BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c92441_g1_i1 len=742 path=[1:0-741]

Length=742
                                                                      Score     E

ref|XP_009622632.1|  PREDICTED: uncharacterized protein LOC104114001  52.4    2e-05   
gb|EYU46627.1|  hypothetical protein MIMGU_mgv1a015057mg              52.8    3e-05   
ref|XP_009787257.1|  PREDICTED: uncharacterized protein LOC104235234  51.6    4e-05   



>ref|XP_009622632.1| PREDICTED: uncharacterized protein LOC104114001 [Nicotiana tomentosiformis]
Length=136

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = +2

Query  458  FSDYITRVRARISRSLTHAggggegggNERKATAVRRDSFNDKVSNYIHRARLSIRATSN  637
            FS YI RV+ ++  + T  G        E +  A RRDSFND++S+YI+RA+L IR T+ 
Sbjct  69   FSGYIDRVKNKMRTTTTSVGSDT-----EIRRAATRRDSFNDRISHYINRAKLKIRTTTM  123

Query  638  VGEG  649
            VG G
Sbjct  124  VGRG  127



>gb|EYU46627.1| hypothetical protein MIMGU_mgv1a015057mg [Erythranthe guttata]
Length=169

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 76/167 (46%), Gaps = 31/167 (19%)
 Frame = +2

Query  185  MAKNQSSS--EGGVCARLYRAVNCGGSAFKSHrrgspppprssaappEIPVVFNHGQVD-  355
            MAK Q+SS    GVC ++YRAV+   +  +S +               IPV F H     
Sbjct  1    MAKKQNSSTTSEGVCKKIYRAVSI--NPIRSTKPPHIIDHHPILITETIPVNFEHSSSSS  58

Query  356  ----TAAAAAKN-----RPPVKEKRVS--------laldedhhhhhhheahFSDYITRVR  484
                +A   AKN      P    K V+            +       ++  FSDYITRV+
Sbjct  59   PTNVSAHNKAKNVTFFSSPNFATKEVAILGGDHNKHDQVKKTERTKANDDKFSDYITRVK  118

Query  485  ARISRSLTHAggggegggNERKATAVRRDSFNDKVSNYIHRARLSIR  625
             ++  S ++ GG         + +A RRDSFNDKVS+YI+RA+  IR
Sbjct  119  DKMKSSASNVGG---------RKSATRRDSFNDKVSSYINRAKFKIR  156



>ref|XP_009787257.1| PREDICTED: uncharacterized protein LOC104235234 [Nicotiana sylvestris]
Length=133

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 5/64 (8%)
 Frame = +2

Query  458  FSDYITRVRARISRSLTHAggggegggNERKATAVRRDSFNDKVSNYIHRARLSIRATSN  637
            FS YI RV+ ++ R+ T + G       E +  A RRDSFND++S+YI+RA+L IR T+ 
Sbjct  69   FSGYIDRVKNKM-RTTTSSVGNET----EIRKVATRRDSFNDRISHYINRAKLKIRTTTI  123

Query  638  VGEG  649
            VG G
Sbjct  124  VGRG  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1259863733868