subsp. malaccensis]
Length=534

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -2

Query  424  ELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIITSL  245
            +  PTTP QRT + W+MASLWIGLVVGVPS+YLAGSLVE GMSWWQGVA VVAA +I   
Sbjct  38   DFHPTTPAQRTATAWDMASLWIGLVVGVPSYYLAGSLVEAGMSWWQGVAVVVAAKVILLG  97

Query  244  TLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLP  65
             L+ A  PGTRYG+PFPVLAR+ FG+ GAH+  LLR+LVACGW+GI+TWIGG+A+F+LLP
Sbjct  98   PLLAAAQPGTRYGVPFPVLARATFGVRGAHVVVLLRALVACGWFGIETWIGGQAVFLLLP  157

Query  64   KTIKDSSFS  38
              ++ S ++
Sbjct  158  AFLRLSPYA  166



>ref|NP_001136535.1| hypothetical protein [Zea mays]
 gb|ACF82113.1| unknown [Zea mays]
 gb|AFW72710.1| hypothetical protein ZEAMMB73_257016 [Zea mays]
Length=541

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 113/160 (71%), Gaps = 17/160 (11%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
            +P  +    +L PT P +RT + W++ASLW+GLVVGVPS+YLAGSLV+LGMS  QGVATV
Sbjct  59   SPRSTSSESDLSPTPPSERTMTAWDLASLWVGLVVGVPSYYLAGSLVDLGMSALQGVATV  118

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
              AN+I  +TL+L   P   +G+PFPVLAR+AFG+ GAH+P ++R+L+ CGW+GI++WIG
Sbjct  119  AFANLIVLVTLVLTAAPAVTHGLPFPVLARAAFGVRGAHVPAVIRALIGCGWFGIESWIG  178

Query  91   GEAIFILLPKTIKDSSFSP---------------ACFLAW  17
            G AIF+LLP  +K  S+ P               ACFLA+
Sbjct  179  GRAIFLLLPSRLK--SYQPLLAPVPGLGVAPLEFACFLAF  216



>ref|XP_004953391.1| PREDICTED: uracil permease-like [Setaria italica]
 gb|AHC53692.1| nucleobase cation symporter 1 [Setaria viridis]
Length=540

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 110/151 (73%), Gaps = 17/151 (11%)
 Frame = -2

Query  424  ELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIITSL  245
            +L PT P +RT + W++ASLW+GLVVGVPS+YLAGSLV+LGMS  QGVATV  AN+I  +
Sbjct  67   DLAPTPPSERTMTAWDLASLWVGLVVGVPSYYLAGSLVDLGMSALQGVATVAFANLIVLV  126

Query  244  TLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLP  65
            TL+L   P   +G+PFPVLAR+AFG+ GAH+P ++R+LV CGW+GI++WIGG AIF+LLP
Sbjct  127  TLVLTAAPAVTHGLPFPVLARAAFGVRGAHVPAVIRALVGCGWFGIESWIGGRAIFLLLP  186

Query  64   KTIKDSSFSP---------------ACFLAW  17
              +K  S+ P               ACFLA+
Sbjct  187  SRLK--SYQPLLAPVPGLGAAPLEFACFLAF  215



>ref|XP_003570071.1| PREDICTED: uracil permease [Brachypodium distachyon]
Length=540

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 118/174 (68%), Gaps = 18/174 (10%)
 Frame = -2

Query  490  PSGSLDDDP-LVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSL  314
            PS +L   P ++   P  S    +L PT P +RT + W++ASLWIGLVVGVPS+YLAGSL
Sbjct  44   PSLTLASRPRMLPARPRMSSSESDLSPTPPSERTMTAWDLASLWIGLVVGVPSYYLAGSL  103

Query  313  VELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRS  134
            V+LGMS  QGVATV  AN +  + L+L   P   +G+PFPVLAR+ FG+ GAH+P ++R+
Sbjct  104  VDLGMSALQGVATVALANAVVLVCLVLTAAPAVTHGLPFPVLARATFGVRGAHVPAVIRA  163

Query  133  LVACGWYGIQTWIGGEAIFILLPKTIKDSSFSP---------------ACFLAW  17
            LV CGW+GI++WIGG A+F+LLP ++K  S++P               ACFLA+
Sbjct  164  LVGCGWFGIESWIGGRAVFLLLPSSLK--SYAPLLKPVPGLGAAPLEFACFLAF  215



>ref|XP_002454506.1| hypothetical protein SORBIDRAFT_04g032390 [Sorghum bicolor]
 gb|EES07482.1| hypothetical protein SORBIDRAFT_04g032390 [Sorghum bicolor]
Length=638

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 110/153 (72%), Gaps = 17/153 (11%)
 Frame = -2

Query  430  SDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIIT  251
              +L PT P +RT + W++ASLW+GLVVGVPS+YLAGSLV+LGMS  QGVATV  AN+I 
Sbjct  163  ESDLSPTPPSERTMTAWDLASLWVGLVVGVPSYYLAGSLVDLGMSALQGVATVTFANLIV  222

Query  250  SLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFIL  71
             +TL+L   P   +G+PFPVLAR+AFG+ GAH+P ++R+LV CGW+GI++WIGG AIF+L
Sbjct  223  LVTLVLTAAPAATHGLPFPVLARAAFGVRGAHVPAVIRALVGCGWFGIESWIGGRAIFLL  282

Query  70   LPKTIKDSSFSP---------------ACFLAW  17
            LP  +K  S+ P               ACFLA+
Sbjct  283  LPSRLK--SYPPLLTPVPGLGAAPLEFACFLAF  313



>ref|XP_001694932.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02084.1| predicted protein [Chlamydomonas reinhardtii]
Length=528

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
            NPDPSLI+++  PTT  +RT+   + A+ WI LV+ + ++YLA SLV+LGMSWWQG+ TV
Sbjct  15   NPDPSLINEDFSPTTQDKRTFDTTDYATFWITLVISITTYYLAASLVDLGMSWWQGILTV  74

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
               N+IT L ++L  HPGT+YG+PFPVLAR++FGI GA++P+L R++VACGW+GIQTWIG
Sbjct  75   FFGNLITLLPMVLNAHPGTKYGVPFPVLARASFGIQGANLPSLSRAIVACGWFGIQTWIG  134

Query  91   GEAIFILL  68
            G +IF +L
Sbjct  135  GSSIFQML  142



>ref|XP_002499820.1| Nucleobase:Cation symporter-1 family [Micromonas sp. RCC299]
 gb|ACO61078.1| Nucleobase:Cation symporter-1 family [Micromonas sp. RCC299]
Length=601

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = -2

Query  487  SGSLDDDPLVQ---DNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGS  317
            + SL DDP+     + P   L++++L P  P QRT++ +++A+LWIGLVV VP++ LAGS
Sbjct  78   AASLLDDPIQARPPNEPSADLLNEDLAPVAPAQRTFTTYDIAALWIGLVVCVPAYTLAGS  137

Query  316  LVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLR  137
            +++LGMS  QG+A +  AN+I  L ++L GH G +YG+PFPVLARSAFGI GA++P ++R
Sbjct  138  VIDLGMSAAQGIACIAIANLIVLLPMVLNGHAGCKYGVPFPVLARSAFGIKGANVPAVMR  197

Query  136  SLVACGWYGIQTWIGGEAIFILLPKTIKDSS  44
            +LV CGW+GIQT +GG+AIF +    +K S+
Sbjct  198  ALVGCGWFGIQTHVGGQAIFAIACAALKLST  228



>ref|WP_006970062.1| nitrate reductase [Plesiocystis pacifica]
 gb|EDM80710.1| NCS1 nucleoside transporter family protein [Plesiocystis pacifica 
SIR-1]
Length=500

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  454  DNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVAT  275
            + PD  L++D+++PT    R +S   MASLW+G+VV VP++ LAG L++ GMSW Q V T
Sbjct  16   ERPDAELVNDDIRPTPAKDRHWSVLSMASLWVGMVVCVPTYMLAGGLIDQGMSWSQAVIT  75

Query  274  VVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWI  95
            V+  N++    ++L GHPGT+YG+PFPVLAR++FGI GAH+P+L+R+LVACGW+GIQTW+
Sbjct  76   VMLGNLVVLAPMVLNGHPGTKYGVPFPVLARASFGIHGAHVPSLMRALVACGWFGIQTWV  135

Query  94   GGEAIFILL  68
            GG AIF LL
Sbjct  136  GGAAIFQLL  144



>gb|KIG14653.1| Cytosine/purine/uracil/thiamine/allantoin permease family protein 
[Enhygromyxa salina]
Length=500

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -2

Query  463  LVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQG  284
            L   +PDP L++D+++P     R +S   MASLW+G+VV VP++ LAG L++ GM+W Q 
Sbjct  6    LALHDPDPGLVNDDIRPVPLADRHWSVMSMASLWVGMVVCVPTYMLAGGLIDQGMNWAQA  65

Query  283  VATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQ  104
            V TV+  N++    +IL GHPGT+YG+PFPVLAR++FGI+GAH+P+L+R+LVACGW+GIQ
Sbjct  66   VLTVMLGNVVVLGPMILNGHPGTKYGVPFPVLARASFGINGAHVPSLMRALVACGWFGIQ  125

Query  103  TWIGGEAIFILL  68
            TW+GG AIF LL
Sbjct  126  TWVGGSAIFQLL  137



>dbj|BAJ85216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=540

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 117/174 (67%), Gaps = 18/174 (10%)
 Frame = -2

Query  490  PSGSLDDDP-LVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSL  314
            PS +L   P ++   P  S    +L PT P +RT + W++ASLWIGLVVGVPS+YLAGSL
Sbjct  44   PSLALSARPRMLPARPRLSASESDLSPTPPSERTMTAWDLASLWIGLVVGVPSYYLAGSL  103

Query  313  VELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRS  134
            V+LGMS  QGVATV  AN++  + L+L   P   +G+PFPVLAR+ FG+ GAH+P ++R+
Sbjct  104  VDLGMSALQGVATVALANLVVLVCLVLTAAPAVTHGLPFPVLARATFGVRGAHVPAVIRA  163

Query  133  LVACGWYGIQTWIGGEAIFILLPKTIKDSSFSP---------------ACFLAW  17
            LV CGW+GI++WIGG A+F+LLP  +K  S+ P               ACFLA+
Sbjct  164  LVGCGWFGIESWIGGRAVFLLLPSALK--SYQPLLTPVPGLGAAPLEFACFLAF  215



>gb|KDO49313.1| hypothetical protein CISIN_1g009276mg [Citrus sinensis]
Length=538

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 112/172 (65%), Gaps = 39/172 (23%)
 Frame = -2

Query  493  IPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSL  314
            + S   +DD      P  +L +++LKP+T  +RT+S                       L
Sbjct  61   LSSTEFNDD----LEPHLTLRNEDLKPSTINERTFS----------------------CL  94

Query  313  VELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRS  134
            V+LGM+WWQG+ATVVAAN+I  + L+L GHPGT+YGIPFPVLARS+FGI GAHIPTLLR+
Sbjct  95   VDLGMAWWQGIATVVAANVILLVPLVLTGHPGTKYGIPFPVLARSSFGIKGAHIPTLLRA  154

Query  133  LVACGWYGIQTWIGGEAIFILLPKTIKDSSF----------SP---ACFLAW  17
            LV CGWYGI+TWIGGEA+F+LLPK IK SS           SP   ACF+A+
Sbjct  155  LVGCGWYGIETWIGGEAVFLLLPKFIKQSSILSQSLPWLGTSPLEFACFIAF  206



>ref|XP_001774040.1| predicted protein [Physcomitrella patens]
 gb|EDQ61092.1| predicted protein [Physcomitrella patens]
Length=614

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -2

Query  466  PLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQ  287
            P    +PD SL + +  PT P  R ++ W+MA LWIGLVVGVP++Y+AGSLVE+GMSW +
Sbjct  120  PRQPSDPDDSLFNADFAPTMPAGRIFTVWDMACLWIGLVVGVPTYYMAGSLVEMGMSWLE  179

Query  286  GVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGI  107
            GV TV   N++  + L+L+GH GT++G+PFPVLAR+AFGI GA++P+LLR+ VACGW+GI
Sbjct  180  GVLTVFVGNVVVLVPLVLSGHSGTKFGVPFPVLARAAFGIRGANVPSLLRAFVACGWFGI  239

Query  106  QTWIGGEAIFILL  68
            QTWIGG+AI+ LL
Sbjct  240  QTWIGGQAIYQLL  252



>gb|EAZ24114.1| hypothetical protein OsJ_07854 [Oryza sativa Japonica Group]
Length=486

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 118/174 (68%), Gaps = 18/174 (10%)
 Frame = -2

Query  490  PSGSLDDDP-LVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSL  314
            P  +L   P ++   P  S    +L PT P +RT + W++ASLW+GLVVGVPS+YLAGSL
Sbjct  42   PGLTLASRPRMLPARPRMSSSESDLSPTPPSERTMTAWDLASLWVGLVVGVPSYYLAGSL  101

Query  313  VELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRS  134
            V+LGMS  QGVATV  AN++  ++L+L   P   +G+PFPVLAR+AFG+ GAH+P ++R+
Sbjct  102  VDLGMSALQGVATVAFANLVVLVSLVLTAAPAVTHGLPFPVLARAAFGVRGAHLPAVIRA  161

Query  133  LVACGWYGIQTWIGGEAIFILLPKTIKDSSFSP---------------ACFLAW  17
            LV CGW+GI++WIGG A+F+LLP  +K  S+ P               ACFLA+
Sbjct  162  LVGCGWFGIESWIGGRAVFLLLPSRLK--SYQPLLAPVPGLGAAPLEFACFLAF  213



>ref|NP_001047676.1| Os02g0666700 [Oryza sativa Japonica Group]
 dbj|BAD28404.1| putative uracil transport protein [Oryza sativa Japonica Group]
 dbj|BAD27781.1| putative uracil transport protein [Oryza sativa Japonica Group]
 dbj|BAF09590.1| Os02g0666700 [Oryza sativa Japonica Group]
 gb|EAY86998.1| hypothetical protein OsI_08392 [Oryza sativa Indica Group]
Length=538

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 118/174 (68%), Gaps = 18/174 (10%)
 Frame = -2

Query  490  PSGSLDDDP-LVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSL  314
            P  +L   P ++   P  S    +L PT P +RT + W++ASLW+GLVVGVPS+YLAGSL
Sbjct  42   PGLTLASRPRMLPARPRMSSSESDLSPTPPSERTMTAWDLASLWVGLVVGVPSYYLAGSL  101

Query  313  VELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRS  134
            V+LGMS  QGVATV  AN++  ++L+L   P   +G+PFPVLAR+AFG+ GAH+P ++R+
Sbjct  102  VDLGMSALQGVATVAFANLVVLVSLVLTAAPAVTHGLPFPVLARAAFGVRGAHLPAVIRA  161

Query  133  LVACGWYGIQTWIGGEAIFILLPKTIKDSSFSP---------------ACFLAW  17
            LV CGW+GI++WIGG A+F+LLP  +K  S+ P               ACFLA+
Sbjct  162  LVGCGWFGIESWIGGRAVFLLLPSRLK--SYQPLLAPVPGLGAAPLEFACFLAF  213



>ref|XP_003571352.2| PREDICTED: uracil permease-like [Brachypodium distachyon]
Length=562

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -2

Query  427  DELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIITS  248
            D+L PT   +RT +  ++A+LW+GLVVGVP++YLAGSLV+LGMS  QGVATV  AN+I  
Sbjct  71   DDLAPTPASERTMTALDLATLWVGLVVGVPAYYLAGSLVDLGMSAAQGVATVALANLIVL  130

Query  247  LTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFILL  68
             TL+LA  P   +G+PFPVLAR+AFGI GAH+P   R+LV CGW+GI++WIGG AIF+LL
Sbjct  131  ATLVLAAAPAATHGLPFPVLARAAFGIRGAHVPAAARALVGCGWFGIESWIGGRAIFLLL  190

Query  67   PKT  59
            P +
Sbjct  191  PDS  193



>ref|XP_006647657.1| PREDICTED: uracil permease-like [Oryza brachyantha]
Length=538

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 113/160 (71%), Gaps = 17/160 (11%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
            +P  S    +L PT P +RT + W++ASLW+GLVVGVPS+YLAGSLV+LGMS  QGVATV
Sbjct  56   SPRMSSSESDLSPTPPSERTMTAWDLASLWVGLVVGVPSYYLAGSLVDLGMSALQGVATV  115

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
              AN++  ++L+L   P   +G+PFPVLAR++FG+ GAH+P ++R+LV CGW+GI++WIG
Sbjct  116  AFANLVVLVSLVLTAAPAVTHGLPFPVLARASFGVRGAHLPAIIRALVGCGWFGIESWIG  175

Query  91   GEAIFILLPKTIKDSSFSP---------------ACFLAW  17
            G A+F+LLP  +K  ++ P               ACFLA+
Sbjct  176  GRAVFLLLPSRLK--TYQPLLAPVPGLGAAPLEFACFLAF  213



>ref|XP_004955137.1| PREDICTED: uracil permease-like [Setaria italica]
Length=538

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  427  DELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIITS  248
             +L PT P +RT + WE+ASLW GLVVGVP++YLAGSLV+LGMS  QGVATV  AN++  
Sbjct  64   SDLSPTPPSERTMTAWELASLWAGLVVGVPAYYLAGSLVDLGMSALQGVATVTFANLVVV  123

Query  247  LTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFILL  68
            +TL+L   P   +G+PFPVLAR+AFG+ GAH+P ++R+LV CGW+GI++WIGG AIF+LL
Sbjct  124  VTLVLTAAPAVTHGLPFPVLARAAFGVHGAHVPAVIRALVGCGWFGIESWIGGRAIFLLL  183

Query  67   PKTIKD  50
            P  +K 
Sbjct  184  PSKLKS  189



>ref|XP_010926588.1| PREDICTED: uncharacterized permease C29B12.14c-like [Elaeis guineensis]
Length=510

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -2

Query  430  SDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIIT  251
            + +L P    QRT++ W+MA LW+GLV GVPS+Y+AGSLVE GM+WWQG++ VVAA  + 
Sbjct  15   NRDLLPVPRSQRTFTAWDMAGLWVGLVTGVPSYYIAGSLVEEGMAWWQGISIVVAAKAVL  74

Query  250  SLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIF  77
               L+LA  PGTRYGIPFP+LAR+AFG+ GAH+P LLR+LVACGW+GI++WIGG+A F
Sbjct  75   LFPLLLAAAPGTRYGIPFPILARAAFGVRGAHVPALLRALVACGWFGIESWIGGQAFF  132



>gb|KIE31602.1| nitrate reductase, partial [Streptomyces pluripotens]
Length=280

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            PDP+L +++L PT P  RT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V TV 
Sbjct  17   PDPTLWNEDLNPTPPAARTWTATNYAALWVSMVVSVPAYMLASGLMSEGMNWWQAVLTVF  76

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH GT+YGIPFPVL R++FG+ GA +P +LR++VACGW+GIQTW+G 
Sbjct  77   LGNLIVLVPMVLVGHAGTKYGIPFPVLVRASFGVRGAQLPAILRAIVACGWFGIQTWLGS  136

Query  88   EAIFILLPKTIKDS  47
            +AI+ +L   + D+
Sbjct  137  QAIYTIL-NVVTDN  149



>ref|WP_012791087.1| nitrate reductase [Chitinophaga pinensis]
 ref|YP_003123112.1| NCS1 nucleoside transporter family [Chitinophaga pinensis DSM 
2588]
 gb|ACU60911.1| NCS1 nucleoside transporter family [Chitinophaga pinensis DSM 
2588]
Length=507

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 101/150 (67%), Gaps = 0/150 (0%)
 Frame = -2

Query  475  DDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMS  296
            D + + Q+    +L S++L P     RT++ W  ASLWI + + +P++ LA SL+E GM+
Sbjct  3    DHEDISQNVSRSALYSEDLAPVPASARTWNTWNYASLWISMSLCIPTYMLASSLIEGGMN  62

Query  295  WWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGW  116
            WWQ + T+ A N +  + +IL GH G +YGIPFPV AR++FG  GA+IP +LR++VACGW
Sbjct  63   WWQAILTIFAGNTVVLIPMILNGHAGAKYGIPFPVFARASFGTKGANIPAMLRAIVACGW  122

Query  115  YGIQTWIGGEAIFILLPKTIKDSSFSPACF  26
            +GIQTWIGG A++ +L   I   +  PA F
Sbjct  123  FGIQTWIGGFALYQMLQLWIPALATMPAIF  152



>ref|WP_012762387.1| nitrate reductase [Ralstonia pickettii]
 ref|YP_002981937.1| NCS1 nucleoside transporter family [Ralstonia pickettii 12D]
 gb|ACS63265.1| NCS1 nucleoside transporter family [Ralstonia pickettii 12D]
Length=517

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 103/154 (67%), Gaps = 1/154 (1%)
 Frame = -2

Query  508  SHSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFY  329
            SH  +  + S          PDP+L +++L PT P  RT++    A+LW+ +VV VP++ 
Sbjct  22   SHFDMSQTTSAAFSADAAGAPDPTLWNEDLNPTPPAARTWTATNYAALWVSMVVSVPAYM  81

Query  328  LAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIP  149
            LA  L+  GM+WWQ V TV   N+I  + ++L GH GT+YGIPFPVL R++FG+ GA +P
Sbjct  82   LASGLMSEGMNWWQAVLTVFLGNLIVLVPMVLVGHAGTKYGIPFPVLVRASFGVRGAQLP  141

Query  148  TLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDS  47
             +LR++VACGW+GIQTW+G +AI+ +L   + D+
Sbjct  142  AILRAIVACGWFGIQTWLGSQAIYTIL-NVVTDN  174



>ref|WP_037028829.1| nitrate reductase [Ralstonia pickettii]
 gb|KFL21086.1| NCS1 nucleoside transporter family protein [Ralstonia pickettii]
Length=492

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            PDP+L +++L PT P  RT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V TV 
Sbjct  17   PDPTLWNEDLNPTPPAARTWTATNYAALWVSMVVSVPAYMLASGLMSEGMNWWQAVLTVF  76

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH GT+YGIPFPVL R++FG+ GA +P +LR++VACGW+GIQTW+G 
Sbjct  77   LGNLIVLVPMVLVGHAGTKYGIPFPVLVRASFGVRGAQLPAILRAIVACGWFGIQTWLGS  136

Query  88   EAIFILLPKTIKDS  47
            +AI+ +L   + D+
Sbjct  137  QAIYTIL-NVVTDN  149



>ref|WP_004631013.1| NCS1 nucleoside transporter-like protein [Ralstonia pickettii]
 gb|ENZ77514.1| NCS1 nucleoside transporter-like protein [Ralstonia pickettii 
OR214]
Length=492

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            PDP+L +++L PT P  RT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V TV 
Sbjct  17   PDPTLWNEDLNPTPPAARTWTATNYAALWVSMVVSVPAYMLASGLMSEGMNWWQAVLTVF  76

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH GT+YGIPFPVL R++FG+ GA +P +LR++VACGW+GIQTW+G 
Sbjct  77   LGNLIVLVPMVLVGHAGTKYGIPFPVLVRASFGVRGAQLPAILRAIVACGWFGIQTWLGS  136

Query  88   EAIFILLPKTIKDS  47
            +AI+ +L   + D+
Sbjct  137  QAIYTIL-NVVTDN  149



>ref|WP_009241132.1| MULTISPECIES: nitrate reductase [Ralstonia]
 ref|YP_001899951.1| NCS1 nucleoside transporter family [Ralstonia pickettii 12J]
 gb|ACD27519.1| NCS1 nucleoside transporter family [Ralstonia pickettii 12J]
 gb|EFP65066.1| NCS1 nucleoside transporter family protein [Ralstonia sp. 5_7_47FAA]
 gb|EGY63248.1| NCS1 nucleoside transporter [Ralstonia sp. 5_2_56FAA]
Length=492

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            PDP+L +++L PT P  RT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V TV 
Sbjct  17   PDPTLWNEDLNPTPPAARTWTATNYAALWVSMVVSVPAYMLASGLMSEGMNWWQAVLTVF  76

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH GT+YGIPFPVL R++FG+ GA +P +LR++VACGW+GIQTW+G 
Sbjct  77   LGNLIVLVPMVLVGHAGTKYGIPFPVLVRASFGVRGAQLPAILRAIVACGWFGIQTWLGS  136

Query  88   EAIFILLPKTIKDS  47
            +AI+ +L   + D+
Sbjct  137  QAIYTIL-NVVTDN  149



>ref|WP_024972435.1| nitrate reductase [Ralstonia pickettii]
Length=492

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            PDP+L +++L PT P  RT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V TV 
Sbjct  17   PDPTLWNEDLNPTPPAARTWTATNYAALWVSMVVSVPAYMLASGLMSEGMNWWQAVLTVF  76

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH GT+YGIPFPVL R++FG+ GA +P +LR++VACGW+GIQTW+G 
Sbjct  77   LGNLIVLVPMVLVGHAGTKYGIPFPVLVRASFGVRGAQLPAILRAIVACGWFGIQTWLGS  136

Query  88   EAIFILLPKTIKDS  47
            +AI+ +L   + D+
Sbjct  137  QAIYTIL-NVVTDN  149



>ref|WP_039374193.1| nitrate reductase [Mumia flava]
 gb|KHL06463.1| nitrate reductase [Mumia flava]
Length=492

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            PDP+L +++L PT P  RT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V TV 
Sbjct  17   PDPTLWNEDLNPTPPAARTWTATNYAALWVSMVVSVPAYMLASGLMSEGMNWWQAVLTVF  76

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH GT+YGIPFPVL R++FG+ GA +P +LR++VACGW+GIQTW+G 
Sbjct  77   LGNLIVLVPMVLVGHAGTKYGIPFPVLVRASFGVRGAQLPAILRAIVACGWFGIQTWLGS  136

Query  88   EAIFILLPKTIKDS  47
            +AI+ +L   + D+
Sbjct  137  QAIYTIL-NVVTDN  149



>ref|WP_033301195.1| nitrate reductase, partial [Nocardiopsis gilva]
Length=505

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 102/161 (63%), Gaps = 7/161 (4%)
 Frame = -2

Query  520  SVAESHSQIIPSGSLD---DDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLV  350
            + A+      P G +    D PL    PD   ++D+L+P    QR +S ++ ++LW+G+ 
Sbjct  4    AAAQPRQVTHPDGRVSLSPDAPL----PDTGYVNDDLRPLRMEQRNWSTYDFSALWVGMA  59

Query  349  VGVPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFG  170
            V +PS+ LAG LV LGM W Q V T+   NII  L ++L GH G +YGIPFPV AR+AFG
Sbjct  60   VNIPSWSLAGGLVALGMDWKQAVLTIALGNIIVLLPMVLTGHAGAKYGIPFPVFARAAFG  119

Query  169  ISGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDS  47
            + GA++P LLR   ACGW+GIQTWIGG+ IF L  + +  S
Sbjct  120  VRGANLPALLRGATACGWFGIQTWIGGQGIFFLTGRLLGPS  160



>ref|WP_027680949.1| nitrate reductase [Ralstonia sp. UNC404CL21Col]
Length=492

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            PDP+L +++L PT P  RT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V TV 
Sbjct  17   PDPTLWNEDLNPTPPAARTWTATNYAALWVSMVVSVPAYMLASGLMSEGMNWWQAVLTVF  76

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH GT+YGIPFPVL R++FG+ GA +P +LR++VACGW+GIQTW+G 
Sbjct  77   LGNLIVLVPMVLVGHAGTKYGIPFPVLVRASFGVRGAQLPAILRAIVACGWFGIQTWLGS  136

Query  88   EAIFILLPKTIKDS  47
            +AI+ +L   + D+
Sbjct  137  QAIYTIL-NVVTDN  149



>ref|XP_009413587.1| PREDICTED: uracil permease-like [Musa acuminata subsp. malaccensis]
Length=520

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 98/142 (69%), Gaps = 3/142 (2%)
 Frame = -2

Query  454  DN--PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGV  281
            DN   DP   +D L P    +R  S W++A LW+ +VV VPS++ A SL+ELGMS WQG+
Sbjct  14   DNTFDDPGAAADGLGPVPADKRNLSWWDVAGLWVVMVVNVPSYFAAASLMELGMSCWQGI  73

Query  280  ATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQT  101
            AT+   N+I    + L  H G RYGI FPV  R+AFGI GA IP LLR++VACGW G ++
Sbjct  74   ATIFLGNLIIYAPICLTAHAGVRYGISFPVQLRAAFGIRGARIPALLRAVVACGWCGTES  133

Query  100  WIGGEAIF-ILLPKTIKDSSFS  38
            WIGG+AIF +LLP+ I+ SS+S
Sbjct  134  WIGGQAIFLLLLPRPIQSSSYS  155



>emb|CEA06602.1| cytosine/purines uracil thiamine allantoin permease [Pseudomonas 
sp. 12M76_air]
 emb|CEF27997.1| cytosine/purines uracil thiamine allantoin permease [Pseudomonas 
sp. 12M76_air]
Length=497

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = -2

Query  481  SLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELG  302
            SL  D  V   P   L +++L P     RT+S   ++ LW+G+VV VP++ +A  LV  G
Sbjct  7    SLLYDAAVSTTPSADLWNEDLAPAKAEDRTWSWQSISGLWVGMVVCVPTYMMAAGLVAEG  66

Query  301  MSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVAC  122
            MSWWQ V TV+A NII  + +I  GH GT++GIPFPVL RS+FG +GA +P +LR LVAC
Sbjct  67   MSWWQAVLTVLAGNIIVLIPMIAIGHAGTKHGIPFPVLLRSSFGTAGAKLPAMLRGLVAC  126

Query  121  GWYGIQTWIGGEAIFILLPKTIKDSSFS  38
            GW+GIQTW+GG AI+I++   + D++ S
Sbjct  127  GWFGIQTWVGGSAIYIII-NIMTDNAIS  153



>ref|WP_026345479.1| nitrate reductase [Novispirillum itersonii]
Length=481

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 94/135 (70%), Gaps = 0/135 (0%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
            N DP L +++L P +P  RT+    +A+LW+G+VV VP++ LA  LV  GM+WWQ V TV
Sbjct  3    NADPDLWNEDLAPASPAARTWDWKAIAALWVGMVVCVPTYMLAAGLVSEGMNWWQAVLTV  62

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
            +  N I  L ++L GH G ++GIPFPVL RS+FG SGA IP L R LVACGW+GI TW+G
Sbjct  63   LLGNAIVLLPMMLIGHAGAKHGIPFPVLLRSSFGTSGAKIPALARGLVACGWFGINTWVG  122

Query  91   GEAIFILLPKTIKDS  47
            G AI+++L     D+
Sbjct  123  GSAIYVILNALTGDA  137



>ref|WP_030058208.1| MULTISPECIES: nitrate reductase [Streptomyces]
Length=513

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            P G ++ DP   + P     S++L+P    +RT++ +   +LW+G+   +PS+ LA  LV
Sbjct  9    PDGRVELDPAAGELPPNGFTSEDLRPVPVARRTWTTYNFLALWVGMAHNIPSWTLASGLV  68

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
             LGM W Q V T+  AN++    ++L GH GT+YGIPFPV AR+AFG+ GA++P L+R+ 
Sbjct  69   ALGMDWKQAVLTIALANVVVLAPMLLTGHAGTKYGIPFPVFARAAFGLRGANLPALIRAA  128

Query  130  VACGWYGIQTWIGGEAIFILLPKTIKDS  47
            VAC W+GIQTWIGGE IF+L  K    S
Sbjct  129  VACAWFGIQTWIGGEGIFLLAGKLFGQS  156



>ref|WP_037899368.1| hypothetical protein, partial [Streptomyces sp. NRRL S-350]
Length=511

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 99/153 (65%), Gaps = 0/153 (0%)
 Frame = -2

Query  505  HSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYL  326
              +  P G ++ D    D P     SD+L+P    +RT++ +   +LW+G+   +PS+ L
Sbjct  10   RQRQYPDGRVELDSSAGDLPPNGFTSDDLRPVPVARRTWTTYNFLALWVGMAHNIPSWTL  69

Query  325  AGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPT  146
            A  LV +GM W Q V T+  AN+I  + ++L GH GT+YGIPFPV AR++FG+ GA++P 
Sbjct  70   ASGLVAIGMDWKQAVLTIALANLIVLVPMLLTGHAGTKYGIPFPVFARASFGLRGANLPA  129

Query  145  LLRSLVACGWYGIQTWIGGEAIFILLPKTIKDS  47
            LLR+ VAC W+GIQTWIGGE IF+L  K +  S
Sbjct  130  LLRAAVACAWFGIQTWIGGEGIFLLAGKLLGQS  162



>ref|WP_039597787.1| nitrate reductase [Ralstonia sp. A12]
 gb|KHK56287.1| nitrate reductase [Ralstonia sp. A12]
Length=492

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 98/136 (72%), Gaps = 1/136 (1%)
 Frame = -2

Query  454  DNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVAT  275
            + PDP+L +++L PT    RT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V T
Sbjct  15   EAPDPTLWNEDLNPTPQAARTWTATNYAALWVSMVVSVPAYMLASGLMSEGMNWWQAVLT  74

Query  274  VVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWI  95
            V   N+I  + ++L GH GT+YGIPFPVL R++FG+ GA +P +LR++VACGW+GIQTW+
Sbjct  75   VFLGNLIVLVPMVLVGHAGTKYGIPFPVLVRASFGVRGAQLPAILRAIVACGWFGIQTWL  134

Query  94   GGEAIFILLPKTIKDS  47
            G +AI+ +L   + D+
Sbjct  135  GSQAIYTIL-NVVTDN  149



>ref|WP_009541210.1| Cytosine/purine/uracil/thiamine/allantoin permease family protein 
[Caenispirillum salinarum]
 gb|EKV29245.1| Cytosine/purine/uracil/thiamine/allantoin permease family protein 
[Caenispirillum salinarum AK4]
Length=513

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP L +++L P+TP  RT+    +A+LW+G+VV VP++ L+  LV  GM+WWQ V TV+A
Sbjct  24   DPGLYNEDLAPSTPEARTWQWSSIAALWVGMVVCVPTYMLSAGLVSEGMAWWQAVLTVLA  83

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
             N+I  + ++L GH G ++GIPFPVL RS+FG  GA +P L+R LVACGW+GI TW+GG 
Sbjct  84   GNVIVLIPMMLIGHAGAKHGIPFPVLLRSSFGTRGAKLPALMRGLVACGWFGINTWVGGM  143

Query  85   AIFILLPKTIKD  50
            AI+++L     D
Sbjct  144  AIYVILNTLTGD  155



>ref|WP_021195082.1| nitrate reductase [Ralstonia sp. AU12-08]
 gb|EPX97503.1| nitrate reductase [Ralstonia sp. AU12-08]
Length=494

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            PDP+L +++L PT    RT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V TV 
Sbjct  19   PDPTLWNEDLNPTPQAARTWTATNYAALWVSMVVSVPAYMLASGLMSEGMNWWQAVLTVF  78

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH GT+YGIPFPVL R++FG+ GA +P +LR++VACGW+GIQTW+G 
Sbjct  79   LGNLIVLVPMVLVGHAGTKYGIPFPVLVRASFGVRGAQLPAILRAIVACGWFGIQTWLGS  138

Query  88   EAIFILLPKTIKDS  47
            +AI+ +L   + D+
Sbjct  139  QAIYTIL-NVVTDN  151



>ref|WP_024975201.1| nitrate reductase [Ralstonia pickettii]
Length=492

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            PDP+L +++L PT    RT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V TV 
Sbjct  17   PDPTLWNEDLNPTPQAARTWTATNYAALWVSMVVSVPAYMLASGLMSEGMNWWQAVLTVF  76

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH GT+YGIPFPVL R++FG+ GA +P +LR++VACGW+GIQTW+G 
Sbjct  77   LGNLIVLVPMVLVGHAGTKYGIPFPVLVRASFGVRGAQLPAILRAIVACGWFGIQTWLGS  136

Query  88   EAIFILLPKTIKDS  47
            +AI+ +L   + D+
Sbjct  137  QAIYTIL-NVVTDN  149



>ref|WP_007820219.1| MULTISPECIES: nitrate reductase [Streptomyces]
 gb|EGJ73701.1| putative cytosine/purines/uracil/thiamine/ allantoin permease 
family protein [Streptomyces sp. Tu6071]
Length=525

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = -2

Query  511  ESHSQIIPSGSLDDDPLVQDNP-----DPSLISDELKPTTPGQRTYSGWEMASLWIGLVV  347
             SH+   P   L  D  V+ +P     D    +++L+P    QR +  +   +LWIG+  
Sbjct  18   HSHAATAPGQHLTPDGRVELDPGAFPADSPHANEDLRPIPVAQRHWGTYNFTALWIGMAH  77

Query  346  GVPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGI  167
             +PS+ LA  LV LGM W Q V T+  ANI+  L ++L GH G +YGIPFPVLAR++FG+
Sbjct  78   NIPSWTLASGLVALGMDWKQAVLTIALANIVVLLPMLLTGHAGPKYGIPFPVLARASFGL  137

Query  166  SGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDS  47
             GA++P LLR+ VACGW+GIQTWIGG+ +F+LL K +  S
Sbjct  138  RGANLPALLRAAVACGWFGIQTWIGGQGVFVLLDKLLPGS  177



>ref|WP_009664992.1| nitrate reductase [Oxalobacteraceae bacterium IMCC9480]
 gb|EGF33291.1| cytosine/purines transporter [Oxalobacteraceae bacterium IMCC9480]
Length=490

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -2

Query  457  QDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVA  278
              N    L + +L+PTTP QRT++    A+LW+ + V VP++ LA  L+  GM+WWQ V 
Sbjct  3    NRNTSNPLWNADLEPTTPAQRTWTATHYAALWVSMAVSVPAYMLASGLMSEGMNWWQAVL  62

Query  277  TVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTW  98
            TV   N+I  + ++L GH G ++GIP+PVLARSAFG+ GA +P +LR++VACGW+GIQTW
Sbjct  63   TVFLGNLIVLVPMVLVGHAGAKHGIPYPVLARSAFGVRGAQLPAILRAIVACGWFGIQTW  122

Query  97   IGGEAIFILL  68
            +GG+AI+ +L
Sbjct  123  LGGQAIYTIL  132



>gb|EYF01165.1| Cytosine/purine/uracil/thiamine/allantoin permease family protein 
[Chondromyces apiculatus DSM 436]
Length=489

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +++L PT   +RT++ W  A+LW+G+ V +P++ +A  L++ GMSW + +A V   N
Sbjct  2    SLSNEDLAPTPAEKRTWTMWHYAALWVGMSVCIPTYTMASGLIDQGMSWKEAIACVALGN  61

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I    +IL  HPGTRYG+PFPVLAR++FG+ GA+IP LLR+LVACGW+GIQTWIGG+A+
Sbjct  62   VIVLAPMILNAHPGTRYGVPFPVLARASFGVLGANIPALLRALVACGWFGIQTWIGGQAL  121

Query  79   FILLPKTI  56
            + L    +
Sbjct  122  YQLFAAAV  129



>ref|WP_005622429.1| MULTISPECIES: nitrate reductase [Ruegeria]
 gb|EEW59375.1| NCS1 nucleoside transporter family protein [Silicibacter sp. 
TrichCH4B]
 gb|ENZ91266.1| NCS1 nucleoside transporter [Ruegeria mobilis F1926]
Length=496

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = -2

Query  481  SLDDDPLVQD--NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVE  308
            S D +P   D    DP L +++  PTT  +RT++   +++LW+G+VV +P++ LA  L+ 
Sbjct  11   SRDSEPGQLDLAGLDPELYNEDQLPTTAAERTWNWLSISALWVGMVVCIPTYLLASYLIG  70

Query  307  LGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLV  128
             GMSW Q V T++AAN I  + ++L GH GT+YGIPFPVL RS+FG +GA IP + R +V
Sbjct  71   AGMSWDQAVMTILAANAIVLIPMVLVGHAGTKYGIPFPVLLRSSFGPAGAKIPAVARGIV  130

Query  127  ACGWYGIQTWIGGEAIFILLPK  62
            ACGW+GIQTW+GG AIF+++ K
Sbjct  131  ACGWFGIQTWVGGSAIFVIVNK  152



>ref|WP_007416470.1| nitrate reductase [Pedosphaera parvula]
 gb|EEF59471.1| NCS1 nucleoside transporter family [bacterium Ellin514]
Length=512

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = -2

Query  436  LISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANI  257
            L S +L P  P +R +  W  A+LWI +   +P++ LA SL++ GM+WWQ + T+  AN+
Sbjct  22   LYSPDLAPVPPERRKWGMWNFAALWISMAACIPTYMLASSLIDGGMNWWQAILTIFLANL  81

Query  256  ITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIF  77
            I  + +IL  H GTRYGIPFPV  R++FG  GA++P LLR+LVACGW+GIQ WIGG AIF
Sbjct  82   IVLIPMILNAHAGTRYGIPFPVFCRASFGTHGANVPALLRALVACGWFGIQAWIGGNAIF  141

Query  76   ILLPKTIKDSSFSPA  32
             +L   +   + +PA
Sbjct  142  KILAVFVPSLAATPA  156



>ref|WP_037828596.1| nitrate reductase, partial [Streptomyces sp. NRRL B-5680]
Length=505

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            P G ++ DP     P     SD+L+P    +RT++ +   +LW+G+   +PS+ LA  LV
Sbjct  1    PDGRVELDPAEGALPSNGFTSDDLRPVPVRRRTWTTYNFLALWVGMAHNIPSWTLASGLV  60

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
             +GM W Q V T+  AN+I    ++L GH GT+YGIPFPV AR++FG+ GA++P L+R+ 
Sbjct  61   AIGMDWKQAVLTIALANLIVLAPMLLTGHAGTKYGIPFPVFARASFGLRGANLPALIRAA  120

Query  130  VACGWYGIQTWIGGEAIFILLPKTIKDS  47
            VAC W+GIQTWIGGE IF+L  K   +S
Sbjct  121  VACAWFGIQTWIGGEGIFLLAGKLFGES  148



>gb|KDV22935.1| nitrate reductase [Burkholderia cepacia JBK9]
Length=502

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP     P  SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAPGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVTTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_024089188.1| nitrate reductase [Leisingera methylohalidivorans]
 ref|YP_008970585.1| nitrate reductase [Leisingera methylohalidivorans DSM 14336]
 gb|AHD00067.1| nitrate reductase [Leisingera methylohalidivorans DSM 14336]
Length=496

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 101/150 (67%), Gaps = 0/150 (0%)
 Frame = -2

Query  517  VAESHSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVP  338
            +A+  S     G+     +     DP L +++  PTT  QRT+    +A+LW+G+VV +P
Sbjct  1    MADITSGYTAQGATASQQVDLSGIDPELYNEDQLPTTAEQRTWDWLAIAALWVGMVVCIP  60

Query  337  SFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGA  158
            ++ LA  L+  GMSW Q V T++AAN I  + ++L GH GT+YGIPFPVL RS+FG +GA
Sbjct  61   TYLLASYLIGSGMSWDQAVMTILAANAIVLIPMVLVGHAGTKYGIPFPVLLRSSFGPTGA  120

Query  157  HIPTLLRSLVACGWYGIQTWIGGEAIFILL  68
             IP + R +VACGW+GIQTW+GG AIF++L
Sbjct  121  KIPAVARGIVACGWFGIQTWVGGSAIFVIL  150



>ref|WP_027865934.1| nitrate reductase [Massilia alkalitolerans]
Length=504

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
             L + +L PTT  QRT+  +  A+LW+G+V+ +P++ LA SL+E GMS WQ V TV  AN
Sbjct  14   ELWNHDLAPTTAAQRTWRWYHFAALWVGMVISIPAYMLAASLIESGMSAWQAVLTVFLAN  73

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  L ++L GH GT+YGIP+ VLAR++FG  GA +P L+R++VACGWYGIQTW GG  I
Sbjct  74   VIVLLPMLLIGHAGTKYGIPYAVLARASFGTRGARLPALMRAIVACGWYGIQTWFGGSMI  133

Query  79   FILL  68
            + LL
Sbjct  134  YTLL  137



>ref|WP_039191935.1| nitrate reductase [Leisingera sp. ANG-M6]
 gb|KIC28142.1| nitrate reductase [Leisingera sp. ANG-M6]
Length=496

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP L +++  PTT  +RT+    +A+LW+G+VV +P++ LA  L+  GMSW Q V T++A
Sbjct  25   DPELYNEDQLPTTAAERTWDWLSIAALWVGMVVCIPTYLLASYLIGSGMSWDQAVLTILA  84

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  + ++L GH GT+YGIPFPVL RS+FG SGA IP + R +VACGW+GIQTW+GG 
Sbjct  85   ANAIVLIPMVLVGHAGTKYGIPFPVLLRSSFGPSGAKIPAVARGIVACGWFGIQTWVGGS  144

Query  85   AIFILL  68
            AIF++L
Sbjct  145  AIFVIL  150



>ref|WP_030597529.1| nitrate reductase, partial [Streptomyces avellaneus]
Length=507

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            P G ++ DP     P     SD+L+P    +RT++ +   +LW+G+   +PS+ LA  LV
Sbjct  15   PDGRVELDPAEGALPSNGFTSDDLRPVPVRRRTWTTYNFLALWVGMAHNIPSWTLASGLV  74

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
             +GM W Q V T+  AN+I    ++L GH GT+YGIPFPV AR++FG+ GA++P L+R+ 
Sbjct  75   AIGMDWKQAVLTIALANLIVLAPMLLTGHAGTKYGIPFPVFARASFGLRGANLPALIRAS  134

Query  130  VACGWYGIQTWIGGEAIFILLPKTIKDS  47
            VAC W+GIQTWIGGE IF+L  K   +S
Sbjct  135  VACAWFGIQTWIGGEGIFLLAGKLFGES  162



>ref|WP_036248407.1| nitrate reductase [Massilia sp. BSC265]
 gb|KFI07225.1| nitrate reductase [Massilia sp. BSC265]
Length=504

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
             P L + +L PTT  QRT+  +  A+LW+G+V+ +P++ LA SL+E GMS WQ V TV  
Sbjct  12   SPELWNHDLAPTTAAQRTWRWYHFAALWVGMVISIPAYMLASSLIEAGMSAWQAVLTVFL  71

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I  + ++L GH GT+YGIP+ VLAR++FG  GA +P L+R++VACGWYGIQTW GG 
Sbjct  72   ANVIVLVPMLLIGHAGTKYGIPYAVLARASFGTRGARLPALMRAIVACGWYGIQTWFGGS  131

Query  85   AIF  77
             I+
Sbjct  132  MIY  134



>ref|WP_036212012.1| nitrate reductase [Massilia sp. LC238]
 gb|KFC69848.1| NCS1 nucleoside transporter [Massilia sp. LC238]
Length=504

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
             L + +L PTT  QRT+  +  A+LW+G+V+ +P++ LA SL+E GMS WQ V TV  AN
Sbjct  14   ELWNHDLAPTTAAQRTWRWYHFAALWVGMVISIPAYMLAASLIESGMSAWQAVLTVFLAN  73

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  L ++L GH GT+YGIP+ VLAR++FG  GA +P L+R++VACGWYGIQTW GG  I
Sbjct  74   VIVLLPMLLIGHAGTKYGIPYAVLARASFGTRGARLPALMRAIVACGWYGIQTWFGGSMI  133

Query  79   FILL  68
            + LL
Sbjct  134  YTLL  137



>ref|WP_030551685.1| nitrate reductase, partial [Streptomyces aureofaciens]
Length=505

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            P G ++ DP     P     SD+L+P    +RT++ +   +LW+G+   +PS+ LA  LV
Sbjct  1    PDGRVELDPAEGALPSNGFTSDDLRPVPVRRRTWTTYNFLALWVGMAHNIPSWTLASGLV  60

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
             +GM W Q V T+  AN+I    ++L GH GT+YGIPFPV AR++FG+ GA++P L+R+ 
Sbjct  61   AIGMDWKQAVLTIALANLIVLAPMLLTGHAGTKYGIPFPVFARASFGLRGANLPALIRAS  120

Query  130  VACGWYGIQTWIGGEAIFILLPKTIKDS  47
            VAC W+GIQTWIGGE IF+L  K   +S
Sbjct  121  VACAWFGIQTWIGGEGIFLLAGKLFGES  148



>ref|WP_039174195.1| nitrate reductase [Leisingera sp. ANG-S5]
 gb|KIC31226.1| nitrate reductase [Leisingera sp. ANG-S5]
Length=496

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP L +++  PTT  +RT+    +A+LW+G+VV +P++ LA  L+  GMSW Q V T++A
Sbjct  25   DPELYNEDQLPTTAAERTWDWLAIAALWVGMVVCIPTYLLASYLIGSGMSWDQAVLTILA  84

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  + ++L GH GT+YGIPFPVL RS+FG SGA IP + R +VACGW+GIQTW+GG 
Sbjct  85   ANAIVLIPMVLVGHAGTKYGIPFPVLLRSSFGPSGAKIPAVARGIVACGWFGIQTWVGGS  144

Query  85   AIFILL  68
            AIF++L
Sbjct  145  AIFVIL  150



>ref|WP_039151889.1| nitrate reductase [Leisingera sp. ANG-DT]
 gb|KIC14515.1| nitrate reductase [Leisingera sp. ANG-DT]
Length=496

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP L +++  PTT  +RT+    +A+LW+G+VV +P++ LA  L+  GMSW Q V T++A
Sbjct  25   DPELYNEDQLPTTAAERTWDWLAIAALWVGMVVCIPTYLLASYLIGSGMSWDQAVLTILA  84

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  + ++L GH GT+YGIPFPVL RS+FG SGA IP + R +VACGW+GIQTW+GG 
Sbjct  85   ANAIVLIPMVLVGHAGTKYGIPFPVLLRSSFGPSGAKIPAVARGIVACGWFGIQTWVGGS  144

Query  85   AIFILL  68
            AIF++L
Sbjct  145  AIFVIL  150



>ref|WP_033349372.1| nitrate reductase, partial [Streptomyces aureofaciens]
Length=505

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            P G ++ DP     P     SD+L+P    +RT++ +   +LW+G+   +PS+ LA  LV
Sbjct  1    PDGRVELDPAEGVLPSNGFTSDDLRPVPVRRRTWTTYNFLALWVGMAHNIPSWTLASGLV  60

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
             +GM W Q V T+  AN+I    ++L GH GT+YGIPFPV AR++FG+ GA++P L+R+ 
Sbjct  61   AIGMDWKQAVLTIALANLIVLAPMLLTGHAGTKYGIPFPVFARASFGLRGANLPALIRAA  120

Query  130  VACGWYGIQTWIGGEAIFILLPKTIKDS  47
            VAC W+GIQTWIGGE IF+L  K   +S
Sbjct  121  VACAWFGIQTWIGGEGIFLLAGKLFGES  148



>ref|WP_035352426.1| nitrate reductase [Edaphobacter aggregans]
Length=474

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 103/154 (67%), Gaps = 5/154 (3%)
 Frame = -2

Query  463  LVQDNP-DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQ  287
            +V+D P DP L +++L PT P +RT+S +   +LW  + + V ++ LA SL+  GM+W Q
Sbjct  4    IVRDVPRDPRLYNEDLAPTPPERRTWSTYNYIALWFSMSMEVTTYMLASSLIAGGMNWKQ  63

Query  286  GVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGI  107
             V T++  N+I  L +IL  H G +YGIPFPV  R++FG  GA+IP +LR+LVACGW+GI
Sbjct  64   AVGTILLGNLIVLLPMILNAHAGAKYGIPFPVFVRASFGTRGANIPAILRALVACGWFGI  123

Query  106  QTWIGGEAIFILL----PKTIKDSSFSPACFLAW  17
            Q+W+GG+AIF +L    P+T        ACFL +
Sbjct  124  QSWLGGQAIFAMLNVLWPQTANQPGVLWACFLGF  157



>ref|WP_038123221.1| nitrate reductase, partial [Tolypothrix bouteillei]
Length=487

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = -2

Query  436  LISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANI  257
            L S++L P    +RT++ W  A+LWI + + +P++ LA SL+E GMSWWQ + T+   N 
Sbjct  17   LYSEDLAPIPAAKRTWTTWNYAALWISMSLCIPTYMLASSLIEGGMSWWQAILTIFCGNT  76

Query  256  ITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIF  77
            I  + ++L GH G +YGIPFPVLAR++FG SGA+IP LLR++VACGW+GIQTWIGG A++
Sbjct  77   IVLIPMVLNGHAGAKYGIPFPVLARASFGTSGANIPALLRAIVACGWFGIQTWIGGFALY  136



>ref|WP_033962221.1| nitrate reductase, partial [Psychroserpens sp. PAMC 27130]
Length=209

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  475  DDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMS  296
            D   L +D    SL SD+L P    QRT+S W +A++W+G+ V +P++ LA  +++ G++
Sbjct  4    DIVELQEDVSASSLYSDDLAPVPSSQRTWSKWHLAAIWVGMAVCIPTYLLASYMIKSGLN  63

Query  295  WWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGW  116
            W++ +  +  AN+I ++ ++L GH G +YG+PFPV+ RS+FGI G  IP+++R LVACGW
Sbjct  64   WYEALIIIGVANLIITIPMVLNGHAGVKYGVPFPVIGRSSFGIKGVQIPSVIRGLVACGW  123

Query  115  YGIQTWIGGEAIF  77
            +G+ TW+GG AI+
Sbjct  124  FGVNTWLGGMAIY  136



>ref|WP_027234184.1| nitrate reductase [Leisingera caerulea]
Length=496

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP L +++  PTT  QRT+    +A+LW+G+VV +P++ LA  L+  GMSW Q V T++A
Sbjct  25   DPELYNEDQLPTTAEQRTWDWLAIAALWVGMVVCIPTYLLASYLIGSGMSWDQAVLTILA  84

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  + ++L GH GT+YGIPFPVL RS+FG +GA IP + R +VACGW+GIQTW+GG 
Sbjct  85   ANAIVLIPMVLVGHAGTKYGIPFPVLLRSSFGPTGAKIPAVARGIVACGWFGIQTWVGGS  144

Query  85   AIFILL  68
            AIF++L
Sbjct  145  AIFVIL  150



>ref|WP_014747975.1| nitrate reductase [Tistrella mobilis]
 ref|YP_006373968.1| cytosine/purines uracil thiamine allantoin permease [Tistrella 
mobilis KA081020-065]
 gb|AFK56986.1| cytosine/purines, uracil, thiamine, allantoin transporter [Tistrella 
mobilis KA081020-065]
Length=509

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP+L +++L PTT  QR++    +A+LW+G+VV VP++ +A  LV  GMSWWQ VATV+ 
Sbjct  33   DPALWNEDLAPTTADQRSWDWPSIAALWVGMVVCVPTYMIAAGLVSEGMSWWQAVATVLV  92

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
             N+I    ++  GH G ++GIPFPVL R++FG  GA +P L+R LVACGW+GI TW+GG+
Sbjct  93   GNLIVLAPMMAVGHAGAKHGIPFPVLLRASFGTRGARLPALMRGLVACGWFGINTWVGGQ  152

Query  85   AIFILL  68
            AI+++L
Sbjct  153  AIYVIL  158



>ref|WP_011349351.1| nitrate reductase [Burkholderia lata]
 ref|YP_366351.1| cytosine/purines, uracil, thiamine, allantoin transporter [Burkholderia 
lata]
 gb|ABB05707.1| cytosine/purines, uracil, thiamine, allantoin transporter [Burkholderia 
lata]
Length=502

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAQGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH GT++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVTTVLLGNLIVLVPMLLIGHAGTKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_030667610.1| nitrate reductase [Streptomyces sp. NRRL B-1347]
Length=517

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 110/171 (64%), Gaps = 3/171 (2%)
 Frame = -2

Query  523  PSVAESHSQIIPS-GSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVV  347
            P  AES SQ   + G ++  P    + D    +D+L+P    +R +S +  A+LW+G+  
Sbjct  9    PPPAESPSQTTAADGRVELSPGAYPH-DSRFANDDLRPVPLAERHWSTYNFAALWVGMAH  67

Query  346  GVPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGI  167
             +PS+ LA  LV  GM W Q V T+  AN+I  L ++L GH G +YGIPFPVLAR++FG+
Sbjct  68   NIPSWTLASGLVAFGMDWKQAVFTIALANVIVLLPMLLTGHAGPKYGIPFPVLARASFGL  127

Query  166  SGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDSSFSPACFLAWH  14
             GA++P L+R+ VACGW+GIQTWIGG+ +F+LL + + D  +S A  +  H
Sbjct  128  RGANLPALVRAAVACGWFGIQTWIGGQGVFVLLDR-VFDGGWSDASHIGGH  177



>ref|WP_019921514.1| nitrate reductase [Duganella zoogloeoides]
Length=495

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
             P L +++L PTT  QRT+  +  A+LW+G+V+ +P++ L+ SL+E GMS WQ V TV  
Sbjct  9    SPQLWNEDLAPTTAAQRTWRWYHFAALWVGMVMCIPAYTLSASLIEGGMSGWQAVLTVFL  68

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  L ++L GH GT++GIP+ VLAR++FG +GA +P L+R++VACGWYGIQTW GG+
Sbjct  69   ANAIVLLPMLLIGHAGTKFGIPYAVLARASFGTAGAKLPALMRAIVACGWYGIQTWFGGQ  128

Query  85   AIFILL  68
             I+ LL
Sbjct  129  MIYTLL  134



>ref|WP_017926992.1| nitrate reductase [Loktanella hongkongensis]
 gb|EYD70896.1| Cytosine/purine/uracil/thiamine/allantoin permease family protein 
[Loktanella hongkongensis DSM 17492]
Length=496

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP L +++  PTT  +RT++   +A+LW+G+VV +P++ LA  L+  GMSW Q V T++A
Sbjct  25   DPRLYNEDQLPTTAAERTWNWLAIAALWVGMVVCIPTYLLASYLINSGMSWDQAVLTILA  84

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  + ++L GH GT+YGIPFPVL RS+FG +GA IP + R +VACGW+GIQTW+GG 
Sbjct  85   ANAIVLIPMVLLGHAGTKYGIPFPVLLRSSFGPTGAKIPAVARGIVACGWFGIQTWVGGS  144

Query  85   AIFILL  68
            AIF++L
Sbjct  145  AIFVIL  150



>ref|WP_008558295.1| nitrate reductase [Leisingera daeponensis]
 gb|EDZ44971.1| NCS1 nucleoside transporter family [Rhodobacterales bacterium 
Y4I]
Length=496

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP L +++  PTT  +RT+    +A+LW+G+VV +P++ LA  L+  GMSW Q V T++A
Sbjct  25   DPELYNEDQLPTTAAERTWDWLAIAALWVGMVVCIPTYLLASYLIGSGMSWDQAVLTILA  84

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  + ++L GH GT+YGIPFPVL RS+FG +GA IP + R +VACGW+GIQTW+GG 
Sbjct  85   ANAIVLIPMVLVGHAGTKYGIPFPVLLRSSFGPTGAKIPAVARGIVACGWFGIQTWVGGS  144

Query  85   AIFILL  68
            AIF++L
Sbjct  145  AIFVIL  150



>gb|EIZ04902.1| cytosine/purines transporter [Ralstonia sp. PBA]
Length=491

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = -2

Query  460  VQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGV  281
            +     P L + +L PT P QRT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V
Sbjct  10   IAATASPDLWNHDLAPTQPAQRTWTAMHYAALWVSMVVSVPAYMLASGLMTEGMNWWQAV  69

Query  280  ATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQT  101
             TV   N+I  + ++L GH G ++GIPFPVLAR++FG+ GA +P LLR++VACGW+GIQT
Sbjct  70   LTVFLGNVIVLVPMVLIGHAGAKHGIPFPVLARASFGVRGAQLPALLRAIVACGWFGIQT  129

Query  100  WIGGEAIF  77
            W+GG AI+
Sbjct  130  WLGGMAIY  137



>ref|WP_030997041.1| nitrate reductase [Streptomyces sp. NRRL F-5630]
Length=525

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 101/159 (64%), Gaps = 5/159 (3%)
 Frame = -2

Query  508  SHSQIIPSGSLDDDPLVQDNP-----DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVG  344
            SH+   P   L  D  V+ +P     D    +++L+P     R +  +   +LWIG+   
Sbjct  19   SHAATAPGQHLTPDGRVELDPGAFPADSPHANEDLRPIPVAHRHWGTYNFTALWIGMAHN  78

Query  343  VPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGIS  164
            +PS+ LA  LV LGM W Q V T+  AN++  L ++L GH G +YGIPFPVLAR++FG+ 
Sbjct  79   IPSWTLASGLVALGMDWKQAVLTIALANVVVLLPMLLTGHAGPKYGIPFPVLARASFGLR  138

Query  163  GAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDS  47
            GA++P LLR+ VACGW+GIQTWIGG+ +F+LL K +  S
Sbjct  139  GANLPALLRAAVACGWFGIQTWIGGQGVFVLLDKLLPGS  177



>ref|WP_019296439.1| MULTISPECIES: nitrate reductase [Leisingera]
 gb|KIC24083.1| nitrate reductase [Leisingera sp. ANG-S3]
 gb|KIC52491.1| nitrate reductase [Leisingera sp. ANG-S]
 gb|KID09871.1| nitrate reductase [Leisingera sp. ANG1]
Length=496

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP L +++  PTT  +RT+    +A+LW+G+VV +P++ LA  L+  GMSW Q V T++A
Sbjct  25   DPELYNEDQLPTTAVERTWDWLAIAALWVGMVVCIPTYLLASYLIGSGMSWDQAVLTILA  84

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  + ++L GH GT+YGIPFPVL RS+FG SGA IP + R +VACGW+GIQTW+GG 
Sbjct  85   ANAIVLIPMVLVGHAGTKYGIPFPVLLRSSFGPSGAKIPAVARGIVACGWFGIQTWVGGS  144

Query  85   AIFILL  68
            AIF++L
Sbjct  145  AIFVIL  150



>ref|WP_037029285.1| nitrate reductase [Ralstonia sp. PBA]
Length=482

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
             P L + +L PT P QRT++    A+LW+ +VV VP++ LA  L+  GM+WWQ V TV  
Sbjct  6    SPDLWNHDLAPTQPAQRTWTAMHYAALWVSMVVSVPAYMLASGLMTEGMNWWQAVLTVFL  65

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
             N+I  + ++L GH G ++GIPFPVLAR++FG+ GA +P LLR++VACGW+GIQTW+GG 
Sbjct  66   GNVIVLVPMVLIGHAGAKHGIPFPVLARASFGVRGAQLPALLRAIVACGWFGIQTWLGGM  125

Query  85   AIF  77
            AI+
Sbjct  126  AIY  128



>ref|WP_023528765.1| hypothetical protein [Streptomycetaceae bacterium MP113-05]
 gb|EST38172.1| hypothetical protein N566_08935 [Streptomycetaceae bacterium 
MP113-05]
Length=511

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 98/150 (65%), Gaps = 0/150 (0%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            P GS ++ P      D    + +L+P    +R ++ +  A+LW+G+ V +PS+ LA  LV
Sbjct  16   PPGSREEVPPGAIPEDSRYANADLRPVPVAERRWTTYNFAALWVGMAVNIPSWTLASGLV  75

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
             LGM W Q V T+  AN+I  L ++L GH G +YGIPFPVLAR++FG+ GA++P LLR L
Sbjct  76   ALGMDWKQAVLTIALANVIVLLPMLLTGHAGPKYGIPFPVLARASFGVVGANLPALLRGL  135

Query  130  VACGWYGIQTWIGGEAIFILLPKTIKDSSF  41
            VAC W+GIQTWIGG++IF L  K     S+
Sbjct  136  VACAWFGIQTWIGGQSIFFLAGKIFGGGSW  165



>ref|WP_008512194.1| nitrate reductase [Mucilaginibacter paludis]
 gb|EHQ30447.1| NCS1 nucleoside transporter family [Mucilaginibacter paludis 
DSM 18603]
Length=507

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 95/143 (66%), Gaps = 0/143 (0%)
 Frame = -2

Query  454  DNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVAT  275
            D  D  L SD+L      QRT+  W  A+LWI + + +P++ LA SL+E GM+WWQ + T
Sbjct  10   DARDSQLFSDDLAAIPLNQRTWGTWNYAALWISMSLCIPTYMLASSLIEGGMNWWQSILT  69

Query  274  VVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWI  95
            ++  N I  + +IL G  G +YGIPFPV AR++FG++GA+IP +LR+++ACGW+GIQTWI
Sbjct  70   ILLGNTIVLIPMILNGRAGAKYGIPFPVFARASFGVTGANIPAMLRAIIACGWFGIQTWI  129

Query  94   GGEAIFILLPKTIKDSSFSPACF  26
            GG A++ ++   +      P  F
Sbjct  130  GGYALYQMVKLWVPSVDALPQVF  152



>ref|WP_034184953.1| nitrate reductase [Burkholderia pyrrocinia]
 gb|KFL49460.1| nitrate reductase [Burkholderia pyrrocinia]
Length=502

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            +P     P  SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    EPDSAAAPGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_027792247.1| nitrate reductase [Burkholderia cepacia]
 gb|AIO26509.1| NCS1 nucleoside transporter family protein [Burkholderia cepacia 
ATCC 25416]
Length=502

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDGAAAQGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q VATV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVATVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>gb|KIG01941.1| NCS1 nucleoside transporter family [Burkholderia sp. MR1]
Length=498

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ VATV+  N
Sbjct  15   SLYNDDLAPTGPAQRTWKWYHFAALWVGMVMNIASYMLAAGLTEQGMSPWQAVATVLLGN  74

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL RS+FG  GA +P LLR++VACGWYGIQTW+GG AI
Sbjct  75   VIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPALLRAIVACGWYGIQTWLGGSAI  134

Query  79   FILL  68
            + LL
Sbjct  135  YTLL  138



>gb|EEE04686.1| permease, cytosine/purine, uracil, thiamine, allantoin family 
[Burkholderia multivorans CGD2]
 gb|EEE10005.1| permease, cytosine/purine, uracil, thiamine, allantoin family 
[Burkholderia multivorans CGD2M]
Length=529

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = -2

Query  508  SHSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFY  329
            +H     + S + D +    P  SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ 
Sbjct  25   AHPMKATANSAEPDGMAM--PGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYM  82

Query  328  LAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIP  149
            LA  L++ GMS WQ V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P
Sbjct  83   LAAGLIQEGMSPWQAVLTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLP  142

Query  148  TLLRSLVACGWYGIQTWIGGEAIFILL  68
             LLR++VACGWYGIQTW+GG AI+ LL
Sbjct  143  ALLRAIVACGWYGIQTWLGGSAIYTLL  169



>gb|EJO56588.1| NCS1 nucleoside transporter family protein [Burkholderia multivorans 
ATCC BAA-247]
Length=529

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = -2

Query  508  SHSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFY  329
            +H     + S + D +    P  SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ 
Sbjct  25   AHPMKATANSAEPDGMAM--PGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYM  82

Query  328  LAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIP  149
            LA  L++ GMS WQ V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P
Sbjct  83   LAAGLIQEGMSPWQAVLTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLP  142

Query  148  TLLRSLVACGWYGIQTWIGGEAIFILL  68
             LLR++VACGWYGIQTW+GG AI+ LL
Sbjct  143  ALLRAIVACGWYGIQTWLGGSAIYTLL  169



>ref|WP_031357236.1| nitrate reductase [Burkholderia sordidicola]
Length=502

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTT  QRT+  +  A+LW+G+V+ + S+ LA  L E GMS W
Sbjct  9    DPQFAAGASSSLYNDDLAPTTAAQRTWKWYHFAALWVGMVMNIASYMLAAGLTEEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL RS+FG  GA +P LLR++VACGWYG
Sbjct  69   QAVLTVLLGNMIVLVPMLLVGHAGAKHGIPYAVLVRSSFGTKGARLPALLRAVVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ L+
Sbjct  129  IQTWLGGSAIYTLI  142



>ref|WP_030551196.1| nitrate reductase [Streptomyces exfoliatus]
Length=513

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            P G ++  P    + DP  ++D+L P    +R ++ +  A+LW+G+   +PS+ LA  LV
Sbjct  16   PGGRVELAPGAAPD-DPRFVNDDLLPVPVERRRWTTYNFAALWVGMAHNIPSWMLASGLV  74

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
             LGM W Q V T+  AN+I  L ++L GH G +YGIPFPVLAR++FG+ GA++P L+R  
Sbjct  75   ALGMDWKQAVLTIALANVIVLLPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALIRGG  134

Query  130  VACGWYGIQTWIGGEAIFILLPKTIKDS  47
            VAC W+GIQTWIGG+ +F+LL K    S
Sbjct  135  VACAWFGIQTWIGGQGVFVLLDKVFGGS  162



>ref|WP_035956975.1| nitrate reductase [Burkholderia multivorans]
 gb|KGC07670.1| NCS1 nucleoside transporter family protein [Burkholderia multivorans]
Length=502

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            P  SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS WQ V TV+
Sbjct  16   PGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPWQAVLTVL  75

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYGIQTW+GG
Sbjct  76   LGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYGIQTWLGG  135

Query  88   EAIFILL  68
             AI+ LL
Sbjct  136  SAIYTLL  142



>ref|WP_017878537.1| nitrate reductase [Janthinobacterium sp. CG3]
Length=494

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
            + +P L +++L PTT  QRT+  +  A+LW+G+V+ +P++ L+ SL++ GMS  Q V TV
Sbjct  6    SANPQLWNEDLAPTTAAQRTWRWYHFAALWVGMVMCIPAYTLSASLIDSGMSGMQAVLTV  65

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
              AN I  L ++L GH GT+YGIP+ VLARS+FG SGA +P L+R++VACGWYGIQTW G
Sbjct  66   FLANAIVLLPMLLIGHAGTKYGIPYAVLARSSFGTSGARLPALMRAIVACGWYGIQTWFG  125

Query  91   GEAIFIL  71
            G+ I+ L
Sbjct  126  GQMIYTL  132



>ref|WP_035947438.1| nitrate reductase [Burkholderia multivorans]
Length=502

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            P  SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS WQ V TV+
Sbjct  16   PGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPWQAVLTVL  75

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYGIQTW+GG
Sbjct  76   LGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYGIQTWLGG  135

Query  88   EAIFILL  68
             AI+ LL
Sbjct  136  SAIYTLL  142



>ref|WP_035489664.1| nitrate reductase [Burkholderia multivorans]
Length=502

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            P  SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS WQ V TV+
Sbjct  16   PGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPWQAVLTVL  75

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYGIQTW+GG
Sbjct  76   LGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYGIQTWLGG  135

Query  88   EAIFILL  68
             AI+ LL
Sbjct  136  SAIYTLL  142



>ref|WP_012217802.1| nitrate reductase [Burkholderia multivorans]
 ref|YP_001585314.1| NCS1 nucleoside transporter [Burkholderia multivorans ATCC 17616]
 ref|YP_001941935.1| NCS1 family nucleobase:cation symporter-1 [Burkholderia multivorans 
ATCC 17616]
 gb|ABX19022.1| NCS1 nucleoside transporter family [Burkholderia multivorans 
ATCC 17616]
 dbj|BAG47945.1| NCS1 family nucleobase:cation symporter-1 [Burkholderia multivorans 
ATCC 17616]
 gb|AIO72061.1| NCS1 nucleoside transporter family protein [Burkholderia multivorans]
Length=502

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            P  SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS WQ V TV+
Sbjct  16   PGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPWQAVLTVL  75

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYGIQTW+GG
Sbjct  76   LGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYGIQTWLGG  135

Query  88   EAIFILL  68
             AI+ LL
Sbjct  136  SAIYTLL  142



>ref|WP_006402885.1| nitrate reductase [Burkholderia multivorans]
 gb|EED96884.1| permease, cytosine/purine, uracil, thiamine, allantoin family 
[Burkholderia multivorans CGD1]
 gb|EJO62761.1| NCS1 nucleoside transporter family protein [Burkholderia multivorans 
CF2]
 gb|KHS09693.1| nitrate reductase [Burkholderia multivorans]
 gb|KHS09746.1| nitrate reductase [Burkholderia multivorans]
Length=502

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            P  SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS WQ V TV+
Sbjct  16   PGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPWQAVLTVL  75

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYGIQTW+GG
Sbjct  76   LGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYGIQTWLGG  135

Query  88   EAIFILL  68
             AI+ LL
Sbjct  136  SAIYTLL  142



>ref|WP_011537686.1| nitrate reductase [Ruegeria sp. TM1040]
 ref|YP_612333.1| NCS1 nucleoside transporter [Ruegeria sp. TM1040]
 gb|ABF63071.1| NCS1 nucleoside transporter family [Ruegeria sp. TM1040]
Length=496

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP L +++  PTT  +RT++   +++LW+G+VV +P++ LA  L+  GMSW Q V T++A
Sbjct  25   DPELYNEDQLPTTAAERTWNWLSISALWVGMVVCIPTYLLASYLIGAGMSWDQAVLTILA  84

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  + ++L GH GT+YGIPFPVL R++FG  GA IP + R +VACGW+GIQTW+GG 
Sbjct  85   ANAIVLIPMVLVGHAGTKYGIPFPVLLRASFGPVGAKIPAVARGIVACGWFGIQTWVGGS  144

Query  85   AIFILLPK  62
            AIF+++ K
Sbjct  145  AIFVIVNK  152



>ref|WP_030276685.1| nitrate reductase [Streptomyces sp. NRRL B-24484]
Length=497

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = -2

Query  511  ESHSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSF  332
             +   + P G ++  P   D  DP   +D+L+P    +R ++ +   +LW+G+   +PS+
Sbjct  2    SATQSVQPDGRIELAP-GTDLSDPRFANDDLRPVPVAKRRWTTYNFLALWVGMAHNIPSW  60

Query  331  YLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHI  152
             LA  LV LGM W Q V T+  AN+I  + ++L GH GT+YGIPFPV AR++FG+ GA++
Sbjct  61   TLASGLVALGMDWKQAVLTIALANLIVLVPMLLTGHAGTKYGIPFPVFARASFGLRGANL  120

Query  151  PTLLRSLVACGWYGIQTWIGGEAIFILLPKTI  56
            P ++R+ VAC W+GIQTWIGGE IF+L  K +
Sbjct  121  PAMIRAAVACAWFGIQTWIGGEGIFLLAGKLL  152



>ref|WP_034209424.1| nitrate reductase [Burkholderia cepacia]
 gb|KGC06750.1| NCS1 nucleoside transporter family protein [Burkholderia cepacia]
Length=502

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVTTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_027786236.1| nitrate reductase [Burkholderia cepacia]
Length=502

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVTTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>gb|KER68989.1| nitrate reductase [Burkholderia cepacia]
Length=502

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAQGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_016643091.1| putative allantoin permease [Streptomyces aurantiacus]
 gb|EPH41970.1| putative allantoin permease [Streptomyces aurantiacus JA 4570]
Length=511

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 99/150 (66%), Gaps = 5/150 (3%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNP-----DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYL  326
            P+    DD  V+  P     D    +D+LKP    +R ++ +  A+LW+G+   +PS+ L
Sbjct  13   PTQRAADDGRVELIPGAYPHDSRFANDDLKPIPLAERHWTTYNFAALWVGMAHNIPSWTL  72

Query  325  AGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPT  146
            A  LV LGM W Q V T+  AN++  L ++L GH G +YGIPFPVLAR++FG+ GA++P 
Sbjct  73   ASGLVALGMDWKQAVLTIALANVVVLLPMLLTGHAGPKYGIPFPVLARASFGLRGANLPA  132

Query  145  LLRSLVACGWYGIQTWIGGEAIFILLPKTI  56
            L+R+ VACGW+GIQTWIGG+ IF+LL +  
Sbjct  133  LIRAAVACGWFGIQTWIGGQGIFVLLNEVF  162



>ref|WP_012337197.1| nitrate reductase [Burkholderia cenocepacia]
 ref|YP_001774322.1| NCS1 nucleoside transporter [Burkholderia cenocepacia MC0-3]
 gb|ACA95827.1| NCS1 nucleoside transporter family [Burkholderia cenocepacia 
MC0-3]
Length=502

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_030211204.1| nitrate reductase [Streptomyces griseoluteus]
Length=513

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP  ++D+L P    +R ++ +  A+LW+G+   +PS+ LA  LV LGM W Q V T+  
Sbjct  30   DPRFVNDDLLPVPVERRRWTTYNFAALWVGMAHNIPSWMLASGLVALGMDWKQAVLTIAL  89

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I  L ++L GH G +YGIPFPVLAR++FG+ GA++P L+R  VAC W+GIQTWIGG+
Sbjct  90   ANVIVLLPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALIRGGVACAWFGIQTWIGGQ  149

Query  85   AIFILLPKTIKDS  47
             +F+LL K    S
Sbjct  150  GVFVLLDKVFGGS  162



>ref|WP_006485642.1| nitrate reductase [Burkholderia cenocepacia]
 ref|YP_002154103.1| putative cytosine/purines, uracil, thiamine, allantoin permease 
[Burkholderia cenocepacia J2315]
 emb|CAR57666.1| putative cytosine/purines, uracil, thiamine, allantoin permease 
[Burkholderia cenocepacia J2315]
 gb|EPZ84786.1| NCS1 nucleoside transporter family protein [Burkholderia cenocepacia 
K56-2Valvano]
 gb|ERI26725.1| NCS1 nucleoside transporter family protein [Burkholderia cenocepacia 
BC7]
Length=502

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_006498605.1| nitrate reductase [Burkholderia cenocepacia]
 emb|CCE52686.1| putative pyrimidine permease in reductive pathway [Burkholderia 
cenocepacia H111]
 emb|CDN65411.1| putative pyrimidine permease in reductive pathway [Burkholderia 
cenocepacia H111]
Length=502

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|XP_005850521.1| hypothetical protein CHLNCDRAFT_16619, partial [Chlorella variabilis]
 gb|EFN58419.1| hypothetical protein CHLNCDRAFT_16619, partial [Chlorella variabilis]
Length=405

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  442  PSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAA  263
            P L S +L P  P QRT+S W+MA+LW+GLVV V S++LAG LV+LGMSW +G+  V+ A
Sbjct  1    PLLHSPDLSPVPPAQRTFSAWDMAALWVGLVVSVSSWFLAGGLVDLGMSWQEGILCVLLA  60

Query  262  NIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEA  83
            N I    ++L GH G +YG+PFPVLARS+FGI GA +P +LR  VA  W+G+ TW+GG A
Sbjct  61   NTIVLAPMVLMGHAGVKYGVPFPVLARSSFGIRGAILPAVLRGCVAACWFGLNTWLGGAA  120

Query  82   I  80
            I
Sbjct  121  I  121



>ref|WP_030320092.1| nitrate reductase [Streptomyces flavochromogenes]
Length=516

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 98/145 (68%), Gaps = 1/145 (1%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            P G ++  P    + DP  ++++L P    QR ++ +  A+LW+G+   +PS+ LA  LV
Sbjct  19   PGGRVELAPGTAPD-DPRFVNEDLLPVPVAQRRWTTYNFAALWVGMAHNIPSWMLASGLV  77

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
             LGM W Q V T+  AN++  L ++L GH G +YGIPFPVLAR++FG+ GA++P L+R+ 
Sbjct  78   ALGMDWKQAVLTIALANVVVLLPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALVRAG  137

Query  130  VACGWYGIQTWIGGEAIFILLPKTI  56
            VAC W+GIQTWIGG+ IF+LL K  
Sbjct  138  VACAWFGIQTWIGGQGIFVLLDKVF  162



>ref|WP_039343221.1| nitrate reductase [Mumia flava]
 gb|KHL17883.1| nitrate reductase [Mumia flava]
Length=502

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDRAAAQGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVTTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_034203769.1| nitrate reductase [Burkholderia cepacia]
 gb|AIO43350.1| NCS1 nucleoside transporter family protein [Burkholderia cepacia]
 gb|KGC04924.1| NCS1 nucleoside transporter family protein [Burkholderia cepacia]
Length=502

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_014251142.1| nitrate reductase [Burkholderia sp. YI23]
 ref|YP_005042393.1| NCS1 nucleoside transporter family [Burkholderia sp. YI23]
 gb|AET91506.1| NCS1 nucleoside transporter family [Burkholderia sp. YI23]
Length=495

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  457  QDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVA  278
             D    SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L + GMS WQ V 
Sbjct  6    HDVESSSLYNDDLAPTGPAQRTWKWYHFAALWVGMVMNIASYMLAAGLTDQGMSPWQAVM  65

Query  277  TVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTW  98
            TV+  N+I  + ++L GH G ++GIP+ VL RS+FG  GA +P LLR++VACGWYGIQTW
Sbjct  66   TVLLGNVIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPALLRAIVACGWYGIQTW  125

Query  97   IGGEAIFILL  68
            +GG AI+ LL
Sbjct  126  LGGSAIYTLL  135



>ref|WP_027811375.1| nitrate reductase [Burkholderia cenocepacia]
Length=502

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_027807589.1| nitrate reductase [Burkholderia cenocepacia]
Length=502

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAARGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_027234034.1| nitrate reductase [Leisingera caerulea]
Length=496

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP L +++  PTT  +RT+    +A+LW+G+VV +P++ LA  L+  GMSW Q V T++ 
Sbjct  25   DPELYNEDQLPTTAAERTWDWVAIAALWVGMVVCIPTYLLASYLIGSGMSWDQAVMTILV  84

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  + ++L GH GT+YGIPFPVL RS+FG +GA IP + R +VACGW+GIQTW+GG 
Sbjct  85   ANAIVLIPMVLVGHAGTKYGIPFPVLLRSSFGPTGAKIPAVARGIVACGWFGIQTWVGGS  144

Query  85   AIFILL  68
            AIF++L
Sbjct  145  AIFVIL  150



>ref|WP_011545787.1| nitrate reductase [Burkholderia cenocepacia]
 ref|YP_621472.1| NCS1 nucleoside transporter [Burkholderia cenocepacia AU 1054]
 ref|YP_839862.1| NCS1 nucleoside transporter [Burkholderia cenocepacia HI2424]
 gb|ABF76499.1| NCS1 nucleoside transporter family [Burkholderia cenocepacia 
AU 1054]
 gb|ABK12969.1| NCS1 nucleoside transporter family [Burkholderia cenocepacia 
HI2424]
 gb|KGY55373.1| nitrate reductase [Burkholderia cepacia]
Length=502

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>dbj|BAO89220.1| NCS1 nucleoside transporter family [Burkholderia sp. RPE67]
Length=495

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  457  QDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVA  278
             D    SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L + GMS WQ V 
Sbjct  6    HDVESSSLYNDDLAPTGPAQRTWKWYHFAALWVGMVMNIASYMLAAGLTDQGMSPWQAVM  65

Query  277  TVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTW  98
            TV+  N+I  + ++L GH G ++GIP+ VL RS+FG  GA +P LLR++VACGWYGIQTW
Sbjct  66   TVLLGNVIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPALLRAIVACGWYGIQTW  125

Query  97   IGGEAIFILL  68
            +GG AI+ LL
Sbjct  126  LGGSAIYTLL  135



>ref|WP_023476504.1| Hydantoin permease [Burkholderia cenocepacia]
 gb|ESS38906.1| Hydantoin permease [Burkholderia cenocepacia KC-01]
Length=502

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_020598644.1| nitrate reductase [Spirosoma panaciterrae]
Length=497

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            +L S++L P    +RT+S W  A+LWI + + +P++ +A SL+E GM+WWQ + T+   N
Sbjct  14   ALYSEDLAPIPASKRTWSTWNYAALWISMSLCIPTYMMASSLIEGGMNWWQAILTIFLGN  73

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
             I  + +IL GH G +YGIPFPVLAR++FG  GA+IP LLR++VACGW+GIQTW+GG ++
Sbjct  74   TIVLVPMILNGHAGAKYGIPFPVLARASFGTRGANIPALLRAIVACGWFGIQTWLGGFSV  133

Query  79   FILLPKTIKDSSFSPACF  26
            + +L   I      P  F
Sbjct  134  YQMLRLWIPSLETLPQIF  151



>ref|WP_034175572.1| nitrate reductase [Burkholderia cenocepacia]
Length=502

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_023545632.1| nitrate reductase [Streptomyces roseochromogenus]
 gb|EST34965.1| nitrate reductase [Streptomyces roseochromogenes subsp. oscitans 
DS 12.976]
Length=508

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 108/168 (64%), Gaps = 5/168 (3%)
 Frame = -2

Query  523  PSVAESHSQIIPSGSLDDDPLVQDNPDPS--LISDELKPTTPGQRTYSGWEMASLWIGLV  350
            P++  S    +P G ++  P     P PS    +++L P   G+RT++ +  ++LW+G+ 
Sbjct  7    PAIPLSGQVTLPDGRVELAP---GTPPPSGPYANEDLLPVPAGKRTWTTYNFSALWVGMA  63

Query  349  VGVPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFG  170
                S+ LA  L+ +GM W Q V T+  AN+I  + ++L GH G +YGIPFPV AR++FG
Sbjct  64   HNTASWTLASGLIAVGMDWKQAVFTIALANLIVLVPMLLTGHAGPKYGIPFPVFARASFG  123

Query  169  ISGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDSSFSPACF  26
            + GA++P ++R+LVACGW+GIQTWIGGEAI+ L  K I DS  + A F
Sbjct  124  VRGANLPAVVRALVACGWFGIQTWIGGEAIYFLAGKLIGDSWSNAAHF  171



>ref|WP_031403033.1| MULTISPECIES: nitrate reductase [Burkholderia]
 gb|KEZ01783.1| nitrate reductase [Burkholderia sp. MSh2]
 gb|KFG92891.1| nitrate reductase [Burkholderia sp. MSh1]
Length=502

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVLTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>gb|EAY67321.1| Cytosine/uracil/thiamine/allantoin permease [Burkholderia cenocepacia 
PC184]
Length=586

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  93   DPDSAAAHGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  152

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  153  QAVMTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  212

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  213  IQTWLGGSAIYTLL  226



>ref|WP_021156781.1| putative pyrimidine permease in reductive pathway [Burkholderia 
sp. AU4i]
 gb|ERJ40879.1| putative pyrimidine permease in reductive pathway [Burkholderia 
sp. AU4i]
Length=502

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDGAAAQGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVTTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_018059551.1| nitrate reductase [Oxalobacteraceae bacterium JGI 0001004-K23]
Length=494

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
            + +  L +++L PTT  QRT+  +  A+LW+G+V+ +P++ L+ SL+E GMS +Q V TV
Sbjct  6    SANTQLWNEDLAPTTAAQRTWRWYHFAALWVGMVMCIPAYTLSASLIEGGMSGYQAVLTV  65

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
              AN I  L ++L GH GT+YGIP+ VLARS+FG +GA IP L+R++VACGWYGIQTW G
Sbjct  66   FLANAIVLLPMLLIGHAGTKYGIPYAVLARSSFGTTGARIPALMRAIVACGWYGIQTWFG  125

Query  91   GEAIFILL  68
            G  I+ LL
Sbjct  126  GSMIYTLL  133



>ref|WP_035172284.1| nitrate reductase, partial [Caldanaerobius polysaccharolyticus]
Length=465

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 93/130 (72%), Gaps = 0/130 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            D  L + +L PT   +RT++ +   +LW+G+ + +P++ +A  L+  GM+W Q + T+  
Sbjct  16   DRELYNKDLAPTDEKERTWTSYNYMALWLGMSICIPTYMMAAGLIAGGMNWKQAIFTIFL  75

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
             N+I  + +IL GHPGT+YGI FPV ARS+FG+ GA+IP ++R++VACGW+GIQTWIGGE
Sbjct  76   GNLIVLIPMILNGHPGTKYGINFPVFARSSFGVRGANIPAIMRAIVACGWFGIQTWIGGE  135

Query  85   AIFILLPKTI  56
            AI  L+ K I
Sbjct  136  AINSLIIKII  145



>ref|WP_012204711.1| nitrate reductase [Delftia acidovorans]
 ref|YP_001563886.1| NCS1 nucleoside transporter [Delftia acidovorans SPH-1]
 gb|ABX35501.1| NCS1 nucleoside transporter family [Delftia acidovorans SPH-1]
Length=497

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL + +L PT P QRT++ +  A+LWIG+V+ +P++ LA S++  GMSW Q V TV   N
Sbjct  13   SLWNHDLAPTLPSQRTWTWYHFAALWIGMVMCIPAYTLAASMITNGMSWSQAVMTVFLGN  72

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G RYGIPF VLAR++FG  GA +P LLR+LVACGWYGIQTW GG  I
Sbjct  73   LIVLIPMLLIGHAGARYGIPFAVLARASFGTHGAKLPALLRALVACGWYGIQTWFGGMMI  132

Query  79   FILL  68
            + LL
Sbjct  133  YTLL  136



>ref|WP_013803149.1| nitrate reductase [Delftia sp. Cs1-4]
 ref|YP_004489227.1| NCS1 nucleoside transporter family [Delftia sp. Cs1-4]
 gb|AEF90872.1| NCS1 nucleoside transporter family [Delftia sp. Cs1-4]
 gb|EZP62926.1| putative permease [Delftia sp. RIT313]
Length=497

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL + +L PT P QRT++ +  A+LWIG+V+ +P++ LA S++  GMSW Q V TV   N
Sbjct  13   SLWNHDLAPTLPSQRTWTWYHFAALWIGMVMCIPAYTLAASMITNGMSWSQAVMTVFLGN  72

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G RYGIPF VLAR++FG  GA +P LLR+LVACGWYGIQTW GG  I
Sbjct  73   LIVLIPMLLIGHAGARYGIPFAVLARASFGTHGAKLPALLRALVACGWYGIQTWFGGMMI  132

Query  79   FILL  68
            + LL
Sbjct  133  YTLL  136



>ref|WP_034363133.1| nitrate reductase [Delftia sp. 670]
 gb|ABS84238.1| putative permease [Delftia sp. I24]
 gb|KEH15111.1| nitrate reductase [Delftia sp. 670]
Length=497

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL + +L PT P QRT++ +  A+LWIG+V+ +P++ LA S++  GMSW Q V TV   N
Sbjct  13   SLWNHDLAPTLPSQRTWTWYHFAALWIGMVMCIPAYTLAASMITNGMSWSQAVMTVFLGN  72

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G RYGIPF VLAR++FG  GA +P LLR+LVACGWYGIQTW GG  I
Sbjct  73   LIVLIPMLLIGHAGARYGIPFAVLARASFGTHGAKLPALLRALVACGWYGIQTWFGGMMI  132

Query  79   FILL  68
            + LL
Sbjct  133  YTLL  136



>ref|WP_007621753.1| probable allantoin permease [Glaciecola arctica]
 dbj|GAC20147.1| probable allantoin permease [Glaciecola arctica BSs20135]
Length=488

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 99/146 (68%), Gaps = 1/146 (1%)
 Frame = -2

Query  475  DDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMS  296
            +++ +   + D  L + +L PTT   RT++    ASLW+ +VV VP++ LA  LV  GM+
Sbjct  4    NNNSVKPAHFDADLWNPDLAPTTDETRTWNWIHFASLWVAMVVCVPTYMLAAGLVSEGMT  63

Query  295  WWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGW  116
            W+Q + TV+  N I  + ++L GH G +YG+PFPVL RSAFG  GA IP L R LVACGW
Sbjct  64   WYQAIITVLLGNAIVLVPMLLIGHAGAKYGVPFPVLLRSAFGTKGAKIPALARGLVACGW  123

Query  115  YGIQTWIGGEAIFILLPKTIKDSSFS  38
            +GIQTW+GG AI+++L  ++ ++SF 
Sbjct  124  FGIQTWVGGSAIYVIL-NSLTNNSFQ  148



>ref|WP_005668392.1| NCS1 nucleoside transporter [Massilia timonae]
 gb|EKU81580.1| NCS1 nucleoside transporter [Massilia timonae CCUG 45783]
Length=488

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
             L +D+L PTT  QRT+  +  A+LW+G+V+ +P++ L+ SLVE GMS WQ V TV  AN
Sbjct  10   DLWNDDLAPTTAAQRTWRWYHFAALWVGMVMCIPAYTLSASLVEAGMSGWQAVLTVFLAN  69

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
             I  + ++L GH G +YGIP+ VLAR++FG  GA +P L+R++VACGWYGIQTW GG  I
Sbjct  70   AIVLVPMLLIGHAGAKYGIPYAVLARTSFGTRGARLPALMRAIVACGWYGIQTWFGGSMI  129

Query  79   FILL  68
            + LL
Sbjct  130  YTLL  133



>ref|WP_012829627.1| nitrate reductase [Haliangium ochraceum]
 ref|YP_003268922.1| NCS1 nucleoside transporter family [Haliangium ochraceum DSM 
14365]
 gb|ACY17029.1| NCS1 nucleoside transporter family [Haliangium ochraceum DSM 
14365]
Length=533

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 3/140 (2%)
 Frame = -2

Query  451  NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATV  272
            +  P LI+ +L P  P  R++  W +A+LW+G+ V +P++ LA  L+  GMSW Q + TV
Sbjct  47   HASPRLINPDLAPVAPDARSWGMWHIAALWVGMAVCIPTYSLAAGLLAQGMSWSQALWTV  106

Query  271  VAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIG  92
            +  N+I  + L L  H GTRYGIPFPVL R++FG  GA++P L+R+LVACGW+GIQTWIG
Sbjct  107  LLGNLIVWVPLALNAHAGTRYGIPFPVLLRASFGTRGANLPALMRALVACGWFGIQTWIG  166

Query  91   GEAIFILLPKTIKDSSFSPA  32
            G AI+ LL   +    F+PA
Sbjct  167  GSAIYTLLAVLL---GFAPA  183



>ref|WP_017236814.1| nitrate reductase [Streptomyces sp. SS]
Length=517

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 96/136 (71%), Gaps = 0/136 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            D   ++D+L P    +R ++ +  A+LW+G+   +PS+ LA  LV LGM W Q V T+  
Sbjct  30   DSRFVNDDLLPVPLAERRWTTYNFAALWVGMAHNIPSWMLASGLVALGMDWKQAVLTIAL  89

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN++  + ++L GH G +YGIPFPVLAR++FG+ GA++P L+R+ VAC W+GIQTWIGG+
Sbjct  90   ANVVVLVPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALIRAGVACAWFGIQTWIGGQ  149

Query  85   AIFILLPKTIKDSSFS  38
             IF+LL K +++ + S
Sbjct  150  GIFVLLDKVLQEVTGS  165



>ref|WP_034190668.1| nitrate reductase [Burkholderia cenocepacia]
 gb|KEA56251.1| nitrate reductase [Burkholderia cenocepacia]
Length=502

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = -2

Query  469  DPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWW  290
            DP        SL +D+L PTTP QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS W
Sbjct  9    DPDSAAARGGSLYNDDLAPTTPAQRTWKWYHFAALWVGMVMNIASYMLAAGLIQEGMSPW  68

Query  289  QGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYG  110
            Q V TV+  N+I    ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYG
Sbjct  69   QAVMTVLLGNLIVLAPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYG  128

Query  109  IQTWIGGEAIFILL  68
            IQTW+GG AI+ LL
Sbjct  129  IQTWLGGSAIYTLL  142



>ref|WP_038455498.1| nitrate reductase [Burkholderia cenocepacia]
 gb|AIO30355.1| NCS1 nucleoside transporter family protein [Burkholderia cenocepacia]
Length=502

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -2

Query  448  PDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVV  269
            P  SL +D+L PTT  QRT+  +  A+LW+G+V+ + S+ LA  L+E GMS WQ V TV+
Sbjct  16   PGGSLYNDDLAPTTAAQRTWKWYHFAALWVGMVMNIASYMLAAGLIEEGMSPWQAVLTVL  75

Query  268  AANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGG  89
              N+I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYGIQTW+GG
Sbjct  76   LGNLIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYGIQTWLGG  135

Query  88   EAIFILL  68
             AI+ LL
Sbjct  136  SAIYTLL  142



>ref|WP_033202978.1| nitrate reductase [Streptomyces wedmorensis]
Length=517

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 96/136 (71%), Gaps = 0/136 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            D   ++D+L P    +R ++ +  A+LW+G+   +PS+ LA  LV LGM W Q V T+  
Sbjct  30   DSRFVNDDLLPVPLAERRWTTYNFAALWVGMAHNIPSWMLASGLVALGMDWKQAVLTIAL  89

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN++  + ++L GH G +YGIPFPVLAR++FG+ GA++P L+R+ VAC W+GIQTWIGG+
Sbjct  90   ANVVVLVPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALIRAGVACAWFGIQTWIGGQ  149

Query  85   AIFILLPKTIKDSSFS  38
             IF+LL K +++ + S
Sbjct  150  GIFVLLDKVLQEVAGS  165



>ref|WP_038495967.1| nitrate reductase [Janthinobacterium agaricidamnosum]
 emb|CDG85003.1| NCS1 nucleoside transporter family protein [Janthinobacterium 
agaricidamnosum NBRC 102515 = DSM 9628]
Length=493

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 97/131 (74%), Gaps = 1/131 (1%)
 Frame = -2

Query  457  QD-NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGV  281
            QD + +  L + +L PTT  QR++  +  A+LW+G+V+ +P++ L+ SL++ GMS +Q V
Sbjct  3    QDFSGNTQLWNADLAPTTAAQRSWRWYHFAALWVGMVMCIPAYTLSASLIDSGMSGYQAV  62

Query  280  ATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQT  101
             TV  AN I  L ++L GH GT+YGIP+ VLARS+FG SGA +P L+R++VACGWYGIQT
Sbjct  63   LTVFLANAIVLLPMLLIGHAGTKYGIPYAVLARSSFGTSGARLPALMRAIVACGWYGIQT  122

Query  100  WIGGEAIFILL  68
            W GG+ I+IL+
Sbjct  123  WFGGQMIYILM  133



>ref|WP_036623138.1| nitrate reductase [Oxalobacteraceae bacterium AB_14]
Length=501

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = -2

Query  481  SLDDDPLVQD-NPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVEL  305
            +  + P+ ++ +    L +++L PTT  QRT+  +  A+LW+G+V+ +P++ L+ SL+E 
Sbjct  3    TFGESPVSKELSGSTQLWNEDLAPTTAAQRTWRWYHFAALWVGMVMCIPAYTLSASLIEG  62

Query  304  GMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVA  125
            GMS +Q V TV  AN I  L ++L GH GT+YGIP+ VLARS+FG +GA +P L+R++VA
Sbjct  63   GMSGYQAVLTVFLANAIVLLPMLLIGHAGTKYGIPYAVLARSSFGTAGARLPALMRAIVA  122

Query  124  CGWYGIQTWIGGEAIFILL  68
            CGWYGIQTW GG+ I+ LL
Sbjct  123  CGWYGIQTWFGGQMIYTLL  141



>ref|WP_034391912.1| nitrate reductase [Delftia acidovorans]
 gb|KFJ11043.1| NCS1 nucleoside transporter family protein [Delftia acidovorans]
Length=497

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL + +L PT P QRT++ +  A+LWIG+V+ +P++ LA S++  GMSW Q V TV   N
Sbjct  13   SLWNHDLAPTLPRQRTWTWYHFAALWIGMVMCIPAYTLAASMITNGMSWSQAVMTVFLGN  72

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G RYGIPF VLAR++FG  GA +P LLR+LVACGWYGIQTW GG  I
Sbjct  73   LIVLIPMLLIGHAGARYGIPFAVLARASFGTHGAKLPALLRALVACGWYGIQTWFGGMMI  132

Query  79   FILL  68
            + LL
Sbjct  133  YTLL  136



>ref|WP_016453019.1| NCS1 family nucleobase:cation symporter-1 [Delftia acidovorans]
 gb|EPD40910.1| NCS1 family nucleobase:cation symporter-1 [Delftia acidovorans 
CCUG 15835]
Length=497

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL + +L PT P QRT++ +  A+LWIG+V+ +P++ LA S++  GMSW Q V TV   N
Sbjct  13   SLWNHDLAPTLPSQRTWTWYHFAALWIGMVMCIPAYTLAASMITNGMSWSQAVMTVFLGN  72

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G RYGIPF VLAR++FG  GA +P +LR+LVACGWYGIQTW GG  I
Sbjct  73   LIVLIPMLLIGHAGARYGIPFAVLARASFGTHGAKLPAMLRALVACGWYGIQTWFGGMMI  132

Query  79   FILL  68
            + LL
Sbjct  133  YTLL  136



>ref|WP_004922926.1| nitrate reductase [Streptomyces griseoflavus]
 gb|EFL38069.1| NCS1 nucleoside family transporter [Streptomyces griseoflavus 
Tu4000]
Length=515

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 98/143 (69%), Gaps = 1/143 (1%)
 Frame = -2

Query  490  PSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLV  311
            P+G ++  P V    DP  ++D+L P    +R ++ +  A+LW+G+   +PS+ LA  LV
Sbjct  17   PAGRVELPPGVTPA-DPRFVNDDLLPVPLARRRWTTYNFAALWVGMAHNIPSWMLASGLV  75

Query  310  ELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSL  131
             LGM W Q V T+  AN+I    ++L GH G +YGIPFPVLAR++FG+ GA++P L+R+ 
Sbjct  76   ALGMDWKQAVFTIALANVIVLAPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALIRAG  135

Query  130  VACGWYGIQTWIGGEAIFILLPK  62
            VAC W+GIQTWIGG+ IF+LL K
Sbjct  136  VACAWFGIQTWIGGQGIFVLLGK  158



>ref|WP_028937214.1| nitrate reductase [Pseudonocardia spinosispora]
Length=503

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = -2

Query  430  SDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIIT  251
            ++EL PTT  +R ++ +  A+LW+G+   +PS+ LA  LV LGM W Q   T+  ANII 
Sbjct  33   NEELLPTTLAERKWTTYNYAALWMGMAHNIPSYLLASGLVALGMDWIQAFLTITLANIIV  92

Query  250  SLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFIL  71
             + ++L  H GT+YGIPFPV AR+ +G+ GA++P LLR+ +ACGW+GIQTW+GG+AIF++
Sbjct  93   LVPMLLNSHAGTKYGIPFPVFARAFYGLRGANLPALLRAFIACGWFGIQTWVGGQAIFVI  152

Query  70   LPKTIKDSSFSPACF  26
            + K   D     A F
Sbjct  153  IGKLSGDGWTKAAAF  167



>ref|WP_016445279.1| NCS1 family nucleobase:cation symporter-1 [Delftia acidovorans]
 gb|EPD44744.1| NCS1 family nucleobase:cation symporter-1 [Delftia acidovorans 
CCUG 274B]
 gb|KEH10894.1| nitrate reductase [Delftia tsuruhatensis]
Length=497

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL + +L PT P QRT++ +  A+LWIG+V+ +P++ LA S++  GMSW Q V TV   N
Sbjct  13   SLWNHDLAPTLPSQRTWTWYHFAALWIGMVMCIPAYTLAASMITNGMSWSQAVMTVFLGN  72

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G RYGIPF VLAR++FG  GA +P +LR+LVACGWYGIQTW GG  I
Sbjct  73   LIVLIPMLLIGHAGARYGIPFAVLARASFGTHGAKLPAMLRALVACGWYGIQTWFGGMMI  132

Query  79   FILL  68
            + LL
Sbjct  133  YTLL  136



>ref|WP_011689268.1| nitrate reductase [Candidatus Solibacter usitatus]
 ref|YP_828842.1| NCS1 nucleoside transporter [Candidatus Solibacter usitatus Ellin6076]
 gb|ABJ88557.1| NCS1 nucleoside transporter family [Candidatus Solibacter usitatus 
Ellin6076]
Length=467

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            D SL +++L P  P +RT+  +  A+LWI + V VP++ LA  L+  GM+WWQ + T++ 
Sbjct  6    DLSLYNEDLAPVPPEKRTWGTYNYAALWISMSVCVPTYMLASGLIAGGMNWWQAILTILL  65

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
             N+I  + ++L  H GT+YGIPFPVL R++FG+ GA++P +LR+LVACGW+GIQ WIGG+
Sbjct  66   GNLIVLVPMVLNAHAGTKYGIPFPVLVRTSFGVRGANLPAVLRALVACGWFGIQAWIGGQ  125

Query  85   AIFILL  68
            AI+ +L
Sbjct  126  AIYSML  131



>ref|WP_030361834.1| MULTISPECIES: nitrate reductase [Streptomyces]
Length=519

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = -2

Query  511  ESHSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSF  332
            +   +++P  S DD             +D+L+P    +R ++ +  A+LW+G+   +PS+
Sbjct  28   DGRVELLPGASPDDS---------RFANDDLRPIPLAERHWTTYNFAALWVGMAHNIPSW  78

Query  331  YLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHI  152
             LA  LV LGM W Q V T+  AN++  L ++L GH G +YGIPFPVLAR++FG+ GA++
Sbjct  79   TLASGLVALGMDWKQAVFTIALANVVVLLPMLLTGHAGPKYGIPFPVLARASFGLRGANL  138

Query  151  PTLLRSLVACGWYGIQTWIGGEAIFILLPKTI  56
            P L+R+ VACGW+GIQTWIGG+ IF+LL +  
Sbjct  139  PALIRAAVACGWFGIQTWIGGQGIFVLLNEVF  170



>ref|WP_037746885.1| nitrate reductase [Streptomyces sp. CNQ-525]
Length=513

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = -2

Query  430  SDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIIT  251
            + +L P    QRT++ +  A+LW+G+ V VP++ LA  L+ LGM W Q V T+  AN+I 
Sbjct  34   NGDLLPVPAAQRTWTTYNFAALWVGMAVNVPTWTLAAGLIALGMDWKQAVLTIALANVIV  93

Query  250  SLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFIL  71
             L ++L GH G +YGIPFPVLARS+FG+ GA++P LLR +VAC W+GIQTWIGG+AI+ L
Sbjct  94   LLPMLLTGHAGPKYGIPFPVLARSSFGVVGANLPALLRGVVACAWFGIQTWIGGQAIYFL  153

Query  70   LPKTIKDSSF  41
              K I   S+
Sbjct  154  AGKIIGAGSW  163



>ref|WP_008353715.1| MULTISPECIES: nitrate reductase [Burkholderia]
 gb|EKS66893.1| NCS1 nucleoside transporter family protein [Burkholderia sp. 
SJ98]
 gb|KDR30653.1| nitrate reductase [Burkholderia zhejiangensis]
Length=495

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  457  QDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVA  278
             D    SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L + GMS WQ V 
Sbjct  6    HDVETSSLYNDDLAPTGPAQRTWKWYHFAALWVGMVMNIASYMLAAGLTDQGMSPWQAVL  65

Query  277  TVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTW  98
            TV+  N+I  + ++L GH G ++GIP+ VL RS+FG  GA +P LLR++VACGWYGIQTW
Sbjct  66   TVLLGNMIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPALLRAIVACGWYGIQTW  125

Query  97   IGGEAIFILL  68
            +GG AI+ LL
Sbjct  126  LGGSAIYTLL  135



>ref|WP_027766324.1| nitrate reductase [Streptomyces sp. CNQ865]
Length=513

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = -2

Query  430  SDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIIT  251
            + +L P    QRT++ +  A+LW+G+ V VP++ LA  L+ LGM W Q V T+  AN+I 
Sbjct  34   NGDLLPVPAAQRTWTTYNFAALWVGMAVNVPTWTLAAGLIALGMDWKQAVLTIALANVIV  93

Query  250  SLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFIL  71
             L ++L GH G +YGIPFPVLARS+FG+ GA++P LLR +VAC W+GIQTWIGG+AI+ L
Sbjct  94   LLPMLLTGHAGPKYGIPFPVLARSSFGVVGANLPALLRGVVACAWFGIQTWIGGQAIYFL  153

Query  70   LPKTIKDSSF  41
              K I   S+
Sbjct  154  AGKIIGAGSW  163



>ref|WP_018837061.1| MULTISPECIES: hypothetical protein [Streptomyces]
Length=513

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = -2

Query  430  SDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIIT  251
            + +L P    QRT++ +  A+LW+G+ V VP++ LA  L+ LGM W Q V T+  AN+I 
Sbjct  34   NGDLLPVPAAQRTWTTYNFAALWVGMAVNVPTWTLAAGLIALGMDWKQAVLTIALANVIV  93

Query  250  SLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFIL  71
             L ++L GH G +YGIPFPVLARS+FG+ GA++P LLR +VAC W+GIQTWIGG+AI+ L
Sbjct  94   LLPMLLTGHAGPKYGIPFPVLARSSFGVVGANLPALLRGVVACAWFGIQTWIGGQAIYFL  153

Query  70   LPKTIKDSSF  41
              K I   S+
Sbjct  154  AGKIIGAGSW  163



>ref|WP_031037832.1| nitrate reductase [Streptomyces olivaceus]
Length=509

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 107/167 (64%), Gaps = 5/167 (3%)
 Frame = -2

Query  520  SVAESHSQIIPSGSLDDDPLVQDNPDPS--LISDELKPTTPGQRTYSGWEMASLWIGLVV  347
            ++  S    +P G ++  P    +P PS    +++L P   G+RT++ +  ++LW+G+  
Sbjct  8    AIPPSAQVTLPDGRVELAP---GSPPPSGRYANEDLLPVPVGKRTWTTYNFSALWVGMAH  64

Query  346  GVPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGI  167
               S+ LA  L+ +GM W Q V T+  AN+I  + ++L GH G RYGIPFPV AR++FG+
Sbjct  65   NTASWTLASGLIAVGMDWKQAVLTIALANLIVLVPMLLTGHAGPRYGIPFPVFARASFGV  124

Query  166  SGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDSSFSPACF  26
             GA++P ++R+LVACGW+GIQTWIGGEAI+ L  K I D   + A F
Sbjct  125  RGANMPAVVRALVACGWFGIQTWIGGEAIYFLAGKLIGDGWTNAAAF  171



>gb|AHE55156.1| hypothetical protein NX02_17405 [Sphingomonas sanxanigenens DSM 
19645 = NX02]
Length=488

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 97/146 (66%), Gaps = 1/146 (1%)
 Frame = -2

Query  457  QDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVA  278
            +D  +P L + +L PT   +RT+  +  A+LWIG++V VPS+ LA  L+E GMS  Q   
Sbjct  8    EDGVEPGLWNPDLAPTGAAERTWRWYHFAALWIGMIVAVPSWMLAAGLIEQGMSAAQAAL  67

Query  277  TVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTW  98
            TV+  N++  + L+L GH G RYG+P+ VLAR++FG  GA +P L R+LVACGWYGIQTW
Sbjct  68   TVLLGNVVILVPLLLIGHAGARYGVPYAVLARASFGTRGARLPALARALVACGWYGIQTW  127

Query  97   IGGEAIFILLPKTI-KDSSFSPACFL  23
            IGGEA+  LL   +  D   +P  FL
Sbjct  128  IGGEALLTLLGIFVGADLKGAPLAFL  153



>ref|WP_018424467.1| nitrate reductase [Burkholderia sp. WSM4176]
Length=503

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ V TV+  N
Sbjct  20   SLYNDDLAPTGPAQRTWRWYHFAALWVGMVMNIASYMLAAGLTEAGMSPWQAVLTVLLGN  79

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I    ++L GH G R+GIP+ VL RS+FG  GA +P +LR++VACGWYGIQTW+GG AI
Sbjct  80   LIVLAPMLLIGHAGARHGIPYAVLVRSSFGTQGAKLPAMLRAIVACGWYGIQTWLGGSAI  139

Query  79   FILL  68
            + LL
Sbjct  140  YTLL  143



>ref|WP_037699705.1| nitrate reductase [Streptomyces atratus]
Length=515

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 103/157 (66%), Gaps = 5/157 (3%)
 Frame = -2

Query  523  PSVAESHS--QIIPSGSLD-DDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGL  353
            PS+ ++ +  Q  P G +   + +V D  D    +D+L P    +RT+S +   SLW+G+
Sbjct  6    PSIPDTSTIQQTYPDGRVALAEGVVLD--DARFANDDLAPVPVERRTWSVYNYVSLWVGM  63

Query  352  VVGVPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAF  173
               +PS+ LA  LV LGM W Q V T+  AN+I  + ++L GH GT+YGIPFPV AR++F
Sbjct  64   AHNIPSWTLASGLVALGMDWKQAVLTIALANLIVLMPMLLTGHAGTKYGIPFPVFARASF  123

Query  172  GISGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPK  62
            G+ GA++P L+R+ VAC W+GIQTWIGGE IF+L  K
Sbjct  124  GMRGANLPALIRAAVACAWFGIQTWIGGEGIFLLAGK  160



>ref|WP_027197450.1| nitrate reductase [Burkholderia sprentiae]
Length=502

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ V+TV+  N
Sbjct  20   SLYNDDLAPTGPAQRTWRWYHFAALWVGMVMNIASYMLAAGLTEAGMSPWQAVSTVLLGN  79

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I    ++L GH G ++GIP+ VL RS+FG  GA +P +LR++VACGWYGIQTW+GG AI
Sbjct  80   LIVLAPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPAMLRAIVACGWYGIQTWLGGSAI  139

Query  79   FILL  68
            + LL
Sbjct  140  YTLL  143



>ref|WP_029967589.1| nitrate reductase [Burkholderia sp. URHA0054]
Length=503

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ V TV+  N
Sbjct  20   SLYNDDLAPTGPAQRTWRWYHFAALWVGMVMNIASYMLAAGLTEQGMSPWQAVVTVLLGN  79

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL RS+FG  GA +P +LR++VACGWYGIQTW+GG AI
Sbjct  80   LIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPAMLRAIVACGWYGIQTWLGGSAI  139

Query  79   FILL  68
            + LL
Sbjct  140  YTLL  143



>ref|WP_036229714.1| nitrate reductase [Massilia sp. JS1662]
 gb|KGF82600.1| nitrate reductase [Massilia sp. JS1662]
Length=495

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            +  L +++L PT+  QRT+  +  A+LW+G+V+ +P++ L+ SL+E GMS +Q V TV  
Sbjct  8    NQDLWNEDLAPTSAAQRTWRWYHFAALWVGMVMCIPAYTLSASLIEAGMSAYQAVFTVFL  67

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  L ++L GH GT+YGIP+ VLAR+AFG  GA +P L+R++VACGWYGIQTW GG 
Sbjct  68   ANAIVLLPMLLIGHAGTKYGIPYAVLARAAFGTRGARLPALMRAIVACGWYGIQTWFGGS  127

Query  85   AIFILL  68
             I+ LL
Sbjct  128  MIYTLL  133



>ref|WP_006052531.1| nitrate reductase [Burkholderia graminis]
 gb|EDT07286.1| NCS1 nucleoside transporter family [Burkholderia graminis C4D1M]
Length=503

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ V TV+  N
Sbjct  20   SLYNDDLAPTGPAQRTWRWYHFAALWVGMVMNIASYMLAAGLTEQGMSPWQAVVTVLLGN  79

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL RS+FG  GA +P +LR++VACGWYGIQTW+GG AI
Sbjct  80   LIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPAMLRAIVACGWYGIQTWLGGSAI  139

Query  79   FILL  68
            + LL
Sbjct  140  YTLL  143



>ref|WP_035528032.1| nitrate reductase [Burkholderia sacchari]
 gb|KHD20470.1| nitrate reductase [Burkholderia sacchari]
Length=503

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = -2

Query  502  SQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLA  323
            SQ   SG ++ D   + +    L +D+L PT   QRT+  +  A+LW+G+V+ + S+ LA
Sbjct  2    SQPAASGDMEGDAHARRSAS-ELYNDDLAPTRAAQRTWRWYHFAALWVGMVMNIASYMLA  60

Query  322  GSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTL  143
              L E GMS WQ V TV+  N+I  + ++L GH G +YGIP+ VL RS+FG  GA +P +
Sbjct  61   AGLTEQGMSPWQAVFTVLLGNMIVLVPMLLIGHAGAKYGIPYAVLVRSSFGTQGAKLPAM  120

Query  142  LRSLVACGWYGIQTWIGGEAIFIL  71
            LR++VACGWYGIQ+W+GG AI+ L
Sbjct  121  LRAIVACGWYGIQSWLGGSAIYTL  144



>ref|WP_010098710.1| nitrate reductase [Burkholderia ubonensis]
Length=502

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PTT  QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ V TV+  N
Sbjct  19   SLYNDDLAPTTAAQRTWKWYHFAALWVGMVMNIASYMLAAGLTEEGMSPWQAVLTVLLGN  78

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL RS+FG  GA +P LLR++VACGWYGIQTW+GG AI
Sbjct  79   LIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPALLRAIVACGWYGIQTWLGGSAI  138

Query  79   FILL  68
            + LL
Sbjct  139  YTLL  142



>ref|WP_020739459.1| nitrate reductase [Sorangium cellulosum]
 ref|YP_008153945.1| nitrate reductase [Sorangium cellulosum So0157-2]
 gb|AGP39763.1| nitrate reductase [Sorangium cellulosum So0157-2]
Length=489

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +++L PT    RT+     A+LWIG+ V +P++ +A  L++ GMSW Q +A V   N
Sbjct  2    SLTNEDLAPTPEAARTWKLGHFAALWIGMAVCIPTYTMASGLIDQGMSWRQALACVALGN  61

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  L +IL  H GTRYGIPFPV AR++FG++GA++P +LR+LVACGW+GIQTW+GG+A+
Sbjct  62   VIVLLPMILNAHAGTRYGIPFPVFARASFGVTGANVPAVLRALVACGWFGIQTWLGGQAL  121

Query  79   FILL  68
            + LL
Sbjct  122  WQLL  125



>gb|EGD03153.1| NCS1 nucleoside transporter [Burkholderia sp. TJI49]
Length=502

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PTT  QRT+  +  A+LW+G+V+ + S+ LA  L+E GMS WQ V TV+  N
Sbjct  19   SLYNDDLAPTTAAQRTWKWYHFAALWVGMVMNIASYMLAAGLIEEGMSPWQAVLTVLLGN  78

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYGIQTW+GG AI
Sbjct  79   LIVLVPMLLIGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYGIQTWLGGSAI  138

Query  79   FILL  68
            + LL
Sbjct  139  YTLL  142



>ref|WP_030692920.1| nitrate reductase [Streptomyces globisporus]
Length=513

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP   +D+L P    +R ++ +  A+LW+G+   +PS+ LA  LV LGM W Q V T+  
Sbjct  30   DPRFANDDLLPVPVAERRWTTYNFAALWVGMAHNIPSWMLASGLVALGMDWKQAVLTIAL  89

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN++  + ++L GH G +YGIPFPVLAR++FG+ GA++P L+R+ VAC W+GIQTWIGG+
Sbjct  90   ANVVVLVPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALVRAGVACAWFGIQTWIGGQ  149

Query  85   AIFILLPKTI  56
             +F+LL K  
Sbjct  150  GVFVLLDKVF  159



>ref|WP_027762087.1| nitrate reductase [Streptomyces sp. CNS606]
Length=523

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            D    + +L P    +R ++ +  A+LW+G+ V +PS+ LA  L+ LGM W Q V T+  
Sbjct  34   DSRFANADLYPVPVAERRWTTYNFAALWVGMAVNIPSWTLASGLIALGMDWKQAVLTIAL  93

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I  L ++L GH G +YGIPFPVLAR++FG+ GA++P LLR LVAC W+GIQTWIGG+
Sbjct  94   ANVIVLLPMLLTGHAGPKYGIPFPVLARASFGVVGANLPALLRGLVACAWFGIQTWIGGQ  153

Query  85   AIFILLPKTIKDSSF  41
            +IF L  K   + S+
Sbjct  154  SIFFLAGKIFGEGSW  168



>ref|WP_012400927.1| nitrate reductase [Burkholderia phymatum]
 ref|YP_001857761.1| NCS1 nucleoside transporter [Burkholderia phymatum STM815]
 gb|ACC70715.1| NCS1 nucleoside transporter family [Burkholderia phymatum STM815]
Length=503

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ V TV+  N
Sbjct  20   SLYNDDLAPTGPAQRTWKWYHFAALWVGMVMNIASYMLAAGLTEEGMSPWQAVLTVLLGN  79

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL RS+FG  GA +P +LR++VACGWYGIQTW+GG AI
Sbjct  80   MIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPAMLRAIVACGWYGIQTWLGGSAI  139

Query  79   FILL  68
            + LL
Sbjct  140  YTLL  143



>ref|WP_020651513.1| nitrate reductase [Massilia niastensis]
Length=484

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
             L +D+L PT   QRT+  +  A+LW+G+V+ +P++ L+ SL+E GMS WQ V TV  AN
Sbjct  10   DLWNDDLAPTDAAQRTWRWYHFAALWVGMVMCIPAYTLSASLIEAGMSGWQAVFTVFLAN  69

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
             I  + ++L GH GT+YGIP+ VLAR++FG +GA +P L+R++VACGWYGIQTW GG  I
Sbjct  70   AIVLVPMLLIGHAGTKYGIPYAVLARTSFGTTGAKLPALMRAIVACGWYGIQTWFGGSMI  129

Query  79   FILL  68
              LL
Sbjct  130  HTLL  133



>ref|WP_020065408.1| MULTISPECIES: nitrate reductase [Burkholderia]
Length=503

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ V TV+  N
Sbjct  20   SLYNDDLAPTGPAQRTWRWYHFAALWVGMVMNIASYMLAAGLTEEGMSPWQAVLTVLLGN  79

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL RS+FG  GA +P +LR++VACGWYGIQTW+GG AI
Sbjct  80   LIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPAMLRAIVACGWYGIQTWLGGSAI  139

Query  79   FILL  68
            + LL
Sbjct  140  YTLL  143



>ref|WP_035929679.1| nitrate reductase [Burkholderia glathei]
 gb|KDR43558.1| nitrate reductase [Burkholderia glathei]
 emb|CDY75271.1| Possible pyrimidine permease in reductive pathway [Burkholderia 
glathei]
Length=503

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ V TV+  N
Sbjct  20   SLYNDDLAPTGPAQRTWKWYHFAALWVGMVMNIASYMLAAGLTEEGMSPWQAVLTVLLGN  79

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + +++ GH G ++GIP+ VL RS+FG  GA +P +LR++VACGWYGIQTW+GG AI
Sbjct  80   VIVLVPMLMIGHAGAKHGIPYAVLVRSSFGTQGAKLPAMLRAIVACGWYGIQTWLGGSAI  139

Query  79   FILL  68
            + LL
Sbjct  140  YTLL  143



>ref|WP_027799882.1| nitrate reductase [Burkholderia dilworthii]
Length=503

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = -2

Query  472  DDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSW  293
            D          SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L E GMS 
Sbjct  9    DPQFAAGAQGSSLYNDDLAPTGPAQRTWRWYHFAALWVGMVMNIASYMLAAGLTEEGMSP  68

Query  292  WQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWY  113
            WQ V TV+  N+I  + ++L GH G ++GIP+ VL RS+FG  GA +P +LR++VACGWY
Sbjct  69   WQAVLTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPAMLRAIVACGWY  128

Query  112  GIQTWIGGEAIFILL  68
            GIQTW+GG AI+ LL
Sbjct  129  GIQTWLGGSAIYTLL  143



>ref|WP_028368802.1| nitrate reductase [Burkholderia sp. UYPR1.413]
Length=501

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PT P QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ V TV+  N
Sbjct  18   SLYNDDLAPTGPAQRTWKWYHFAALWVGMVMNIASYMLAAGLTEEGMSPWQAVLTVLLGN  77

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL RS+FG  GA +P +LR++VACGWYGIQTW+GG AI
Sbjct  78   MIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPAMLRAIVACGWYGIQTWLGGSAI  137

Query  79   FILL  68
            + LL
Sbjct  138  YTLL  141



>ref|WP_020374427.1| nitrate reductase [Sulfobacillus thermosulfidooxidans]
Length=477

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 95/132 (72%), Gaps = 2/132 (2%)
 Frame = -2

Query  457  QDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVA  278
            Q N D + ++ ++ PTTP QR +S +   SLWIG+   +P++ +AG  + LG++WWQ + 
Sbjct  4    QANDDVTYVNRDIAPTTPEQRQWSLYNYLSLWIGMAHNIPTYLMAGGFIVLGLNWWQAIL  63

Query  277  TVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTW  98
            TV   N+I  + ++L  HPGT+YGIPFPVLAR++FG+ GA IP +LR+LV  GW+GI+T 
Sbjct  64   TVFIGNLIVLIPILLNAHPGTKYGIPFPVLARASFGVIGAGIPAVLRALVGAGWFGIETA  123

Query  97   IGGEAI--FILL  68
            IGG+AI  F+LL
Sbjct  124  IGGQAIQTFLLL  135



>ref|WP_037769652.1| nitrate reductase [Streptomyces sp. FXJ7.023]
Length=509

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 107/167 (64%), Gaps = 5/167 (3%)
 Frame = -2

Query  520  SVAESHSQIIPSGSLDDDPLVQDNPDPS--LISDELKPTTPGQRTYSGWEMASLWIGLVV  347
            ++  S    +P G ++  P    +P PS    +++L P   G+RT++ +  ++LW+G+  
Sbjct  8    AIPPSAQVTLPDGRVELAP---GSPPPSGRYANEDLLPVPVGKRTWTTYNFSALWVGMAH  64

Query  346  GVPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGI  167
               S+ LA  L+ +GM W Q V T+  AN+I  + ++L GH G RYGIPFPV AR++FG+
Sbjct  65   NTASWTLASGLIAVGMDWKQAVLTIALANLIVLVPMLLTGHAGPRYGIPFPVFARASFGV  124

Query  166  SGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDSSFSPACF  26
             GA++P ++R+LVACGW+GIQTWIGGEAI+ L  K I D   + A F
Sbjct  125  RGANLPAVVRALVACGWFGIQTWIGGEAIYFLAGKLIGDGWTNAAPF  171



>ref|WP_005309616.1| nitrate reductase [Streptomyces pristinaespiralis]
 gb|EDY65760.1| allantoin permease [Streptomyces pristinaespiralis ATCC 25486]
Length=513

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            D   ++D+L P    +R ++ +  A+LW+G+   +PS+ LA  LV LGM W Q V T+  
Sbjct  31   DNRFVNDDLLPVPVARRRWTTYNFAALWVGMAHNIPSWLLASGLVALGMDWKQAVFTIAL  90

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I  L ++L GH G +YGIPFPVLAR++FG+ GA++P ++R+ VAC W+GIQTWIGG+
Sbjct  91   ANVIVLLPMLLTGHAGPKYGIPFPVLARASFGLRGANLPAMIRAAVACAWFGIQTWIGGQ  150

Query  85   AIFILLPK  62
             IF+LL K
Sbjct  151  GIFVLLGK  158



>ref|WP_035615462.1| nitrate reductase [Haloferula sp. BvORR071]
Length=490

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 87/126 (69%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            D +L +++L P  P +RT++ W  A+LWI +   +P++ LA  LVE GM+WWQ V TV  
Sbjct  7    DANLTNEDLAPVPPEKRTWTMWNFAALWISMAACIPTYMLASGLVEKGMNWWQAVLTVFL  66

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
             N I  + +IL  H G  YGIPFPV  R++FG  GA++P +LR+LVACGW+GIQ WIGG+
Sbjct  67   GNAIVLVPMILNAHAGAAYGIPFPVFCRASFGTLGANVPAVLRALVACGWFGIQAWIGGD  126

Query  85   AIFILL  68
            AI  +L
Sbjct  127  AIHQIL  132



>dbj|GAK32569.1| putative allantoin permease [alpha proteobacterium Q-1]
Length=513

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (63%), Gaps = 11/151 (7%)
 Frame = -2

Query  520  SVAESHSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGV  341
              A SH Q    G            D +L + +L PT   +RT+     ASLW+ +VV V
Sbjct  18   DAAHSHDQANDQGH-----------DQALWNADLAPTPLSERTWDWKAFASLWVAMVVCV  66

Query  340  PSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISG  161
            P++ L+GSLV  GM+WWQ V TV   N+I  + ++L GH G ++G+PFPVL RS+FG  G
Sbjct  67   PAYLLSGSLVSEGMNWWQAVLTVFLGNLIVLIPMMLVGHAGAKHGVPFPVLLRSSFGTVG  126

Query  160  AHIPTLLRSLVACGWYGIQTWIGGEAIFILL  68
            A +P LLR LVACGW+GI TW+GG AI+++L
Sbjct  127  ARLPALLRGLVACGWFGINTWVGGSAIYVIL  157



>ref|WP_006379653.1| NCS1 nucleoside transporter family protein [Streptomyces turgidiscabies]
 gb|ELP65300.1| NCS1 nucleoside transporter family protein [Streptomyces turgidiscabies 
Car8]
Length=514

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = -2

Query  523  PSVAESHSQI-IPSGSLDDDPLVQDNPDPS--LISDELKPTTPGQRTYSGWEMASLWIGL  353
            P+     SQ+ +P G ++  P   D P PS    +++L P    +RT++ +  ++LW+G+
Sbjct  6    PTAIPLSSQLTLPDGRVEISP---DAPVPSGPYANEDLLPVPVEKRTWNTYNFSALWVGM  62

Query  352  VVGVPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAF  173
                 S+ LA  L+ +GM W Q V T+  AN+I  + ++L GH G +YGIPFPV AR++F
Sbjct  63   AHNTASWTLASGLIAVGMDWKQAVLTIALANVIVLVPMLLTGHAGPKYGIPFPVFARASF  122

Query  172  GISGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDS  47
            G+ GA++P ++R+LVACGW+GIQTWIGGEAI+ L  K I DS
Sbjct  123  GVRGANLPAVVRALVACGWFGIQTWIGGEAIYFLAGKLIGDS  164



>ref|WP_014265872.1| nitrate reductase [Granulicella mallensis]
 ref|YP_005058024.1| NCS1 nucleoside transporter family [Granulicella mallensis MP5ACTX8]
 gb|AEU36994.1| NCS1 nucleoside transporter family [Granulicella mallensis MP5ACTX8]
Length=490

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 102/159 (64%), Gaps = 5/159 (3%)
 Frame = -2

Query  478  LDDDPL-VQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELG  302
            LD D +  +  PDP L + +L PT P QRT+S +   +LW  + + V ++ LA SL+  G
Sbjct  10   LDSDQMGAEFAPDPRLYNADLAPTEPSQRTWSTYNYIALWFSMSMEVTTYMLAASLIAGG  69

Query  301  MSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVAC  122
            M+W Q V T++  N+I  + ++L  H G +YGIPFPV  R++FG  GA+IP +LR++VAC
Sbjct  70   MNWKQAVGTILLGNLIVLIPMLLNAHAGAKYGIPFPVFVRASFGPVGANIPAMLRAIVAC  129

Query  121  GWYGIQTWIGGEAI----FILLPKTIKDSSFSPACFLAW  17
            GW+GIQ+WIGG+AI     +L P+     S +  CFL +
Sbjct  130  GWFGIQSWIGGQAIAAMVVVLWPRAEHMPSVTWLCFLGF  168



>ref|WP_026178932.1| nitrate reductase [Streptomyces sp. R1-NS-10]
Length=520

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = -2

Query  523  PSVAESHSQI-IPSGSLDDDPLVQDNPDPS--LISDELKPTTPGQRTYSGWEMASLWIGL  353
            P+  E  +Q+ +  G ++  P    +P PS    +D+L P    +RT++ +  ++LW+G+
Sbjct  11   PTAIEPTAQVTLADGRVEIAP---GSPQPSGPYANDDLLPVPVEKRTWTTYNFSALWVGM  67

Query  352  VVGVPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAF  173
                 S+ LA  L+ +GM W Q V T+  AN+I  + ++L GH G +YGIPFPV AR++F
Sbjct  68   AHNTASWTLASGLIAVGMDWKQAVFTIALANLIVLVPMLLTGHAGPKYGIPFPVFARASF  127

Query  172  GISGAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPKTIKDS  47
            G+ GA++P ++R+LVACGW+GIQTWIGGEAIF L  K I DS
Sbjct  128  GVRGANLPAVVRALVACGWFGIQTWIGGEAIFFLAGKLIGDS  169



>ref|WP_014216769.1| nitrate reductase [Niastella koreensis]
 ref|YP_005006259.1| NCS1 nucleoside transporter family [Niastella koreensis GR20-10]
 gb|AEV96855.1| NCS1 nucleoside transporter family [Niastella koreensis GR20-10]
Length=506

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 99/154 (64%), Gaps = 11/154 (7%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            + SL S++L P     R ++ W  A+LWI + + +P++ LA SL+  GM+WWQ + T+  
Sbjct  15   NESLYSEDLAPVPVTNRKWNTWNYAALWISMSLCIPTYMLASSLIGGGMNWWQAILTIFL  74

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
             N I  + +IL GH G +YGIPFPV AR++FG+ GA+IP +LR++VACGW+GIQTWIGG 
Sbjct  75   GNTIVLVPMILNGHAGAKYGIPFPVFARASFGVRGANIPAILRAIVACGWFGIQTWIGGA  134

Query  85   AIFIL-------LPKTIKDSSFSPA----CFLAW  17
            AI+ +       +P+    S F  A    CFL +
Sbjct  135  AIYQMIRVWNPTMPEIDATSLFPQAIPFICFLGF  168



>ref|WP_023559909.1| nitrate reductase [Alteromonas macleodii]
 ref|YP_008549985.1| nitrate reductase [Alteromonas macleodii str. 'Deep ecotype']
 gb|AGV54102.1| nitrate reductase [Alteromonas macleodii str. 'Deep ecotype']
Length=499

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 97/144 (67%), Gaps = 1/144 (1%)
 Frame = -2

Query  475  DDDPLVQ-DNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGM  299
            ++ P+ +  + D  L +++L PT+   RT+   + A+LW+ +VV VP++ L+  LV  GM
Sbjct  5    NNQPMTKPSHYDGDLWNEDLAPTSKATRTWGWKDYAALWVAMVVCVPTYLLSAGLVSEGM  64

Query  298  SWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACG  119
            +W+Q V TV+  NII  + ++L GH G +YG+PFPVL RSAFG  GA IP L R LVACG
Sbjct  65   NWYQAVITVLLGNIIVLVPMMLIGHAGAKYGLPFPVLLRSAFGTKGAKIPALARGLVACG  124

Query  118  WYGIQTWIGGEAIFILLPKTIKDS  47
            W+GI TW+GG AI+++L     D+
Sbjct  125  WFGINTWVGGSAIYVILNSISGDA  148



>ref|WP_028219055.1| nitrate reductase [Burkholderia oxyphila]
Length=505

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 95/144 (66%), Gaps = 1/144 (1%)
 Frame = -2

Query  502  SQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLA  323
            SQ   SG +D D   + +    L +D+L PT   QRT+  +   +LW+G+V+ + S+ LA
Sbjct  2    SQPAASGGVDSDASARRSAS-ELYNDDLAPTGAAQRTWRWYHFGALWVGMVMNIASYMLA  60

Query  322  GSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTL  143
              L E GMS WQ V TV+  N+I  + ++L GH G +YGIP+ VL RS+FG  GA +P +
Sbjct  61   AGLTEQGMSPWQAVLTVLLGNMIVLVPMLLIGHAGAKYGIPYAVLVRSSFGTQGAKLPAM  120

Query  142  LRSLVACGWYGIQTWIGGEAIFIL  71
            LR++VACGWYGIQ+W+GG AI+ L
Sbjct  121  LRAIVACGWYGIQSWLGGSAIYTL  144



>ref|WP_008445576.1| NCS1 nucleoside transporter family protein [Janthinobacterium 
sp. HH01]
 gb|ELX12830.1| NCS1 nucleoside transporter family protein [Janthinobacterium 
sp. HH01]
Length=493

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = -2

Query  430  SDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAANIIT  251
            +++L PT+  QRT+  +  A+LW+G+V+ +P++ L+ SL+E GMS +Q V TV  AN I 
Sbjct  13   NEDLAPTSAAQRTWRWYHFAALWVGMVMCIPAYTLSASLIEGGMSGYQAVLTVFLANAIV  72

Query  250  SLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAIFIL  71
             L ++L GH GT+YGIP+ VLARS+FG +GA +P L+R++VACGWYGIQTW GG+ I+ L
Sbjct  73   LLPMLLIGHAGTKYGIPYAVLARSSFGTAGARLPALMRAVVACGWYGIQTWFGGQMIYTL  132

Query  70   L  68
            L
Sbjct  133  L  133



>ref|WP_037621536.1| nitrate reductase [Streptomyces aureus]
Length=507

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            D   ++D+L P    +RT+  +   SLW+G+   +PS+ LA  LV LGM W Q V T+  
Sbjct  33   DSRFVNDDLAPVPIERRTWGVYNYLSLWVGMAHNIPSWTLASGLVALGMDWKQAVLTIAL  92

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I  + ++L GH GT+YGIPFPV AR++FG+ GA++P ++R++VAC W+GIQTWIGGE
Sbjct  93   ANVIVLVPMVLTGHAGTKYGIPFPVFARASFGLRGANLPAMVRAVVACAWFGIQTWIGGE  152

Query  85   AIFILLPKTI  56
             IF+L  K +
Sbjct  153  GIFLLAGKLL  162



>ref|WP_024016987.1| cytosine/purines uracil thiamine allantoin permease [Alteromonas 
macleodii]
 ref|YP_008920062.1| cytosine/purines uracil thiamine allantoin permease [Alteromonas 
macleodii str. 'Aegean Sea MED64']
 gb|AGP83172.1| cytosine/purines uracil thiamine allantoin permease [Alteromonas 
macleodii str. 'Aegean Sea MED64']
Length=499

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 97/144 (67%), Gaps = 1/144 (1%)
 Frame = -2

Query  475  DDDPLVQ-DNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGM  299
            ++ P+ +  + D  L +++L PT+   RT+   + A+LW+ +VV VP++ L+  LV  GM
Sbjct  5    NNQPMTKPSHYDGDLWNEDLAPTSKATRTWGWKDYAALWVAMVVCVPTYLLSAGLVSEGM  64

Query  298  SWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACG  119
            +W+Q V TV+  N+I  + ++L GH G +YG+PFPVL RSAFG  GA IP L R LVACG
Sbjct  65   NWYQAVITVLLGNVIVLVPMMLIGHAGAKYGLPFPVLLRSAFGTKGAKIPALARGLVACG  124

Query  118  WYGIQTWIGGEAIFILLPKTIKDS  47
            W+GI TW+GG AI+++L     D+
Sbjct  125  WFGINTWVGGSAIYVILNSVSGDA  148



>ref|WP_020746626.1| cytosine/purines uracil thiamine allantoin permease [Alteromonas 
macleodii]
 ref|YP_008193847.1| cytosine/purines uracil thiamine allantoin permease [Alteromonas 
macleodii str. 'English Channel 615']
 gb|AGP79197.1| cytosine/purines uracil thiamine allantoin permease [Alteromonas 
macleodii str. 'English Channel 615']
Length=499

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = -2

Query  475  DDDPLVQ-DNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGM  299
            ++ P+ +  + D  L +++L PT    RT+   + A+LW+ +VV VP++ L+  LV  GM
Sbjct  5    NNQPMTKPSHYDGDLWNEDLAPTNKATRTWGWKDYAALWVAMVVCVPTYLLSAGLVSEGM  64

Query  298  SWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACG  119
            +W+Q V TV+  N+I  + ++L GH G +YG+PFPVL RSAFG  GA IP L R LVACG
Sbjct  65   NWYQAVITVLLGNVIVLVPMMLIGHAGAKYGLPFPVLLRSAFGTKGAKIPALARGLVACG  124

Query  118  WYGIQTWIGGEAIFILLPKTIKDS  47
            W+GI TW+GG AI+++L     D+
Sbjct  125  WFGINTWVGGSAIYVILNSVSGDA  148



>ref|WP_012372088.1| nitrate reductase [Burkholderia ambifaria]
 ref|YP_001815715.1| NCS1 nucleoside transporter [Burkholderia ambifaria MC40-6]
 gb|ACB68162.1| NCS1 nucleoside transporter family [Burkholderia ambifaria MC40-6]
Length=502

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PTT  QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS WQ V TV+  N
Sbjct  19   SLYNDDLAPTTAAQRTWRWYHFAALWVGMVMNIASYMLAAGLIQEGMSPWQAVLTVLLGN  78

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYGIQTW+GG AI
Sbjct  79   LIVLVPMLLVGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYGIQTWLGGSAI  138

Query  79   FILL  68
            + LL
Sbjct  139  YTLL  142



>ref|WP_006760705.1| nitrate reductase [Burkholderia ambifaria]
 gb|EDT39318.1| NCS1 nucleoside transporter family [Burkholderia ambifaria MEX-5]
Length=502

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PTT  QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS WQ V TV+  N
Sbjct  19   SLYNDDLAPTTQAQRTWRWYHFAALWVGMVMNIASYMLAAGLIQEGMSPWQAVLTVLLGN  78

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYGIQTW+GG AI
Sbjct  79   LIVLVPMLLVGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYGIQTWLGGSAI  138

Query  79   FILL  68
            + LL
Sbjct  139  YTLL  142



>ref|WP_006753680.1| nitrate reductase [Burkholderia ambifaria]
 gb|EDT01947.1| NCS1 nucleoside transporter family [Burkholderia ambifaria IOP40-10]
Length=502

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PTT  QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS WQ V TV+  N
Sbjct  19   SLYNDDLAPTTAAQRTWRWYHFAALWVGMVMNIASYMLAAGLIQEGMSPWQAVLTVLLGN  78

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYGIQTW+GG AI
Sbjct  79   LIVLVPMLLVGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYGIQTWLGGSAI  138

Query  79   FILL  68
            + LL
Sbjct  139  YTLL  142



>ref|WP_035842580.1| nitrate reductase, partial [Kitasatospora azatica]
Length=495

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP   +++L P   G+R ++ +   +LW+G+   +PS+ LA  LV LGM W Q V T+  
Sbjct  30   DPRFTNEDLVPVPVGRRRWTTYNFLALWVGMAHNIPSWTLASGLVALGMDWKQAVLTIAL  89

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I  + ++L GH GT+YGIPFPV AR+AFG+ GA++P L+R+ VAC W+GIQ+WIGGE
Sbjct  90   ANVIVLVPMLLTGHAGTKYGIPFPVFARAAFGLRGANLPALIRAAVACAWFGIQSWIGGE  149

Query  85   AIFILLPKTI  56
             IF+L  K +
Sbjct  150  GIFLLAGKLL  159



>ref|WP_032787170.1| nitrate reductase [Streptomyces sp. JS01]
 gb|KFK87171.1| nitrate reductase [Streptomyces sp. JS01]
Length=515

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP   +D+L P    +RT++ +  A+LWIG+   +PS+ LA  LV LGM W Q V T+  
Sbjct  35   DPRFANDDLLPVPVERRTWTTYNFAALWIGMAHNIPSWLLASGLVALGMDWKQAVFTIAL  94

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I    ++L GH G +YGIPFPVLAR++FG+ GA++P L+R+ VAC W+GIQTWIGG 
Sbjct  95   ANVIVLAPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALIRAAVACAWFGIQTWIGGV  154

Query  85   AIFILLPK  62
             IF LL K
Sbjct  155  GIFTLLGK  162



>ref|WP_013589008.1| nitrate reductase [Burkholderia sp. CCGE1001]
 ref|YP_004228860.1| NCS1 nucleoside transporter family [Burkholderia sp. CCGE1001]
 gb|ADX55800.1| NCS1 nucleoside transporter family [Burkholderia sp. CCGE1001]
Length=503

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PT+  QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ V TV+  N
Sbjct  20   SLYNDDLAPTSTAQRTWRWYHFAALWVGMVMNIASYMLAAGLTEQGMSPWQAVLTVLLGN  79

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL RS+FG  GA +P +LR++VACGWYGIQTW+GG AI
Sbjct  80   VIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPAMLRAIVACGWYGIQTWLGGSAI  139

Query  79   FILL  68
            + LL
Sbjct  140  YTLL  143



>ref|WP_011660850.1| nitrate reductase [Burkholderia ambifaria]
 ref|YP_777842.1| NCS1 nucleoside transporter [Burkholderia ambifaria AMMD]
 gb|ABI91508.1| NCS1 nucleoside transporter family [Burkholderia ambifaria AMMD]
Length=502

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PTT  QRT+  +  A+LW+G+V+ + S+ LA  L++ GMS WQ V TV+  N
Sbjct  19   SLYNDDLAPTTAAQRTWRWYHFAALWVGMVMNIASYMLAAGLIQEGMSPWQAVLTVLLGN  78

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL R++FG  GA +P LLR++VACGWYGIQTW+GG AI
Sbjct  79   LIVLVPMLLVGHAGAKHGIPYAVLVRASFGTQGAKLPALLRAIVACGWYGIQTWLGGSAI  138

Query  79   FILL  68
            + LL
Sbjct  139  YTLL  142



>ref|WP_010395100.1| nitrate reductase [Janthinobacterium lividum]
Length=494

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            +  L +++L PTT  QRT+  +  A+LW+G+V+ +P++ L+ SL++ GMS +Q V TV  
Sbjct  8    NTQLWNEDLAPTTAAQRTWRWYHFAALWVGMVMCIPAYTLSASLIDSGMSGYQAVLTVFL  67

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  L ++L GH GT+YGIP+ VLAR++FG  GA +P L+R++VACGWYGIQTW GG+
Sbjct  68   ANAIVLLPMLLIGHAGTKYGIPYAVLARASFGTMGARLPALMRAIVACGWYGIQTWFGGQ  127

Query  85   AIFILL  68
             I+ L+
Sbjct  128  MIYTLM  133



>ref|WP_034782401.1| nitrate reductase [Janthinobacterium lividum]
 gb|KHA78751.1| nitrate reductase [Janthinobacterium lividum]
Length=494

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            +  L +++L PTT  QRT+  +  A+LW+G+V+ +P++ L+ SL++ GMS +Q V TV  
Sbjct  8    NTQLWNEDLAPTTAAQRTWRWYHFAALWVGMVMCIPAYTLSASLIDSGMSGYQAVLTVFL  67

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  L ++L GH GT+YGIP+ VLAR++FG  GA +P L+R++VACGWYGIQTW GG+
Sbjct  68   ANAIVLLPMLLIGHAGTKYGIPYAVLARASFGTMGARLPALMRAIVACGWYGIQTWFGGQ  127

Query  85   AIFILL  68
             I+ L+
Sbjct  128  MIYTLM  133



>ref|WP_035825024.1| nitrate reductase [Janthinobacterium sp. RA13]
Length=494

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            +  L +++L PTT  QRT+  +  A+LW+G+V+ +P++ L+ SL++ GMS +Q V TV  
Sbjct  8    NTQLWNEDLAPTTAAQRTWRWYHFAALWVGMVMCIPAYTLSASLIDSGMSGYQAVLTVFL  67

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  L ++L GH GT+YGIP+ VLAR++FG  GA +P L+R++VACGWYGIQTW GG+
Sbjct  68   ANAIVLLPMLLIGHAGTKYGIPYAVLARASFGTMGARLPALMRAIVACGWYGIQTWFGGQ  127

Query  85   AIFILL  68
             I+ L+
Sbjct  128  MIYTLM  133



>ref|WP_034754573.1| nitrate reductase [Janthinobacterium lividum]
 gb|EZP37458.1| NCS1 nucleoside transporter family protein [Janthinobacterium 
lividum]
Length=494

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            +  L +++L PTT  QRT+  +  A+LW+G+V+ +P++ L+ SL++ GMS +Q V TV  
Sbjct  8    NTQLWNEDLAPTTAAQRTWRWYHFAALWVGMVMCIPAYTLSASLIDSGMSGYQAVLTVFL  67

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN I  L ++L GH GT+YGIP+ VLAR++FG  GA +P L+R++VACGWYGIQTW GG+
Sbjct  68   ANAIVLLPMLLIGHAGTKYGIPYAVLARASFGTMGARLPALMRAIVACGWYGIQTWFGGQ  127

Query  85   AIFILL  68
             I+ L+
Sbjct  128  MIYTLM  133



>ref|WP_030722701.1| nitrate reductase [Streptomyces griseus]
Length=515

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP   +D+L P    +RT++ +  A+LWIG+   +PS+ LA  LV LGM W Q V T+  
Sbjct  35   DPRFANDDLLPVPVERRTWTTYNFAALWIGMAHNIPSWLLASGLVALGMDWKQAVFTIAL  94

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I    ++L GH G +YGIPFPVLAR++FG+ GA++P L+R+ VAC W+GIQTWIGG 
Sbjct  95   ANVIVLAPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALIRAAVACAWFGIQTWIGGV  154

Query  85   AIFILLPK  62
             IF LL K
Sbjct  155  GIFTLLGK  162



>ref|WP_028812947.1| nitrate reductase [Streptomyces flavidovirens]
Length=519

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            D   ++D+L P    +R ++ +  A+LW+G+   +PS+ LA  LV LGM W Q V T+  
Sbjct  32   DSRFVNDDLLPVPVERRRWTTYNFAALWVGMAHNIPSWMLASGLVALGMDWKQAVLTIAL  91

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I  L ++L GH G +YGIPFPVLAR++FG+ GA++P L+R+ VAC W+GIQTWIGG+
Sbjct  92   ANVIVLLPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALIRAGVACAWFGIQTWIGGQ  151

Query  85   AIFILLPK  62
             IF+LL K
Sbjct  152  GIFVLLGK  159



>ref|WP_027770376.1| nitrate reductase [Streptomyces sp. CNQ329]
Length=521

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 97/154 (63%), Gaps = 9/154 (6%)
 Frame = -2

Query  523  PSVAESHSQIIPSGSLDDDPLVQDNPDPSLISDELKPTTPGQRTYSGWEMASLWIGLVVG  344
            P  A+   ++ PS          D       + +L P    +RT++ +  A+LWIG+ V 
Sbjct  12   PEPADGRVELAPS---------DDLAGSRYANGDLLPVPAARRTWTTYNFAALWIGMAVN  62

Query  343  VPSFYLAGSLVELGMSWWQGVATVVAANIITSLTLILAGHPGTRYGIPFPVLARSAFGIS  164
            VP++ LA  L+ LGM W Q V T+  AN+I  L ++L GH G +YGIPFPVLARS+FG+ 
Sbjct  63   VPTWTLAAGLIALGMDWKQAVLTIALANVIVLLPMLLTGHAGPKYGIPFPVLARSSFGVV  122

Query  163  GAHIPTLLRSLVACGWYGIQTWIGGEAIFILLPK  62
            GA++P LLR +VAC W+GIQTWIGG+AI+ L  K
Sbjct  123  GANLPALLRGVVACAWFGIQTWIGGQAIYFLAGK  156



>ref|WP_006128646.1| MULTISPECIES: nitrate reductase [Streptomyces]
 gb|EFE78665.1| integral membrane transporter [Streptomyces roseosporus NRRL 
15998]
 gb|ESU46756.1| putative cytosine/purines/uracil/thiamine/ allantoin permease 
family protein [Streptomyces sp. HCCB10043]
 gb|EWS95531.1| allantoin permease [Streptomyces roseosporus NRRL 11379]
Length=515

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP   +D+L P    +RT++ +  A+LWIG+   +PS+ LA  LV LGM W Q V T+  
Sbjct  35   DPRFTNDDLLPVPVERRTWTTYNFAALWIGMAHNIPSWLLASGLVALGMDWKQAVFTIAL  94

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I    ++L GH G +YGIPFPVLAR++FG+ GA++P L+R+ VAC W+GIQTWIGG 
Sbjct  95   ANVIVLAPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALIRAAVACAWFGIQTWIGGV  154

Query  85   AIFILLPK  62
             IF LL K
Sbjct  155  GIFTLLGK  162



>ref|WP_015003268.1| nitrate reductase [Burkholderia phenoliruptrix]
 ref|YP_006834718.1| nucleobase:cation symporter-1, NCS1 family [Burkholderia phenoliruptrix 
BR3459a]
 gb|AFT86536.1| nucleobase:cation symporter-1, NCS1 family [Burkholderia phenoliruptrix 
BR3459a]
Length=503

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  439  SLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVAAN  260
            SL +D+L PT+  QRT+  +  A+LW+G+V+ + S+ LA  L E GMS WQ V TV+  N
Sbjct  20   SLYNDDLAPTSTAQRTWRWYHFAALWVGMVMNIASYMLAAGLTEQGMSPWQAVLTVLLGN  79

Query  259  IITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGEAI  80
            +I  + ++L GH G ++GIP+ VL RS+FG  GA +P +LR++VACGWYGIQTW+GG AI
Sbjct  80   VIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPAMLRAIVACGWYGIQTWLGGSAI  139

Query  79   FILL  68
            + LL
Sbjct  140  YTLL  143



>ref|WP_030585433.1| nitrate reductase [Streptomyces globisporus]
Length=512

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  445  DPSLISDELKPTTPGQRTYSGWEMASLWIGLVVGVPSFYLAGSLVELGMSWWQGVATVVA  266
            DP   +D+L P    +RT++ +  A+LWIG+   +PS+ LA  LV LGM W Q V T+  
Sbjct  35   DPRFANDDLLPVPVERRTWTTYNFAALWIGMAHNIPSWLLASGLVALGMDWKQAVFTIAL  94

Query  265  ANIITSLTLILAGHPGTRYGIPFPVLARSAFGISGAHIPTLLRSLVACGWYGIQTWIGGE  86
            AN+I    ++L GH G +YGIPFPVLAR++FG+ GA++P L+R+ VAC W+GIQTWIGG 
Sbjct  95   ANVIVLAPMLLTGHAGPKYGIPFPVLARASFGLRGANLPALIRAAVACAWFGIQTWIGGV  154

Query  85   AIFILLPK  62
             IF LL K
Sbjct  155  GIFTLLGK  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 546044595962