BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9228_g2_i1 len=922 path=[900:0-921]

Length=922
                                                                      Score     E

ref|XP_004235874.1|  PREDICTED: ABC transporter I family member 17      369   2e-124   
ref|XP_009609209.1|  PREDICTED: ABC transporter I family member 17      368   3e-124   
ref|XP_006341433.1|  PREDICTED: ABC transporter I family member 1...    367   5e-124   
ref|XP_011073244.1|  PREDICTED: ABC transporter I family member 1...    363   2e-122   
emb|CDO98264.1|  unnamed protein product                                363   9e-122   
ref|XP_009788357.1|  PREDICTED: ABC transporter I family member 17      362   1e-121   
ref|XP_006366268.1|  PREDICTED: ABC transporter I family member 1...    360   1e-120   
ref|XP_010322648.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    357   2e-119   
ref|XP_011082719.1|  PREDICTED: ABC transporter I family member 1...    355   4e-119   
ref|XP_007010833.1|  Non-intrinsic ABC protein 3                        355   6e-119   
ref|XP_010265390.1|  PREDICTED: ABC transporter I family member 1...    353   2e-118   
gb|EPS72839.1|  hypothetical protein M569_01919                         350   3e-117   
gb|AIU41664.1|  ABC transporter family protein                          348   3e-116   
gb|EYU21787.1|  hypothetical protein MIMGU_mgv1a012074mg                347   4e-116   
gb|KDO61984.1|  hypothetical protein CISIN_1g022337mg                   346   5e-115   
ref|XP_006453206.1|  hypothetical protein CICLE_v10009186mg             344   9e-115   
ref|XP_010110724.1|  ABC transporter I family member 17                 344   1e-114   
gb|KDP35911.1|  hypothetical protein JCGZ_09883                         343   2e-114   
ref|XP_002325227.2|  hypothetical protein POPTR_0018s13190g             343   4e-114   Populus trichocarpa [western balsam poplar]
ref|XP_010556228.1|  PREDICTED: ABC transporter I family member 17      341   1e-113   
ref|XP_002522043.1|  phosphate abc transporter, putative                340   8e-113   Ricinus communis
gb|KHG02984.1|  ABC transporter I family member 17                      340   8e-113   
ref|XP_007160546.1|  hypothetical protein PHAVU_002G330700g             338   2e-112   
ref|XP_009346033.1|  PREDICTED: ABC transporter I family member 1...    338   2e-112   
gb|KFK41217.1|  hypothetical protein AALP_AA2G100800                    337   8e-112   
ref|XP_009349086.1|  PREDICTED: ABC transporter I family member 1...    337   9e-112   
ref|XP_011017753.1|  PREDICTED: ABC transporter I family member 17      336   1e-111   
ref|XP_007224441.1|  hypothetical protein PRUPE_ppa022227mg             335   2e-111   
ref|XP_010033774.1|  PREDICTED: ABC transporter I family member 17      335   4e-111   
emb|CDX96058.1|  BnaA07g26730D                                          335   5e-111   
ref|XP_009105344.1|  PREDICTED: ABC transporter I family member 17      334   7e-111   
ref|XP_009359982.1|  PREDICTED: ABC transporter I family member 1...    334   8e-111   
ref|XP_010415418.1|  PREDICTED: ABC transporter I family member 1...    333   1e-110   
ref|XP_010511791.1|  PREDICTED: ABC transporter I family member 17      333   2e-110   
ref|XP_008378893.1|  PREDICTED: ABC transporter I family member 1...    333   3e-110   
ref|XP_010675422.1|  PREDICTED: ABC transporter I family member 17      333   4e-110   
ref|XP_008382727.1|  PREDICTED: ABC transporter I family member 1...    335   4e-110   
ref|XP_006845711.1|  hypothetical protein AMTR_s00019p00241340          332   6e-110   
emb|CDY01873.1|  BnaC06g29130D                                          331   9e-110   
ref|NP_176961.1|  ABC transporter I family member 17                    331   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888648.1|  ATNAP3                                             330   2e-109   
ref|XP_006391200.1|  hypothetical protein EUTSA_v10019008mg             330   3e-109   
ref|NP_001152673.1|  phosphate import ATP-binding protein pstB 1        330   4e-109   Zea mays [maize]
ref|XP_006584910.1|  PREDICTED: ABC transporter I family member 17      329   5e-109   
ref|XP_008223828.1|  PREDICTED: ABC transporter I family member 17      333   5e-109   
gb|AFW69271.1|  phosphate import ATP-binding protein pstB 1             329   9e-109   
emb|CAN70271.1|  hypothetical protein VITISV_010974                     328   1e-108   Vitis vinifera
ref|XP_002266816.1|  PREDICTED: ABC transporter I family member 17      328   1e-108   Vitis vinifera
ref|XP_004299789.1|  PREDICTED: ABC transporter I family member 1...    328   2e-108   
ref|XP_006302704.1|  hypothetical protein CARUB_v10020815mg             326   1e-107   
dbj|BAD53904.1|  putative multidrug resistance protein                  324   1e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004503265.1|  PREDICTED: ABC transporter I family member 1...    323   2e-106   
gb|EPS58585.1|  hypothetical protein M569_16228                         323   2e-106   
ref|XP_003631128.1|  ABC transporter I family member                    322   2e-106   
dbj|BAA76420.1|  multidrug resistance protein                           322   2e-106   Cicer arietinum [garbanzo]
ref|NP_001058453.1|  Os06g0695800                                       324   1e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009410211.1|  PREDICTED: protein STAR1                           320   4e-105   
ref|XP_006657287.1|  PREDICTED: LOW QUALITY PROTEIN: protein STAR...    322   2e-104   
ref|XP_002438933.1|  hypothetical protein SORBIDRAFT_10g028530          318   2e-104   Sorghum bicolor [broomcorn]
gb|AGL45585.1|  sensitive to aluminum rhizotoxicity 1 protein           317   3e-104   
ref|XP_004967253.1|  PREDICTED: protein STAR1-like                      317   1e-103   
ref|XP_004150743.1|  PREDICTED: ABC transporter I family member 1...    316   1e-103   
ref|XP_008453537.1|  PREDICTED: ABC transporter I family member 17      314   5e-103   
dbj|BAJ97887.1|  predicted protein                                      310   3e-101   
ref|XP_003563480.1|  PREDICTED: protein STAR1                           309   4e-101   
gb|EEE66281.1|  hypothetical protein OsJ_22488                          310   4e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004966143.1|  PREDICTED: protein STAR1-like                      308   6e-100   
gb|ADE77572.1|  unknown                                                 306   1e-99    
gb|EEC81244.1|  hypothetical protein OsI_24312                          308   3e-99    Oryza sativa Indica Group [Indian rice]
gb|EMS45210.1|  Protein STAR1                                           304   1e-98    
ref|XP_008809991.1|  PREDICTED: protein STAR1                           291   5e-94    
ref|XP_010929292.1|  PREDICTED: protein STAR1                           288   1e-92    
ref|XP_002972606.1|  hypothetical protein SELMODRAFT_228126             282   2e-90    
gb|AFW69272.1|  hypothetical protein ZEAMMB73_510526                    283   1e-89    
ref|XP_002972060.1|  ATP-binding cassette transporter, subfamily ...    277   1e-88    
gb|EMT32912.1|  ABC transporter I family member 17                      275   7e-87    
ref|XP_001769120.1|  ATP-binding cassette transporter, subfamily ...    246   5e-77    
ref|XP_002974404.1|  hypothetical protein SELMODRAFT_414560             236   3e-72    
ref|XP_002985705.1|  hypothetical protein SELMODRAFT_446336             233   5e-71    
ref|XP_010265392.1|  PREDICTED: ABC transporter I family member 1...    224   1e-68    
gb|EMT05468.1|  hypothetical protein F775_42535                         221   4e-68    
gb|KHN00143.1|  ABC transporter I family member 17                      220   7e-68    
gb|ACU21458.1|  unknown                                                 220   7e-68    Glycine max [soybeans]
ref|XP_010265391.1|  PREDICTED: ABC transporter I family member 1...    221   6e-67    
gb|KDO36204.1|  hypothetical protein CISIN_1g046954mg                   211   3e-64    
gb|KCW53583.1|  hypothetical protein EUGRSUZ_J02855                     208   3e-62    
gb|ADM77072.1|  ABC transporter-like protein                            204   1e-61    
ref|WP_013298285.1|  phosphate ABC transporter ATP-binding protein      199   2e-58    
ref|WP_026485986.1|  phosphate ABC transporter ATP-binding protein      199   3e-58    
ref|WP_013298440.1|  phosphate ABC transporter ATP-binding protein      197   1e-57    
ref|WP_015312092.1|  ABC-type phosphate transport system, ATPase ...    193   3e-56    
ref|WP_038070231.1|  phosphate ABC transporter ATP-binding protein      189   1e-54    
ref|WP_014759189.1|  phosphate ABC transporter ATP-binding protein      189   2e-54    
ref|WP_013149751.1|  phosphate ABC transporter ATP-binding protein      184   8e-53    
ref|WP_028991621.1|  phosphate ABC transporter ATP-binding protein      184   1e-52    
ref|WP_003867036.1|  MULTISPECIES: phosphate ABC transporter ATP-...    183   3e-52    
ref|WP_009051890.1|  MULTISPECIES: phosphate ABC transporter ATP-...    182   4e-52    
gb|KHO61291.1|  phosphate ABC transporter ATP-binding protein, Ph...    181   1e-51    
ref|WP_003869904.1|  phosphate ABC transporter ATP-binding protein      182   2e-51    
ref|WP_029688444.1|  phosphate ABC transporter ATP-binding protein      180   3e-51    
ref|WP_014062201.1|  phosphate ABC transporter ATP-binding protein      179   6e-51    
ref|WP_009611257.1|  phosphate ABC transporter ATP-binding protein      178   2e-50    
ref|WP_006569253.1|  phosphate ABC transporter ATP-binding protein      178   2e-50    
ref|WP_012269684.1|  MULTISPECIES: phosphate ABC transporter ATP-...    178   3e-50    
ref|WP_004399736.1|  MULTISPECIES: ABC-type phosphate transport s...    177   4e-50    
ref|WP_011024777.1|  phosphate ABC transporter ATP-binding protein      177   5e-50    
ref|WP_031314164.1|  phosphate ABC transporter ATP-binding protein      177   6e-50    
gb|ERM91541.1|  phosphate ABC transporter ATP-binding protein           177   7e-50    
gb|AIS51475.1|  phosphate import ATP-binding protein PstB 1             177   2e-49    
gb|ABK91979.1|  ABC-type metal ion transport system ATPase              169   3e-47    uncultured bacterium
gb|AHF06856.1|  phosphate ABC transporter ATP-binding protein           167   3e-46    
ref|WP_036372428.1|  hypothetical protein                               166   4e-46    
ref|WP_015053405.1|  phosphate ABC transporter ATP-binding protein      167   5e-46    
ref|WP_023173976.1|  ABC transporter                                    167   6e-46    
ref|WP_011523623.1|  choline transporter                                166   7e-46    
ref|WP_011392686.1|  ABC transporter                                    166   9e-46    
dbj|GAF26941.1|  ABC-type phosphate transport system, ATPase comp...    166   1e-45    
gb|EMS52544.1|  Protein STAR1                                           162   2e-45    
ref|WP_017728303.1|  hypothetical protein                               165   3e-45    
ref|WP_022361154.1|  putative uncharacterized protein                   163   2e-44    
ref|WP_035971965.1|  choline transporter                                162   2e-44    
emb|CBH38054.1|  putative phosphate ABC-transporter, ATP-binding ...    162   2e-44    uncultured archaeon
ref|WP_021866547.1|  phosphate ABC transporter ATP-binding protei...    162   3e-44    
ref|WP_013150464.1|  MULTISPECIES: phosphate ABC transporter ATP-...    162   4e-44    
ref|WP_012995457.1|  phosphate ABC transporter ATP-binding protein      161   7e-44    
ref|WP_006570261.1|  phosphate ABC transporter ATP-binding protein      161   1e-43    
ref|WP_003871115.1|  MULTISPECIES: phosphate ABC transporter ATP-...    160   1e-43    
ref|WP_022626906.1|  phosphate ABC transporter ATP-binding protein      160   1e-43    
ref|WP_012958223.1|  phosphate ABC transporter ATP-binding protein      160   1e-43    
ref|WP_007706630.1|  phosphate ABC transporter ATP-binding protein [    160   3e-43    
ref|WP_015590431.1|  phosphate ABC transporter ATP-binding protei...    159   3e-43    
gb|KGP72958.1|  phosphate ABC transporter ATP-binding protein           159   3e-43    
ref|WP_030035740.1|  phosphate ABC transporter ATP-binding protein      159   3e-43    
ref|WP_036818791.1|  phosphate ABC transporter ATP-binding protein      159   4e-43    
ref|WP_009052536.1|  MULTISPECIES: phosphate ABC transporter ATP-...    159   4e-43    
ref|WP_003484679.1|  phosphate ABC transporter ATP-binding protein      159   5e-43    
ref|WP_014643751.1|  ABC transporter ATP-binding protein                158   5e-43    
ref|WP_012342103.1|  phosphate ABC transporter ATP-binding protein      159   6e-43    
ref|WP_035982992.1|  choline transporter                                158   9e-43    
gb|KHO62793.1|  phosphate ABC transporter ATP-binding protein, Ph...    158   9e-43    
ref|WP_027577887.1|  choline transporter                                157   9e-43    
ref|WP_028986193.1|  hypothetical protein                               158   1e-42    
ref|WP_008116785.1|  phosphate ABC transporter ATP-binding protein [    157   1e-42    
gb|KCZ72960.1|  ABC-type phosphate transport system, ATPase compo...    157   1e-42    
ref|WP_036782122.1|  phosphate ABC transporter ATP-binding protein      157   1e-42    
ref|WP_033842551.1|  glycine/betaine ABC transporter ATP-binding ...    161   1e-42    
ref|WP_008512452.1|  phosphate ABC transporter, ATP-binding protein     158   1e-42    
ref|WP_035690482.1|  choline transporter                                157   1e-42    
ref|WP_033023717.1|  glycine/betaine ABC transporter ATP-binding ...    161   1e-42    
ref|WP_031405910.1|  glycine/betaine ABC transporter ATP-binding ...    161   1e-42    
ref|WP_011025854.1|  phosphate ABC transporter ATP-binding protein      158   1e-42    
dbj|BAQ16648.1|  YbbL ABC transporter ATP-binding protein               157   2e-42    
gb|AIS52689.1|  phosphate import ATP-binding protein PstB 2             157   2e-42    
ref|WP_012269192.1|  MULTISPECIES: phosphate ABC transporter ATP-...    157   2e-42    
ref|WP_015009064.1|  phosphate ABC transporter ATP-binding protein      157   2e-42    
ref|WP_011986851.1|  phosphate ABC transporter ATP-binding protein      157   3e-42    
ref|WP_004441523.1|  phosphate ABC transporter ATP-binding protein      157   3e-42    
ref|WP_004440590.1|  phosphate ABC transporter ATP-binding protein      157   3e-42    
ref|WP_022207138.1|  phosphate ABC transporter ATP-binding protei...    157   3e-42    
ref|WP_014521289.1|  phosphate ABC transporter ATP-binding protein      157   4e-42    
ref|WP_015323674.1|  phosphate ABC transporter, ATP-binding protein     157   5e-42    
ref|WP_003404686.1|  phosphate transporter ATP-binding protein          156   5e-42    
ref|WP_020958513.1|  glycine/betaine ABC transporter ATPase             160   5e-42    
emb|CCE09909.1|  ABC transporter, ATPase subunit precursor              157   5e-42    
ref|WP_022142004.1|  phosphate ABC transporter ATP-binding protei...    157   5e-42    
ref|WP_015739023.1|  phosphate ABC transporter ATP-binding protein      156   5e-42    
ref|WP_013298212.1|  phosphate ABC transporter ATP-binding protein      156   5e-42    
ref|WP_024736676.1|  phosphate ABC transporter ATP-binding protein      156   6e-42    
ref|WP_013237907.1|  MULTISPECIES: phosphate ABC transporter ATP-...    156   6e-42    
ref|WP_009144708.1|  phosphate ABC transporter ATP-binding protein      156   6e-42    
ref|WP_009854954.1|  phosphate ABC transporter ATP-binding protein      156   6e-42    
ref|WP_012962486.1|  phosphate ABC transporter ATP-binding protein      156   6e-42    
ref|WP_020156624.1|  hypothetical protein                               156   6e-42    
ref|WP_008393288.1|  MULTISPECIES: phosphate ABC transporter ATP-...    156   6e-42    
ref|WP_013897826.1|  phosphate ABC transporter ATP-binding protein      156   8e-42    
dbj|GAK38737.1|  glycine betaine/L-proline ABC transporter ATP-bi...    159   8e-42    
ref|WP_013822279.1|  phosphate ABC transporter ATP-binding protein      156   9e-42    
ref|WP_004030715.1|  phosphate ABC transporter ATP-binding protein      156   9e-42    
ref|WP_038067937.1|  phosphate ABC transporter ATP-binding protein      155   1e-41    
ref|WP_012058019.1|  phosphate ABC transporter ATP-binding protein      155   1e-41    
ref|WP_006308556.1|  phosphate ABC transporter ATP-binding protein      155   1e-41    
ref|WP_022438357.1|  putative uncharacterized protein                   155   1e-41    
emb|CEA13097.1|  Phosphate import ATP-binding protein PstB              155   2e-41    
ref|WP_008881428.1|  glycine/betaine ABC transporter ATPase             158   2e-41    
ref|WP_011886704.1|  glycine/betaine ABC transporter ATPase             158   2e-41    
ref|WP_012311192.1|  MULTISPECIES: phosphate ABC transporter ATP-...    155   2e-41    
ref|WP_011229819.1|  MULTISPECIES: glycine/betaine ABC transporte...    158   2e-41    
ref|WP_011498866.1|  phosphate ABC transporter ATP-binding protein      155   2e-41    
ref|WP_006701710.1|  phosphate ABC transporter ATP-binding protein      155   2e-41    
ref|WP_033009966.1|  glycine/betaine ABC transporter ATP-binding ...    158   2e-41    
gb|AHI25216.1|  phosphate transporter ATP-binding protein               155   2e-41    
ref|WP_003494413.1|  phosphate ABC transporter ATP-binding protein      154   3e-41    
ref|WP_022024271.1|  phosphate ABC transporter                          155   3e-41    
ref|WP_013787856.1|  MULTISPECIES: phosphate ABC transporter ATP-...    154   3e-41    
ref|WP_006303385.1|  phosphate ABC transporter ATP-binding protein      155   3e-41    
ref|WP_003537096.1|  MULTISPECIES: phosphate ABC transporter ATP-...    154   3e-41    
ref|WP_013522855.1|  MULTISPECIES: glycine/betaine ABC transporte...    157   3e-41    
ref|WP_028828552.1|  glycine/betaine ABC transporter ATP-binding ...    157   3e-41    
gb|KGO13471.1|  phosphate ABC transporter ATP-binding protein           154   4e-41    
ref|WP_027293996.1|  phosphate ABC transporter ATP-binding protein      154   4e-41    
ref|WP_013798447.1|  phosphate ABC transporter ATP-binding protein      154   4e-41    
ref|WP_028044787.1|  phosphate ABC transporter ATP-binding protein      154   5e-41    
ref|WP_033006926.1|  MULTISPECIES: glycine/betaine ABC transporte...    157   5e-41    
ref|WP_004836897.1|  phosphate ABC transporter ATP-binding protein      154   5e-41    
gb|AIY89491.1|  Phosphate transport ATP-binding protein PstB            153   5e-41    
ref|WP_010507524.1|  phosphate ABC transporter ATP-binding protein      154   5e-41    
dbj|BAM70829.1|  phosphate ABC transporter ATP-binding subunit          154   5e-41    
ref|WP_036740494.1|  MULTISPECIES: phosphate ABC transporter ATP-...    154   5e-41    
gb|EPR26305.1|  Glycine betaine transport ATP-binding protein           157   6e-41    
gb|EGL20223.1|  phosphate ABC transporter, ATP-binding protein          154   6e-41    
ref|WP_010272026.1|  phosphate ABC transporter ATP-binding protein      154   6e-41    
ref|WP_015868090.1|  phosphate ABC transporter ATP-binding protein      154   6e-41    
ref|WP_017509637.1|  phosphate ABC transporter ATP-binding protein      154   6e-41    
ref|WP_012942658.1|  choline transporter                                153   6e-41    
ref|WP_015373835.1|  osmoprotectant ABC transporter ATP-binding p...    157   6e-41    
ref|WP_010877337.1|  phosphate ABC transporter ATP-binding protein      154   7e-41    
ref|WP_012065580.1|  phosphate ABC transporter ATP-binding protein      154   7e-41    
ref|WP_026485547.1|  phosphate ABC transporter ATP-binding protein      153   7e-41    
ref|WP_003453508.1|  phosphate ABC transporter ATP-binding protein      154   7e-41    
ref|WP_008790934.1|  phosphate ABC transporter ATP-binding protein      153   7e-41    
ref|WP_008930462.1|  phosphate ABC transporter ATP-binding protein      154   8e-41    
ref|WP_015529353.1|  phosphate ABC transporter ATP-binding protei...    154   8e-41    
ref|WP_005332270.1|  phosphate ABC transporter ATP-binding protein      154   8e-41    
ref|WP_039736044.1|  phosphate ABC transporter ATP-binding protein      154   9e-41    
ref|WP_010517153.1|  phosphate ABC transporter ATP-binding protein      154   9e-41    
emb|CCZ23722.1|  phosphate import ATP-binding protein PstB 2            153   9e-41    
ref|WP_005006689.1|  Phosphate import ATP-binding protein pstB 1        153   9e-41    
ref|WP_013432749.1|  MULTISPECIES: phosphate ABC transporter ATP-...    153   9e-41    
ref|WP_007862246.1|  phosphate ABC transporter ATP-binding protein [    153   9e-41    
ref|WP_039693739.1|  phosphate ABC transporter ATP-binding protein      153   1e-40    
ref|WP_021719575.1|  phosphate ABC transporter ATP-binding protein      153   1e-40    
ref|WP_021868767.1|  phosphate import ATP-binding protein pstB          153   1e-40    
ref|WP_035376183.1|  phosphate ABC transporter ATP-binding protein      153   1e-40    
ref|WP_021288553.1|  phosphate ABC transporter ATP-binding protein      153   1e-40    
ref|WP_004609391.1|  phosphate ABC transporter ATP-binding protein [    153   1e-40    
ref|WP_013430199.1|  MULTISPECIES: phosphate ABC transporter ATP-...    153   1e-40    
ref|WP_028597807.1|  phosphate ABC transporter ATP-binding protein      153   1e-40    
ref|WP_005213541.1|  phosphate ABC transporter, ATP-binding protein     153   1e-40    
ref|WP_013076474.1|  phosphate ABC transporter ATP-binding protein      153   1e-40    
ref|WP_039651694.1|  phosphate ABC transporter ATP-binding protein      152   1e-40    
ref|WP_008412356.1|  amino-acid transporter subunit ; ATP-binding...    152   2e-40    
ref|WP_022446182.1|  phosphate ABC transporter ATP-binding protein      153   2e-40    
ref|WP_022375181.1|  phosphate ABC transporter                          152   2e-40    
ref|WP_028498018.1|  phosphate ABC transporter ATP-binding protein      152   2e-40    
ref|WP_013412189.1|  phosphate ABC transporter ATP-binding protein      152   2e-40    
ref|WP_023992669.1|  Phosphate import ATP-binding protein PstB          152   2e-40    
ref|WP_013290370.1|  phosphate ABC transporter ATP-binding protein      152   2e-40    
ref|WP_017750683.1|  phosphate ABC transporter ATP-binding protein      152   2e-40    
ref|WP_026196620.1|  phosphate ABC transporter ATP-binding protein      152   2e-40    
ref|WP_033316561.1|  phosphate ABC transporter ATP-binding protein      152   2e-40    
ref|WP_023845461.1|  phosphate ABC transporter ATP-binding protei...    152   3e-40    
ref|WP_022202331.1|  putative uncharacterized protein                   152   3e-40    
ref|WP_012696006.1|  phosphate ABC transporter ATP-binding protein      152   3e-40    
ref|WP_028548057.1|  phosphate ABC transporter ATP-binding protein      152   3e-40    
ref|WP_028328374.1|  phosphate ABC transporter ATP-binding protein      152   3e-40    
ref|WP_027823764.1|  phosphate ABC transporter ATP-binding protein      152   3e-40    
ref|WP_002569038.1|  phosphate ABC transporter ATP-binding protein [    152   3e-40    
gb|KGK98619.1|  phosphate ABC transporter ATP-binding protein           152   3e-40    
ref|WP_002572986.1|  MULTISPECIES: phosphate import ATP-binding p...    152   3e-40    
gb|AHH13715.1|  Phosphate transport ATP-binding protein pstB            152   3e-40    
ref|WP_031476774.1|  phosphate ABC transporter ATP-binding protein      152   3e-40    
ref|WP_021877759.1|  Phosphate import ATP-binding protein PstB          152   4e-40    
ref|WP_012421991.1|  phosphate ABC transporter ATP-binding protein      152   4e-40    
ref|WP_002586707.1|  phosphate ABC transporter ATP-binding protein [    152   4e-40    
ref|WP_013999530.1|  phosphate ABC transporter ATP-binding protein      151   4e-40    
ref|WP_002592664.1|  phosphate import ATP-binding protein PstB [        151   4e-40    
ref|WP_007061487.1|  phosphate ABC transporter ATP-binding protein      151   4e-40    
ref|WP_013915024.1|  phosphate ABC transporter ATP-binding protein      152   4e-40    
ref|WP_022273917.1|  phosphate import ATP-binding protein pstB          151   4e-40    
ref|WP_014649949.1|  phosphate ABC transporter ATP-binding protein      151   5e-40    
ref|WP_013766921.1|  phosphate ABC transporter ATP-binding protein      151   5e-40    
ref|WP_013121439.1|  ABC transporter                                    151   5e-40    
ref|WP_038062373.1|  hypothetical protein                               151   5e-40    
ref|WP_011345003.1|  phosphate ABC transporter ATP-binding protein      151   5e-40    
ref|WP_013295139.1|  phosphate ABC transporter ATP-binding protein      151   5e-40    
ref|WP_028052938.1|  phosphate ABC transporter ATP-binding protein      151   5e-40    
ref|WP_024301366.1|  phosphate ABC transporter ATP-binding protein      151   5e-40    
ref|WP_025725520.1|  phosphate ABC transporter ATP-binding protein      151   6e-40    
ref|WP_014104299.1|  phosphate ABC transporter ATP-binding protein      151   6e-40    
ref|WP_027356081.1|  phosphate ABC transporter ATP-binding protein      151   6e-40    
ref|WP_035509097.1|  MULTISPECIES: phosphate ABC transporter ATP-...    150   6e-40    
ref|WP_039678669.1|  phosphate ABC transporter ATP-binding protein      151   6e-40    
ref|WP_006802817.1|  phosphate ABC transporter ATP-binding protein      151   6e-40    
ref|WP_007892819.1|  phosphate ABC transporter ATP-binding protein      151   7e-40    
ref|WP_011033941.1|  phosphate ABC transporter ATP-binding protein      151   7e-40    
ref|WP_035307506.1|  phosphate ABC transporter ATP-binding protein      151   7e-40    
ref|WP_033829638.1|  phosphate ABC transporter ATP-binding protein      151   7e-40    
ref|WP_011877084.1|  phosphate ABC transporter ATP-binding protein      151   7e-40    
ref|WP_011306768.1|  phosphate ABC transporter ATP-binding protein      151   7e-40    
ref|WP_007438162.1|  phosphate ABC transporter ATP-binding protein      151   8e-40    
ref|WP_019086376.1|  phosphate ABC transporter ATP-binding protein      151   8e-40    
ref|WP_005338968.1|  phosphate ABC transporter ATP-binding protein      150   8e-40    
ref|WP_013909330.1|  phosphate ABC transporter ATP-binding protein      150   9e-40    
ref|WP_011838136.1|  MULTISPECIES: phosphate ABC transporter ATP-...    150   9e-40    
ref|WP_008953457.1|  MULTISPECIES: phosphate ABC transporter ATP-...    150   9e-40    
gb|KIG09263.1|  YbbL ABC transporter ATP-binding protein                150   9e-40    
ref|WP_016648836.1|  phosphate ABC transporter, ATP-binding protein     150   9e-40    
ref|WP_011772173.1|  phosphate ABC transporter ATP-binding protein      150   9e-40    
ref|WP_034233403.1|  phosphate ABC transporter ATP-binding protein      150   9e-40    
ref|WP_022279221.1|  MULTISPECIES: phosphate import ATP-binding p...    150   9e-40    
ref|WP_006301899.1|  phosphate ABC transporter ATP-binding protein      151   1e-39    
ref|WP_012158147.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
ref|WP_027720104.1|  hypothetical protein                               150   1e-39    
ref|WP_025747540.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
ref|WP_028841594.1|  hypothetical protein                               150   1e-39    
ref|WP_011405950.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
ref|WP_008978402.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
ref|WP_026664573.1|  MULTISPECIES: phosphate ABC transporter ATP-...    150   1e-39    
ref|WP_006965599.1|  MULTISPECIES: phosphate import ATP-binding p...    151   1e-39    
gb|KIG07105.1|  YbbL ABC transporter ATP-binding protein                150   1e-39    
ref|WP_038351272.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
ref|WP_027429022.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
ref|WP_026801031.1|  phosphate ABC transporter ATP-binding protein      149   1e-39    
ref|WP_012717373.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
ref|WP_022093586.1|  phosphate ABC transporter ATP-binding protei...    150   1e-39    
ref|WP_008396237.1|  MULTISPECIES: phosphate ABC transporter ATP-...    150   1e-39    
ref|WP_033164779.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
ref|WP_021875500.1|  Putative Phosphate ABC transporter, ATPase s...    150   1e-39    
ref|WP_024654045.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
ref|WP_016484091.1|  phosphate ABC transporter ATP-binding protei...    151   1e-39    
ref|WP_026300487.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
ref|WP_008688406.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
ref|WP_012035313.1|  ABC-type transport system, ATPase component        150   1e-39    
ref|WP_025646966.1|  MULTISPECIES: phosphate ABC transporter ATP-...    151   1e-39    
ref|WP_026528712.1|  phosphate ABC transporter ATP-binding protein      150   1e-39    
emb|CDG82393.1|  ABC transporter family protein                         151   2e-39    
ref|WP_012032837.1|  phosphate ABC transporter ATP-binding protein      150   2e-39    
ref|WP_026667116.1|  MULTISPECIES: hypothetical protein                 150   2e-39    
ref|WP_022345789.1|  phosphate ABC transporter ATP-binding protei...    150   2e-39    
ref|WP_013275063.1|  glycine/betaine ABC transporter ATPase             153   2e-39    
ref|WP_006908218.1|  phosphate ABC transporter ATP-binding protein      150   2e-39    
ref|WP_038053172.1|  phosphate ABC transporter ATP-binding protein      150   2e-39    
gb|AID44796.1|  Phosphate transport ATP-binding protein PstB            150   2e-39    
ref|WP_020954607.1|  phosphate ABC transporter ATP-binding protein      150   2e-39    
ref|WP_019262376.1|  phosphate ABC transporter ATP-binding protein      150   2e-39    
ref|WP_007440771.1|  hypothetical protein                               150   2e-39    
ref|WP_011171042.1|  phosphate ABC transporter ATP-binding protein      150   2e-39    
ref|WP_035542001.1|  phosphate ABC transporter ATP-binding protein      149   2e-39    
gb|KIA69764.1|  YbbL ABC transporter ATP-binding protein                149   2e-39    
ref|WP_006445967.1|  ABC transporter                                    150   2e-39    
ref|WP_026177853.1|  choline transporter                                149   2e-39    
ref|WP_021937831.1|  phosphate transport system ATP-binding protein     150   2e-39    
ref|WP_038490839.1|  hypothetical protein                               151   2e-39    
ref|WP_005806188.1|  MULTISPECIES: phosphate ABC transporter ATP-...    150   2e-39    
ref|WP_012537984.1|  MULTISPECIES: phosphate ABC transporter ATP-...    150   2e-39    
ref|WP_034538185.1|  phosphate ABC transporter ATP-binding protein      149   2e-39    
ref|WP_013381025.1|  phosphate ABC transporter ATP-binding protein      150   2e-39    
ref|WP_021652472.1|  MULTISPECIES: phosphate ABC transporter, ATP...    149   2e-39    
ref|WP_003621506.1|  phosphate ABC transporter ATP-binding protein      150   2e-39    
ref|WP_023176828.1|  phosphate ABC transporter ATP-binding protein      149   2e-39    
ref|WP_008402764.1|  MULTISPECIES: phosphate ABC transporter ATP-...    149   2e-39    
ref|WP_006738485.1|  phosphate ABC transporter ATP-binding protein      149   2e-39    
ref|WP_004826601.1|  phosphate ABC transporter ATP-binding protein      150   2e-39    
ref|WP_013826423.1|  phosphate ABC transporter ATP-binding protein      149   2e-39    
ref|WP_039232422.1|  phosphate ABC transporter ATP-binding protein      149   2e-39    
ref|WP_021956808.1|  phosphate import ATP-binding protein pstB 3        149   2e-39    
gb|AHH08180.1|  Phosphate transport ATP-binding protein pstB            149   2e-39    
ref|WP_014696101.1|  phosphate ABC transporter ATP-binding protein      149   2e-39    
ref|WP_032077711.1|  phosphate ABC transporter ATP-binding protein      149   2e-39    
ref|WP_021977008.1|  phosphate ABC transporter ATP-binding protei...    149   2e-39    
ref|WP_021386169.1|  phosphate ABC transporter, ATP-binding protein     149   2e-39    
ref|WP_031389391.1|  phosphate ABC transporter ATP-binding protein      149   3e-39    
ref|WP_006568083.1|  MULTISPECIES: phosphate ABC transporter ATP-...    149   3e-39    
ref|WP_028308693.1|  phosphate ABC transporter ATP-binding protein      149   3e-39    
ref|WP_013656168.1|  phosphate ABC transporter ATP-binding protein      149   3e-39    
ref|WP_024621654.1|  phosphate ABC transporter ATP-binding protein [    149   3e-39    
ref|WP_022359895.1|  phosphate import ATP-binding protein pstB          149   3e-39    
ref|WP_007979440.1|  choline transporter                                149   3e-39    
ref|WP_004275076.1|  phosphate ABC transporter ATP-binding protein      149   3e-39    
ref|WP_023391348.1|  phosphate ABC transporter, ATP-binding protein     149   3e-39    
ref|WP_015526284.1|  phosphate ABC transporter ATP-binding protei...    149   3e-39    
ref|WP_003466490.1|  phosphate ABC transporter ATPase                   149   3e-39    
ref|WP_004277183.1|  phosphate ABC transporter ATP-binding protein      149   3e-39    
ref|WP_035166583.1|  phosphate ABC transporter ATP-binding protein      149   3e-39    
ref|WP_034124803.1|  phosphate ABC transporter ATP-binding protein      149   3e-39    
ref|WP_014453126.1|  phosphate ABC transporter ATP-binding protein      149   3e-39    
ref|WP_013867255.1|  phosphate ABC transporter ATP-binding protein      149   3e-39    
ref|WP_026656012.1|  hypothetical protein                               149   3e-39    
ref|WP_034886614.1|  phosphate ABC transporter ATP-binding protein      149   3e-39    
ref|WP_004622906.1|  MULTISPECIES: phosphate ABC transporter, ATP...    149   3e-39    
ref|WP_019163015.1|  phosphate ABC transporter ATP-binding protein      149   3e-39    
gb|EEH98208.1|  phosphate import ATP-binding protein PstB               149   3e-39    
ref|WP_035285730.1|  phosphate ABC transporter ATP-binding protein      149   4e-39    
ref|WP_004079999.1|  MULTISPECIES: phosphate ABC transporter ATP-...    149   4e-39    
ref|WP_024614585.1|  phosphate ABC transporter ATP-binding protein      149   4e-39    
ref|WP_035163099.1|  phosphate ABC transporter ATP-binding protein      149   4e-39    
ref|WP_033161991.1|  phosphate ABC transporter ATP-binding protein      149   4e-39    
ref|WP_008790717.1|  MULTISPECIES: phosphate ABC transporter ATP-...    149   4e-39    
gb|AHH05199.1|  Phosphate transport ATP-binding protein pstB            149   4e-39    
ref|WP_010283087.1|  glycine/betaine ABC transporter ATPase             152   4e-39    
ref|WP_031538810.1|  glycine/betaine ABC transporter ATP-binding ...    152   5e-39    
ref|WP_005728036.1|  phosphate ABC transporter ATP-binding protein      149   5e-39    
ref|WP_022854735.1|  phosphate ABC transporter ATP-binding protein      149   5e-39    
ref|WP_015778297.1|  phosphate ABC transporter ATP-binding protein      149   5e-39    
ref|WP_004834062.1|  phosphate ABC transporter ATP-binding protein      149   5e-39    
ref|WP_004036596.1|  phosphate ABC transporter ATP-binding protein      149   5e-39    
ref|WP_038558007.1|  phosphate ABC transporter ATP-binding protein      149   5e-39    
ref|WP_014094697.1|  phosphate ABC transporter ATP-binding protein      149   5e-39    
ref|WP_016204047.1|  glycine betaine/L-proline ABC transporter, A...    151   5e-39    
ref|WP_011976754.1|  phosphate ABC transporter ATP-binding protein      149   5e-39    
ref|WP_019246794.1|  phosphate ABC transporter ATP-binding protein      148   6e-39    
ref|WP_024954174.1|  phosphate ABC transporter ATP-binding protein      149   6e-39    
ref|WP_020311754.1|  MULTISPECIES: phosphate ABC transporter            149   6e-39    
ref|WP_028554807.1|  phosphate ABC transporter ATP-binding protein      149   6e-39    
ref|WP_004622104.1|  phosphate ABC transporter ATP-binding protein [    148   6e-39    
ref|WP_018132166.1|  phosphate ABC transporter ATP-binding protein      148   6e-39    
ref|WP_036365314.1|  phosphate ABC transporter ATP-binding protein      149   6e-39    
ref|WP_003501535.1|  MULTISPECIES: phosphate ABC transporter ATP-...    149   6e-39    
ref|WP_008723664.1|  MULTISPECIES: phosphate ABC transporter ATP-...    148   6e-39    
ref|WP_011972234.1|  phosphate ABC transporter ATP-binding protein      148   6e-39    
gb|KEJ91785.1|  phosphate ABC transporter ATP-binding protein           149   7e-39    
ref|WP_037985970.1|  phosphate ABC transporter ATP-binding protein      147   7e-39    
ref|WP_022352063.1|  phosphate import ATP-binding protein pstB          148   7e-39    
ref|WP_003511195.1|  phosphate ABC transporter ATP-binding protein [    148   7e-39    
ref|WP_014015077.1|  MULTISPECIES: phosphate ABC transporter ATP-...    148   7e-39    
ref|WP_023483408.1|  phosphate ABC transporter-like protein             148   7e-39    
ref|WP_019224618.1|  phosphate ABC transporter ATP-binding protein      148   7e-39    
ref|WP_013615723.1|  amino acid ABC transporter ATP-binding protein     150   7e-39    
ref|WP_015898053.1|  phosphate import ATP-binding protein pstB 1        149   7e-39    
gb|AIY89863.1|  Phosphate transport ATP-binding protein PstB            148   7e-39    
ref|WP_015533778.1|  MULTISPECIES: phosphate ABC transporter ATP-...    148   7e-39    
ref|WP_012290501.1|  phosphate ABC transporter ATP-binding protein      148   8e-39    
ref|WP_036324543.1|  phosphate ABC transporter ATP-binding protein      148   8e-39    
ref|WP_008288102.1|  phosphate ABC transporter ATP-binding protein      148   8e-39    
gb|KDN25221.1|  phosphate transporter ATP-binding protein               148   8e-39    
ref|WP_029504040.1|  phosphate ABC transporter ATP-binding protein      148   8e-39    
ref|WP_027621470.1|  phosphate ABC transporter ATP-binding protein [    148   8e-39    
ref|WP_035021404.1|  phosphate ABC transporter ATP-binding protein      148   8e-39    
gb|EQJ53784.1|  phosphate ABC transporter, ATP-binding protein          148   8e-39    
ref|WP_012749041.1|  glycine/betaine ABC transporter ATPase             151   9e-39    
ref|WP_038148062.1|  phosphate ABC transporter ATP-binding protein      148   9e-39    
ref|WP_027399568.1|  phosphate ABC transporter ATP-binding protein      148   9e-39    
ref|WP_015513235.1|  phosphate ABC transporter ATP-binding protei...    148   9e-39    
gb|EFU80184.1|  phosphate ABC transporter, ATP-binding protein          148   9e-39    
ref|WP_016206437.1|  phosphate ABC transporter ATPase                   148   9e-39    
ref|WP_002839347.1|  phosphate ABC transporter ATP-binding protein      148   9e-39    
ref|WP_005359794.1|  phosphate ABC transporter ATP-binding protein      148   9e-39    
ref|WP_002838253.1|  phosphate ABC transporter ATP-binding protein      148   9e-39    
ref|WP_012991246.1|  phosphate ABC transporter ATP-binding protein      148   9e-39    
ref|WP_022303152.1|  phosphate import ATP-binding protein pstB 3        148   9e-39    
ref|WP_028975294.1|  phosphate ABC transporter ATP-binding protein      148   9e-39    
ref|WP_022153758.1|  phosphate import ATP-binding protein pstB          148   9e-39    
ref|WP_022663875.1|  phosphate ABC transporter ATP-binding protein      149   1e-38    
ref|WP_021298142.1|  hypothetical protein                               147   1e-38    
gb|KGJ51831.1|  phosphate ABC transporter ATP-binding protein [ [       148   1e-38    
ref|WP_011264530.1|  phosphate ABC transporter ATP-binding protein      149   1e-38    
ref|WP_002609095.1|  MULTISPECIES: phosphate ABC transporter ATP-...    148   1e-38    
ref|WP_007474062.1|  phosphate ABC transporter ATP-binding protein      148   1e-38    
ref|WP_015044832.1|  MULTISPECIES: phosphate ABC transporter ATP-...    148   1e-38    
ref|WP_037299843.1|  phosphate ABC transporter ATP-binding protein      149   1e-38    
gb|KIA81317.1|  phosphate ABC transporter ATP-binding protein           148   1e-38    
ref|WP_020492086.1|  phosphate ABC transporter ATP-binding protein      148   1e-38    
ref|WP_002836199.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
dbj|BAP61387.1|  phosphate ABC transporter ATP-binding protein          147   1e-38    
ref|WP_032121821.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_004864363.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_007476028.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_027204801.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_018673809.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_004857011.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_019674014.1|  phosphate ABC transporter ATP-binding protein      149   1e-38    
ref|WP_022755237.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_022249191.1|  phosphate transport system ATP-binding protein     147   1e-38    
ref|WP_012662616.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_004246787.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_010666138.1|  phosphate ABC transporter ATP-binding protein      148   1e-38    
ref|WP_013538246.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_036062036.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_025482008.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
ref|WP_022653907.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
emb|CCY32516.1|  putative uncharacterized protein                       147   1e-38    
ref|WP_009254961.1|  phosphate ABC transporter ATP-binding protein      147   1e-38    
dbj|BAP63291.1|  phosphate ABC transporter ATP-binding protein          147   1e-38    
ref|WP_007002390.1|  phosphate ABC transporter ATP-binding protein      148   1e-38    
ref|WP_026394733.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_007050736.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_023843628.1|  phosphate transporter subunit                      147   2e-38    
ref|WP_038534045.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_036325020.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_011973289.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_014967435.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_034767470.1|  amino acid ABC transporter ATP-binding protein     147   2e-38    
ref|WP_022228991.1|  phosphate ABC transporter ATP-binding protei...    147   2e-38    
ref|WP_021914953.1|  phosphate transport system ATP-binding protein     147   2e-38    
ref|WP_036768251.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_013843262.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_024726788.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_011308775.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
dbj|GAJ39679.1|  osmoprotectant ABC transporter ATP-binding protein     150   2e-38    
ref|WP_019133853.1|  hypothetical protein                               147   2e-38    
ref|WP_036635822.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_023438013.1|  phosphate transport ATP-binding protein pstB       147   2e-38    
emb|CCF16212.1|  phosphate ABC transporter, ATP-binding protein         147   2e-38    
ref|WP_014356735.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_006534565.1|  MULTISPECIES: phosphate ABC transporter ATP-...    147   2e-38    
ref|WP_009577953.1|  Phosphate transport ATP-binding protein PstB       148   2e-38    
dbj|GAE88461.1|  phosphate transport ATP-binding protein PstB [ [       147   2e-38    
ref|WP_037960608.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    
ref|WP_034264600.1|  hypothetical protein                               147   2e-38    
ref|WP_038700536.1|  phosphate ABC transporter ATP-binding protein      147   2e-38    



>ref|XP_004235874.1| PREDICTED: ABC transporter I family member 17 [Solanum lycopersicum]
Length=263

 Score =   369 bits (946),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/256 (75%), Positives = 228/256 (89%), Gaps = 5/256 (2%)
 Frame = +1

Query  169  MEV-PEERELLLMVD----GDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGI  333
            ME+ P  RE LL  +    G +E    KIQV+GLT+VS+KG+++LN +++DIP+G+IMG+
Sbjct  1    MEILPGAREHLLGSNWNENGFEENPEIKIQVRGLTKVSEKGVSILNNVSVDIPKGIIMGV  60

Query  334  IGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVA  513
            IGPSGSGKSTFLR+LNRLWEP++ +VFLDG DICDLDVL+LR K+GMLFQLP LFEGTVA
Sbjct  61   IGPSGSGKSTFLRSLNRLWEPSSNSVFLDGHDICDLDVLALRRKIGMLFQLPVLFEGTVA  120

Query  514  DNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEV  693
            DN+RYGP L+GKKLSD++V +LL+LADLDSSF NK GGELSVGQAQRVALARTLANEPEV
Sbjct  121  DNVRYGPQLKGKKLSDNEVYKLLTLADLDSSFFNKSGGELSVGQAQRVALARTLANEPEV  180

Query  694  LLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            LLLDEPTSALDPISTQNIEDVLV+LK+E+ MTI MVSHSIKQI+RIAD+VCLLV GEIVE
Sbjct  181  LLLDEPTSALDPISTQNIEDVLVKLKREQNMTIVMVSHSIKQIKRIADIVCLLVNGEIVE  240

Query  874  VLKPDQLSQAKHPMAQ  921
            +LKPDQL ++KHPMAQ
Sbjct  241  ILKPDQLFESKHPMAQ  256



>ref|XP_009609209.1| PREDICTED: ABC transporter I family member 17 [Nicotiana tomentosiformis]
Length=260

 Score =   368 bits (944),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 190/250 (76%), Positives = 225/250 (90%), Gaps = 1/250 (0%)
 Frame = +1

Query  175  VPEERE-LLLMVDGDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGS  351
            +P  RE LL+   G  E+A  KIQV+GLT+VSDKG+++LN + +DIP+G+IMG+IGPSGS
Sbjct  4    IPGSREPLLINESGFGESAEIKIQVRGLTKVSDKGISILNNVNVDIPKGIIMGVIGPSGS  63

Query  352  GKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYG  531
            GKS+ LR+LNRLWEP + TVFLD +DICDLDVL+LR K+GMLFQLP LFEGTVADN+RYG
Sbjct  64   GKSSLLRSLNRLWEPPSNTVFLDSQDICDLDVLTLRRKIGMLFQLPVLFEGTVADNVRYG  123

Query  532  PLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEP  711
            P L+GKKLSD++V +LL+LADLDSSF +K GGELSVGQAQRVALARTLANEPEVLLLDEP
Sbjct  124  PQLKGKKLSDNEVYKLLNLADLDSSFFSKSGGELSVGQAQRVALARTLANEPEVLLLDEP  183

Query  712  TSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQ  891
            TSALDPISTQNIEDVLV+LK+E+ +T+ MVSHSIKQI+RIAD+VCLLV GEIVE+LKPDQ
Sbjct  184  TSALDPISTQNIEDVLVKLKREQNLTVVMVSHSIKQIKRIADIVCLLVNGEIVEILKPDQ  243

Query  892  LSQAKHPMAQ  921
            LS+AKHPMAQ
Sbjct  244  LSEAKHPMAQ  253



>ref|XP_006341433.1| PREDICTED: ABC transporter I family member 17-like [Solanum tuberosum]
Length=263

 Score =   367 bits (943),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 191/256 (75%), Positives = 228/256 (89%), Gaps = 5/256 (2%)
 Frame = +1

Query  169  MEV-PEERELLLMVDGDD----EAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGI  333
            ME+ P  RE LL  +G++    E    KIQV+GLT+VS+KG+++LN + +DIP+G+IMG+
Sbjct  1    MEILPGAREHLLGSNGNENGFEENPEIKIQVRGLTKVSEKGVSILNNVNVDIPKGVIMGV  60

Query  334  IGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVA  513
            IGPSGSGKSTFLR+LNRLWEP++ +VFLDG DICDLDVL+LR K+GMLFQ+P LFEGTVA
Sbjct  61   IGPSGSGKSTFLRSLNRLWEPSSNSVFLDGHDICDLDVLALRRKIGMLFQIPVLFEGTVA  120

Query  514  DNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEV  693
            DN+RYGP L+GKKLSD++V +LL+LADLDSSF NK GGELSVGQAQRVALARTLANEPEV
Sbjct  121  DNVRYGPQLKGKKLSDNEVYKLLTLADLDSSFFNKSGGELSVGQAQRVALARTLANEPEV  180

Query  694  LLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            LLLDEPTSALDPISTQNIEDVLV+LK+E+ MTI MVSHSIKQI+RIA++VCLLV GEIVE
Sbjct  181  LLLDEPTSALDPISTQNIEDVLVKLKREQNMTIVMVSHSIKQIKRIAEIVCLLVNGEIVE  240

Query  874  VLKPDQLSQAKHPMAQ  921
            +LKPDQL ++KHPMAQ
Sbjct  241  ILKPDQLFESKHPMAQ  256



>ref|XP_011073244.1| PREDICTED: ABC transporter I family member 17-like [Sesamum indicum]
Length=260

 Score =   363 bits (933),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/232 (82%), Positives = 212/232 (91%), Gaps = 0/232 (0%)
 Frame = +1

Query  226  AGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA  405
             G KI+V+ LT+VSDK + +LN++ LDIPRG+IMG+IGPSGSGKSTFLRALNRLWEPA+ 
Sbjct  23   GGVKIEVRDLTKVSDKDVRILNKVNLDIPRGVIMGVIGPSGSGKSTFLRALNRLWEPASG  82

Query  406  TVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrlls  585
            +V LDG DIC+LDVLSLR KVGMLFQLP LFEGTVADN+RYGP LRGKKLSD +V +LL+
Sbjct  83   SVLLDGVDICELDVLSLRRKVGMLFQLPVLFEGTVADNVRYGPQLRGKKLSDGEVHKLLA  142

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            LADLDSSF  K GGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR
Sbjct  143  LADLDSSFYGKSGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  202

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            LKK++ MTI MVSHSIKQIQRIADVVCLLV GEIVE+L+P+QLS+AKHPMAQ
Sbjct  203  LKKDRGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEILEPNQLSEAKHPMAQ  254



>emb|CDO98264.1| unnamed protein product [Coffea canephora]
Length=304

 Score =   363 bits (933),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 191/251 (76%), Positives = 224/251 (89%), Gaps = 5/251 (2%)
 Frame = +1

Query  181  EERELLLMVDGDDEAAGT-----KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPS  345
            E+R L++ V+ ++  +G      KIQ++ L++VSDK + +LN++ +DIPRG+IMG+IGPS
Sbjct  46   EQRLLVVDVNENEHGSGNESSDAKIQIRELSKVSDKSVPILNKVNVDIPRGMIMGVIGPS  105

Query  346  GSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIR  525
            GSGKSTFLRALNRLWEP + TVFLDG+DI DLDVL+LR +VGMLFQLPALFEGTVADNIR
Sbjct  106  GSGKSTFLRALNRLWEPPSKTVFLDGQDIGDLDVLALRRRVGMLFQLPALFEGTVADNIR  165

Query  526  YGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLD  705
            YGP L+GKKL+D++V +LL+LADLDS+F  K GGELSVGQAQRVALARTLANEPEVLLLD
Sbjct  166  YGPQLKGKKLTDNEVYKLLTLADLDSTFFGKSGGELSVGQAQRVALARTLANEPEVLLLD  225

Query  706  EPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKP  885
            EPTSALDPISTQNIEDVLV+LKKEK MTI MVSHSIKQIQRIADVVCLLV GEIVE+LKP
Sbjct  226  EPTSALDPISTQNIEDVLVKLKKEKGMTIVMVSHSIKQIQRIADVVCLLVGGEIVEILKP  285

Query  886  DQLSQAKHPMA  918
            D+LS+AKHPMA
Sbjct  286  DKLSEAKHPMA  296



>ref|XP_009788357.1| PREDICTED: ABC transporter I family member 17 [Nicotiana sylvestris]
Length=260

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/253 (75%), Positives = 224/253 (89%), Gaps = 2/253 (1%)
 Frame = +1

Query  169  MEV-PEERELLLMVD-GDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGP  342
            ME+ P  RE LL  + G  E    KIQV+GLT+VSDKG+++LN + +DIP+G+IMG+IGP
Sbjct  1    MEILPGSREPLLENESGFREDGEIKIQVRGLTKVSDKGISILNNVNVDIPKGIIMGVIGP  60

Query  343  SGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNI  522
            SGSGKST LR+LNRLWEP + TVFLDG+DICDLDVL+LR K+GMLFQLP LFEG VADN+
Sbjct  61   SGSGKSTLLRSLNRLWEPPSNTVFLDGQDICDLDVLTLRRKIGMLFQLPVLFEGAVADNV  120

Query  523  RYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLL  702
            RYGP L+GKKLSD++V +LL+LADLDSSF +K GGELSVGQAQRVALARTLANEPEVLLL
Sbjct  121  RYGPQLKGKKLSDNEVYKLLTLADLDSSFFSKSGGELSVGQAQRVALARTLANEPEVLLL  180

Query  703  DEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            DEPTSALDPISTQNIEDVLV+LK+E+ +T+ MVSHSIKQI+RIAD+VCLLV GEIVE+LK
Sbjct  181  DEPTSALDPISTQNIEDVLVKLKREQNLTVVMVSHSIKQIKRIADIVCLLVNGEIVEILK  240

Query  883  PDQLSQAKHPMAQ  921
            PDQL +AKHPMAQ
Sbjct  241  PDQLCEAKHPMAQ  253



>ref|XP_006366268.1| PREDICTED: ABC transporter I family member 17-like [Solanum tuberosum]
Length=280

 Score =   360 bits (923),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 202/292 (69%), Positives = 235/292 (80%), Gaps = 23/292 (8%)
 Frame = +1

Query  52   IQISQGWGEAHCPYIILPIHFFGEKLNLQFHHLI*DSCLMEVPE-ERELLLMVDGDD--E  222
            ++ISQ W                 K++ Q H     S  +E+ + ER  LL V+ +D   
Sbjct  1    MEISQNWS----------------KISPQLHS----SHSLEISQGERGHLLAVEMNDIKG  40

Query  223  AAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPAN  402
            AA TKI+++GL +VSDKG ++L  + +DIPRG+IMGIIGPSGSGKST LRALNRLWEP  
Sbjct  41   AAETKIEIRGLNKVSDKGDSILKSVRVDIPRGVIMGIIGPSGSGKSTILRALNRLWEPPK  100

Query  403  ATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrll  582
             TVFLDG DICDLDVL LR KVGMLFQLP LFEGTVADNIRYGP L+GKKLSD++V +LL
Sbjct  101  NTVFLDGTDICDLDVLCLRRKVGMLFQLPVLFEGTVADNIRYGPKLKGKKLSDNEVYKLL  160

Query  583  sladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLV  762
            +LADLDSSF  K GGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLV
Sbjct  161  TLADLDSSFFYKSGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLV  220

Query  763  RLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMA  918
            +L+K++ MTI +VSHSIKQIQRIAD+VCLLV+GEIVE++KPDQLS+AKHPMA
Sbjct  221  KLRKDQMMTIVIVSHSIKQIQRIADIVCLLVDGEIVEIIKPDQLSEAKHPMA  272



>ref|XP_010322648.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter I family member 
17-like [Solanum lycopersicum]
Length=280

 Score =   357 bits (916),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 192/247 (78%), Positives = 217/247 (88%), Gaps = 2/247 (1%)
 Frame = +1

Query  184  ERELLLMVDGDD--EAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGK  357
            ER  LL V+ +D   A  TKI+V+ L +VSDKG ++L  + +DI RG+IMGIIGPSGSGK
Sbjct  26   ERGHLLAVEMNDIKGATETKIEVRELNKVSDKGDSILKSVRVDITRGVIMGIIGPSGSGK  85

Query  358  STFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPL  537
            ST LRALNRLWE    TVFLDG DICDLDVL LR KVGMLFQLP LFEGTVADNIRYGP 
Sbjct  86   STILRALNRLWEXPKGTVFLDGTDICDLDVLCLRRKVGMLFQLPVLFEGTVADNIRYGPK  145

Query  538  LRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTS  717
            L+GKKLSD++V +LL+LADLDSSF NK GGELSVGQAQRVALARTLANEPEVLLLDEPTS
Sbjct  146  LKGKKLSDNEVYKLLTLADLDSSFFNKSGGELSVGQAQRVALARTLANEPEVLLLDEPTS  205

Query  718  ALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLS  897
            ALDPISTQNIEDVLV+LKK+++MTI +VSHSIKQIQRIAD+VCLLV+GEIVE++KPDQLS
Sbjct  206  ALDPISTQNIEDVLVKLKKDQKMTIVIVSHSIKQIQRIADIVCLLVDGEIVEIIKPDQLS  265

Query  898  QAKHPMA  918
            +AKHPMA
Sbjct  266  EAKHPMA  272



>ref|XP_011082719.1| PREDICTED: ABC transporter I family member 17-like [Sesamum indicum]
Length=260

 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 209/229 (91%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            K++V+ LT+VS K + +LN+I+LDI RG I+G+IGPSGSGKSTFLRALNRLWEPA+ATVF
Sbjct  25   KMEVRHLTKVSGKDVRILNRISLDIRRGEIVGVIGPSGSGKSTFLRALNRLWEPASATVF  84

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG DIC LDVL LR +VGMLFQLP +FEGTVADN+RYGP LRGKK+SD++V  LL+LAD
Sbjct  85   LDGVDICQLDVLHLRRRVGMLFQLPVMFEGTVADNVRYGPQLRGKKVSDNEVHNLLALAD  144

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LD SF +K GGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDV+V+LKK
Sbjct  145  LDPSFYSKSGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVMVKLKK  204

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            ++ MTI MVSHSIKQIQRIADVVCLLV GEIVE+LKPDQLS+AKHPMAQ
Sbjct  205  DREMTIVMVSHSIKQIQRIADVVCLLVNGEIVEILKPDQLSEAKHPMAQ  253



>ref|XP_007010833.1| Non-intrinsic ABC protein 3 [Theobroma cacao]
 gb|EOY19643.1| Non-intrinsic ABC protein 3 [Theobroma cacao]
Length=261

 Score =   355 bits (910),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 189/250 (76%), Positives = 215/250 (86%), Gaps = 6/250 (2%)
 Frame = +1

Query  190  ELLLMVDGDDEAA------GTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGS  351
             LLL VD  D         G K +++GL +VS+ G+ +LN I++DIP+G+I+GIIGPSGS
Sbjct  5    HLLLTVDDSDHQHSNHHDRGVKFEIRGLRKVSEAGVPILNGISVDIPKGMIVGIIGPSGS  64

Query  352  GKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYG  531
            GKST LRALNRLWEP + TVFLDG DI DLDVL LR KVGMLFQLP LF+GTVADNIRYG
Sbjct  65   GKSTMLRALNRLWEPQSNTVFLDGHDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYG  124

Query  532  PLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEP  711
            P LRGKKLSD++V +LL+LADLDSSF +K GGELSVGQAQRVALARTLANEPEVLLLDEP
Sbjct  125  PRLRGKKLSDEEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEP  184

Query  712  TSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQ  891
            TSALDPISTQNIEDV+V+LKK+K MT+ MVSHSIKQIQR+ADVVCLLV GEIVEVLKP +
Sbjct  185  TSALDPISTQNIEDVIVKLKKKKGMTVVMVSHSIKQIQRVADVVCLLVNGEIVEVLKPGE  244

Query  892  LSQAKHPMAQ  921
            LS+AKHPMAQ
Sbjct  245  LSEAKHPMAQ  254



>ref|XP_010265390.1| PREDICTED: ABC transporter I family member 17 isoform X1 [Nelumbo 
nucifera]
Length=261

 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/253 (74%), Positives = 215/253 (85%), Gaps = 3/253 (1%)
 Frame = +1

Query  169  MEVPEERELLLMVDGDD---EAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIG  339
            ME   +   + M++G D       +KIQV+GLTRVSD G+ +LN +++DIP+G+I+GIIG
Sbjct  1    METTPDETRIPMLNGVDVIEPETKSKIQVRGLTRVSDTGVPILNGVSVDIPKGVIVGIIG  60

Query  340  PSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADN  519
            PSGSGKST LRALNRLWEP   TV LDG+DICDLDVL+LR KVGMLFQLP LF+GTVADN
Sbjct  61   PSGSGKSTLLRALNRLWEPPAGTVLLDGRDICDLDVLTLRRKVGMLFQLPVLFDGTVADN  120

Query  520  IRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLL  699
            IRYGP LRGKKLSD +V +LL+LADLDSSF  K GGELSVGQAQRVALARTLAN+P+VLL
Sbjct  121  IRYGPQLRGKKLSDTEVSKLLNLADLDSSFATKAGGELSVGQAQRVALARTLANDPKVLL  180

Query  700  LDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVL  879
            LDEPTSALDPISTQNIED +V+LKK + MT  MVSHS+KQIQRIADVVCLLV GEIVEVL
Sbjct  181  LDEPTSALDPISTQNIEDAIVKLKKARSMTTVMVSHSVKQIQRIADVVCLLVNGEIVEVL  240

Query  880  KPDQLSQAKHPMA  918
            KPD LS+AKHPMA
Sbjct  241  KPDHLSEAKHPMA  253



>gb|EPS72839.1| hypothetical protein M569_01919, partial [Genlisea aurea]
Length=256

 Score =   350 bits (898),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 210/229 (92%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            KI+V+ LT++SDK + +LN++ LDIP+G+IMG+IGPSGSGKSTFLRALNRLWEP   +VF
Sbjct  21   KIEVRDLTKISDKDVMILNKLNLDIPKGVIMGVIGPSGSGKSTFLRALNRLWEPPPTSVF  80

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG DIC LDVL+LR +VGMLFQLP LFEGTVADN+RYGP L+GKKLSD++V +LL+LAD
Sbjct  81   LDGVDICKLDVLNLRRRVGMLFQLPVLFEGTVADNVRYGPQLKGKKLSDEEVYKLLTLAD  140

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LDS+F  K GGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQN+EDVLV+LKK
Sbjct  141  LDSTFFAKAGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNVEDVLVKLKK  200

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            E+ +T+ +VSHSIKQIQRIADVVCL+V GEIVE+LKP+QLS+AKHPMA+
Sbjct  201  ERELTVVIVSHSIKQIQRIADVVCLVVSGEIVEILKPNQLSEAKHPMAK  249



>gb|AIU41664.1| ABC transporter family protein [Hevea brasiliensis]
Length=283

 Score =   348 bits (894),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 216/251 (86%), Gaps = 4/251 (2%)
 Frame = +1

Query  181  EERELLLMVDGDDEAAG----TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSG  348
            ++R+  L+  GD EA G     K +++ LT+ SD G+T+L+ + LDIP+G+++GIIGPSG
Sbjct  26   DDRQEHLLAVGDIEAGGDDPQNKFRIRDLTKKSDAGVTILSGVNLDIPKGVVVGIIGPSG  85

Query  349  SGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRY  528
            SGKST LR++NRLWEP + TVFLDG DI DLDVLSLR KVGMLFQ+PALFEGTVADNIR+
Sbjct  86   SGKSTLLRSMNRLWEPPSGTVFLDGHDIRDLDVLSLRRKVGMLFQIPALFEGTVADNIRF  145

Query  529  GPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDE  708
            GP LRG+KL D +V +LL+LADLDSSF  K G ELSVGQAQRVALARTLANEPEVLLLDE
Sbjct  146  GPQLRGQKLPDHEVHKLLALADLDSSFHKKNGNELSVGQAQRVALARTLANEPEVLLLDE  205

Query  709  PTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPD  888
            PTSALDPISTQNIEDV+V+LKK + MTI MVSHSIKQIQRIADVVCLLV GE+VEVLKPD
Sbjct  206  PTSALDPISTQNIEDVIVKLKKTQGMTIVMVSHSIKQIQRIADVVCLLVNGEVVEVLKPD  265

Query  889  QLSQAKHPMAQ  921
            +LSQAKHPMAQ
Sbjct  266  ELSQAKHPMAQ  276



>gb|EYU21787.1| hypothetical protein MIMGU_mgv1a012074mg [Erythranthe guttata]
Length=262

 Score =   347 bits (891),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 206/234 (88%), Gaps = 0/234 (0%)
 Frame = +1

Query  220  EAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPA  399
             +A  KI+V+ LT+VSDK   +LN++++DIPRG IMG+IGPSGSGKSTFLRALNRLWEPA
Sbjct  22   HSASAKIEVRDLTKVSDKDEVILNKVSVDIPRGAIMGVIGPSGSGKSTFLRALNRLWEPA  81

Query  400  NATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrl  579
            +ATVFLDG DICD+DVL+LR KVGMLFQLP LF+GTVADN+RYGP L GKKLSD+++ +L
Sbjct  82   SATVFLDGVDICDIDVLTLRRKVGMLFQLPVLFQGTVADNVRYGPELSGKKLSDNEIYKL  141

Query  580  lsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVL  759
            L+LADLDSSF  K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVL
Sbjct  142  LALADLDSSFYIKSGAELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVL  201

Query  760  VRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            V+LK E  +T+ +VSHSIKQIQRIADV CLLV GEIVE+L P  LS AKHPMAQ
Sbjct  202  VKLKNEIGLTVVIVSHSIKQIQRIADVACLLVNGEIVEILPPHHLSLAKHPMAQ  255



>gb|KDO61984.1| hypothetical protein CISIN_1g022337mg [Citrus sinensis]
Length=298

 Score =   346 bits (887),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 192/259 (74%), Positives = 216/259 (83%), Gaps = 6/259 (2%)
 Frame = +1

Query  160  SCLMEVPEERELLLMVDGDDEAAGT------KIQVKGLTRVSDKGLTLLNQITLDIPRGL  321
            +C +   E RE LL V G+ EA         K +V+ L + SD G  +L  + ++IP+G+
Sbjct  32   TCSLFRDEVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEIPKGV  91

Query  322  IMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFE  501
            IMGIIGPSGSGKST LRALNRLWEP + TVFLDG+DI DLDVLSLR KVGMLFQ+PALFE
Sbjct  92   IMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFE  151

Query  502  GTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLAN  681
            GTV DNIRYGP LRGKKL++++V +LLSLADLDSSF NK GGE+SVGQAQRVALARTLAN
Sbjct  152  GTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLAN  211

Query  682  EPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEG  861
            EPEVLLLDEPTSALDPISTQNIEDVLV+LKK+  MTI MVSHSIKQIQRIADVVCLLV G
Sbjct  212  EPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNG  271

Query  862  EIVEVLKPDQLSQAKHPMA  918
            EIVEVLKPD LS+AKHPMA
Sbjct  272  EIVEVLKPDLLSEAKHPMA  290



>ref|XP_006453206.1| hypothetical protein CICLE_v10009186mg [Citrus clementina]
 ref|XP_006474308.1| PREDICTED: ABC transporter I family member 17-like [Citrus sinensis]
 gb|ESR66446.1| hypothetical protein CICLE_v10009186mg [Citrus clementina]
Length=270

 Score =   344 bits (883),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 191/259 (74%), Positives = 216/259 (83%), Gaps = 6/259 (2%)
 Frame = +1

Query  160  SCLMEVPEERELLLMVDGDDEAAGT------KIQVKGLTRVSDKGLTLLNQITLDIPRGL  321
            +C +   E RE LL V G+ EA         K +V+ L + SD G  +L  + ++IP+G+
Sbjct  4    TCSLFRDEVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEIPKGV  63

Query  322  IMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFE  501
            IMGIIGPSGSGKST LRALNRLWEP + TVFLDG+DI DLDVLSLR KVGMLFQ+PALFE
Sbjct  64   IMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFE  123

Query  502  GTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLAN  681
            GTVADNIRYGP LRGKKL++++V +LLSLADLDSSF +K G E+SVGQAQRVALARTLAN
Sbjct  124  GTVADNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLSKTGAEISVGQAQRVALARTLAN  183

Query  682  EPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEG  861
            EPEVLLLDEPTSALDPISTQNIEDVLV+LKK+  MTI MVSHSIKQIQRIADVVCLLV G
Sbjct  184  EPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNG  243

Query  862  EIVEVLKPDQLSQAKHPMA  918
            EIVEVLKPD LS+AKHPMA
Sbjct  244  EIVEVLKPDLLSEAKHPMA  262



>ref|XP_010110724.1| ABC transporter I family member 17 [Morus notabilis]
 gb|EXC27889.1| ABC transporter I family member 17 [Morus notabilis]
Length=264

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 183/247 (74%), Positives = 214/247 (87%), Gaps = 3/247 (1%)
 Frame = +1

Query  187  RELLLMVDGD---DEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGK  357
            RE LL+VDGD   +E +  K +++ L + S+ G  +LN +++D+P+G+I+GIIGPSGSGK
Sbjct  10   REHLLVVDGDGGENEGSEVKFRIRELRKWSESGDPILNGVSVDVPKGVIVGIIGPSGSGK  69

Query  358  STFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPL  537
            ST LRALNRLWEP   +V LDG+DIC++DVL LR KVGMLFQLP LFEGTVADNIRYGP 
Sbjct  70   STLLRALNRLWEPPPGSVLLDGRDICEIDVLDLRRKVGMLFQLPVLFEGTVADNIRYGPQ  129

Query  538  LRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTS  717
            LRGKKLSD +V +LL+LADLDSSF  K G ELSVGQAQRVALARTLANEPEVLLLDEPTS
Sbjct  130  LRGKKLSDQEVHKLLTLADLDSSFYTKAGSELSVGQAQRVALARTLANEPEVLLLDEPTS  189

Query  718  ALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLS  897
            ALDPIST+NIEDV+V+LKK++ MTI MVSHSIKQIQR+ADVVCLLV GEIVEVLKPD+LS
Sbjct  190  ALDPISTENIEDVIVKLKKKQGMTILMVSHSIKQIQRVADVVCLLVNGEIVEVLKPDELS  249

Query  898  QAKHPMA  918
            +AKHPMA
Sbjct  250  EAKHPMA  256



>gb|KDP35911.1| hypothetical protein JCGZ_09883 [Jatropha curcas]
Length=272

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 211/248 (85%), Gaps = 3/248 (1%)
 Frame = +1

Query  187  RELLLMVD---GDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGK  357
            RE L  VD    D   +  K ++K L + SD G+T+LN I LDIP+G+I+GIIGPSGSGK
Sbjct  18   REHLFTVDDFESDIGGSQIKFRIKNLIKKSDAGVTILNGINLDIPKGVIVGIIGPSGSGK  77

Query  358  STFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPL  537
            ST LR+LNRLWEP + TVFLDG+DI DLDVL LR +VGMLFQ+PALFEGTVADNIRYGP 
Sbjct  78   STLLRSLNRLWEPPSGTVFLDGRDIRDLDVLGLRRRVGMLFQVPALFEGTVADNIRYGPQ  137

Query  538  LRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTS  717
            LRGKKL+D +V +LL LADLDS+F  K G ELSVGQAQRVALARTLANEPEVLLLDEPTS
Sbjct  138  LRGKKLTDHEVHKLLKLADLDSTFHKKNGSELSVGQAQRVALARTLANEPEVLLLDEPTS  197

Query  718  ALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLS  897
            ALDPISTQNIEDV+V+LK+ + MT+ MVSHSIKQIQR+ADVVCL+V GE+VEVLKP++LS
Sbjct  198  ALDPISTQNIEDVIVKLKENRGMTVVMVSHSIKQIQRVADVVCLVVNGEVVEVLKPNELS  257

Query  898  QAKHPMAQ  921
            +AKHPMAQ
Sbjct  258  EAKHPMAQ  265



>ref|XP_002325227.2| hypothetical protein POPTR_0018s13190g [Populus trichocarpa]
 gb|EEF03792.2| hypothetical protein POPTR_0018s13190g [Populus trichocarpa]
Length=272

 Score =   343 bits (879),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 184/247 (74%), Positives = 212/247 (86%), Gaps = 0/247 (0%)
 Frame = +1

Query  181  EERELLLMVDGDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKS  360
            +E  L + V+   + A  K +++ LT+VSD G+ +LN I +DIP+G+I+GIIGPSGSGKS
Sbjct  19   QEPLLAVNVEAAKDGAEAKFRIRNLTKVSDAGVPILNGINMDIPKGMIVGIIGPSGSGKS  78

Query  361  TFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLL  540
            T LRALNRLWEP + TVFLDG D+ DLDVL  R KVGMLFQLPALF+GTVADNIRYGP L
Sbjct  79   TVLRALNRLWEPPSGTVFLDGHDVKDLDVLGHRRKVGMLFQLPALFDGTVADNIRYGPQL  138

Query  541  RGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSA  720
            +GKKL+DD+V +LLSLADLDSSF  K   ELSVGQAQRVALARTLANEPEVLLLDEPTSA
Sbjct  139  KGKKLTDDEVYKLLSLADLDSSFYKKTSNELSVGQAQRVALARTLANEPEVLLLDEPTSA  198

Query  721  LDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQ  900
            LDPISTQNIEDVLV+LKK++ +T+ +VSHSIKQIQRIADVVCLLV GEIVEVLKPD LS+
Sbjct  199  LDPISTQNIEDVLVKLKKQRGLTVVIVSHSIKQIQRIADVVCLLVNGEIVEVLKPDDLSE  258

Query  901  AKHPMAQ  921
            AKHPMAQ
Sbjct  259  AKHPMAQ  265



>ref|XP_010556228.1| PREDICTED: ABC transporter I family member 17 [Tarenaya hassleriana]
Length=271

 Score =   341 bits (875),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/247 (74%), Positives = 209/247 (85%), Gaps = 3/247 (1%)
 Frame = +1

Query  190  ELLLMVDGDDEAAGT---KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKS  360
            E L++VD ++    +   KI V+ LTRVS+ G  +L  +T+ IPRG+I+GIIGPSGSGKS
Sbjct  18   EHLVVVDAEERQESSREPKIWVRDLTRVSEIGSPVLRGVTVAIPRGMIVGIIGPSGSGKS  77

Query  361  TFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLL  540
            TFLR LNRLWEP  ATVFLDG DI ++DV+ LR +VGMLFQLP LF+GTVADN+RYGP L
Sbjct  78   TFLRCLNRLWEPPPATVFLDGDDITEIDVIMLRRRVGMLFQLPVLFDGTVADNVRYGPQL  137

Query  541  RGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSA  720
            RG+KLSD +V  LL LADLD+SFC K G ELSVGQAQRVALARTLANEPEVLLLDEPTSA
Sbjct  138  RGQKLSDKEVCELLKLADLDASFCEKIGAELSVGQAQRVALARTLANEPEVLLLDEPTSA  197

Query  721  LDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQ  900
            LDPISTQNIEDV+V+LKK++ MTI MVSHSIKQIQRIAD+VCLLV GEIVEVLKP  LSQ
Sbjct  198  LDPISTQNIEDVIVKLKKQREMTIVMVSHSIKQIQRIADIVCLLVNGEIVEVLKPQDLSQ  257

Query  901  AKHPMAQ  921
            AKHPMAQ
Sbjct  258  AKHPMAQ  264



>ref|XP_002522043.1| phosphate abc transporter, putative [Ricinus communis]
 gb|EEF40243.1| phosphate abc transporter, putative [Ricinus communis]
Length=276

 Score =   340 bits (871),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 206/238 (87%), Gaps = 2/238 (1%)
 Frame = +1

Query  208  DGDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRL  387
            D DD     K +++ LTR +D G  +LN + LD+P+G+I+GI+GPSGSGKSTFLR+LNRL
Sbjct  34   DNDDNQY--KFRIRNLTRETDGGAKILNGVNLDVPKGVIVGIVGPSGSGKSTFLRSLNRL  91

Query  388  WEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdq  567
            WEP   TVFLDG DI DLDVLSLR KVGMLFQ+P LFEGT+ADNIRYGP LRGKKLSD++
Sbjct  92   WEPPPGTVFLDGCDIRDLDVLSLRRKVGMLFQIPVLFEGTIADNIRYGPQLRGKKLSDNE  151

Query  568  vlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNI  747
            V +LL LADLDSSF  K  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNI
Sbjct  152  VHKLLILADLDSSFHKKNYGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNI  211

Query  748  EDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            E+V+V+LKK + MTI MVSHSIKQIQR+ADVVCLLV GE+VEVLKP++LS+AKHPMAQ
Sbjct  212  EEVIVKLKKNQGMTIVMVSHSIKQIQRVADVVCLLVNGEVVEVLKPNELSEAKHPMAQ  269



>gb|KHG02984.1| ABC transporter I family member 17 [Gossypium arboreum]
Length=300

 Score =   340 bits (873),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            K Q++ L +VSD G+ +LN I + IP+G+I+GIIGPSGSGKST LRALNRLWEP + TVF
Sbjct  24   KFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVF  83

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG+DI DLDVL LR KVGMLFQLP LF+GTVADNIRYG  L GKKL+D +V +LL+LAD
Sbjct  84   LDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLAD  143

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LDSSF +K GGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDV+V+LKK
Sbjct  144  LDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKK  203

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            ++RMT+ MVSHSIKQIQR+ADVVCLLV GEIVE+LKP +LS+AKHPMAQ
Sbjct  204  KRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQ  252



>ref|XP_007160546.1| hypothetical protein PHAVU_002G330700g [Phaseolus vulgaris]
 gb|ESW32540.1| hypothetical protein PHAVU_002G330700g [Phaseolus vulgaris]
Length=257

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/245 (73%), Positives = 210/245 (86%), Gaps = 3/245 (1%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTF  366
            RE LL VD +   A  K +++ LTRVS  G+++L  I LDIP+G+ +GIIGPSGSGKST 
Sbjct  9    REHLLEVDAN---AKLKFEIRNLTRVSHDGVSILKGINLDIPKGVTVGIIGPSGSGKSTL  65

Query  367  LRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG  546
            LRALNRLWEP +A+VFLDG+DI  LDVLSLR KVGMLFQLPALF+GTV DN+RYGP LRG
Sbjct  66   LRALNRLWEPPSASVFLDGQDISHLDVLSLRRKVGMLFQLPALFQGTVGDNVRYGPGLRG  125

Query  547  KKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALD  726
            KKLSDD+V +LL +ADLD+SF +K G ELSVGQAQRVALARTLAN PEVLLLDEPTSALD
Sbjct  126  KKLSDDEVRKLLEMADLDASFMDKSGAELSVGQAQRVALARTLANSPEVLLLDEPTSALD  185

Query  727  PISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAK  906
            PIST+NIED L++L K + MT+ MVSHSIKQIQRIAD+VCLLV+GEIVEVLKPD+LS+A 
Sbjct  186  PISTENIEDALMKLNKNRGMTVIMVSHSIKQIQRIADMVCLLVDGEIVEVLKPDKLSEAN  245

Query  907  HPMAQ  921
            HPMA+
Sbjct  246  HPMAR  250



>ref|XP_009346033.1| PREDICTED: ABC transporter I family member 17-like [Pyrus x bretschneideri]
 ref|XP_009346034.1| PREDICTED: ABC transporter I family member 17-like [Pyrus x bretschneideri]
Length=273

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/249 (72%), Positives = 208/249 (84%), Gaps = 1/249 (0%)
 Frame = +1

Query  175  VPEERELLLMVDGDDEAAGTKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGS  351
            V   RE LL VD  +     K +++ L + SD  G ++LN +TLDIPRG+IMG+IGPSGS
Sbjct  17   VEAAREHLLTVDNGEAHGDVKFRIQNLAKKSDTTGASILNGLTLDIPRGVIMGVIGPSGS  76

Query  352  GKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYG  531
            GKST LRALNRLWEP + TVFLDG D+ D DVLSLR KVGMLFQLP LFEGTVADNIRYG
Sbjct  77   GKSTLLRALNRLWEPPSGTVFLDGHDVLDTDVLSLRRKVGMLFQLPVLFEGTVADNIRYG  136

Query  532  PLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEP  711
            P L+G+KLSD++V +LL+L DLDSSF  K G E+SVGQ+QRVALARTLAN PEVLLLDEP
Sbjct  137  PQLKGRKLSDEEVHKLLNLVDLDSSFATKTGSEMSVGQSQRVALARTLANSPEVLLLDEP  196

Query  712  TSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQ  891
            TSALDPIST++IE  LV+LK+++ MTI MVSHSIKQIQRIAD+VCLLV+GEIVEVLKPDQ
Sbjct  197  TSALDPISTEHIEGALVKLKQKQGMTIVMVSHSIKQIQRIADIVCLLVDGEIVEVLKPDQ  256

Query  892  LSQAKHPMA  918
            LSQA HPMA
Sbjct  257  LSQANHPMA  265



>gb|KFK41217.1| hypothetical protein AALP_AA2G100800 [Arabis alpina]
Length=265

 Score =   337 bits (863),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 214/242 (88%), Gaps = 2/242 (1%)
 Frame = +1

Query  202  MVDGDDEAAGT--KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRA  375
            +VD DD  +G   KI+V+ LTRVSD G  +L  +T+DIP+G+I+G+IGPSGSGKSTFLR+
Sbjct  17   LVDVDDLLSGQEPKIRVRDLTRVSDDGSLILRGVTIDIPKGMIIGVIGPSGSGKSTFLRS  76

Query  376  LNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKL  555
            LNRLWEP   TVFL+G+DI ++DV++LR +VGMLFQLP LF+GTVADN+RYGP LRG+KL
Sbjct  77   LNRLWEPPETTVFLNGEDITNIDVITLRRRVGMLFQLPVLFQGTVADNVRYGPNLRGEKL  136

Query  556  SDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
            +++ V +LLSLADLD+SF  K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS
Sbjct  137  TEEAVYKLLSLADLDASFAKKTGAELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  196

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPM  915
            T+NIEDV+V+LKK++ +T  +VSHSIKQIQR+AD+VCL+V+GEIVEVLKPD+LSQA+HPM
Sbjct  197  TENIEDVIVKLKKQRGITTVIVSHSIKQIQRVADIVCLVVDGEIVEVLKPDELSQARHPM  256

Query  916  AQ  921
            A+
Sbjct  257  AK  258



>ref|XP_009349086.1| PREDICTED: ABC transporter I family member 17-like [Pyrus x bretschneideri]
Length=273

 Score =   337 bits (863),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 179/249 (72%), Positives = 207/249 (83%), Gaps = 1/249 (0%)
 Frame = +1

Query  175  VPEERELLLMVDGDDEAAGTKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGS  351
            V   RE LL VD  +     K +++ L + SD  G ++LN +TLDIP+G+IMG+IGPSGS
Sbjct  17   VEAAREHLLTVDNGEAHGDVKFRIQNLAKKSDTTGASILNGLTLDIPKGVIMGVIGPSGS  76

Query  352  GKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYG  531
            GKST LRALNRLWEP + TVFLDG D+ D DVLSLR KVGMLFQLP LFEGTVADNIRYG
Sbjct  77   GKSTLLRALNRLWEPPSGTVFLDGHDVLDTDVLSLRRKVGMLFQLPVLFEGTVADNIRYG  136

Query  532  PLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEP  711
            P L+G+KLSD+ V +LL+L DLDSSF  K G E+SVGQ+QRVALARTLAN PEVLLLDEP
Sbjct  137  PQLKGRKLSDEDVHKLLNLVDLDSSFATKTGSEMSVGQSQRVALARTLANSPEVLLLDEP  196

Query  712  TSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQ  891
            TSALDPIST++IE  LV+LK+++ MTI MVSHSIKQIQRIAD+VCLLV+GEIVEVLKPDQ
Sbjct  197  TSALDPISTEHIEGALVKLKQKQGMTIVMVSHSIKQIQRIADIVCLLVDGEIVEVLKPDQ  256

Query  892  LSQAKHPMA  918
            LSQA HPMA
Sbjct  257  LSQANHPMA  265



>ref|XP_011017753.1| PREDICTED: ABC transporter I family member 17 [Populus euphratica]
Length=272

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/246 (74%), Positives = 211/246 (86%), Gaps = 0/246 (0%)
 Frame = +1

Query  181  EERELLLMVDGDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKS  360
            +E  L + V+   + A  K +++ LT+VSD G+ +L+ I +DIP+G+I+GIIGPSGSGKS
Sbjct  19   QEPLLAVNVEAAKDGAEAKFRIRNLTKVSDTGVPILSGINMDIPKGMIVGIIGPSGSGKS  78

Query  361  TFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLL  540
            T LRALNRLWEP   TVFLDG D+ DLDVL  R KVGMLFQLPALF+GTVADNIRYGPLL
Sbjct  79   TVLRALNRLWEPPCGTVFLDGHDVNDLDVLGHRRKVGMLFQLPALFDGTVADNIRYGPLL  138

Query  541  RGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSA  720
            +GKKL+DD+V +LLSLADLDSSF  K   ELSVGQAQRVALARTLAN+PEVLLLDEPTSA
Sbjct  139  KGKKLTDDEVYKLLSLADLDSSFYKKTSNELSVGQAQRVALARTLANQPEVLLLDEPTSA  198

Query  721  LDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQ  900
            LDPISTQNIE+VLV+LKK++ +T+ +VSHSIKQIQRIADVVCLLV GEIVEVLKPD LS+
Sbjct  199  LDPISTQNIEEVLVKLKKQRGLTVVIVSHSIKQIQRIADVVCLLVNGEIVEVLKPDDLSE  258

Query  901  AKHPMA  918
            AKHPMA
Sbjct  259  AKHPMA  264



>ref|XP_007224441.1| hypothetical protein PRUPE_ppa022227mg, partial [Prunus persica]
 gb|EMJ25640.1| hypothetical protein PRUPE_ppa022227mg, partial [Prunus persica]
Length=258

 Score =   335 bits (860),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/245 (74%), Positives = 208/245 (85%), Gaps = 1/245 (0%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGSGKST  363
            RE LL VD  +     K +++ LT+ S+  G  +LN ++LDIP+G+I+G+IGPSGSGKST
Sbjct  6    REHLLTVDIGEADGDVKFRIRNLTKKSETTGCAILNGLSLDIPKGVIVGVIGPSGSGKST  65

Query  364  FLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLR  543
             LRALNRLWEP + TVFLDG D+ DLDVLSLR KVGMLFQLPALFEGTVADNIRYGP LR
Sbjct  66   LLRALNRLWEPPSGTVFLDGHDLRDLDVLSLRRKVGMLFQLPALFEGTVADNIRYGPQLR  125

Query  544  GKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSAL  723
            GKKLSD  V +LL+L DLDSSF +K G E+SVGQAQRVALARTLAN PEVLLLDEPTSAL
Sbjct  126  GKKLSDQNVHKLLTLVDLDSSFFSKTGSEMSVGQAQRVALARTLANSPEVLLLDEPTSAL  185

Query  724  DPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQA  903
            DPIST++IE  L +LKK++ MTI MVSHSIKQIQRIAD+VCLLV+GEIVEVLKPDQLSQA
Sbjct  186  DPISTEHIEGALEKLKKKQGMTIIMVSHSIKQIQRIADIVCLLVDGEIVEVLKPDQLSQA  245

Query  904  KHPMA  918
            +HPMA
Sbjct  246  QHPMA  250



>ref|XP_010033774.1| PREDICTED: ABC transporter I family member 17 [Eucalyptus grandis]
 gb|KCW53582.1| hypothetical protein EUGRSUZ_J02855 [Eucalyptus grandis]
Length=271

 Score =   335 bits (859),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 212/249 (85%), Gaps = 2/249 (1%)
 Frame = +1

Query  181  EERELLLMVDGDD--EAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSG  354
            E +E LL+VD  D  +    K +VKGL +VSD G  +L +I L+IP+G I+GIIGPSGSG
Sbjct  16   EAQEHLLVVDIADGVKEDRAKFEVKGLNKVSDAGDPILREINLEIPQGKIVGIIGPSGSG  75

Query  355  KSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGP  534
            KST LRALNRLWEP + TVFLDG+DI +LDVLSLR KVGMLFQLPA+FEGTVADN+RYGP
Sbjct  76   KSTLLRALNRLWEPPSGTVFLDGEDIKNLDVLSLRRKVGMLFQLPAMFEGTVADNVRYGP  135

Query  535  LLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPT  714
             L GKKL+D +V +LL+LADLDSS  ++ G ELSVGQAQRVALARTLANEPEVLLLDEPT
Sbjct  136  QLMGKKLTDGEVFKLLNLADLDSSLFSRAGSELSVGQAQRVALARTLANEPEVLLLDEPT  195

Query  715  SALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            SALDPISTQNIEDVLV+LKK + +T  MVSHSIKQIQRIADVVCLLV GE+VEVL PD+L
Sbjct  196  SALDPISTQNIEDVLVKLKKTQGLTTIMVSHSIKQIQRIADVVCLLVSGELVEVLTPDRL  255

Query  895  SQAKHPMAQ  921
            S+AKHPMAQ
Sbjct  256  SEAKHPMAQ  264



>emb|CDX96058.1| BnaA07g26730D [Brassica napus]
Length=264

 Score =   335 bits (858),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            KI+V+ LTRVSD G  +L  +++DIP+G+I+G+IGPSGSGKSTFLR+LNRLWEP   TVF
Sbjct  29   KIRVRDLTRVSDDGSLILKGVSMDIPKGMIVGVIGPSGSGKSTFLRSLNRLWEPPATTVF  88

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG DI ++DV++LR +VGMLFQLP LFEGTVADN+RYGP LRG+KLSD  V +LL+ AD
Sbjct  89   LDGVDITNIDVITLRRRVGMLFQLPVLFEGTVADNVRYGPNLRGEKLSDQDVYKLLTFAD  148

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LD+SF  K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST+NIEDV+V+LKK
Sbjct  149  LDASFAKKTGSELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTENIEDVIVKLKK  208

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            ++ +T  +VSHSIKQIQR+AD+VCL+V+GEIVEVLKPD+LSQA HPMA+
Sbjct  209  QRGITTVIVSHSIKQIQRVADIVCLVVDGEIVEVLKPDELSQATHPMAR  257



>ref|XP_009105344.1| PREDICTED: ABC transporter I family member 17 [Brassica rapa]
Length=264

 Score =   334 bits (857),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            KI+V+ LTRVSD G  +L  +++DIP+G+I+G+IGPSGSGKSTFLR+LNRLWEP   TVF
Sbjct  29   KIRVRDLTRVSDDGSLILKGVSMDIPKGMIVGVIGPSGSGKSTFLRSLNRLWEPPATTVF  88

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG DI ++DV++LR +VGMLFQLP LFEGTVADN+RYGP LRG+KLSD  V +LL+ AD
Sbjct  89   LDGVDITNIDVITLRRRVGMLFQLPVLFEGTVADNVRYGPNLRGEKLSDQDVYKLLTFAD  148

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LD+SF  K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST+NIEDV+V+LKK
Sbjct  149  LDASFAKKTGSELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTENIEDVIVKLKK  208

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            ++ +T  +VSHSIKQIQR+AD+VCL+V+GEIVEVLKPD+LSQA HPMA+
Sbjct  209  QRGITTVIVSHSIKQIQRVADIVCLVVDGEIVEVLKPDELSQATHPMAR  257



>ref|XP_009359982.1| PREDICTED: ABC transporter I family member 17-like [Pyrus x bretschneideri]
 ref|XP_009349234.1| PREDICTED: ABC transporter I family member 17-like [Pyrus x bretschneideri]
Length=273

 Score =   334 bits (857),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 179/245 (73%), Positives = 206/245 (84%), Gaps = 1/245 (0%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGSGKST  363
            RE LL VD  +     K +++ L + SD  G  +LN +TL+IPRG+IMG+IGPSGSGKST
Sbjct  21   REHLLTVDVGEADGDVKFRIRNLAKKSDTTGAAILNGLTLNIPRGVIMGVIGPSGSGKST  80

Query  364  FLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLR  543
             LRALNRLWEP + TVFLDG+DI D+DVLSLR KVGMLFQLP LFEGTVADNIRYGP L+
Sbjct  81   LLRALNRLWEPPSGTVFLDGRDILDVDVLSLRRKVGMLFQLPVLFEGTVADNIRYGPQLK  140

Query  544  GKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSAL  723
            GKKLSD+ V +LL+L DLDSSF  K G E+SVGQ+QRVALARTLAN PEVLLLDEPTSAL
Sbjct  141  GKKLSDEDVHKLLTLVDLDSSFSTKTGSEMSVGQSQRVALARTLANSPEVLLLDEPTSAL  200

Query  724  DPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQA  903
            DPIST+ IE  L +LK+++ MTI MVSHSIKQIQRIAD+VCLLV+GEIVEVLKPDQLSQA
Sbjct  201  DPISTERIEGALEKLKQKQGMTIVMVSHSIKQIQRIADIVCLLVDGEIVEVLKPDQLSQA  260

Query  904  KHPMA  918
            +HPMA
Sbjct  261  QHPMA  265



>ref|XP_010415418.1| PREDICTED: ABC transporter I family member 17-like [Camelina 
sativa]
Length=264

 Score =   333 bits (855),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 206/229 (90%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            KI+V  LTRV+D G  +L  +++DIP+G+I+G+IGPSGSGKSTFLR+LNRLWEP  +TVF
Sbjct  29   KIRVHDLTRVADDGSRILKGVSIDIPKGMIVGVIGPSGSGKSTFLRSLNRLWEPPESTVF  88

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG+DI  +DV++LR +VGMLFQLP LF+GTVADN+RYGP LRG+KL+D++V +LLSLAD
Sbjct  89   LDGEDITKVDVITLRRRVGMLFQLPVLFQGTVADNVRYGPNLRGEKLNDEEVYKLLSLAD  148

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LD+SF  K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST+NIEDV+VRLKK
Sbjct  149  LDASFAKKTGAELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTENIEDVIVRLKK  208

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            ++ +T  +VSHSIKQIQ++ADVVCL+V+GEIVEVLKP +LSQAKHPMAQ
Sbjct  209  QRGITTVIVSHSIKQIQKVADVVCLVVDGEIVEVLKPSELSQAKHPMAQ  257



>ref|XP_010511791.1| PREDICTED: ABC transporter I family member 17 [Camelina sativa]
Length=264

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/245 (71%), Positives = 211/245 (86%), Gaps = 0/245 (0%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTF  366
            RE L+ V     +   KI+V  LTRV+D G  +L  +++DIP+G+I+G+IGPSGSGKSTF
Sbjct  13   REHLVDVVVSSGSEEPKIRVHDLTRVADDGSRILKGVSIDIPKGMIVGVIGPSGSGKSTF  72

Query  367  LRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG  546
            LR+LNRLWEP  +TVFLDG+DI  +DV++LR +VGMLFQLP LF+GTVADN+RYGP LRG
Sbjct  73   LRSLNRLWEPPESTVFLDGEDITKVDVITLRRRVGMLFQLPVLFQGTVADNVRYGPNLRG  132

Query  547  KKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALD  726
            +KL+D++V +LLSLADLD+SF  K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALD
Sbjct  133  EKLNDEEVYKLLSLADLDASFAKKTGAELSVGQAQRVALARTLANEPEVLLLDEPTSALD  192

Query  727  PISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAK  906
            PIST+NIEDV+VRLKK++ +T  MVSHSIKQIQ++ADVVCL+V+GEIVEVLKP +LS AK
Sbjct  193  PISTENIEDVIVRLKKQRGITTVMVSHSIKQIQKVADVVCLVVDGEIVEVLKPSELSHAK  252

Query  907  HPMAQ  921
            HPMAQ
Sbjct  253  HPMAQ  257



>ref|XP_008378893.1| PREDICTED: ABC transporter I family member 17-like [Malus domestica]
Length=273

 Score =   333 bits (853),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 178/245 (73%), Positives = 205/245 (84%), Gaps = 1/245 (0%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGSGKST  363
            RE LL VD  +     K +++ L + SD  G  +LN +TLDIP+GLIMG+IGPSGSGKST
Sbjct  21   REHLLTVDVGEADGDVKFRIRNLAKKSDTTGAAILNGLTLDIPKGLIMGVIGPSGSGKST  80

Query  364  FLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLR  543
             LRALNRLWEP + TVFLDG+DI D+DVLSLR KVGMLFQLP LFEGTVADNIRYGP L+
Sbjct  81   LLRALNRLWEPPSGTVFLDGRDILDVDVLSLRRKVGMLFQLPVLFEGTVADNIRYGPQLK  140

Query  544  GKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSAL  723
            GKK+ D+ V +LL+L DLDSSF  K G E+SVGQ+QRVALARTLAN PEVLLLDEPTSAL
Sbjct  141  GKKVGDEDVHKLLTLVDLDSSFSTKTGSEMSVGQSQRVALARTLANSPEVLLLDEPTSAL  200

Query  724  DPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQA  903
            DPIST+ IE  L +LK+++ MTI MVSHSIKQIQRIAD+VCLLV+GEIVEVLKPDQLSQA
Sbjct  201  DPISTERIEGALEKLKQKQGMTIVMVSHSIKQIQRIADIVCLLVDGEIVEVLKPDQLSQA  260

Query  904  KHPMA  918
            +HPMA
Sbjct  261  QHPMA  265



>ref|XP_010675422.1| PREDICTED: ABC transporter I family member 17 [Beta vulgaris 
subsp. vulgaris]
Length=276

 Score =   333 bits (853),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 210/241 (87%), Gaps = 2/241 (1%)
 Frame = +1

Query  205  VDGDDEAAGT--KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRAL  378
            V+G++   G   KI++K L ++SDKG+ +L+ + L IP+G+I+GIIGPSGSGKST LRAL
Sbjct  29   VNGENIVDGVEKKIEIKNLRKLSDKGVCILDGVNLQIPKGMIVGIIGPSGSGKSTLLRAL  88

Query  379  NRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLS  558
            NRLWEP   TVFLDG+DICDLDVL++R +VGMLFQLPALF+GTVADN+RYGP LRGKKLS
Sbjct  89   NRLWEPPAETVFLDGRDICDLDVLAVRRRVGMLFQLPALFQGTVADNVRYGPKLRGKKLS  148

Query  559  DdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST  738
            D++V  LLS+ADLD+SF NK G ELSVGQ QRVA+ARTLAN+PEVLLLDEPTSALDPIST
Sbjct  149  DEEVQSLLSVADLDASFINKNGNELSVGQQQRVAVARTLANDPEVLLLDEPTSALDPIST  208

Query  739  QNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMA  918
            QNIE+ LV+LK  + MT+ MVSHSI+Q+QRIAD+VCLLV+G +VEVL P+QLS+AKHPMA
Sbjct  209  QNIEEALVKLKTNQGMTVIMVSHSIRQVQRIADLVCLLVDGTVVEVLPPNQLSEAKHPMA  268

Query  919  Q  921
            +
Sbjct  269  K  269



>ref|XP_008382727.1| PREDICTED: ABC transporter I family member 17-like [Malus domestica]
 ref|XP_008382728.1| PREDICTED: ABC transporter I family member 17-like [Malus domestica]
Length=339

 Score =   335 bits (859),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 177/244 (73%), Positives = 204/244 (84%), Gaps = 1/244 (0%)
 Frame = +1

Query  190  ELLLMVDGDDEAAGTKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGSGKSTF  366
            E LL VD  +     K +++ L + SD  G ++LN +TLDIP+G+IMG+IGPSGSGKST 
Sbjct  88   EHLLTVDNGEAHGDVKFRIRNLAKKSDTTGASILNGLTLDIPKGVIMGVIGPSGSGKSTL  147

Query  367  LRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG  546
            LRALNRLWEP + TVFLDG DI D DVLSLR KVGMLFQLP LFEGTVADNIRYGP L+G
Sbjct  148  LRALNRLWEPPSGTVFLDGHDILDTDVLSLRRKVGMLFQLPVLFEGTVADNIRYGPQLKG  207

Query  547  KKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALD  726
            +KLSD+ V +LL+L DLDS F  K G E+SVGQ+QRVALARTLAN PEVLLLDEPTSALD
Sbjct  208  RKLSDEDVHKLLNLVDLDSFFATKTGSEMSVGQSQRVALARTLANSPEVLLLDEPTSALD  267

Query  727  PISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAK  906
            PIST++IE  LV+LK+++ MTI MVSHSIKQIQRIAD+VCLLV+GEIVEVLKPDQLSQA 
Sbjct  268  PISTEHIEGALVKLKQKQGMTIVMVSHSIKQIQRIADIVCLLVDGEIVEVLKPDQLSQAN  327

Query  907  HPMA  918
            HPMA
Sbjct  328  HPMA  331



>ref|XP_006845711.1| hypothetical protein AMTR_s00019p00241340 [Amborella trichopoda]
 gb|ERN07386.1| hypothetical protein AMTR_s00019p00241340 [Amborella trichopoda]
Length=261

 Score =   332 bits (850),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 188/251 (75%), Positives = 214/251 (85%), Gaps = 2/251 (1%)
 Frame = +1

Query  175  VPEER-ELLLMVDGDDEAAG-TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSG  348
            V E+R ELLL V  ++E    TKI+V+ L+  S  G+ +L+ + +DI +GLI+GIIGPSG
Sbjct  4    VSEDRKELLLNVAEEEEFPKFTKIRVRDLSYKSRTGVPILSGVCVDISKGLIVGIIGPSG  63

Query  349  SGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRY  528
            SGKSTFLRALNRLWEP +  VFLDG+DI D+DVLSLR KVGMLFQLPALFEGTVADNIRY
Sbjct  64   SGKSTFLRALNRLWEPPSGAVFLDGEDIQDIDVLSLRRKVGMLFQLPALFEGTVADNIRY  123

Query  529  GPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDE  708
            GP L GKKLSDDQV +LLSLADLDSS  +K GGELSVGQAQRVALARTLANEPEVLLLDE
Sbjct  124  GPSLMGKKLSDDQVSKLLSLADLDSSLADKNGGELSVGQAQRVALARTLANEPEVLLLDE  183

Query  709  PTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPD  888
            PTSALDPISTQNIED +V+LKK + +T  MVSHS+KQIQRIAD+VCLLV GEIVEVLKP+
Sbjct  184  PTSALDPISTQNIEDAIVKLKKSQGLTTVMVSHSVKQIQRIADLVCLLVNGEIVEVLKPE  243

Query  889  QLSQAKHPMAQ  921
             LS AKHPMA+
Sbjct  244  DLSDAKHPMAR  254



>emb|CDY01873.1| BnaC06g29130D [Brassica napus]
Length=264

 Score =   331 bits (849),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            KI+V+ LTRVSD G  +L  +++DIP+G+I+G+IGPSGSGKSTFLR+LNRLWEP   TVF
Sbjct  29   KIRVRDLTRVSDDGSLILKGVSMDIPKGMIVGVIGPSGSGKSTFLRSLNRLWEPPATTVF  88

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG DI  +DV++LR +VGMLFQLP LFEGTVADN+RYGP LRG+KLSD  V +LLS AD
Sbjct  89   LDGVDITSIDVITLRRRVGMLFQLPVLFEGTVADNVRYGPNLRGEKLSDQDVYKLLSFAD  148

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LD+S   K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST+NIEDV+V+LKK
Sbjct  149  LDASLAKKTGSELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTENIEDVIVKLKK  208

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            ++ +T  +VSHSIKQIQR+AD+VCL+V+GEIVEVLKPD+LSQA HPMA+
Sbjct  209  QRGITTVIVSHSIKQIQRVADIVCLVVDGEIVEVLKPDELSQATHPMAR  257



>ref|NP_176961.1| ABC transporter I family member 17 [Arabidopsis thaliana]
 sp|Q9C9W0.1|AB17I_ARATH RecName: Full=ABC transporter I family member 17; Short=ABC transporter 
ABCI.17; Short=AtABCI17; AltName: Full=MRP-related 
protein 1; AltName: Full=Non-intrinsic ABC protein 3 [Arabidopsis 
thaliana]
 gb|AAG52004.1|AC012563_14 putative ABC transporter; 66585-65723 [Arabidopsis thaliana]
 gb|AAM63511.1| putative ABC transporter [Arabidopsis thaliana]
 dbj|BAC42356.1| putative ABC transporter [Arabidopsis thaliana]
 gb|AAO50638.1| putative ABC transporter protein [Arabidopsis thaliana]
 dbj|BAJ09459.1| sensitive to aluminum rhizotoxicity 1 [Arabidopsis thaliana]
 gb|AEE34724.1| ABC transporter I family member 17 [Arabidopsis thaliana]
Length=263

 Score =   331 bits (848),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            KI+V  LTRV+D G  +L  +T+DIP+G+I+G+IGPSGSGKSTFLR+LNRLWEP  +TVF
Sbjct  28   KIRVHDLTRVADDGSRILKGVTIDIPKGMIVGVIGPSGSGKSTFLRSLNRLWEPPESTVF  87

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG+DI ++DV++LR +VGMLFQLP LF+GTVADN+RYGP LRG+KLSD++V +LLSLAD
Sbjct  88   LDGEDITNVDVIALRRRVGMLFQLPVLFQGTVADNVRYGPNLRGEKLSDEEVYKLLSLAD  147

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LD+SF  K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST+NIEDV+V+LKK
Sbjct  148  LDASFAKKTGAELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTENIEDVIVKLKK  207

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            ++ +T  +VSHSIKQIQ++AD+VCL+V+GEIVEVLKP +LS A HPMAQ
Sbjct  208  QRGITTVIVSHSIKQIQKVADIVCLVVDGEIVEVLKPSELSHATHPMAQ  256



>ref|XP_002888648.1| ATNAP3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64907.1| ATNAP3 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 208/240 (87%), Gaps = 0/240 (0%)
 Frame = +1

Query  202  MVDGDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALN  381
            +VD     +  KI+V  LTRV+D G  +L  +T+DIP+GLI+G+IGPSGSGKSTFLR+LN
Sbjct  16   LVDVGVSGSEPKIRVHDLTRVADDGSRILKGVTVDIPKGLIVGVIGPSGSGKSTFLRSLN  75

Query  382  RLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSD  561
            RLWEP  +TVFLDG+DI  +DV++LR +VGMLFQLP LF+GTVADN+RYGP LRG+KLSD
Sbjct  76   RLWEPPESTVFLDGEDITKVDVIALRRRVGMLFQLPVLFQGTVADNVRYGPNLRGEKLSD  135

Query  562  dqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQ  741
            ++V +LLSLADLD+SF  K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST+
Sbjct  136  EEVYKLLSLADLDASFAKKTGAELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTE  195

Query  742  NIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            NIEDV+V+LKK++ +T  +VSHSIKQIQ++AD+VCL+V+GEIVEVLKP +LS A HPMAQ
Sbjct  196  NIEDVIVKLKKQRGITTVIVSHSIKQIQKVADIVCLIVDGEIVEVLKPSELSHATHPMAQ  255



>ref|XP_006391200.1| hypothetical protein EUTSA_v10019008mg [Eutrema salsugineum]
 gb|ESQ28486.1| hypothetical protein EUTSA_v10019008mg [Eutrema salsugineum]
Length=265

 Score =   330 bits (847),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 175/247 (71%), Positives = 214/247 (87%), Gaps = 5/247 (2%)
 Frame = +1

Query  187  RELLLMVD--GDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKS  360
            RE LL VD   D E    KI+V+ LTRVSD G  +L  +++D+P+G+I+G+IGPSGSGKS
Sbjct  15   REHLLDVDCLSDGEP---KIRVRDLTRVSDDGSLILRGVSIDLPKGMIVGVIGPSGSGKS  71

Query  361  TFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLL  540
            TFLR+LNRLWEP   TVFLDG+DI ++DV++LR +VGMLFQLP LFEGTVADN+RYGP L
Sbjct  72   TFLRSLNRLWEPPETTVFLDGEDITNIDVITLRRRVGMLFQLPVLFEGTVADNVRYGPNL  131

Query  541  RGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSA  720
            RG+KLS+++V +LL+LADLD+SF  K G ELSVGQAQRVALARTLANEPEVLLLDEPTSA
Sbjct  132  RGEKLSEEEVYKLLTLADLDASFAKKTGAELSVGQAQRVALARTLANEPEVLLLDEPTSA  191

Query  721  LDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQ  900
            LDPIST+NIEDV+V+LKK++ +T  +VSHSIKQIQR+AD+VCL+V+GEIVEVLKP+ LSQ
Sbjct  192  LDPISTENIEDVIVKLKKQRGITTVIVSHSIKQIQRVADIVCLVVDGEIVEVLKPNDLSQ  251

Query  901  AKHPMAQ  921
            A HPMA+
Sbjct  252  ATHPMAR  258



>ref|NP_001152673.1| phosphate import ATP-binding protein pstB 1 [Zea mays]
 gb|ACG48860.1| phosphate import ATP-binding protein pstB 1 [Zea mays]
Length=262

 Score =   330 bits (845),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 173/246 (70%), Positives = 202/246 (82%), Gaps = 1/246 (0%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGSGKST  363
            RE LL VDG +  A  KI+V+GL R +D  G  +L  + LD+PRG +MG+IGPSGSGKST
Sbjct  10   REHLLDVDGGEAVAAPKIRVRGLRRRADATGEEILRGVHLDVPRGAVMGVIGPSGSGKST  69

Query  364  FLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLR  543
             LRALNRLWEPA   V LDG DIC LDVL+LR KVGMLFQLPA+F+GTVADN+RYGP LR
Sbjct  70   LLRALNRLWEPAPGAVLLDGADICALDVLALRRKVGMLFQLPAMFDGTVADNVRYGPQLR  129

Query  544  GKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSAL  723
            GKKL++ +V  LL LADLD + C+KP  ELSVGQAQRVALARTLAN+PEVLLLDEPTSAL
Sbjct  130  GKKLTEAEVKSLLHLADLDPALCSKPASELSVGQAQRVALARTLANDPEVLLLDEPTSAL  189

Query  724  DPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQA  903
            DPISTQNIE+ +VRLKK + +T  +VSHS+KQIQRIAD+VCL+V GE+VEVL P  LS A
Sbjct  190  DPISTQNIEEAIVRLKKTRGLTTVIVSHSVKQIQRIADLVCLVVAGEVVEVLAPSDLSDA  249

Query  904  KHPMAQ  921
            KHPMA+
Sbjct  250  KHPMAR  255



>ref|XP_006584910.1| PREDICTED: ABC transporter I family member 17 [Glycine max]
Length=260

 Score =   329 bits (844),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 177/247 (72%), Positives = 205/247 (83%), Gaps = 3/247 (1%)
 Frame = +1

Query  190  ELLLMVDG---DDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKS  360
            E LL VDG    D  A  K  ++ L+RVS+ G+ +L  I L+IP G+I+G+IGPSGSGKS
Sbjct  7    ECLLEVDGYGDGDGKAKPKFLIRNLSRVSEDGVPILKGINLEIPEGVIVGVIGPSGSGKS  66

Query  361  TFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLL  540
            TFLRALNRLWEP +A+VFLD +DIC LDVLSLR  V MLFQLPALFEG+VADN+RYGP L
Sbjct  67   TFLRALNRLWEPPSASVFLDAQDICHLDVLSLRRNVAMLFQLPALFEGSVADNVRYGPQL  126

Query  541  RGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSA  720
            RGKKLSDD+V +LL +ADLD+SF +K G ELSVGQAQRVALARTLAN P+VLLLDEPTSA
Sbjct  127  RGKKLSDDEVRKLLLMADLDASFMDKSGAELSVGQAQRVALARTLANSPQVLLLDEPTSA  186

Query  721  LDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQ  900
            LDPIST+NIED LV+L K + MT+ MVSHSIKQIQRIA +VCLLV+GEIVEVL P  LSQ
Sbjct  187  LDPISTENIEDALVKLNKNQGMTVIMVSHSIKQIQRIAHIVCLLVDGEIVEVLNPHNLSQ  246

Query  901  AKHPMAQ  921
            A HPMA+
Sbjct  247  ANHPMAK  253



>ref|XP_008223828.1| PREDICTED: ABC transporter I family member 17 [Prunus mume]
Length=367

 Score =   333 bits (854),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 179/245 (73%), Positives = 208/245 (85%), Gaps = 1/245 (0%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGSGKST  363
            RE +L VD  +     K +++ LT+ S+  G  +LN ++LDIP+G+I+G+IGPSGSGKST
Sbjct  115  REHILTVDIGEADGDVKFRIRNLTKKSETTGCAILNGLSLDIPKGVIVGVIGPSGSGKST  174

Query  364  FLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLR  543
             LRALNRLWEP + TVFLDG D+ +LDVLSLR KVGMLFQLPALFEGTVADNIRYGP LR
Sbjct  175  LLRALNRLWEPPSGTVFLDGHDLRELDVLSLRRKVGMLFQLPALFEGTVADNIRYGPRLR  234

Query  544  GKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSAL  723
            GKKLSD  V +LL+L DLDSSF +K G E+SVGQAQRVALARTLAN PEVLLLDEPTSAL
Sbjct  235  GKKLSDQDVHKLLTLVDLDSSFFSKTGSEMSVGQAQRVALARTLANSPEVLLLDEPTSAL  294

Query  724  DPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQA  903
            DPIST++IE  L +LKK++ MTI MVSHSIKQIQRIAD+VCLLV+GEIVEVLKPDQLSQA
Sbjct  295  DPISTEHIEGALEKLKKKQGMTIIMVSHSIKQIQRIADIVCLLVDGEIVEVLKPDQLSQA  354

Query  904  KHPMA  918
            +HPMA
Sbjct  355  QHPMA  359



>gb|AFW69271.1| phosphate import ATP-binding protein pstB 1 [Zea mays]
Length=262

 Score =   329 bits (843),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 174/246 (71%), Positives = 202/246 (82%), Gaps = 1/246 (0%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGSGKST  363
            RE LL VDG   AA  KI+V+GL R +D  G  +L  + LD+PRG +MG+IGPSGSGKST
Sbjct  10   REHLLDVDGGGAAAVPKIRVRGLRRRADATGEEILRGVHLDVPRGAVMGVIGPSGSGKST  69

Query  364  FLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLR  543
             LRALNRLWEPA   V LDG DIC LDVL+LR KVGMLFQLPA+F+GTVADN+RYGP LR
Sbjct  70   LLRALNRLWEPAPGAVLLDGADICALDVLALRRKVGMLFQLPAMFDGTVADNVRYGPQLR  129

Query  544  GKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSAL  723
            GKKL++ +V  LL LADLD + C+KP  ELSVGQAQRVALARTLAN+PEVLLLDEPTSAL
Sbjct  130  GKKLTEAEVKSLLHLADLDPALCSKPASELSVGQAQRVALARTLANDPEVLLLDEPTSAL  189

Query  724  DPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQA  903
            DPISTQNIE+ +VRLKK + +T  +VSHS+KQIQRIAD+VCL+V GE+VEVL P  LS A
Sbjct  190  DPISTQNIEEAIVRLKKTRGLTTVIVSHSVKQIQRIADLVCLVVAGEVVEVLAPSDLSDA  249

Query  904  KHPMAQ  921
            KHPMA+
Sbjct  250  KHPMAR  255



>emb|CAN70271.1| hypothetical protein VITISV_010974 [Vitis vinifera]
Length=251

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            K +V+ L +VS+ G  +L  I +D+P+G I+G+IGPSGSGKST LR LNRLWEP + TV+
Sbjct  16   KFRVRNLIKVSESGEAILRGIDVDVPKGAIVGVIGPSGSGKSTLLRVLNRLWEPPSGTVY  75

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG DI +LDVL LR KVGMLFQLP LFEGTVADNIRYGP LRGKKL+D++VL+LL+LAD
Sbjct  76   LDGTDIRELDVLGLRRKVGMLFQLPVLFEGTVADNIRYGPQLRGKKLTDNEVLKLLTLAD  135

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LDSSF  K GGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDV+V+LKK
Sbjct  136  LDSSFMKKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKK  195

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMA  918
             + MTI MVSHSIKQIQRIAD VCLLV+GEI EVL+PD+LS+A+HPMA
Sbjct  196  SRGMTIVMVSHSIKQIQRIADRVCLLVDGEITEVLEPDKLSEARHPMA  243



>ref|XP_002266816.1| PREDICTED: ABC transporter I family member 17 [Vitis vinifera]
 emb|CBI17869.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 177/248 (71%), Positives = 210/248 (85%), Gaps = 1/248 (0%)
 Frame = +1

Query  178  PEERELLLMVDGDDEAA-GTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSG  354
            P    L+L V+ +++     K +V+ L +VS+ G  +L  I +D+P+G I+G+IGPSGSG
Sbjct  13   PAVEPLILQVEEEEDGERKPKFRVRNLIKVSESGEAILRGIDVDVPKGAIVGVIGPSGSG  72

Query  355  KSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGP  534
            KST LR LNRLWEP + TV+LDG DI +LDVL LR KVGMLFQLP LFEGTVADNIRYGP
Sbjct  73   KSTLLRVLNRLWEPPSGTVYLDGTDIRELDVLGLRRKVGMLFQLPVLFEGTVADNIRYGP  132

Query  535  LLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPT  714
             LRGKKL+D++VL+LL+LADLDSSF  K GGELSVGQAQRVALARTLANEPEVLLLDEPT
Sbjct  133  QLRGKKLTDNEVLKLLTLADLDSSFMKKTGGELSVGQAQRVALARTLANEPEVLLLDEPT  192

Query  715  SALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            SALDPISTQNIEDV+V+LKK + MT+ MVSHSIKQIQRIAD VCLLV+GEI+EVL+PD+L
Sbjct  193  SALDPISTQNIEDVIVKLKKSRGMTVVMVSHSIKQIQRIADRVCLLVDGEIIEVLEPDKL  252

Query  895  SQAKHPMA  918
            S+A+HPMA
Sbjct  253  SEARHPMA  260



>ref|XP_004299789.1| PREDICTED: ABC transporter I family member 17-like [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/252 (71%), Positives = 206/252 (82%), Gaps = 6/252 (2%)
 Frame = +1

Query  181  EERELLLMVDGDDEAAGT-KIQVKGLTRVSDKGLT-----LLNQITLDIPRGLIMGIIGP  342
            E  E  ++V  D EA G  K +++ LTR+SD         +LN++++DIP+G+I+GIIGP
Sbjct  13   ENEEEAVLVINDGEADGNVKFRIRNLTRISDGAGGGGGAIILNKLSVDIPKGVIVGIIGP  72

Query  343  SGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNI  522
            SGSGKST LRALNRLWEP   TVFLDG DI DLDVLSLR KVGMLFQLP LFEGTVADN+
Sbjct  73   SGSGKSTLLRALNRLWEPPYGTVFLDGHDIKDLDVLSLRRKVGMLFQLPVLFEGTVADNV  132

Query  523  RYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLL  702
            RYGP L GK LSD  V +LL+LA LDSSF +K G ELSVGQAQRVALARTLAN PEVLLL
Sbjct  133  RYGPQLSGKNLSDQDVHKLLTLAGLDSSFFSKTGSELSVGQAQRVALARTLANSPEVLLL  192

Query  703  DEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            DEPTSALDPIST++IE VL +LK ++ MT+ MVSHSIKQIQRIADVVCLLV GE+VEVLK
Sbjct  193  DEPTSALDPISTEHIEGVLEKLKNKRGMTVIMVSHSIKQIQRIADVVCLLVNGEVVEVLK  252

Query  883  PDQLSQAKHPMA  918
            PD+LS+AKHPMA
Sbjct  253  PDKLSEAKHPMA  264



>ref|XP_006302704.1| hypothetical protein CARUB_v10020815mg [Capsella rubella]
 gb|EOA35602.1| hypothetical protein CARUB_v10020815mg [Capsella rubella]
Length=262

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            KI+V  LTRV+D G  +L  +++DIP+G+I+G+IGPSGSGKST LR+LNRLWEP  +TVF
Sbjct  27   KIRVHDLTRVADDGSRILKGVSIDIPKGMIVGVIGPSGSGKSTLLRSLNRLWEPPESTVF  86

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG+DI  +DV++LR +VGMLFQLP LF+GTVADN+RYGP LRG+KLSD++V +LLSLAD
Sbjct  87   LDGEDITKVDVITLRRRVGMLFQLPVLFQGTVADNVRYGPNLRGEKLSDEEVYKLLSLAD  146

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LD+SF  K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST+NIEDV+V+LK+
Sbjct  147  LDASFAKKTGAELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTENIEDVIVKLKR  206

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            ++ +T  +VSHSIKQIQ++ADVVCL+V+GEIVEVLKP +LS AKHPMA+
Sbjct  207  QRGITTVIVSHSIKQIQKVADVVCLVVDGEIVEVLKPSELSHAKHPMAK  255



>dbj|BAD53904.1| putative multidrug resistance protein [Oryza sativa Japonica 
Group]
 dbj|BAH28259.1| sensitive to aluminum rhizotoxicity 1 [Oryza sativa Japonica 
Group]
Length=291

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/251 (71%), Positives = 209/251 (83%), Gaps = 6/251 (2%)
 Frame = +1

Query  187  RELLLMVDG-----DDEAAGTKIQVKGLTRVSD-KGLTLLNQITLDIPRGLIMGIIGPSG  348
            RE LL VDG        AAG KI+V+GLTR S+ +G  +L  + LD+PRG+++G+IGPSG
Sbjct  35   REHLLDVDGVGEEGAAAAAGPKIRVRGLTRRSEARGEEILRGVDLDVPRGVVVGVIGPSG  94

Query  349  SGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRY  528
            SGKST LRALNRLWEPA   V LDG DIC +DVL+LR KVGMLFQLPA+F+GTVADN+RY
Sbjct  95   SGKSTLLRALNRLWEPAPGAVLLDGVDICGIDVLALRRKVGMLFQLPAMFDGTVADNVRY  154

Query  529  GPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDE  708
            GP L+GKKL+D +V  LLSLADLD + C+KP  ELSVGQAQRVALARTLAN+PEVLLLDE
Sbjct  155  GPQLQGKKLTDAEVQSLLSLADLDPALCSKPASELSVGQAQRVALARTLANDPEVLLLDE  214

Query  709  PTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPD  888
            PTSALDPISTQNIE+ +VRLKK + +T  MVSHS+KQIQRIAD+VCLLV GE+VEVL P 
Sbjct  215  PTSALDPISTQNIEEAIVRLKKTRGLTTVMVSHSVKQIQRIADLVCLLVAGEVVEVLPPS  274

Query  889  QLSQAKHPMAQ  921
            +LS+AKHPMA+
Sbjct  275  ELSEAKHPMAR  285



>ref|XP_004503265.1| PREDICTED: ABC transporter I family member 17-like [Cicer arietinum]
Length=267

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 201/230 (87%), Gaps = 1/230 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKG-LTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATV  411
            K Q++ L ++SD G + +LN ITLDIP+G+I+GIIGPSGSGKST LRALNRLWEP +++V
Sbjct  31   KFQIQNLRKLSDDGKIHILNGITLDIPKGVIVGIIGPSGSGKSTLLRALNRLWEPPSSSV  90

Query  412  FLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsla  591
            FLD +DIC LDVLSLR KV MLFQLPALFEGTVA+N+RYGP LRG KL+DD V +LL +A
Sbjct  91   FLDAQDICHLDVLSLRRKVAMLFQLPALFEGTVAENVRYGPQLRGIKLTDDDVSKLLLMA  150

Query  592  dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLK  771
            DLD+SF +K G +LSVGQAQRVALARTLAN+PEVLLLDEPTSALDPIST+NIE  L++L 
Sbjct  151  DLDASFMDKSGADLSVGQAQRVALARTLANQPEVLLLDEPTSALDPISTENIEAALMKLN  210

Query  772  KEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            K + MT+ MVSHSIKQIQR+A VVCLLV+G+IVEVLKP QLSQAKHPMA+
Sbjct  211  KSQGMTLIMVSHSIKQIQRMAHVVCLLVDGQIVEVLKPHQLSQAKHPMAR  260



>gb|EPS58585.1| hypothetical protein M569_16228, partial [Genlisea aurea]
Length=259

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/234 (71%), Positives = 203/234 (87%), Gaps = 5/234 (2%)
 Frame = +1

Query  235  KIQVKGLTRV-----SDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPA  399
            K++V+ L+R+      ++G  +LN++ +DIPRG I G+IGPSGSGKSTFLRALNRLWEP 
Sbjct  20   KMEVRDLSRLVVIGGEEEGSRILNKVNVDIPRGSITGVIGPSGSGKSTFLRALNRLWEPP  79

Query  400  NATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrl  579
            + TVF+DG D+  +DVL++R ++GMLFQ+PALF GTVADN+RYGP LRG++LS+++V+RL
Sbjct  80   SGTVFIDGVDVSTVDVLAIRRRIGMLFQIPALFSGTVADNVRYGPRLRGEELSEEEVVRL  139

Query  580  lsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVL  759
            LSLADLD SFC +  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDP+STQN+EDVL
Sbjct  140  LSLADLDPSFCGRSAGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPVSTQNVEDVL  199

Query  760  VRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            +RLKKE+ MTI MVSHS+KQIQRIADVVCLLV GE+VE+L P  LS AKHPMAQ
Sbjct  200  LRLKKERGMTIVMVSHSVKQIQRIADVVCLLVGGEVVEILPPATLSSAKHPMAQ  253



>ref|XP_003631128.1| ABC transporter I family member [Medicago truncatula]
 gb|ACJ84737.1| unknown [Medicago truncatula]
 gb|AET05604.1| ATP-binding ABC transporter [Medicago truncatula]
 gb|AFK35253.1| unknown [Medicago truncatula]
Length=255

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 198/237 (84%), Gaps = 2/237 (1%)
 Frame = +1

Query  217  DEAAGTKIQVKGLTRVSDKG-LTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE  393
            +E    KIQ+K L + SD G L +L  IT+DIP+G+++GIIGPSGSGKST LRA+NRLWE
Sbjct  12   EEQQQPKIQIKNLRKESDDGKLQILKGITVDIPKGMVVGIIGPSGSGKSTLLRAMNRLWE  71

Query  394  PANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqv-  570
            P +++VFLDG DIC+LDVLSLR KV MLFQLPALFEGTVADN+RYGP LRG KL+DD+V 
Sbjct  72   PPSSSVFLDGVDICNLDVLSLRRKVAMLFQLPALFEGTVADNVRYGPQLRGIKLTDDEVG  131

Query  571  lrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIE  750
              LL      S+F +K G ELSVGQAQRVALARTLAN PEVLLLDEPTSALDPIST+NIE
Sbjct  132  KLLLMADLDASTFKDKSGAELSVGQAQRVALARTLANSPEVLLLDEPTSALDPISTENIE  191

Query  751  DVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
              L++L K + MT+ MVSHSIKQIQR+ADVVCL+V+GEIVEVLKP+QLSQA HPMA+
Sbjct  192  GALMKLNKNQGMTLIMVSHSIKQIQRMADVVCLVVDGEIVEVLKPNQLSQANHPMAR  248



>dbj|BAA76420.1| multidrug resistance protein [Cicer arietinum]
Length=261

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 201/230 (87%), Gaps = 1/230 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKG-LTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATV  411
            K Q++ L ++SD G + +LN ITLDIP+G+I+GIIGPSGSGKST LRALNRLWEP +++V
Sbjct  25   KFQIQNLRKLSDDGKIHILNGITLDIPKGVIVGIIGPSGSGKSTLLRALNRLWEPPSSSV  84

Query  412  FLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsla  591
            FLD +DIC LDVLSLR KV MLFQLPALFEGTVA+N+RYGP LRG KL+DD V +LL +A
Sbjct  85   FLDAQDICHLDVLSLRRKVAMLFQLPALFEGTVAENVRYGPQLRGIKLTDDDVSKLLLMA  144

Query  592  dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLK  771
            DLD+SF +K G +LSVGQAQRVALARTLAN+PEVLLLDEPTSALDPIST+NIE  L++L 
Sbjct  145  DLDASFMDKSGADLSVGQAQRVALARTLANQPEVLLLDEPTSALDPISTENIEAALMKLN  204

Query  772  KEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            K + MT+ MVSHSIKQIQR+A VVCLLV+G+IVEVLKP QLSQAKHPMA+
Sbjct  205  KSQGMTLIMVSHSIKQIQRMAHVVCLLVDGQIVEVLKPHQLSQAKHPMAR  254



>ref|NP_001058453.1| Os06g0695800 [Oryza sativa Japonica Group]
 sp|Q0D9V6.1|STAR1_ORYSJ RecName: Full=Protein STAR1; AltName: Full=ABC transporter ABCI.12; 
Short=OsABCI12; AltName: Full=ABC transporter I family 
member 12; AltName: Full=Protein ALUMINUM SENSITIVE 1; AltName: 
Full=Protein SENSITIVE TO ALUMINUM RHIZOTOXICITY 1 [Oryza 
sativa Japonica Group]
 dbj|BAF20367.1| Os06g0695800 [Oryza sativa Japonica Group]
Length=346

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/251 (71%), Positives = 209/251 (83%), Gaps = 6/251 (2%)
 Frame = +1

Query  187  RELLLMVDG-----DDEAAGTKIQVKGLTRVSD-KGLTLLNQITLDIPRGLIMGIIGPSG  348
            RE LL VDG        AAG KI+V+GLTR S+ +G  +L  + LD+PRG+++G+IGPSG
Sbjct  90   REHLLDVDGVGEEGAAAAAGPKIRVRGLTRRSEARGEEILRGVDLDVPRGVVVGVIGPSG  149

Query  349  SGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRY  528
            SGKST LRALNRLWEPA   V LDG DIC +DVL+LR KVGMLFQLPA+F+GTVADN+RY
Sbjct  150  SGKSTLLRALNRLWEPAPGAVLLDGVDICGIDVLALRRKVGMLFQLPAMFDGTVADNVRY  209

Query  529  GPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDE  708
            GP L+GKKL+D +V  LLSLADLD + C+KP  ELSVGQAQRVALARTLAN+PEVLLLDE
Sbjct  210  GPQLQGKKLTDAEVQSLLSLADLDPALCSKPASELSVGQAQRVALARTLANDPEVLLLDE  269

Query  709  PTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPD  888
            PTSALDPISTQNIE+ +VRLKK + +T  MVSHS+KQIQRIAD+VCLLV GE+VEVL P 
Sbjct  270  PTSALDPISTQNIEEAIVRLKKTRGLTTVMVSHSVKQIQRIADLVCLLVAGEVVEVLPPS  329

Query  889  QLSQAKHPMAQ  921
            +LS+AKHPMA+
Sbjct  330  ELSEAKHPMAR  340



>ref|XP_009410211.1| PREDICTED: protein STAR1 [Musa acuminata subsp. malaccensis]
Length=265

 Score =   320 bits (819),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 171/253 (68%), Positives = 214/253 (85%), Gaps = 6/253 (2%)
 Frame = +1

Query  181  EERE-LLLMVDG----DDEAAGTKIQVKGLTRVSD-KGLTLLNQITLDIPRGLIMGIIGP  342
            E RE LL+ VDG    D  A   K+QV+ LT+ S+  G  +L+++ LD+P G+I+GIIGP
Sbjct  7    EVREHLLVNVDGARGLDSPAKKAKLQVRDLTKQSEATGEMILSKVNLDVPEGVIVGIIGP  66

Query  343  SGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNI  522
            SGSGKST LRALNRLWEP + +V LDG+DIC LDVL+LR +VGMLFQLPALF+G+VA+N+
Sbjct  67   SGSGKSTLLRALNRLWEPPSGSVLLDGQDICKLDVLTLRRRVGMLFQLPALFDGSVAENV  126

Query  523  RYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLL  702
            RYGP L+GKKL++++V +LLSLADLD +F +K   +LSVGQAQRVALARTLAN+PEVLLL
Sbjct  127  RYGPQLKGKKLTEEEVKKLLSLADLDPAFASKASSQLSVGQAQRVALARTLANDPEVLLL  186

Query  703  DEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            DEPTSALDPISTQNIE+ +VRLK+ +RMT  MVSHS+KQIQRIAD+VCLLV GE+VEVL+
Sbjct  187  DEPTSALDPISTQNIEEAIVRLKESRRMTTVMVSHSVKQIQRIADLVCLLVAGEMVEVLE  246

Query  883  PDQLSQAKHPMAQ  921
            P +LS+A+HPMA+
Sbjct  247  PARLSEAQHPMAR  259



>ref|XP_006657287.1| PREDICTED: LOW QUALITY PROTEIN: protein STAR1-like [Oryza brachyantha]
Length=368

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 172/253 (68%), Positives = 206/253 (81%), Gaps = 8/253 (3%)
 Frame = +1

Query  187  RELLLMVDGDDE-------AAGTKIQVKGLTRVSD-KGLTLLNQITLDIPRGLIMGIIGP  342
            RE LL VDG +        A   KI+V+GL+R S+  G  +L  + LD+PRG+++G+IGP
Sbjct  110  REHLLDVDGGEGEGAPAAVAGMPKIRVRGLSRRSEASGEEILRGVDLDVPRGVVVGVIGP  169

Query  343  SGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNI  522
            SGSGKST LRALNRLWEPA   V LDG DIC +DVL+LR +VGMLFQLPA+F+GTVADN+
Sbjct  170  SGSGKSTLLRALNRLWEPAPGAVLLDGVDICAIDVLALRRRVGMLFQLPAMFDGTVADNV  229

Query  523  RYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLL  702
            RYGP LRGKKL+D +V  LLSLADLD + C++P  ELSVGQAQRVALARTLAN+PEVLLL
Sbjct  230  RYGPQLRGKKLTDAEVQSLLSLADLDPALCSRPASELSVGQAQRVALARTLANDPEVLLL  289

Query  703  DEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            DEPTSALDPISTQNIE+ +VRLKK + +T  MVSHS+KQIQRIAD+VCL+V GE+VEVL 
Sbjct  290  DEPTSALDPISTQNIEEAIVRLKKTRGLTTVMVSHSVKQIQRIADLVCLVVAGEVVEVLP  349

Query  883  PDQLSQAKHPMAQ  921
            P  LS+AKHPMA+
Sbjct  350  PSGLSEAKHPMAR  362



>ref|XP_002438933.1| hypothetical protein SORBIDRAFT_10g028530 [Sorghum bicolor]
 gb|EER90300.1| hypothetical protein SORBIDRAFT_10g028530 [Sorghum bicolor]
Length=268

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/252 (69%), Positives = 204/252 (81%), Gaps = 7/252 (3%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGT--KIQVKGLTRVSDK-----GLTLLNQITLDIPRGLIMGIIGPS  345
            RE LL VDG   AA    KI+V+GL R ++      G  +L  + LD+PRG++MG+IGPS
Sbjct  10   REHLLDVDGGAAAAAAEPKIRVRGLRRRAESADAATGEEILRGVHLDVPRGVVMGVIGPS  69

Query  346  GSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIR  525
            GSGKST LRALNRLWEPA   V LDG DIC +DVL+LR KVGMLFQ PA+F+GTVADN+R
Sbjct  70   GSGKSTLLRALNRLWEPAPGAVLLDGADICAIDVLTLRRKVGMLFQTPAMFDGTVADNVR  129

Query  526  YGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLD  705
            YGP LRGKKL++ +V  LLSLADLD + C+KP  ELSVGQAQRVALARTLAN+PEVLLLD
Sbjct  130  YGPQLRGKKLTEAEVKNLLSLADLDPALCSKPASELSVGQAQRVALARTLANDPEVLLLD  189

Query  706  EPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKP  885
            EPTSALDPISTQNIE+ +VRLKK + +T  +VSHS+KQIQRIAD+VCL+V GEIVEVL P
Sbjct  190  EPTSALDPISTQNIEEAIVRLKKTRGLTTVIVSHSVKQIQRIADLVCLVVAGEIVEVLAP  249

Query  886  DQLSQAKHPMAQ  921
             +LS AKHPMA+
Sbjct  250  SELSDAKHPMAR  261



>gb|AGL45585.1| sensitive to aluminum rhizotoxicity 1 protein [Medicago sativa]
Length=259

 Score =   317 bits (812),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 206/245 (84%), Gaps = 4/245 (2%)
 Frame = +1

Query  199  LMVDGDDEAAGTKIQVKGLTRVSDKG-LTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRA  375
            L++D +++    KI++K L + SD G L +L  IT+DIP+G+++GIIGPSGSGKST LRA
Sbjct  8    LLLDVEEQQQQPKIKIKNLRKESDDGKLEILKGITVDIPKGMVVGIIGPSGSGKSTLLRA  67

Query  376  LNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKL  555
            LNRLWEP++++VFLDG DIC+LD LSLR KV MLFQLPALFEGTVADN+RYGP LRG KL
Sbjct  68   LNRLWEPSSSSVFLDGVDICNLDALSLRRKVAMLFQLPALFEGTVADNVRYGPQLRGIKL  127

Query  556  SDdqvlrllsla---dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALD  726
            +DD+V +LL +A      ++F +K G +LSVGQAQRVALARTLAN PEVLLLDEPTSALD
Sbjct  128  TDDEVGKLLLMADLDSSSTNFKDKSGADLSVGQAQRVALARTLANSPEVLLLDEPTSALD  187

Query  727  PISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAK  906
            PIST+NIE  L++L K + +T+ MVSHSIKQIQR+AD+VCL+V+G+IVEVLKP+QLSQA 
Sbjct  188  PISTENIEGALMKLNKNQGITLIMVSHSIKQIQRMADLVCLVVDGQIVEVLKPNQLSQAH  247

Query  907  HPMAQ  921
            HPMA+
Sbjct  248  HPMAR  252



>ref|XP_004967253.1| PREDICTED: protein STAR1-like [Setaria italica]
Length=302

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 205/249 (82%), Gaps = 4/249 (2%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGT---KIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGSG  354
            +E LL VDG  + AG    KI+V+GL R++D  G  +L  + LD+PRG++MG+IGPSGSG
Sbjct  47   QEHLLDVDGPADGAGAAHPKIRVRGLRRLADATGDEILRGVDLDVPRGVVMGVIGPSGSG  106

Query  355  KSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGP  534
            KST LRALNRLWEPA   V LDG DI  +DVL+LR +VGMLFQLPA+F+GTVADN+RYGP
Sbjct  107  KSTLLRALNRLWEPAPGAVLLDGADIRGIDVLALRRRVGMLFQLPAMFDGTVADNVRYGP  166

Query  535  LLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPT  714
             LRGKKL++ +V  LLS+ADLD +  +KP  ELSVGQAQRVALARTLAN+PEVLLLDEPT
Sbjct  167  QLRGKKLTEAEVKNLLSMADLDPALSSKPASELSVGQAQRVALARTLANDPEVLLLDEPT  226

Query  715  SALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            SALDPISTQNIE+ +VRLKK + +T  +VSHS+KQIQRIAD+VCL+V GEIVEVL P +L
Sbjct  227  SALDPISTQNIEEAIVRLKKARGLTTVLVSHSVKQIQRIADLVCLVVSGEIVEVLAPSEL  286

Query  895  SQAKHPMAQ  921
            S AKHPMA+
Sbjct  287  SGAKHPMAR  295



>ref|XP_004150743.1| PREDICTED: ABC transporter I family member 17-like [Cucumis sativus]
 ref|XP_004162805.1| PREDICTED: ABC transporter I family member 17-like [Cucumis sativus]
 gb|KGN65512.1| hypothetical protein Csa_1G433110 [Cucumis sativus]
Length=269

 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 201/244 (82%), Gaps = 2/244 (1%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTF  366
            RE LL+V+   E  G    VK   R+ +    +L  I++DIP+G I+GIIGPSG GKST 
Sbjct  20   REHLLVVNEGSENGGVGDHVK--IRIRNLTNQILRGISVDIPKGKIVGIIGPSGGGKSTT  77

Query  367  LRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG  546
            LRALNRLWEP   +VFLDG+DI +LDVL LR KVGMLFQ+P LFEGTVADNIRYGP LRG
Sbjct  78   LRALNRLWEPPAGSVFLDGQDIVNLDVLGLRRKVGMLFQIPVLFEGTVADNIRYGPQLRG  137

Query  547  KKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALD  726
            KKLSDD+V +LLSLADLDSSF +K G ELSVGQAQRVALARTLAN PEVLLLDEPTSALD
Sbjct  138  KKLSDDEVHKLLSLADLDSSFFSKIGSELSVGQAQRVALARTLANAPEVLLLDEPTSALD  197

Query  727  PISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAK  906
            PIST+NIEDVLVRLK    +TI MVSHSIKQIQRIAD+VCLLV GEIVE+L P++LS+AK
Sbjct  198  PISTENIEDVLVRLKTRWGLTIVMVSHSIKQIQRIADIVCLLVNGEIVEILPPNKLSEAK  257

Query  907  HPMA  918
            HPMA
Sbjct  258  HPMA  261



>ref|XP_008453537.1| PREDICTED: ABC transporter I family member 17 [Cucumis melo]
Length=269

 Score =   314 bits (805),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 177/244 (73%), Positives = 203/244 (83%), Gaps = 2/244 (1%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTF  366
            RE LL+V+ + E  G    VK   R+ +    +L  I++DIP+G I+GIIGPSG GKST 
Sbjct  20   REHLLVVNEEIENRGVDDHVK--IRIRNLTNQILRGISVDIPKGKIVGIIGPSGGGKSTT  77

Query  367  LRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG  546
            LRALNRLWEP   +VFLDG+DI +LDVL LR KVGMLFQ+P LFEGTVADNIRYGP LRG
Sbjct  78   LRALNRLWEPPAGSVFLDGQDIVNLDVLGLRRKVGMLFQIPVLFEGTVADNIRYGPQLRG  137

Query  547  KKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALD  726
            KKLSDD+V +LLSLADLDSSF +K G ELSVGQAQRVALARTLAN PEVLLLDEPTSALD
Sbjct  138  KKLSDDEVHKLLSLADLDSSFFSKIGSELSVGQAQRVALARTLANTPEVLLLDEPTSALD  197

Query  727  PISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAK  906
            PIST+NIEDVLV+LK +  +TI MVSHSIKQIQRIAD+VCLLV GEIVE+L P++LS+AK
Sbjct  198  PISTENIEDVLVKLKTKWGLTIVMVSHSIKQIQRIADIVCLLVNGEIVEILPPNKLSEAK  257

Query  907  HPMA  918
            HPMA
Sbjct  258  HPMA  261



>dbj|BAJ97887.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   310 bits (795),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 203/248 (82%), Gaps = 2/248 (1%)
 Frame = +1

Query  181  EERELLLMVDGDDEAAGTKIQVKGLTRVSD-KGLTLLNQITLDIPRGLIMGIIGPSGSGK  357
            + RE LL V G   A G KI+V+GL R ++  G  +L  + LD+P G++MG+IGPSGSGK
Sbjct  34   DSREHLLDVGGL-AAGGPKIRVRGLRRRAEASGEEILRGVDLDVPGGVVMGVIGPSGSGK  92

Query  358  STFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPL  537
            ST LRALNRLWEPA   V LDG DIC +DVL+LR KVGMLFQLPA+F+G+VADN+RYGP 
Sbjct  93   STLLRALNRLWEPAPGAVTLDGADICGMDVLALRRKVGMLFQLPAMFDGSVADNVRYGPQ  152

Query  538  LRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTS  717
            LRGKKL++ +V  LLSL+DLD +  ++P  EL VGQAQRVALARTLAN+PEVLLLDEPTS
Sbjct  153  LRGKKLTEAEVKGLLSLSDLDPALSSRPASELFVGQAQRVALARTLANDPEVLLLDEPTS  212

Query  718  ALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLS  897
            ALDPISTQNIE+ +VRLKK + +T  +VSHS+KQIQRIAD+VCL+V+GE+VEVL P  LS
Sbjct  213  ALDPISTQNIEEAIVRLKKARGLTTVIVSHSVKQIQRIADLVCLVVDGEVVEVLAPSDLS  272

Query  898  QAKHPMAQ  921
            +AKHPMA+
Sbjct  273  EAKHPMAR  280



>ref|XP_003563480.1| PREDICTED: protein STAR1 [Brachypodium distachyon]
Length=265

 Score =   309 bits (792),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 193/230 (84%), Gaps = 1/230 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSD-KGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATV  411
            KI+V+GL R S+  G  +L  + LD+PRG++MG+IGPSGSGKST LRALNRLWEPA   V
Sbjct  30   KIRVRGLRRRSEASGEEILRGVDLDVPRGVVMGVIGPSGSGKSTLLRALNRLWEPAPGAV  89

Query  412  FLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsla  591
             LDG DIC +DVL+LR KVGMLFQLPA+F+GTVADN+RYGP L GKKL+D +V  LLSL+
Sbjct  90   SLDGADICGIDVLALRRKVGMLFQLPAMFDGTVADNVRYGPQLLGKKLTDAEVKNLLSLS  149

Query  592  dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLK  771
            DLD +  +K   ELSVGQ QRVALARTLAN+PEVLLLDEPTSALDPISTQNIE+ +VRLK
Sbjct  150  DLDPALSSKLASELSVGQGQRVALARTLANDPEVLLLDEPTSALDPISTQNIEEAIVRLK  209

Query  772  KEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            K + +T  MVSHS+KQIQRIAD+VCL+V+GE+VEVL P +LS AKHPMA+
Sbjct  210  KTRGLTTVMVSHSVKQIQRIADLVCLVVDGEVVEVLAPSELSAAKHPMAR  259



>gb|EEE66281.1| hypothetical protein OsJ_22488 [Oryza sativa Japonica Group]
Length=372

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 178/277 (64%), Positives = 209/277 (75%), Gaps = 32/277 (12%)
 Frame = +1

Query  187  RELLLMVDG-----DDEAAGTKIQVKGLTRVSD-KGLTLLNQITLDIPRGLIMGIIGPSG  348
            RE LL VDG        AAG KI+V+GLTR S+ +G  +L  + LD+PRG+++G+IGPSG
Sbjct  90   REHLLDVDGVGEEGAAAAAGPKIRVRGLTRRSEARGEEILRGVDLDVPRGVVVGVIGPSG  149

Query  349  SGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALF----------  498
            SGKST LRALNRLWEPA   V LDG DIC +DVL+LR KVGMLFQLPA+F          
Sbjct  150  SGKSTLLRALNRLWEPAPGAVLLDGVDICGIDVLALRRKVGMLFQLPAMFDDKNYFEKYF  209

Query  499  ----------------EGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGE  630
                            EGTVADN+RYGP L+GKKL+D +V  LLSLADLD + C+KP  E
Sbjct  210  YCGRNYNYPKLPKVVFEGTVADNVRYGPQLQGKKLTDAEVQSLLSLADLDPALCSKPASE  269

Query  631  LSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHS  810
            LSVGQAQRVALARTLAN+PEVLLLDEPTSALDPISTQNIE+ +VRLKK + +T  MVSHS
Sbjct  270  LSVGQAQRVALARTLANDPEVLLLDEPTSALDPISTQNIEEAIVRLKKTRGLTTVMVSHS  329

Query  811  IKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            +KQIQRIAD+VCLLV GE+VEVL P +LS+AKHPMA+
Sbjct  330  VKQIQRIADLVCLLVAGEVVEVLPPSELSEAKHPMAR  366



>ref|XP_004966143.1| PREDICTED: protein STAR1-like [Setaria italica]
Length=298

 Score =   308 bits (788),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 161/229 (70%), Positives = 189/229 (83%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            KI+V+ L R +  G  +L  + LD+PRG++MG+IGPSGSGKST LRALNRLWEPA   V 
Sbjct  64   KIRVRELRRQAAGGQEILRGVDLDVPRGVVMGVIGPSGSGKSTLLRALNRLWEPAPGAVL  123

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG DIC LDV +LR +VGMLFQ PA+FEGTVA N+RYGP LRGK+L++ +V  LL+LAD
Sbjct  124  LDGADICGLDVRTLRRRVGMLFQQPAMFEGTVAYNVRYGPKLRGKELTEAEVQNLLNLAD  183

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LD +  +KP  ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIED +VRL K
Sbjct  184  LDPAMSSKPATELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDTIVRLNK  243

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
             + +T  +VSHS+KQIQRIAD+VCLLV GEIVEVL P +LS AKHPMA+
Sbjct  244  TRGLTAVIVSHSVKQIQRIADLVCLLVAGEIVEVLPPSELSSAKHPMAR  292



>gb|ADE77572.1| unknown [Picea sitchensis]
Length=268

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 201/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  190  ELLLMVDGDDEAAGT------KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGS  351
            ELLL +D +D  A        K+ V+ L R S++G +LL+ +++DI +G ++G+IGPSGS
Sbjct  12   ELLLRIDEEDAEASRNGDLHPKMSVRDLRRKSEEGRSLLSGVSVDIWKGTVVGVIGPSGS  71

Query  352  GKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYG  531
            GKSTFLRALNRLWEP+  +VFLD  DI  LDVL+LR +VGMLFQ PALF+G VADNI+YG
Sbjct  72   GKSTFLRALNRLWEPSADSVFLDYHDITKLDVLALRRRVGMLFQTPALFDGNVADNIKYG  131

Query  532  PLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEP  711
            P LRG KLSD++V + L  ADL+SS  ++  G LSVGQAQRVALARTLANEPEVLLLDEP
Sbjct  132  PALRGLKLSDEEVSKYLGWADLESSLASRSVGGLSVGQAQRVALARTLANEPEVLLLDEP  191

Query  712  TSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQ  891
            TSALDPISTQ+IE+ + +LK+ K MTI MVSHS+KQIQRIADVV LLV+G+IVE LKPDQ
Sbjct  192  TSALDPISTQHIEESIGKLKRGKGMTIIMVSHSVKQIQRIADVVFLLVDGQIVETLKPDQ  251

Query  892  LSQAKHPMAQ  921
            LS A HPMA+
Sbjct  252  LSNANHPMAR  261



>gb|EEC81244.1| hypothetical protein OsI_24312 [Oryza sativa Indica Group]
Length=372

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 177/277 (64%), Positives = 208/277 (75%), Gaps = 32/277 (12%)
 Frame = +1

Query  187  RELLLMVDG-----DDEAAGTKIQVKGLTRVSD-KGLTLLNQITLDIPRGLIMGIIGPSG  348
            RE LL VDG        AAG KI+V+GLTR S+ +G  +L  + LD+P G+++G+IGPSG
Sbjct  90   REHLLDVDGVGEEGAAAAAGPKIRVRGLTRRSEARGEEILRGVDLDVPHGVVVGVIGPSG  149

Query  349  SGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALF----------  498
            SGKST LRALNRLWEPA   V LDG DIC +DVL+LR KVGMLFQLPA+F          
Sbjct  150  SGKSTLLRALNRLWEPAPGAVLLDGVDICGIDVLALRRKVGMLFQLPAMFDDKNYFEEYF  209

Query  499  ----------------EGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGE  630
                            EGTVADN+RYGP L+GKKL+D +V  LLSLADLD + C+KP  E
Sbjct  210  YCWRNYNYPKLPKVVFEGTVADNVRYGPQLQGKKLTDAEVQSLLSLADLDPALCSKPASE  269

Query  631  LSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHS  810
            LSVGQAQRVALARTLAN+PEVLLLDEPTSALDPISTQNIE+ +VRLKK + +T  MVSHS
Sbjct  270  LSVGQAQRVALARTLANDPEVLLLDEPTSALDPISTQNIEEAIVRLKKTRGLTTVMVSHS  329

Query  811  IKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            +KQIQRIAD+VCLLV GE+VEVL P +LS+AKHPMA+
Sbjct  330  VKQIQRIADLVCLLVAGEVVEVLPPSELSEAKHPMAR  366



>gb|EMS45210.1| Protein STAR1 [Triticum urartu]
Length=286

 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 169/272 (62%), Positives = 203/272 (75%), Gaps = 28/272 (10%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSD-KGLTLLNQITLDIPRGLIMGIIGPSGSGKST  363
            RE LL V G   A G KI+V+GL R ++  G  +L  + LD+PRG++MG+IGPSGSGKST
Sbjct  9    REHLLDVGGL-AAGGPKIRVRGLRRRAEASGEEILRGVDLDVPRGVVMGVIGPSGSGKST  67

Query  364  FLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLR  543
             LRALNRLWEPA   V LDG DIC +DVL+LR KVGMLFQLPA+F+GTVADN+RYGP LR
Sbjct  68   LLRALNRLWEPAPGAVTLDGADICGMDVLALRRKVGMLFQLPAMFDGTVADNVRYGPQLR  127

Query  544  GKKLSDdqvlrllsladldssFCNKPGGELSVGQ--------------------------  645
            GKKLS+ +V  LLSL+DLD +  ++P  ELSVGQ                          
Sbjct  128  GKKLSEAEVKSLLSLSDLDPALSSRPASELSVGQAQRVALARTLANDPEALLPGQAHTRA  187

Query  646  AQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQ  825
            AQRVALARTLAN+PEVLLLDEPTSALDPISTQNIE+ +VRLK  + +T  +VSHS+KQIQ
Sbjct  188  AQRVALARTLANDPEVLLLDEPTSALDPISTQNIEEAIVRLKTARGLTTVIVSHSVKQIQ  247

Query  826  RIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            RIAD+VCL+V+GE+VEVL P  LS+AKHPMA+
Sbjct  248  RIADLVCLVVDGEVVEVLAPSALSEAKHPMAR  279



>ref|XP_008809991.1| PREDICTED: protein STAR1 [Phoenix dactylifera]
Length=266

 Score =   291 bits (745),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 174/256 (68%), Positives = 208/256 (81%), Gaps = 12/256 (5%)
 Frame = +1

Query  181  EERELLLM-VDGDDEAAG-------TKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGI  333
            E RE LL+ VDG   AAG        K+QV+ LT++S+  G  +L ++ LD+P G IMG+
Sbjct  7    EIREHLLVDVDG---AAGQKLPKEAAKLQVRNLTKLSETTGEPILREVNLDVPEGAIMGV  63

Query  334  IGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVA  513
            IGPSGSGKST LRA+NRLWEP+  TVFLDG+DIC LDVLSLR KVGMLFQLPALF+GTVA
Sbjct  64   IGPSGSGKSTLLRAVNRLWEPSPGTVFLDGQDICGLDVLSLRRKVGMLFQLPALFDGTVA  123

Query  514  DNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEV  693
            DN+R+GP LRGKKL++ +V +LLS ADLD SF +K    LSVG+ QRVALARTLAN+PEV
Sbjct  124  DNVRFGPQLRGKKLTEAEVQKLLSQADLDPSFASKSASGLSVGEGQRVALARTLANDPEV  183

Query  694  LLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            LLLDEPTSALDPISTQNIE+ +V+LKK + MTI MVSHS+KQIQRIADV+CL+V G +VE
Sbjct  184  LLLDEPTSALDPISTQNIEEAIVQLKKSRGMTIVMVSHSVKQIQRIADVLCLVVGGVVVE  243

Query  874  VLKPDQLSQAKHPMAQ  921
            VL P  LSQA+HPMA+
Sbjct  244  VLDPSGLSQAQHPMAR  259



>ref|XP_010929292.1| PREDICTED: protein STAR1 [Elaeis guineensis]
Length=266

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 203/248 (82%), Gaps = 7/248 (3%)
 Frame = +1

Query  199  LMVDGDDEAA------GTKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGSGK  357
            L+VD D  A         K+QV+ LT+ S+  G  +L ++ LDIP G I+G+IGPSGSGK
Sbjct  12   LLVDVDGVAGEKLPTKAAKLQVRNLTKRSETTGEPILREVNLDIPEGAIVGVIGPSGSGK  71

Query  358  STFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPL  537
            ST LR+LNRLWEP+   VFLDG+DIC LDV+SLR KVGMLFQLPALF+GTVADN+R+GP 
Sbjct  72   STLLRSLNRLWEPSPGAVFLDGQDICGLDVISLRRKVGMLFQLPALFDGTVADNVRFGPQ  131

Query  538  LRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTS  717
            LRGKKL++ +V +LLSLADLD +F +KP   LSVG+ QRVALARTLAN+PEVLLLDEPTS
Sbjct  132  LRGKKLAEAEVQKLLSLADLDPAFASKPVTGLSVGEGQRVALARTLANDPEVLLLDEPTS  191

Query  718  ALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLS  897
            ALDPISTQNIE+ +VRLKK + MTI MVSHS+KQIQRIADVVCL+V G +VEVL P +LS
Sbjct  192  ALDPISTQNIEEAIVRLKKSRGMTIVMVSHSVKQIQRIADVVCLVVGGVVVEVLDPSRLS  251

Query  898  QAKHPMAQ  921
            QA+HPMA+
Sbjct  252  QAEHPMAR  259



>ref|XP_002972606.1| hypothetical protein SELMODRAFT_228126 [Selaginella moellendorffii]
 gb|EFJ26692.1| hypothetical protein SELMODRAFT_228126 [Selaginella moellendorffii]
Length=258

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 185/229 (81%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            K+ V+ L+R +D G T+L+ ++ D+  G ++GIIGPSGSGKST LRALNRLWEP   T+F
Sbjct  24   KLSVRRLSRRADTGDTILSNLSFDVFPGAVVGIIGPSGSGKSTLLRALNRLWEPPAQTIF  83

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG+D+  LDV++LR +VGMLFQ P LFEGTV+DN+RYGP LRGK L D +VL LL  AD
Sbjct  84   LDGQDVTKLDVIALRRRVGMLFQTPCLFEGTVSDNVRYGPKLRGKTLEDGEVLALLQQAD  143

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LDSSF +KP   LSVGQ+QRVALARTLAN PEVLLLDEPTS+LDP+STQNIE  L++L K
Sbjct  144  LDSSFADKPVHGLSVGQSQRVALARTLANRPEVLLLDEPTSSLDPVSTQNIEASLLKLCK  203

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            +K +T+ +VSHSI Q+QR+ADVV LLV G+IVE++ P +L  A HP+A+
Sbjct  204  DKSLTLVLVSHSINQVQRMADVVFLLVNGQIVEIVTPGELENASHPLAR  252



>gb|AFW69272.1| hypothetical protein ZEAMMB73_510526 [Zea mays]
Length=341

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 184/246 (75%), Gaps = 19/246 (8%)
 Frame = +1

Query  187  RELLLMVDGDDEAAGTKIQVKGLTRVSDK-GLTLLNQITLDIPRGLIMGIIGPSGSGKST  363
            RE LL VDG   AA  KI+V+GL R +D  G  +L  + LD+PRG +MG+IGPSGSGKST
Sbjct  107  REHLLDVDGGGAAAVPKIRVRGLRRRADATGEEILRGVHLDVPRGAVMGVIGPSGSGKST  166

Query  364  FLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLR  543
             LRALNRLWEPA   V LDG DIC LDVL+LR KVGMLFQLPA+F+GTVADN+RYGP LR
Sbjct  167  LLRALNRLWEPAPGAVLLDGADICALDVLALRRKVGMLFQLPAMFDGTVADNVRYGPQLR  226

Query  544  GKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSAL  723
            GKKL++ +V  LL LADLD + C+KP  ELS                  VLLLDEPTSAL
Sbjct  227  GKKLTEAEVKSLLHLADLDPALCSKPASELS------------------VLLLDEPTSAL  268

Query  724  DPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQA  903
            DPISTQNIE+ +VRLKK + +T  +VSHS+KQIQRIAD+VCL+V GE+VEVL P  LS A
Sbjct  269  DPISTQNIEEAIVRLKKTRGLTTVIVSHSVKQIQRIADLVCLVVAGEVVEVLAPSDLSDA  328

Query  904  KHPMAQ  921
            KHPMA+
Sbjct  329  KHPMAR  334



>ref|XP_002972060.1| ATP-binding cassette transporter, subfamily I, member 6, SmABCI6 
[Selaginella moellendorffii]
 gb|EFJ26977.1| ATP-binding cassette transporter, subfamily I, member 6, SmABCI6 
[Selaginella moellendorffii]
Length=258

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 184/229 (80%), Gaps = 0/229 (0%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            K+ V+ L+R +D G T+L+ ++ D+  G ++GIIGPSGSGKST LRALNRLWEP   T+F
Sbjct  24   KLSVRRLSRRADTGDTILSNLSFDVFPGAVVGIIGPSGSGKSTLLRALNRLWEPPAQTIF  83

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG+D+  LDV++LR +VGMLFQ P LFEGTV+ N+RYGP LRGK L D +VL LL  AD
Sbjct  84   LDGQDVTKLDVIALRRRVGMLFQTPCLFEGTVSYNVRYGPKLRGKTLEDGEVLALLQQAD  143

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            LDSSF +KP   LSVGQ+QRVALARTLAN PEVLLLDEPTS+LDP+STQNIE  L++L K
Sbjct  144  LDSSFADKPVHGLSVGQSQRVALARTLANRPEVLLLDEPTSSLDPVSTQNIEASLLKLCK  203

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            +K +T+ +VSHSI Q+QR+ADVV LLV G+IVE++ P +L  A HP+A+
Sbjct  204  DKGLTLVLVSHSINQVQRMADVVFLLVNGQIVEIVTPGELENASHPLAR  252



>gb|EMT32912.1| ABC transporter I family member 17 [Aegilops tauschii]
Length=323

 Score =   275 bits (703),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 195/284 (69%), Gaps = 43/284 (15%)
 Frame = +1

Query  184  ERELLLMVDGDDEAAGTKIQVKGLTRVSD-KGLTLLNQITLDIPRGLIMGIIGPSGSGKS  360
            E E LL     D A G KI+V+GL R S+  G  +L  + LD+PRG +MG+IGPSG GKS
Sbjct  39   EHEHLL-----DVADGPKIRVRGLRRRSEASGEEVLRGVDLDVPRGAVMGVIGPSGGGKS  93

Query  361  TFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFE-------------  501
            T LRALNRLWEPA   V LDG DIC +DVL+LR +VGMLFQLPA+F+             
Sbjct  94   TPLRALNRLWEPAPGAVALDGADICGIDVLALRRRVGMLFQLPAMFDVHGWKLVGDDDEV  153

Query  502  ------------------------GTVADNIRYGPLLRGKKLSDdqvlrllsladldssF  609
                                    GTVADN+RYGP LRGKKL+D +V  LLSLADLD + 
Sbjct  154  GDASLSRNKRPLNEFRLSSPCAAPGTVADNVRYGPQLRGKKLTDAEVEGLLSLADLDPAM  213

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             ++P  ELSVGQAQRVALA    N PEVLLLDEPTSALDPISTQNIE+ +VRLK+ + +T
Sbjct  214  SSRPASELSVGQAQRVALAPPPPNGPEVLLLDEPTSALDPISTQNIEEAIVRLKETRGLT  273

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
              +VSHS+KQIQR+AD+VCL+V+GE+VEVL    L++AKHP+A+
Sbjct  274  TVIVSHSVKQIQRVADLVCLVVDGEVVEVLAASDLARAKHPVAR  317



>ref|XP_001769120.1| ATP-binding cassette transporter, subfamily I, member 1, ABC 
component protein PpABCI1 [Physcomitrella patens]
 gb|EDQ66094.1| ATP-binding cassette transporter, subfamily I, member 1, ABC 
component protein PpABCI1 [Physcomitrella patens]
Length=219

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 168/213 (79%), Gaps = 3/213 (1%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRC  462
            LL  I+++I  GL+  IIGPSGSGKSTFLRA+NRLWEP   T+FLDG+DI  +DVL++R 
Sbjct  1    LLKGISVEISGGLVYCIIGPSGSGKSTFLRAINRLWEPPADTIFLDGEDIVKMDVLTVRR  60

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVG  642
            ++GMLFQ P LF+  VADN+RYGP L+GK L D +V   L  ADLD+SF +KP   LSVG
Sbjct  61   RIGMLFQTPMLFD--VADNVRYGPNLQGKTLIDSEVEGYLEQADLDASFVHKPVVGLSVG  118

Query  643  QAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQI  822
            QAQRVALARTLAN+P+VLLLDEPTSALDPIST +IE  ++ LK+   +T+ MVSHS++Q+
Sbjct  119  QAQRVALARTLANKPDVLLLDEPTSALDPISTHHIEQSVLELKRSG-LTVIMVSHSLEQV  177

Query  823  QRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            +RIAD VCL+V GE++EV KP +L  A HP A+
Sbjct  178  KRIADHVCLVVAGELLEVFKPTELDCASHPRAR  210



>ref|XP_002974404.1| hypothetical protein SELMODRAFT_414560 [Selaginella moellendorffii]
 gb|EFJ24626.1| hypothetical protein SELMODRAFT_414560 [Selaginella moellendorffii]
Length=283

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 168/239 (70%), Gaps = 4/239 (2%)
 Frame = +1

Query  214  DDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE  393
            D  A   KI+V  L R++  G TLL+ I L+I  G I G+IGPSGSGKST LRALNRLWE
Sbjct  38   DAAATAIKIRVDNLRRLASNGATLLSGINLEIKAGTIHGLIGPSGSGKSTVLRALNRLWE  97

Query  394  PANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
            P    +FLDG DI  L+V+ LR +VGM+FQ   LF G+VADN+RYGPLLRG  LSD+++ 
Sbjct  98   PPARAIFLDGADITQLEVIGLRRRVGMVFQAACLFPGSVADNVRYGPLLRGVHLSDERIE  157

Query  574  rllsladld---ssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQN  744
             LL  A +      F +K   ELS G+AQRV+LARTLANEPEVLLLDEPTSALDP+ST  
Sbjct  158  ELLVRAGIADPSKRFASKSEKELSGGEAQRVSLARTLANEPEVLLLDEPTSALDPLSTNL  217

Query  745  IEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            +E  ++ L+++  MT+ +VSH+++QI+RI DV   L +G +V+    +QL Q + P+ Q
Sbjct  218  VEKTVMELRRDG-MTVVLVSHNMQQIERIVDVATFLCDGSVVDTGTLEQLKQLRVPVLQ  275



>ref|XP_002985705.1| hypothetical protein SELMODRAFT_446336 [Selaginella moellendorffii]
 gb|EFJ13283.1| hypothetical protein SELMODRAFT_446336 [Selaginella moellendorffii]
Length=280

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 166/232 (72%), Gaps = 4/232 (2%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            KI+V  L R++  G TLL+ I L+I  G I G+IGPSGSGKST LRALNRLWEP    +F
Sbjct  42   KIRVDNLRRLASNGATLLSGINLEIKAGTIHGLIGPSGSGKSTVLRALNRLWEPPARAIF  101

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG DI  L+V+ LR +VGM+FQ   LF G+VADN+RYGPLLRG  LSD+++  LL  A 
Sbjct  102  LDGADITQLEVIGLRRRVGMVFQAACLFPGSVADNVRYGPLLRGVHLSDERIEELLVRAG  161

Query  595  ld---ssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +      F +K   ELS G+AQRV+LARTLANEPEVLLLDEPTSALDP+ST  +E  ++ 
Sbjct  162  IADPSKRFASKSEKELSGGEAQRVSLARTLANEPEVLLLDEPTSALDPLSTNLVEKTVME  221

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            L+++  MT+ +VSH+++QI+RI DV   L +G +V+    +QL Q + P+ Q
Sbjct  222  LRRDG-MTVVLVSHNMQQIERIVDVATFLCDGSVVDTGTLEQLKQLRVPVLQ  272



>ref|XP_010265392.1| PREDICTED: ABC transporter I family member 17 isoform X3 [Nelumbo 
nucifera]
Length=192

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 146/177 (82%), Gaps = 3/177 (2%)
 Frame = +1

Query  169  MEVPEERELLLMVDGDD---EAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIG  339
            ME   +   + M++G D       +KIQV+GLTRVSD G+ +LN +++DIP+G+I+GIIG
Sbjct  1    METTPDETRIPMLNGVDVIEPETKSKIQVRGLTRVSDTGVPILNGVSVDIPKGVIVGIIG  60

Query  340  PSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADN  519
            PSGSGKST LRALNRLWEP   TV LDG+DICDLDVL+LR KVGMLFQLP LF+GTVADN
Sbjct  61   PSGSGKSTLLRALNRLWEPPAGTVLLDGRDICDLDVLTLRRKVGMLFQLPVLFDGTVADN  120

Query  520  IRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPE  690
            IRYGP LRGKKLSD +V +LL+LADLDSSF  K GGELSVGQAQRVALARTLAN+P+
Sbjct  121  IRYGPQLRGKKLSDTEVSKLLNLADLDSSFATKAGGELSVGQAQRVALARTLANDPK  177



>gb|EMT05468.1| hypothetical protein F775_42535 [Aegilops tauschii]
Length=168

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +1

Query  439  LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNK  618
            +DVL+LR KVGMLFQLPA+F+G+V DN+RYGP LRGKKLS+ +V  LLSL+DLD +  ++
Sbjct  1    MDVLALRRKVGMLFQLPAMFDGSVGDNVRYGPQLRGKKLSEAEVKSLLSLSDLDPALSSR  60

Query  619  PGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAM  798
            P  ELSVGQAQRVALAR LAN+PEVLLLDEPTSALDPISTQNIE+ +VRLK  + +T  +
Sbjct  61   PASELSVGQAQRVALARPLANDPEVLLLDEPTSALDPISTQNIEEAIVRLKTARGLTTVI  120

Query  799  VSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            VSHS+KQIQRIAD+VCL+V+GE+VEVL P  LS+AKHPMA+
Sbjct  121  VSHSVKQIQRIADLVCLVVDGEVVEVLAPSALSEAKHPMAR  161



>gb|KHN00143.1| ABC transporter I family member 17 [Glycine soja]
Length=157

 Score =   220 bits (561),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  472  MLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQ  651
            MLFQLPALFEG+VADN+RYGP LRGKKLSDD+V +LL +ADLD+SF +K G ELSVGQAQ
Sbjct  1    MLFQLPALFEGSVADNVRYGPQLRGKKLSDDEVRKLLLMADLDASFMDKSGAELSVGQAQ  60

Query  652  RVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRI  831
            RVALARTLAN P+VLLLDEPTSALDPIST+NIED LV+L K + MT+ MVSHSIKQIQRI
Sbjct  61   RVALARTLANSPQVLLLDEPTSALDPISTENIEDALVKLNKNQGMTVIMVSHSIKQIQRI  120

Query  832  ADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            A +VCLLV+GEIVEVL P  LSQA HPMA+
Sbjct  121  AHIVCLLVDGEIVEVLNPHNLSQANHPMAK  150



>gb|ACU21458.1| unknown [Glycine max]
Length=157

 Score =   220 bits (561),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  472  MLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQ  651
            MLFQLPALFEG+VADN+RYGP LRGKKLSDD+V +LL +ADLD+SF +K G ELSVGQAQ
Sbjct  1    MLFQLPALFEGSVADNVRYGPQLRGKKLSDDEVRKLLLMADLDASFMDKSGAELSVGQAQ  60

Query  652  RVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRI  831
            RVALARTLAN P+VLLLDEPTSALDPIST+NIED LV+L K + MT+ MVSHSIKQIQRI
Sbjct  61   RVALARTLANSPQVLLLDEPTSALDPISTENIEDALVKLNKNQGMTVIMVSHSIKQIQRI  120

Query  832  ADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            A +VCLLV+GEIVEVL P  LSQA HPMA+
Sbjct  121  AHIVCLLVDGEIVEVLNPHNLSQANHPMAK  150



>ref|XP_010265391.1| PREDICTED: ABC transporter I family member 17 isoform X2 [Nelumbo 
nucifera]
Length=253

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 146/177 (82%), Gaps = 3/177 (2%)
 Frame = +1

Query  169  MEVPEERELLLMVDGDD---EAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIG  339
            ME   +   + M++G D       +KIQV+GLTRVSD G+ +LN +++DIP+G+I+GIIG
Sbjct  1    METTPDETRIPMLNGVDVIEPETKSKIQVRGLTRVSDTGVPILNGVSVDIPKGVIVGIIG  60

Query  340  PSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADN  519
            PSGSGKST LRALNRLWEP   TV LDG+DICDLDVL+LR KVGMLFQLP LF+GTVADN
Sbjct  61   PSGSGKSTLLRALNRLWEPPAGTVLLDGRDICDLDVLTLRRKVGMLFQLPVLFDGTVADN  120

Query  520  IRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPE  690
            IRYGP LRGKKLSD +V +LL+LADLDSSF  K GGELSVGQAQRVALARTLAN+P+
Sbjct  121  IRYGPQLRGKKLSDTEVSKLLNLADLDSSFATKAGGELSVGQAQRVALARTLANDPK  177



>gb|KDO36204.1| hypothetical protein CISIN_1g046954mg, partial [Citrus sinensis]
Length=146

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  505  TVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANE  684
            TVADNIRYGP LRGKKL++++V +LLSLADLDSSF +K G E+SVGQAQRVALARTLANE
Sbjct  1    TVADNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLSKTGAEISVGQAQRVALARTLANE  60

Query  685  PEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGE  864
            PEVLLLDEPTSALDPISTQNIEDVLV+LKK+  MTI MVSHSIKQIQRIADVVCLLV GE
Sbjct  61   PEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGE  120

Query  865  IVEVLKPDQLSQAKHPMA  918
            IVEVLKPD LS+AKHPMA
Sbjct  121  IVEVLKPDLLSEAKHPMA  138



>gb|KCW53583.1| hypothetical protein EUGRSUZ_J02855 [Eucalyptus grandis]
Length=206

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 142/173 (82%), Gaps = 2/173 (1%)
 Frame = +1

Query  181  EERELLLMVDGDD--EAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSG  354
            E +E LL+VD  D  +    K +VKGL +VSD G  +L +I L+IP+G I+GIIGPSGSG
Sbjct  16   EAQEHLLVVDIADGVKEDRAKFEVKGLNKVSDAGDPILREINLEIPQGKIVGIIGPSGSG  75

Query  355  KSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGP  534
            KST LRALNRLWEP + TVFLDG+DI +LDVLSLR KVGMLFQLPA+FEGTVADN+RYGP
Sbjct  76   KSTLLRALNRLWEPPSGTVFLDGEDIKNLDVLSLRRKVGMLFQLPAMFEGTVADNVRYGP  135

Query  535  LLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEV  693
             L GKKL+D +V +LL+LADLDSS  ++ G ELSVGQAQRVALARTLANEPEV
Sbjct  136  QLMGKKLTDGEVFKLLNLADLDSSLFSRAGSELSVGQAQRVALARTLANEPEV  188



>gb|ADM77072.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77073.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77074.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77075.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77076.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77077.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77078.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77079.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77080.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77081.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77082.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77083.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77084.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77085.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77086.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77087.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77088.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77089.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77090.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77091.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77092.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77093.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77094.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77095.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77096.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77097.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77098.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77099.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77100.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77101.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77102.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77103.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77104.1| ABC transporter-like protein [Picea sitchensis]
 gb|ADM77105.1| ABC transporter-like protein [Picea sitchensis]
Length=154

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  346  GSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIR  525
            GSGKSTFLRALNRLWEP   +VFLD  DI  LDVL+LR +VGMLFQ PALFEG+VADNIR
Sbjct  1    GSGKSTFLRALNRLWEPPADSVFLDNHDISRLDVLALRRRVGMLFQTPALFEGSVADNIR  60

Query  526  YGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLD  705
            YGP LRG+KLSD++V   L LADL+SS   +    LSVGQAQRVALAR LANEPEVLLLD
Sbjct  61   YGPALRGEKLSDEKVAEYLGLADLESSLAARSASGLSVGQAQRVALARALANEPEVLLLD  120

Query  706  EPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSH  807
            EPTSALDPIST++IE  + +LK+ K MTI MVSH
Sbjct  121  EPTSALDPISTEHIEKSIGKLKRGKGMTIIMVSH  154



>ref|WP_013298285.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacterium 
thermosaccharolyticum]
 ref|YP_003852403.1| ABC transporter [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
 gb|ADL69319.1| ABC transporter related [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
Length=242

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 145/203 (71%), Gaps = 2/203 (1%)
 Frame = +1

Query  265  SDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLD  444
            SD    +L  IT++IP G I  IIGPSG+GKST ++ +NRL +P    + +DGKDI D D
Sbjct  12   SDSDEVILKDITIEIPTGYIYTIIGPSGAGKSTLIKLINRLIDPTEGKILIDGKDIKDYD  71

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPG  624
            ++ LR K+GM+FQ P LF+GTV DNI+YGP+L+GKK  D  V   LS+  LD ++  +  
Sbjct  72   IIELRRKIGMVFQQPYLFDGTVEDNIKYGPMLKGKKGID--VEYYLSIVGLDKNYRTRKV  129

Query  625  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVS  804
             +LS G+AQR+++ARTLANEPEVLLLDEPTSALDP STQ IE++++ LK +  +T   ++
Sbjct  130  DDLSGGEAQRISIARTLANEPEVLLLDEPTSALDPASTQVIEELVMDLKNKLNLTFIWIT  189

Query  805  HSIKQIQRIADVVCLLVEGEIVE  873
            H+++Q +R+ D    + +G +VE
Sbjct  190  HNMEQAKRVGDYTVFINKGRLVE  212



>ref|WP_026485986.1| phosphate ABC transporter ATP-binding protein [Caldanaerobius 
polysaccharolyticus]
Length=244

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 147/203 (72%), Gaps = 2/203 (1%)
 Frame = +1

Query  265  SDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLD  444
            S  G  +L  ++ D+P G I  +IGPSG+GKST ++ +NRL +P   TV++DG+DI  +D
Sbjct  14   SSGGKDILKDLSFDLPEGFIHTVIGPSGAGKSTMIKLINRLIDPTAGTVYVDGEDIRSVD  73

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPG  624
            V+ LR ++GM+FQ   LFEGTVADNIRYGP L+G +  D  V+R L +  LD  + ++  
Sbjct  74   VIKLRRRIGMVFQQACLFEGTVADNIRYGPSLQGNR--DVDVVRFLHMVGLDEDYQHRDV  131

Query  625  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVS  804
             +LS G+ QRV++ARTLAN PE++LLDEPTSALDP S+Q IED+++RLKKE ++T   ++
Sbjct  132  SQLSGGEQQRVSIARTLANSPEIMLLDEPTSALDPASSQLIEDLILRLKKELKLTFVWIT  191

Query  805  HSIKQIQRIADVVCLLVEGEIVE  873
            H+++Q  R+ D   L+V+G ++E
Sbjct  192  HNMEQAIRVGDYTLLIVDGRLIE  214



>ref|WP_013298440.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacterium 
thermosaccharolyticum]
 ref|YP_003852558.1| ABC transporter [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
 gb|ADL69474.1| ABC transporter related [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
Length=242

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 142/203 (70%), Gaps = 2/203 (1%)
 Frame = +1

Query  265  SDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLD  444
            SD    +L  ITL+I  G I  IIGPSG+GKST ++ +NRL +P    + +DG DI + D
Sbjct  12   SDSDDVILKDITLEIYMGHIYTIIGPSGAGKSTLIKLINRLIDPTEGKILIDGNDIMNYD  71

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPG  624
            ++ LR K+GM+FQ P LFEGTV DNI+YGP+L+GK+  D  V   L +  LD S+  K  
Sbjct  72   IIQLRRKIGMVFQQPYLFEGTVEDNIKYGPMLKGKR--DVDVEYYLKIVGLDKSYSKKKV  129

Query  625  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVS  804
             +LS G+AQR+++ARTLANEPEVLLLDEPTSALDP STQ IE++++ LK +  +T   ++
Sbjct  130  DDLSGGEAQRISIARTLANEPEVLLLDEPTSALDPASTQVIEELVIDLKNKLNLTFIWIT  189

Query  805  HSIKQIQRIADVVCLLVEGEIVE  873
            H+++Q +R+ D    + +G +VE
Sbjct  190  HNMEQAKRVGDYTIFINKGRLVE  212



>ref|WP_015312092.1| ABC-type phosphate transport system, ATPase component [Thermoanaerobacterium 
thermosaccharolyticum]
 ref|YP_007299289.1| ABC-type phosphate transport system, ATPase component [Thermoanaerobacterium 
thermosaccharolyticum M0795]
 gb|AGB19592.1| ABC-type phosphate transport system, ATPase component [Thermoanaerobacterium 
thermosaccharolyticum M0795]
Length=242

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 141/203 (69%), Gaps = 2/203 (1%)
 Frame = +1

Query  265  SDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLD  444
            SD    +L  ITL+I  G I  IIGPSG+GKST ++ +NRL +     + +DG DI + D
Sbjct  12   SDSDDVILEDITLEIYMGHIYTIIGPSGAGKSTLIKLINRLIDATEGKILIDGNDIKNYD  71

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPG  624
            ++ LR K+GM+FQ P LFEGTV DNI+YGP+L+GK+  D  V   L +  LD S+  K  
Sbjct  72   IIQLRRKIGMVFQQPYLFEGTVEDNIKYGPMLKGKR--DVDVEYYLKIVGLDKSYSKKKV  129

Query  625  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVS  804
             +LS G+AQR+++ARTLANEPEVLLLDEPTSALDP STQ IE++++ LK +  +T   ++
Sbjct  130  DDLSGGEAQRISIARTLANEPEVLLLDEPTSALDPASTQVIEELVIDLKNKLNLTFIWIT  189

Query  805  HSIKQIQRIADVVCLLVEGEIVE  873
            H+++Q +R+ D    + +G +VE
Sbjct  190  HNMEQAKRVGDYTIFINKGRLVE  212



>ref|WP_038070231.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacterium 
aotearoense]
Length=242

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 141/197 (72%), Gaps = 2/197 (1%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRC  462
            +L  I+++I  G I  IIGPSG+GKSTF++ +NRL +P    + +D K+I D D++ LR 
Sbjct  18   ILKDISMEISLGYIYTIIGPSGAGKSTFIKLINRLIDPTEGKILIDDKNIKDYDIIKLRR  77

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVG  642
            ++GM+FQ P LFEGTV DNI+YG ++RG+K  D  +   LS+  LD S+ ++   +LS G
Sbjct  78   RIGMVFQQPYLFEGTVEDNIKYGSMIRGQK--DTDLDYYLSMVGLDKSYSSRKVDDLSGG  135

Query  643  QAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQI  822
            +AQR+++AR+LANEP VLLLDEPTSALDP STQ IED+++ LK +  +TI  ++H+++Q 
Sbjct  136  EAQRISIARSLANEPTVLLLDEPTSALDPASTQVIEDLVMELKNKLNLTIIWITHNMEQA  195

Query  823  QRIADVVCLLVEGEIVE  873
            +R+ D    +  G ++E
Sbjct  196  KRVGDFTIFINNGRLIE  212



>ref|WP_014759189.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacterium 
saccharolyticum]
 ref|YP_006392952.1| ABC transporter [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
 gb|AFK87353.1| ABC transporter related protein [Thermoanaerobacterium saccharolyticum 
JW/SL-YS485]
 gb|ETO37080.1| ABC transporter [Thermoanaerobacterium aotearoense SCUT27]
Length=245

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 141/197 (72%), Gaps = 2/197 (1%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRC  462
            +L  I+++I  G I  IIGPSG+GKSTF++ +NRL +P    + +D K+I D D++ LR 
Sbjct  21   ILKDISMEISLGYIYTIIGPSGAGKSTFIKLINRLIDPTEGKILIDDKNIKDYDIIKLRR  80

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVG  642
            ++GM+FQ P LFEGTV DNI+YG ++RG+K  D  +   LS+  LD S+ ++   +LS G
Sbjct  81   RIGMVFQQPYLFEGTVEDNIKYGSMIRGQK--DTDLDYYLSMVGLDKSYSSRKVDDLSGG  138

Query  643  QAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQI  822
            +AQR+++AR+LANEP VLLLDEPTSALDP STQ IED+++ LK +  +TI  ++H+++Q 
Sbjct  139  EAQRISIARSLANEPTVLLLDEPTSALDPASTQVIEDLVMELKNKLNLTIIWITHNMEQA  198

Query  823  QRIADVVCLLVEGEIVE  873
            +R+ D    +  G ++E
Sbjct  199  KRVGDFTIFINNGRLIE  215



>ref|WP_013149751.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacter 
mathranii]
 ref|YP_003676146.1| ABC transporter-like protein [Thermoanaerobacter mathranii subsp. 
mathranii str. A3]
 gb|ADH60135.1| ABC transporter related protein [Thermoanaerobacter mathranii 
subsp. mathranii str. A3]
Length=240

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/217 (46%), Positives = 148/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATV  411
             KI+ K ++  S  G  +L  I++    G I  I+GPSG+GKST ++ +NRL +P + ++
Sbjct  2    NKIEFKEVSYGS-FGKEILKDISVKFEGGAIHTIVGPSGAGKSTLIKLINRLIDPTHGSI  60

Query  412  FLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsla  591
             +D  DI  +DV+ LR ++GM+FQ P LFEGTV DNI YGP+L+G+K  +  V   LS+ 
Sbjct  61   LIDDVDIKTIDVIDLRRRIGMVFQQPHLFEGTVKDNIEYGPMLKGEK--NVNVEYYLSIV  118

Query  592  dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLK  771
             L++ +  +    LS G+ QRV++ARTLAN PE LLLDEPTSALDP ST+ IE+++V+LK
Sbjct  119  GLNNEYATRDVKNLSGGEQQRVSIARTLANNPEALLLDEPTSALDPTSTEIIEELIVKLK  178

Query  772  KEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            +E  +T+  ++H+++Q +RI D   LL +G +VE  K
Sbjct  179  EEMNLTVIWITHNMEQAKRIGDYTALLNKGILVEYAK  215



>ref|WP_028991621.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacter 
thermocopriae]
Length=240

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 148/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATV  411
             KI+ K ++  S  G  +L  I++    G I  I+GPSG+GKST ++ +NRL +P + ++
Sbjct  2    NKIEFKEVSYGS-FGKEILKDISVKFEGGAIHTIVGPSGAGKSTLIKLINRLIDPTHGSI  60

Query  412  FLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsla  591
             +D  DI  +DV+ LR ++GM+FQ P LFEGTV DNI YGP+L+G+K  +  V   LS+ 
Sbjct  61   LIDDVDIKTIDVIDLRRRIGMVFQQPHLFEGTVKDNIEYGPMLKGEK--NVNVEYYLSIV  118

Query  592  dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLK  771
             L++ +  +    LS G+ QRV++ARTLAN PE LLLDEPTSALDP ST+ IE+++V+LK
Sbjct  119  GLNNEYATRDVKNLSGGEQQRVSIARTLANNPEALLLDEPTSALDPTSTEIIEELIVKLK  178

Query  772  KEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            +E  +T+  ++H+++Q +RI D   LL +G ++E  K
Sbjct  179  EEMNLTVIWITHNMEQAKRIGDYTALLNKGILIEYAK  215



>ref|WP_003867036.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Thermoanaerobacter]
 ref|YP_003476161.1| ABC transporter [Thermoanaerobacter italicus Ab9]
 gb|EEU63006.1| ABC transporter related protein [Thermoanaerobacter ethanolicus 
CCSD1]
 gb|ADD01599.1| ABC transporter related protein [Thermoanaerobacter italicus 
Ab9]
Length=241

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 147/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATV  411
             KI+ K ++  S  G  +L  I++    G I  I+GPSG+GKST ++ +NRL +P   ++
Sbjct  2    NKIEFKEVS-YSSFGKEILKDISVKFEGGAIHTIVGPSGAGKSTLIKLINRLIDPTYGSI  60

Query  412  FLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsla  591
             +D  DI  +DV+ LR ++GM+FQ P LFEGTV DNI YGP+L+G+K  +  V   LS+ 
Sbjct  61   LIDDVDIKTIDVIDLRRRIGMVFQQPHLFEGTVKDNIEYGPMLKGEK--NVNVEYYLSIV  118

Query  592  dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLK  771
             L+S +  +    LS G+ QRV++ARTLAN PE LLLDEPT+ALDP ST+ IE+++V+LK
Sbjct  119  GLNSEYATRDVKNLSGGEQQRVSIARTLANNPEALLLDEPTAALDPTSTEIIEELIVKLK  178

Query  772  KEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            +E  +T+  ++H+++Q +RI D   LL +G ++E  K
Sbjct  179  EEMNLTVIWITHNMEQAKRIGDYTALLNKGILIEYAK  215



>ref|WP_009051890.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Thermoanaerobacter]
 ref|YP_001661906.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacter 
sp. X514]
 ref|YP_003903247.1| ABC transporter-like protein [Thermoanaerobacter sp. X513]
 gb|ABY91570.1| ABC transporter related [Thermoanaerobacter sp. X514]
 gb|EFK85319.1| ABC transporter related protein [Thermoanaerobacter sp. X561]
 gb|ADN53956.1| ABC transporter related protein [Thermoanaerobacter sp. X513]
Length=240

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 147/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATV  411
             KI+ K ++  S  G  +L  I++    G I  I+GPSG+GKST ++ +NRL +P + ++
Sbjct  2    NKIEFKEVSYGS-FGKEILKDISVKFEGGAIHTIVGPSGAGKSTLIKLINRLIDPTHGSI  60

Query  412  FLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsla  591
             +D  DI  +DV+ LR ++GM+FQ P LFEGTV DNI YGP+L+G+K  +  V   LS+ 
Sbjct  61   LIDDVDIKTIDVIDLRRRIGMVFQQPHLFEGTVKDNIEYGPMLKGEK--NVNVEYYLSIV  118

Query  592  dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLK  771
             L++ +  +    LS G+ QRV++ARTL N PE LLLDEPTSALDP ST+ IE+++V+LK
Sbjct  119  GLNNEYATRDVKNLSGGEQQRVSIARTLTNNPEALLLDEPTSALDPTSTEIIEELIVKLK  178

Query  772  KEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            +E  +T+  ++H+++Q +RI D   LL +G +VE  K
Sbjct  179  EEMNLTVIWITHNMEQAKRIGDYTALLNKGILVEYAK  215



>gb|KHO61291.1| phosphate ABC transporter ATP-binding protein, PhoT family [Thermoanaerobacter 
sp. YS13]
Length=241

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 140/206 (68%), Gaps = 2/206 (1%)
 Frame = +1

Query  265  SDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLD  444
            S  G  +L  I++    G I  I+GPSG+GKST ++ +NRL EP + ++ +D  DI  +D
Sbjct  12   SSFGKEILKNISVKFEGGAIHTIVGPSGAGKSTLIKLINRLIEPTHGSILIDDVDIKTID  71

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPG  624
            V+ LR ++GM+FQ P LFEGTV +NI YGP+L+G+K  +  V   LS+  L+S +  +  
Sbjct  72   VIDLRRRIGMVFQQPHLFEGTVKENIEYGPMLKGEK--NIHVEYYLSIVGLNSEYATRDV  129

Query  625  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVS  804
              LS G+ QRV++ARTLAN PE LLLDEPTSALDP ST+ +E ++  LK++  +TI  ++
Sbjct  130  KNLSGGEQQRVSIARTLANNPETLLLDEPTSALDPTSTEIVEKLIFYLKEKMNLTIIWIT  189

Query  805  HSIKQIQRIADVVCLLVEGEIVEVLK  882
            H+++Q +RI D   LL +G+++E  K
Sbjct  190  HNMEQAKRIGDYTALLNKGQLIEYAK  215



>ref|WP_003869904.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacter 
ethanolicus]
 gb|EGD52147.1| ABC transporter related protein [Thermoanaerobacter ethanolicus 
JW 200]
Length=279

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 142/206 (69%), Gaps = 2/206 (1%)
 Frame = +1

Query  265  SDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLD  444
            S  G  +L  I++    G I  I+GPSG+GKST ++ +NRL +P + ++ +DG D+  +D
Sbjct  50   SSFGKEILKNISVKFEGGAIHTIVGPSGAGKSTLIKLINRLIDPTHGSILIDGVDVKTID  109

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPG  624
            V+ LR ++GM+FQ P LFEGTV +NI YGP+L+G+K  +  V   LS+A L+S +  +  
Sbjct  110  VIDLRRRIGMVFQQPHLFEGTVKENIEYGPMLKGEK--NINVEYYLSIAGLNSEYATRDV  167

Query  625  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVS  804
              LS G+ QRV++ARTLAN PE LLLDEPTSALDP ST+ +E ++  LK++  +TI  ++
Sbjct  168  KSLSGGEQQRVSIARTLANNPETLLLDEPTSALDPTSTEIVEKLIFNLKEKMNLTIIWIT  227

Query  805  HSIKQIQRIADVVCLLVEGEIVEVLK  882
            H+++Q +RI D   LL +G+++E  K
Sbjct  228  HNMEQAKRIGDYTVLLNKGQLIEYAK  253



>ref|WP_029688444.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacter 
sp. A7A]
Length=241

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 139/203 (68%), Gaps = 2/203 (1%)
 Frame = +1

Query  274  GLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLS  453
            G  +L  I++    G I  I+GPSG+GKST ++ +NRL +P + ++ +D  DI  +DV+ 
Sbjct  15   GNKILKNISVKFEGGAIHTIVGPSGAGKSTLIKLINRLIDPTHGSILIDDVDIKTIDVID  74

Query  454  LRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGEL  633
            LR ++GM+FQ P LFEGTV +NI YGP+L+G+K  +  V   LS+  L++ +  K    L
Sbjct  75   LRRRIGMVFQQPHLFEGTVKENIEYGPMLKGEK--NVNVEYYLSIVGLNNEYATKDVKNL  132

Query  634  SVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSI  813
            S G+ QRV++ARTLAN PE LLLDEPTSALDP ST+ +E ++  LK++  +TI  ++H++
Sbjct  133  SGGEQQRVSIARTLANNPEALLLDEPTSALDPTSTEIVEKLIFNLKEKMNLTIIWITHNM  192

Query  814  KQIQRIADVVCLLVEGEIVEVLK  882
            +Q +RI D   LL +G+++E  K
Sbjct  193  EQAKRIGDYTALLNKGQLIEYAK  215



>ref|WP_014062201.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacter 
wiegelii]
 ref|YP_004819125.1| ABC transporter-like protein [Thermoanaerobacter wiegelii Rt8.B1]
 gb|AEM77841.1| ABC transporter related protein [Thermoanaerobacter wiegelii 
Rt8.B1]
Length=241

 Score =   179 bits (455),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 140/206 (68%), Gaps = 2/206 (1%)
 Frame = +1

Query  265  SDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLD  444
            S  G  +L  I++    G I  I+GPSG+GKST ++ +NRL +P + ++ +D  DI  +D
Sbjct  12   SSFGKEILKNISVKFEGGAIHTIVGPSGAGKSTLIKLINRLIDPTHGSILIDDVDIKTID  71

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPG  624
            V+ LR ++GM+FQ P LFEGTV +NI YGP+L+G+K  +  V   LS+  L++ +  +  
Sbjct  72   VIDLRRRIGMVFQQPHLFEGTVKENIEYGPMLKGEK--NVNVEYYLSIVGLNNEYATRDV  129

Query  625  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVS  804
              LS G+ QRV++ARTLAN PE LLLDEPTSALDP ST+ +E ++  LK++  +TI  ++
Sbjct  130  KNLSGGEQQRVSIARTLANNPEALLLDEPTSALDPTSTEIVEKLIFNLKEKMNLTIIWIT  189

Query  805  HSIKQIQRIADVVCLLVEGEIVEVLK  882
            H+++Q +RI D   LL +G+++E  K
Sbjct  190  HNMEQAKRIGDYTALLNKGQLIEYAK  215



>ref|WP_009611257.1| phosphate ABC transporter ATP-binding protein [Caldanaerobacter 
subterraneus]
 gb|EEB75172.1| ABC transporter, ATP-binding protein, putative [Caldanaerobacter 
subterraneus subsp. pacificus DSM 12653]
Length=239

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 144/229 (63%), Gaps = 6/229 (3%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            +I++K ++   D G  +L  +     +  I  ++GPSG+GKST L+ +NRL EP    +F
Sbjct  2    EIELKNISYFRD-GKYILKNVYFKFEKNGIYTVVGPSGAGKSTMLKLINRLIEPTEGAIF  60

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            ++G +  ++DV+ LR K+GM+FQ P LFEGTV +NI  GP LRG+K  D           
Sbjct  61   INGVEYKNIDVILLRRKIGMVFQRPFLFEGTVKENIELGPSLRGEKNIDALFYLEAVGLS  120

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
             D  F  K    LS G+AQRV++AR LAN PEVLLLDEPTS+LDP ST  IE+++ RL +
Sbjct  121  KDYLF--KDVNNLSGGEAQRVSIARALANSPEVLLLDEPTSSLDPTSTSIIEELIKRLNR  178

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            E  M I +V+H+++Q +RI D    L +GE++E  K  +  +  +P+++
Sbjct  179  EGIMVI-LVTHNMEQAKRIGDYTLFLYKGELIEARKTWEFFE--NPISE  224



>ref|WP_006569253.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacter 
siderophilus]
 gb|EIV99276.1| ABC-type phosphate transport system, ATPase component [Thermoanaerobacter 
siderophilus SR4]
Length=241

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 138/203 (68%), Gaps = 2/203 (1%)
 Frame = +1

Query  274  GLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLS  453
            G  +L   ++    G I  I+GPSG+GKST ++ +NRL +P + ++ +D  DI  +DV+ 
Sbjct  15   GKEILKNTSVKFEGGAIHTIVGPSGAGKSTLIKLINRLIDPTHGSILIDDVDIKTIDVID  74

Query  454  LRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGEL  633
            LR +VGM+FQ P LFEGTV +NI YGP+L+G+K  +  V   LS+  L++ +  +    L
Sbjct  75   LRRRVGMVFQQPHLFEGTVKENIEYGPMLKGEK--NVNVEYYLSIVGLNNEYATRDVKNL  132

Query  634  SVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSI  813
            S G+ QRV++ARTLAN PE LLLDEPTSALDP ST+ +E ++  LK++  +TI  ++H++
Sbjct  133  SGGEQQRVSIARTLANNPEALLLDEPTSALDPTSTEIVEKLIFNLKEKMNLTIIWITHNM  192

Query  814  KQIQRIADVVCLLVEGEIVEVLK  882
            +Q +RI D   LL +G+++E  K
Sbjct  193  EQAKRIGDYTALLNKGQLIEYAK  215



>ref|WP_012269684.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Thermoanaerobacter]
 ref|YP_001665925.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacter 
pseudethanolicus ATCC 33223]
 ref|YP_004186908.1| ABC transporter-like protein [Thermoanaerobacter brockii subsp. 
finnii Ako-1]
 gb|ABY95589.1| ABC transporter related [Thermoanaerobacter pseudethanolicus 
ATCC 33223]
 gb|ADV80525.1| ABC transporter related protein [Thermoanaerobacter brockii subsp. 
finnii Ako-1]
Length=241

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 145/217 (67%), Gaps = 3/217 (1%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATV  411
             KI+ K ++  S  G  +L  I++    G I  I+GPSG+GKST ++ +NRL +P + ++
Sbjct  2    NKIEFKEVSYNS-FGKEILKNISVKFEGGAIHTIVGPSGAGKSTLIKLINRLIDPTHGSI  60

Query  412  FLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsla  591
             +D  DI  +DV+ LR +VGM+FQ P LFEGTV +NI YGP+L+G+K  +  V   LS+ 
Sbjct  61   LIDDVDIKTIDVIDLRRRVGMVFQQPHLFEGTVKENIEYGPMLKGEK--NVNVEYYLSIV  118

Query  592  dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLK  771
             L+S +  +    LS G+ QRV++ARTLAN PE LLLDEPTSALDP  T+ +E ++  LK
Sbjct  119  GLNSEYATRNVKNLSGGEQQRVSIARTLANNPEALLLDEPTSALDPTFTEIVEKLIFNLK  178

Query  772  KEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            ++  +TI  ++H+++Q +RI D   LL +G+++E  K
Sbjct  179  EKMNLTIIWITHNMEQAKRIGDYTALLNKGQLIEYAK  215



>ref|WP_004399736.1| MULTISPECIES: ABC-type phosphate transport system, ATPase component 
[Thermoanaerobacter]
 gb|EMT39535.1| ABC-type phosphate transport system, ATPase component [Thermoanaerobacter 
thermohydrosulfuricus WC1]
Length=241

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 139/206 (67%), Gaps = 2/206 (1%)
 Frame = +1

Query  265  SDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLD  444
            S  G  +L  I++    G I  I+GPSG+GKST ++ +NRL +P + ++ +D  DI  +D
Sbjct  12   SSFGKEILKNISVKFEGGAIHTIVGPSGAGKSTLIKLINRLIDPTHGSILIDDVDIKTID  71

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPG  624
            V+ LR ++GM+FQ P LFEGTV +NI YGP+L+G+K  +  V   LS+  L+S +  +  
Sbjct  72   VIDLRRRIGMVFQQPHLFEGTVKENIEYGPMLKGEK--NVNVEYYLSIVGLNSEYATRDV  129

Query  625  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVS  804
              LS G+ QRV++ARTLAN PE LLLDEPTSALDP ST+ +E ++  LK++  +TI  ++
Sbjct  130  KNLSGGEQQRVSIARTLANNPEALLLDEPTSALDPTSTEIVEKLIFNLKEKMNLTIIWIT  189

Query  805  HSIKQIQRIADVVCLLVEGEIVEVLK  882
            H+++Q +RI D   LL +G ++E  K
Sbjct  190  HNMEQAKRIGDYTALLNKGILIEYAK  215



>ref|WP_011024777.1| phosphate ABC transporter ATP-binding protein [Caldanaerobacter 
subterraneus]
 ref|NP_622008.1| phosphate ABC transporter ATP-binding protein [Caldanaerobacter 
subterraneus subsp. tengcongensis MB4]
 sp|Q8RCU0.1|PSTB1_THETN RecName: Full=Phosphate import ATP-binding protein PstB 1; AltName: 
Full=ABC phosphate transporter 1; AltName: Full=Phosphate-transporting 
ATPase 1 [Caldanaerobacter subterraneus subsp. 
tengcongensis MB4]
 gb|AAM23612.1| ABC-type phosphate transport system, ATPase component [Caldanaerobacter 
subterraneus subsp. tengcongensis MB4]
Length=239

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 143/229 (62%), Gaps = 6/229 (3%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            +I++K +    D G  +L  +     +  I  ++GPSG+GKST L+ +NRL EP    +F
Sbjct  2    EIELKNVNYFRD-GKYILKNVYFKFEKNGIYTVVGPSGAGKSTMLKLINRLIEPTEGAIF  60

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            ++G +  ++DV+ LR K+GM+FQ P LFEGTV +NI  GP LRG+K  D           
Sbjct  61   INGVEYKNIDVILLRRKIGMVFQRPFLFEGTVKENIELGPSLRGEKNIDALFYLEAVGLS  120

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
             D  F  K    LS G+AQRV++AR LAN PEVLLLDEPTS+LDP ST  IE+++ RL +
Sbjct  121  KDYLF--KDVNNLSGGEAQRVSIARALANSPEVLLLDEPTSSLDPTSTSIIEELIKRLNR  178

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            E  M I +V+H+++Q +RI D    L +GE++E  K  +  +  +P+++
Sbjct  179  EGIMVI-LVTHNMEQAKRIGDYTLFLYKGELIEARKTWEFFE--NPVSE  224



>ref|WP_031314164.1| phosphate ABC transporter ATP-binding protein [Caldanaerobacter 
subterraneus]
Length=240

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 144/229 (63%), Gaps = 6/229 (3%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            +I++K ++   D G  +L  +     +  I  ++GPSG+GKST L+ +NRL EP    +F
Sbjct  3    EIELKNISYFRD-GKYILKNVYFKFEKNGIYTVVGPSGAGKSTMLKLINRLIEPTEGAIF  61

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            ++G +  ++DV+ LR K+GM+FQ P LFEGTV +NI  GP L+G+K  D           
Sbjct  62   INGVEYKNIDVILLRRKIGMVFQRPFLFEGTVKENIELGPSLKGEKNIDALFYLEAVGLS  121

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
             D  F  K    LS G+AQRV++AR LAN PEVLLLDEPTS+LDP ST  IE+++ RL +
Sbjct  122  KDYLF--KDVNNLSGGEAQRVSIARALANSPEVLLLDEPTSSLDPTSTSIIEELIKRLNR  179

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            E  M I +V+H+++Q +RI D    L +GE++E  K  +  +  +P+++
Sbjct  180  EGIMVI-LVTHNMEQAKRIGDYTLFLYKGELIEARKTWEFFE--NPISE  225



>gb|ERM91541.1| phosphate ABC transporter ATP-binding protein [Caldanaerobacter 
subterraneus subsp. yonseiensis KB-1]
Length=239

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 144/229 (63%), Gaps = 6/229 (3%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            +I++K ++   D G  +L  +     +  I  ++GPSG+GKST L+ +NRL EP    +F
Sbjct  2    EIELKNISYFRD-GKYILKNVYFKFEKNGIYTVVGPSGAGKSTMLKLINRLIEPTEGAIF  60

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            ++G +  ++DV+ LR K+GM+FQ P LFEGTV +NI  GP L+G+K  D           
Sbjct  61   INGVEYKNIDVILLRRKIGMVFQRPFLFEGTVKENIELGPSLKGEKNIDALFYLEAVGLS  120

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
             D  F  K    LS G+AQRV++AR LAN PEVLLLDEPTS+LDP ST  IE+++ RL +
Sbjct  121  KDYLF--KDVNNLSGGEAQRVSIARALANSPEVLLLDEPTSSLDPTSTSIIEELIKRLNR  178

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMAQ  921
            E  M I +V+H+++Q +RI D    L +GE++E  K  +  +  +P+++
Sbjct  179  EGIMVI-LVTHNMEQAKRIGDYTLFLYKGELIEARKTWEFFE--NPISE  224



>gb|AIS51475.1| phosphate import ATP-binding protein PstB 1 [Thermoanaerobacter 
kivui]
Length=279

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 137/203 (67%), Gaps = 2/203 (1%)
 Frame = +1

Query  274  GLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLS  453
            G  +L  I++    G I  I+GPSG+GKST ++ +NRL +P + ++ +D  DI  +DV+ 
Sbjct  53   GKEILKNISVKFEGGAIHTIVGPSGAGKSTLIKLINRLIDPTHGSILIDDVDIKTIDVID  112

Query  454  LRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGEL  633
            LR +VGM+FQ P LFE TV +NI YGP+L+G+K  +  V   LS+  L+  +  +    L
Sbjct  113  LRRRVGMVFQQPHLFEETVKENIEYGPMLKGEK--NVNVEYYLSIVGLNIEYATRDVKNL  170

Query  634  SVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSI  813
            S G+ QRV++ARTLAN PE LLLDEPTSALDP ST+ +E ++  LK++  +TI  ++H++
Sbjct  171  SGGEQQRVSIARTLANNPEALLLDEPTSALDPTSTEIVEKLIFNLKEKMNLTIIWITHNM  230

Query  814  KQIQRIADVVCLLVEGEIVEVLK  882
            +Q +RI D   LL +G+++E  K
Sbjct  231  EQAKRIGDYTALLNKGQLIEYAK  253



>gb|ABK91979.1| ABC-type metal ion transport system ATPase [uncultured bacterium]
Length=229

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 129/207 (62%), Gaps = 1/207 (0%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRC  462
            LL  ++  +  G ++ ++GPSG+GKST LR LNRL EP   T+   GKD  ++D   LR 
Sbjct  24   LLRDVSFQLEHGQVLAVLGPSGAGKSTLLRMLNRLDEPTKGTMLFHGKDYREMDPRHLRR  83

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVG  642
            ++GM+ Q   LF GT A N+RYGPL  G++L+D   +         + + ++    LS G
Sbjct  84   RIGMVMQHAYLFPGTSALNVRYGPLQHGEELAD-AQVSEWMRQVGMAGYEDRDVANLSGG  142

Query  643  QAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQI  822
            +AQRV++AR LAN+PEVLLLDEPTSALD  S Q+IE +LV L +E+  T   V+H + Q 
Sbjct  143  EAQRVSIARALANQPEVLLLDEPTSALDDASKQDIERLLVSLVRERNTTCVWVTHDVAQA  202

Query  823  QRIADVVCLLVEGEIVEVLKPDQLSQA  903
            +R+AD+V  L  G+   +  P +L  A
Sbjct  203  RRVADLVLKLEGGQAAGLGMPQELLHA  229



>gb|AHF06856.1| phosphate ABC transporter ATP-binding protein [Desulfitobacterium 
metallireducens DSM 15288]
Length=243

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 133/201 (66%), Gaps = 2/201 (1%)
 Frame = +1

Query  271  KGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVL  450
            + LTLL  ++L I  G +  ++GPSGSGKST L  LNRL E +   ++LD  +   +DVL
Sbjct  17   RDLTLLEHVSLKIREGRVHALLGPSGSGKSTLLYTLNRLREISEGKIYLDETETRLIDVL  76

Query  451  SLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGE  630
             LR +VG++ Q    F GTV+DNI YG  ++GK+L D      L   ++D  F N+    
Sbjct  77   ELRRRVGLVMQKAIFFPGTVSDNILYGAHIQGKELPDPGHYLELVGLNID--FANRDPNT  134

Query  631  LSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHS  810
            LS GQ QRV++AR LAN+PEVLLLDEPTSALD  +++++E+V+ +L +E ++T+  V+H 
Sbjct  135  LSGGQQQRVSIARALANDPEVLLLDEPTSALDAQASEHLEEVVTQLCQECQLTVVWVTHD  194

Query  811  IKQIQRIADVVCLLVEGEIVE  873
            ++Q QR+A  V LL  G ++E
Sbjct  195  LQQAQRVAQDVTLLYRGHMLE  215



>ref|WP_036372428.1| hypothetical protein [Moorella thermoacetica]
Length=224

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 137/207 (66%), Gaps = 0/207 (0%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRC  462
            +LN+IT    +  I  ++GPSGSGKS+ LR LNRL +PA   + LDG+D+  L++ +LR 
Sbjct  2    ILNKITTFFLKEKITAVLGPSGSGKSSLLRLLNRLEDPAAGRITLDGQDLQSLNIFTLRR  61

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVG  642
            +VGM+ QLP LF GTV +NI YGP LRG  LS D+   L+ +  L +   ++    LS+G
Sbjct  62   RVGMVRQLPTLFPGTVLENISYGPRLRGIPLSRDRAGELILMVGLGTELLDRRADSLSIG  121

Query  643  QAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQI  822
            Q QRV+LARTLANEPEVLLLDEPTSALDP +  NI  ++V LK    +TI +V+H + Q 
Sbjct  122  QQQRVSLARTLANEPEVLLLDEPTSALDPTAAANILHLMVDLKSRLGLTIILVTHILDQA  181

Query  823  QRIADVVCLLVEGEIVEVLKPDQLSQA  903
            ++IAD V  +  GEIVE     Q   A
Sbjct  182  RQIADEVLFMHRGEIVETAPAQQFFTA  208



>ref|WP_015053405.1| phosphate ABC transporter ATP-binding protein [Methanolobus psychrophilus]
 ref|YP_006923057.1| phosphate ABC transporter ATP-binding protein [Methanolobus psychrophilus 
R15]
 gb|AFV23689.1| phosphate ABC transporter ATP-binding protein [Methanolobus psychrophilus 
R15]
Length=266

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 148/244 (61%), Gaps = 15/244 (6%)
 Frame = +1

Query  214  DDEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE  393
            DD A GT+I+V+GL         L + I++DIP+  +   IGPSG GKSTFLR LNR+ +
Sbjct  13   DDFANGTEIEVRGLNLWYGTNHAL-HDISIDIPKNSVTAFIGPSGCGKSTFLRCLNRMND  71

Query  394  --PA---NATVFLDGKDIC--DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKK  552
              P+      V ++G+DI   ++DV+ LR KVGM+FQ P  F  ++ DN+ YGP + G  
Sbjct  72   LIPSCRIEGNVNINGEDIYSRNVDVVDLRKKVGMVFQKPNPFPMSIHDNVAYGPRIHGAP  131

Query  553  LSDdqvlrllslad-----ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTS  717
              D   +   +L         S   N    +LS GQ QR+ +ARTLA +PEV+L DEP S
Sbjct  132  KKDINGIVEYALKSGALWGEVSERLNTSALDLSGGQQQRLCIARTLAVKPEVILFDEPCS  191

Query  718  ALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLS  897
            ALDPIST  IED+++ LKK+   TI +V+H+++Q  RI+D     + G+I+E  + +Q+ 
Sbjct  192  ALDPISTSKIEDLILELKKQ--YTIVIVTHNMQQAARISDYTAFFLLGDIIEFGRTEQIF  249

Query  898  QAKH  909
            ++ H
Sbjct  250  ESPH  253



>ref|WP_023173976.1| ABC transporter [Gloeobacter kilaueensis]
 ref|YP_008712495.1| ABC transporter [Gloeobacter kilaueensis JS1]
 gb|AGY58788.1| ABC transporter [Gloeobacter kilaueensis JS1]
Length=245

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 138/210 (66%), Gaps = 6/210 (3%)
 Frame = +1

Query  259  RVSDKGLTLLNQI-----TLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDG  423
            R+ +  LTL +QI     +L +  G I  +IG +GSGKS+ LR LNRL+E A  +VFL  
Sbjct  18   RLQNLSLTLQSQIVLANVSLTLAAGTIGCLIGANGSGKSSLLRCLNRLYETAPGSVFLGE  77

Query  424  KDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladlds  603
            +DI  L VLSLR +V ++ Q PALF GTV +N+ YGP L G+  S      LL    L+ 
Sbjct  78   QDITALPVLSLRRRVSLVAQQPALFAGTVHENLAYGPRLHGEPFSVTDAKELLLQVQLEP  137

Query  604  sFC-NKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEK  780
            +F  ++    LS G+AQRV LAR+LAN P VLLLDEPT+ALDP+ST+++EDVL++L +E+
Sbjct  138  AFYLDRDVQSLSGGEAQRVNLARSLANRPWVLLLDEPTAALDPLSTRHVEDVLLQLNREE  197

Query  781  RMTIAMVSHSIKQIQRIADVVCLLVEGEIV  870
            R+T+  VSH   Q+ R+A  +  L  G +V
Sbjct  198  RITVLWVSHDPAQVLRVAHALFQLERGRLV  227



>ref|WP_011523623.1| choline transporter [Candidatus Koribacter versatilis]
 ref|YP_591896.1| ABC transporter ATPase [Candidatus Koribacter versatilis Ellin345]
 gb|ABF41822.1| ABC transporter, ATPase subunit [Candidatus Koribacter versatilis 
Ellin345]
Length=237

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 132/203 (65%), Gaps = 3/203 (1%)
 Frame = +1

Query  262  VSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDL  441
            V DK   +++ ++L + +G ++ ++GPSGSGKS+FLR LNRL EP +  V+L+GKD  +L
Sbjct  24   VGDK--VIVDAVSLTVAQGEVLCVLGPSGSGKSSFLRLLNRLAEPTSGMVYLEGKDYREL  81

Query  442  DVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKP  621
                LR +VGM+ Q   LF G VA+N+R+GP  RG++++D   +         S + ++ 
Sbjct  82   APRELRRRVGMITQQAFLFPGRVAENVRFGPRQRGQEITD-DAVEECLRGVGLSGYGSRQ  140

Query  622  GGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMV  801
            G  LS G+AQRV++AR LANEP VLL DEPTSALD  S   IE +L  + K +++T  MV
Sbjct  141  GSTLSGGEAQRVSIARALANEPVVLLADEPTSALDDFSKSGIEALLREIVKARQLTCVMV  200

Query  802  SHSIKQIQRIADVVCLLVEGEIV  870
            +H + Q +R+AD V L   G +V
Sbjct  201  THDVAQARRMADRVALFRGGRVV  223



>ref|WP_011392686.1| ABC transporter [Moorella thermoacetica]
 ref|YP_430029.1| ABC transporter [Moorella thermoacetica ATCC 39073]
 gb|ABC19486.1| phosphate ABC transporter ATP-binding protein, PhoT family [Moorella 
thermoacetica ATCC 39073]
Length=251

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 137/207 (66%), Gaps = 0/207 (0%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRC  462
            +LN+IT    +  I  ++GPSGSGKS+ LR LNRL +PA   + LDG+D+  L++ +LR 
Sbjct  29   ILNKITTFFLKEKITAVLGPSGSGKSSLLRLLNRLEDPAAGRITLDGQDLQSLNIFTLRR  88

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVG  642
            +VGM+ QLP LF GTV +NI YGP LRG  LS D+   L+ +  L +   ++    LS+G
Sbjct  89   RVGMVRQLPTLFPGTVLENISYGPRLRGIPLSRDRAGELILMVGLGTELLDRRADSLSIG  148

Query  643  QAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQI  822
            Q QRV+LARTLANEPEVLLLDEPTSALDP +  NI  ++V LK    +TI +V+H + Q 
Sbjct  149  QQQRVSLARTLANEPEVLLLDEPTSALDPTAAANILHLMVDLKSRLGLTIILVTHILDQA  208

Query  823  QRIADVVCLLVEGEIVEVLKPDQLSQA  903
            ++IAD V  +  GEIVE     Q   A
Sbjct  209  RQIADEVLFMHRGEIVETAPAQQFFTA  235



>dbj|GAF26941.1| ABC-type phosphate transport system, ATPase component [Moorella 
thermoacetica Y72]
Length=259

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 137/207 (66%), Gaps = 0/207 (0%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRC  462
            +LN+IT    +  I  ++GPSGSGKS+ LR LNRL +PA   + LDG+D+  L++ +LR 
Sbjct  37   ILNKITTFFLKEKITAVLGPSGSGKSSLLRLLNRLEDPAAGRITLDGQDLQSLNIFTLRR  96

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVG  642
            +VGM+ QLP LF GTV +NI YGP LRG  LS D+   L+ +  L +   ++    LS+G
Sbjct  97   RVGMVRQLPTLFPGTVLENISYGPRLRGIPLSRDRAGELILMVGLGTELLDRRADSLSIG  156

Query  643  QAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQI  822
            Q QRV+LARTLANEPEVLLLDEPTSALDP +  NI  ++V LK    +TI +V+H + Q 
Sbjct  157  QQQRVSLARTLANEPEVLLLDEPTSALDPTAAANILHLMVDLKSRLGLTIILVTHILDQA  216

Query  823  QRIADVVCLLVEGEIVEVLKPDQLSQA  903
            ++IAD V  +  GEIVE     Q   A
Sbjct  217  RQIADEVLFMHRGEIVETAPAQQFFTA  243



>gb|EMS52544.1| Protein STAR1 [Triticum urartu]
Length=153

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  502  GTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLAN  681
            GTVADN+RYGP LRG+ L+D QV  LL L+DLD +  ++P  ELSVGQAQRVALARTLAN
Sbjct  8    GTVADNVRYGPRLRGETLTDAQVEELLGLSDLDPALASRPASELSVGQAQRVALARTLAN  67

Query  682  EPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEG  861
            +PEVLLLDEPTSALDPISTQNIE+ +VRLKK + +T  +VSHS++QIQRIAD+VCL+V+G
Sbjct  68   DPEVLLLDEPTSALDPISTQNIEEAIVRLKKARGITTVIVSHSVRQIQRIADLVCLVVDG  127

Query  862  EIVEVLKPDQLSQAKHPMAQ  921
             +VEVL P  LSQAKH MA+
Sbjct  128  VVVEVLPPSDLSQAKHLMAR  147



>ref|WP_017728303.1| hypothetical protein [Bacillus sp. L1(2012)]
Length=238

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 133/200 (67%), Gaps = 1/200 (1%)
 Frame = +1

Query  295  ITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCKVGM  474
            ++  I +G  + +IGPSG+GKS+ L  +NRL +P N  +F   K + D  ++ +R ++GM
Sbjct  18   LSFSIIKGQYVTLIGPSGAGKSSLLLLINRLEDPTNGHIFYQNKPLKDYPIIDIRKRIGM  77

Query  475  LFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQAQR  654
            +FQ  +LF+GTVA+NIRYGP L  ++ ++ +   LL    L  SF NKP  ELS G+ QR
Sbjct  78   VFQSTSLFDGTVAENIRYGPKLHNREWNETKSKELLDAVQLPQSFLNKPIEELSGGEQQR  137

Query  655  VALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIA  834
            V+LARTLANEPE+LLLDE TSALD  + + IE +L  L+++ R TI MV+H ++Q +R+ 
Sbjct  138  VSLARTLANEPEMLLLDEVTSALDLRNVELIEQLLKGLQQKGR-TIIMVTHDVEQAKRLG  196

Query  835  DVVCLLVEGEIVEVLKPDQL  894
                 L EG IVE  + ++L
Sbjct  197  SYSLFLHEGRIVEKGETNEL  216



>ref|WP_022361154.1| putative uncharacterized protein [Bacteroides pectinophilus CAG:437]
 emb|CDD55931.1| putative uncharacterized protein [Bacteroides pectinophilus CAG:437]
Length=251

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 136/234 (58%), Gaps = 15/234 (6%)
 Frame = +1

Query  229  GTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----  393
             +K +VK L  +       L  I +DI +  I   IGPSG GKSTFL+ LNR+ +     
Sbjct  3    NSKFEVKNLN-LHYGAFHALKNINMDIAKNEITAFIGPSGCGKSTFLKTLNRMNDLVEGV  61

Query  394  PANATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqv  570
              +  ++LDG DI  D+D +SLR +VGM+FQ P  F  +V DNI YGP L G +   +  
Sbjct  62   KIDGNIYLDGVDIYNDMDAISLRHRVGMVFQQPNPFPKSVYDNIAYGPRLFGVRKKAELD  121

Query  571  lrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPI  732
              +       + +        K    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPI
Sbjct  122  EIVERSLRQAAIWDELKDRLKKSALGLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPI  181

Query  733  STQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            ST  IED++V LK  K+ TI MV+H+++Q  R++D     + GE++E    ++L
Sbjct  182  STSKIEDLVVELK--KKYTIVMVTHNMQQATRVSDKTVFFLLGEVIEAAPTEEL  233



>ref|WP_035971965.1| choline transporter [Bradyrhizobium sp. WSM3983]
Length=234

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/217 (43%), Positives = 136/217 (63%), Gaps = 2/217 (1%)
 Frame = +1

Query  226  AGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA  405
            A   ++ + L+R + + + L++ +++ +  G I+ I+GPSG+GKS+FLR LNRL EP + 
Sbjct  10   AAAALETRHLSRRAGERV-LVSDVSMQVSAGEILAIVGPSGAGKSSFLRLLNRLDEPTSG  68

Query  406  TVFLDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrlls  585
            TV L+ +D   +    LR ++GM  Q   LF GTVA NI +GP  RG+ LS    +  L 
Sbjct  69   TVLLNSRDFRSIAPRELRRRIGMSMQTAYLFPGTVAANIAFGPRQRGEILS-CAQVDSLL  127

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
                   F  +    LS G+AQRVALARTLANEPEVLLLDEPTSALD  S + IED+++ 
Sbjct  128  ERVGLPGFAARDVSNLSGGEAQRVALARTLANEPEVLLLDEPTSALDETSVRGIEDLILT  187

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEV  876
            + +E++MT  +V+H+  Q  R+AD   ++  G  V +
Sbjct  188  IVRERQMTCVIVTHNRAQAIRLADKTMVMEAGRSVTI  224



>emb|CBH38054.1| putative phosphate ABC-transporter, ATP-binding protein [uncultured 
archaeon]
 emb|CBH38455.1| putative phosphate import ATP-binding protein pstB [uncultured 
archaeon]
Length=250

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/235 (43%), Positives = 142/235 (60%), Gaps = 14/235 (6%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKG-LTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPAN--  402
            +KI+ +GL    +KG +  L ++ L+I    I  +IGPSG GK+TFLRALNR+ E  +  
Sbjct  2    SKIEARGLNVYYEKGTVHALKEVNLEIETNKITALIGPSGCGKTTFLRALNRMNEVNDVM  61

Query  403  --ATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG---KKLSD  561
                VF+DGKDI +  +DV+ LR KVGM+FQ P  F  ++ DN+ YGP + G   KKL  
Sbjct  62   TKGKVFIDGKDIYNGSVDVIQLRKKVGMVFQQPNPFPMSIYDNVAYGPRIHGTRNKKLDM  121

Query  562  dqvlrllsladldssF--CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
                 L   A  D       K   + S GQ QR+ +ARTLA +PE++L DEP SALDPIS
Sbjct  122  IVEESLKKAALWDEVHDRLEKNALKFSGGQQQRLCIARTLAVDPEIILFDEPCSALDPIS  181

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQ  900
            T  +ED+L  LKK+   TI +V+H+++Q  R++D     + GE++E  K  Q+ +
Sbjct  182  TSRVEDLLRELKKD--YTIVIVTHNMQQAARVSDFTAFFLLGELIECGKTTQIFE  234



>ref|WP_021866547.1| phosphate ABC transporter ATP-binding protein PhoT family (TC 
3.A.1.7.1) [Eubacterium sp. CAG:86]
 emb|CCX81933.1| phosphate ABC transporter ATP-binding protein PhoT family (TC 
3.A.1.7.1) [Eubacterium sp. CAG:86]
Length=258

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 129/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDI-CDLDV  447
            L  I ++I +  I   IGPSG GKSTFL+ LNR+ +       +  V+LDGKDI  D+D 
Sbjct  28   LKNINMNIEKNQITAFIGPSGCGKSTFLKTLNRMNDLVDGVKIDGNVYLDGKDIFADMDA  87

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            ++LR +VGM+FQ P  F  ++ DNI YGP L G K   +  + +       + +      
Sbjct  88   INLRHRVGMVFQQPNPFPKSIYDNIAYGPRLFGVKKKSELDIIVEKSLKQAAIWDEVKDR  147

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST  IED+ V LK     T
Sbjct  148  LKKSALGLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPISTSRIEDLAVELK--NNYT  205

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            I MV+H+++Q  RI+D     + GE++E  K +QL
Sbjct  206  IIMVTHNMQQAARISDNTAFFLLGEMIEYGKTEQL  240



>ref|WP_013150464.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Thermoanaerobacter]
 ref|YP_003677179.1| phosphate ABC transporter ATPase [Thermoanaerobacter mathranii 
subsp. mathranii str. A3]
 gb|ADH61168.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacter 
mathranii subsp. mathranii str. A3]
Length=249

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 138/225 (61%), Gaps = 15/225 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            KIQVK L       +  L +I LD+ R  ++ +IGPSG GKSTF+R LNR+ +       
Sbjct  3    KIQVKDLDLFYGD-VQALKKINLDVERNSVLALIGPSGCGKSTFIRTLNRMNDLIEGVKI  61

Query  400  NATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG----KKLSDd  564
            N TV LDG+D+  ++DV+ LR +VGM+FQ P  F  TV DN+ YGP + G    KKL++ 
Sbjct  62   NGTVLLDGQDVYKEVDVIELRKRVGMVFQKPNPFPMTVYDNVAYGPRIHGIKDKKKLNEI  121

Query  565  qvlrllslad--ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST  738
                L + A          K    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST
Sbjct  122  VEKSLKAAALWDEVKDRLYKSALSLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPIST  181

Query  739  QNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
              IE+++  LK   + TI +V+H+++Q  R++D     + GE+VE
Sbjct  182  MKIEELINELK--NKYTIIIVTHNMQQAGRVSDYTAFFLNGELVE  224



>ref|WP_012995457.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacter 
italicus]
 ref|YP_003477283.1| phosphate ABC transporter ATPase [Thermoanaerobacter italicus 
Ab9]
 gb|ADD02721.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacter 
italicus Ab9]
Length=249

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 138/225 (61%), Gaps = 15/225 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            KIQVK L       +  L +I LD+ R  ++ +IGPSG GKSTF+R LNR+ +       
Sbjct  3    KIQVKDLDLFYGD-VQALKKINLDVERNSVLALIGPSGCGKSTFIRTLNRMNDLIEGVKI  61

Query  400  NATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG----KKLSDd  564
            N TV LDG+D+  ++DV+ LR +VGM+FQ P  F  TV DN+ YGP + G    KKL++ 
Sbjct  62   NGTVLLDGQDVYKEVDVIELRKRVGMVFQKPNPFPMTVYDNVAYGPRIHGIKDKKKLNEI  121

Query  565  qvlrllslad--ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST  738
                L + A          K    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST
Sbjct  122  VEKSLKAAALWDEVKDRLYKSALSLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPIST  181

Query  739  QNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
              IE+++  LK   + TI +V+H+++Q  R++D     + GE++E
Sbjct  182  MKIEELINELK--NKYTIIIVTHNMQQAGRVSDYTAFFLNGELIE  224



>ref|WP_006570261.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacter 
siderophilus]
 gb|EIW00896.1| LOW QUALITY PROTEIN: phosphate ABC transporter, ATP-binding protein 
[Thermoanaerobacter siderophilus SR4]
Length=248

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 134/214 (63%), Gaps = 13/214 (6%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC-DLDV  447
            L +I LD+    ++ +IGPSG GKSTF+R LNR+ +       N TV LDG+D+  ++DV
Sbjct  19   LKKINLDVEANSVLALIGPSGCGKSTFIRTLNRMNDLIEGVKINGTVLLDGQDLYKEVDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG---KKLSDdqvlrllslad--ldssFC  612
            + LR KVGM+FQ P  F  TV DN+ YGP + G   KKL++     L + A         
Sbjct  79   IELRKKVGMVFQKPNPFPMTVYDNVAYGPRIHGIKDKKLNEIVEKSLKAAALWDEVKDRL  138

Query  613  NKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTI  792
            +K    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST  IE+++  LK   + TI
Sbjct  139  HKSALSLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPISTMKIEELIEELK--NKYTI  196

Query  793  AMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
             +V+H+++Q  R++D     + GE++E    DQ+
Sbjct  197  IIVTHNMQQAGRVSDYTAFFLNGELIESGPTDQV  230



>ref|WP_003871115.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Thermoanaerobacter]
 ref|YP_004820273.1| phosphate ABC transporter ATPase [Thermoanaerobacter wiegelii 
Rt8.B1]
 gb|EGD50835.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacter 
ethanolicus JW 200]
 gb|AEM78989.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacter 
wiegelii Rt8.B1]
 gb|EMT38822.1| phosphate ABC transporter, ATP-binding protein [Thermoanaerobacter 
thermohydrosulfuricus WC1]
Length=249

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 134/215 (62%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC-DLDV  447
            L +I LD+    ++ +IGPSG GKSTF+R LNR+ +       N TV LDG+D+  ++DV
Sbjct  19   LKKINLDVEANSVLALIGPSGCGKSTFIRTLNRMNDLIEGVKINGTVLLDGQDLYKEVDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG----KKLSDdqvlrllslad--ldssF  609
            + LR KVGM+FQ P  F  TV DN+ YGP + G    KKL++     L + A        
Sbjct  79   IELRKKVGMVFQKPNPFPMTVYDNVAYGPRIHGIKDKKKLNEIVEKSLKAAALWDEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             +K    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST  IE+++  LK   + T
Sbjct  139  LHKSALSLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPISTMKIEELIEELK--NKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            I +V+H+++Q  R++D     + GE++E    DQ+
Sbjct  197  IIIVTHNMQQAGRVSDYTAFFLNGELIESGPTDQV  231



>ref|WP_022626906.1| phosphate ABC transporter ATP-binding protein [Bacillus marmarensis]
 gb|ERN54835.1| phosphate ABC transporter ATP-binding protein [Bacillus marmarensis 
DSM 21297]
Length=236

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 129/197 (65%), Gaps = 1/197 (1%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCK  465
            LN+I+  +    I+ +IGPSG+GKS+ L  +NRL +  + ++    K+I    ++ LR +
Sbjct  14   LNKISFTVLENQIVTLIGPSGAGKSSHLYLMNRLDDKRSGSITFKEKEIESYPIVELRQQ  73

Query  466  VGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQ  645
            +GM+FQ PALF+GTV++N+ YGP L  +  SD++ + LL    L   F +KP  ELS G+
Sbjct  74   IGMVFQSPALFDGTVSENVSYGPNLHNRDWSDEKTIELLESVHLSPEFLHKPIDELSGGE  133

Query  646  AQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQ  825
             QRVA  RTLANEPE+LLLDE TSALD  + + IED +  L+K  + TI MV+H ++Q +
Sbjct  134  QQRVAFLRTLANEPEILLLDEVTSALDLRNVELIEDFIRTLQKRGK-TIFMVTHDVEQAE  192

Query  826  RIADVVCLLVEGEIVEV  876
            R+ D    L +GE++E 
Sbjct  193  RLGDQTFYLEKGELIET  209



>ref|WP_012958223.1| phosphate ABC transporter ATP-binding protein [Bacillus pseudofirmus]
 ref|YP_003427753.1| phosphate ABC transporter ATP-binding protein [Bacillus pseudofirmus 
OF4]
 gb|ADC50861.1| phosphate ABC transporter ATP-binding protein [Bacillus pseudofirmus 
OF4]
Length=236

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 130/197 (66%), Gaps = 1/197 (1%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCK  465
            LN+I+  +    I+ +IGPSG+GKS+ L  +NRL +  + ++    K+I    ++ LR +
Sbjct  14   LNKISFTVLENQIVTLIGPSGAGKSSLLYLMNRLDDKRSGSITFKEKEIESYPIVELRQQ  73

Query  466  VGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQ  645
            +GM+FQ PALF+GTV++N+ YGP L  +  SD++ ++LL    L   F +KP  ELS G+
Sbjct  74   IGMVFQSPALFDGTVSENVSYGPNLHNRDWSDEKTIKLLESVHLSPEFLHKPIDELSGGE  133

Query  646  AQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQ  825
             QRVA  RTLANEPE+LLLDE TSALD  + + IED +  L+K  + TI MV+H ++Q +
Sbjct  134  QQRVAFLRTLANEPEILLLDEVTSALDLRNVELIEDFIRTLQKRGK-TIFMVTHDVEQAE  192

Query  826  RIADVVCLLVEGEIVEV  876
            R+ D    L +GE++E 
Sbjct  193  RLGDQTFYLEKGELIET  209



>ref|WP_007706630.1| phosphate ABC transporter ATP-binding protein [[Clostridium] 
asparagiforme]
 gb|EEG57136.1| phosphate ABC transporter, ATP-binding protein [ [[Clostridium 
asparagiforme] DSM 15981]
Length=266

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 138/243 (57%), Gaps = 22/243 (9%)
 Frame = +1

Query  226  AGTKIQVKGLTRVSDKGLTL-------LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNR  384
            AG +  V+  T++S + L L       L  I+LD+    I   IGPSG GKSTFL+ LNR
Sbjct  8    AGEENNVEAKTKISARSLNLYYGENHALKDISLDLYEHKITAFIGPSGCGKSTFLKTLNR  67

Query  385  LWE-----PANATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLR  543
            + +       + TV LD +DI D  +D   LR K+GM+FQ P  F  ++ DN+ YGP + 
Sbjct  68   MNDLVAGVKIDGTVLLDEEDIYDPQVDTTLLRKKIGMVFQQPNPFPMSIYDNVAYGPRIH  127

Query  544  GKKLSDdqvlrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLD  705
            G K        + S     + +        KP   LS GQ QR+ +AR LA EPEVLL+D
Sbjct  128  GIKNKARLDEIVESSLRGAALWDEVSDRLRKPALGLSGGQQQRLCIARALAVEPEVLLMD  187

Query  706  EPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKP  885
            EPTSALDPIST  IED++  LK   R T+A+V+H+++Q  RIAD     + GE+VE    
Sbjct  188  EPTSALDPISTLKIEDLMDDLK--SRYTVAIVTHNMQQAARIADYTAFFLVGEVVEYAAT  245

Query  886  DQL  894
            D+L
Sbjct  246  DEL  248



>ref|WP_015590431.1| phosphate ABC transporter ATP-binding protein, PhoT family [Archaeoglobus 
sulfaticallidus]
 ref|YP_007906826.1| phosphate ABC transporter ATP-binding protein, PhoT family [Archaeoglobus 
sulfaticallidus PM70-1]
 gb|AGK60833.1| phosphate ABC transporter ATP-binding protein, PhoT family [Archaeoglobus 
sulfaticallidus PM70-1]
Length=226

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 135/213 (63%), Gaps = 1/213 (0%)
 Frame = +1

Query  256  TRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDIC  435
             R S +G  +L  + L + R  +M I GPSGSGKST LR +NRL E     + +DG  I 
Sbjct  7    VRKSIRGKEILKGVNLKVKRREVMVIAGPSGSGKSTLLRCINRLTEIDGGDILVDGISIK  66

Query  436  DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCN  615
              + + LR  VGM+FQ P +FEG V DNI YG  L GK  ++  V +L     +++   +
Sbjct  67   KYNPIQLRRNVGMVFQFPVMFEGRVKDNIAYGLRLLGKTATEKSVEKLAREVGIEN-LLD  125

Query  616  KPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIA  795
                +LS G+ QRVA+ARTLA EP+VLLLDEPT++LDP + + IE+++++L + + +T+ 
Sbjct  126  ADASKLSGGEQQRVAIARTLALEPKVLLLDEPTASLDPENVRKIENLVLKLVRSRDLTVL  185

Query  796  MVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
             V+H ++Q +RI D V ++ +G IV V  P+++
Sbjct  186  WVTHDVEQAKRIGDRVAVMKDGRIVTVEDPEKI  218



>gb|KGP72958.1| phosphate ABC transporter ATP-binding protein [Pontibacillus 
yanchengensis Y32]
Length=231

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 121/197 (61%), Gaps = 1/197 (1%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRC  462
            +L  I + I +G  + I GPSGSGKST L   NRL +P    +      I    +  LR 
Sbjct  15   ILQNINVTIEKGEKVIIFGPSGSGKSTLLHLFNRLQDPDEGKIHFKDNPIQSYHIPDLRN  74

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVG  642
            + G++ Q P LF GTV DNI+YGP LRG    +     LL+   L + + ++    LS G
Sbjct  75   QAGLVMQAPHLFPGTVLDNIKYGPSLRGD-WREQDGEELLAYVQLPTEYLSRDVNHLSGG  133

Query  643  QAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQI  822
            + QRV+LARTLAN+PEVLLLDEPTSALD  + + IEDVL  L  E ++T+ MV+H++KQ 
Sbjct  134  EQQRVSLARTLANKPEVLLLDEPTSALDQHTIEEIEDVLEELIHEHQLTMIMVTHNLKQA  193

Query  823  QRIADVVCLLVEGEIVE  873
            +R+ D    L EGEI+E
Sbjct  194  KRLGDKGIFLSEGEILE  210



>ref|WP_030035740.1| phosphate ABC transporter ATP-binding protein [Clostridium botulinum]
 dbj|GAE02971.1| phosphate transporter ATP-binding protein [Clostridium botulinum 
B str. Osaka05]
Length=249

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 131/215 (61%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-----TVFLDGKDIC-DLDV  447
            L  I +DI +  +  +IGPSG GKSTFLR LNR+ +  ++     +V+ +GKDI  D DV
Sbjct  19   LKNINIDIEKNKVTALIGPSGCGKSTFLRTLNRMNDLIDSVKIEGSVYYEGKDIYKDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR K+GM+FQ P  F  ++ DNI YGP + G K  +     +       + +      
Sbjct  79   IDLRKKIGMVFQNPNPFPMSIYDNIAYGPRIHGIKTKEKLNEIVEKSLKGAALWEEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +ARTLA EPE+LL+DEPTSALDPIST  IE+++  LK   + T
Sbjct  139  LKKNALGLSGGQQQRLCIARTLAVEPEILLMDEPTSALDPISTLKIEELMDELK--NKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            + +V+H+++Q  RI+D     + GEI+EV K ++L
Sbjct  197  VIIVTHNMQQAGRISDNTAFFLNGEIIEVGKTEEL  231



>ref|WP_036818791.1| phosphate ABC transporter ATP-binding protein [Pontibacillus 
yanchengensis]
Length=227

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 121/197 (61%), Gaps = 1/197 (1%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRC  462
            +L  I + I +G  + I GPSGSGKST L   NRL +P    +      I    +  LR 
Sbjct  11   ILQNINVTIEKGEKVIIFGPSGSGKSTLLHLFNRLQDPDEGKIHFKDNPIQSYHIPDLRN  70

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVG  642
            + G++ Q P LF GTV DNI+YGP LRG    +     LL+   L + + ++    LS G
Sbjct  71   QAGLVMQAPHLFPGTVLDNIKYGPSLRGD-WREQDGEELLAYVQLPTEYLSRDVNHLSGG  129

Query  643  QAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQI  822
            + QRV+LARTLAN+PEVLLLDEPTSALD  + + IEDVL  L  E ++T+ MV+H++KQ 
Sbjct  130  EQQRVSLARTLANKPEVLLLDEPTSALDQHTIEEIEDVLEELIHEHQLTMIMVTHNLKQA  189

Query  823  QRIADVVCLLVEGEIVE  873
            +R+ D    L EGEI+E
Sbjct  190  KRLGDKGIFLSEGEILE  206



>ref|WP_009052536.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Thermoanaerobacter]
 ref|YP_001663600.1| phosphate transporter ATP-binding protein [Thermoanaerobacter 
sp. X514]
 ref|YP_003903861.1| phosphate ABC transporter ATPase subunit [Thermoanaerobacter 
sp. X513]
 gb|ABY93264.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacter 
sp. X514]
 gb|EFK84737.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacter 
sp. X561]
 gb|ADN54570.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacter 
sp. X513]
Length=249

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 140/225 (62%), Gaps = 15/225 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            KIQVK L       +  L +ITLD+    ++ +IGPSG GKSTF+R LNR+ +       
Sbjct  3    KIQVKDLDLFYGD-VQALKKITLDVEANSVLALIGPSGCGKSTFIRTLNRMNDLIEGVKI  61

Query  400  NATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG----KKLSDd  564
            + TV LDG+D+  ++DV+ LR +VGM+FQ P  F  TV DN+ YGP + G    KKL++ 
Sbjct  62   SGTVLLDGQDVYKEVDVIELRKRVGMVFQKPNPFPMTVYDNVAYGPRIHGIKDKKKLNEI  121

Query  565  qvlrllsla--dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST  738
                L + A  D      +K    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST
Sbjct  122  VEKSLKAAALWDEVKDRLDKSALSLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPIST  181

Query  739  QNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
              IE+++  LK   + TI +V+H+++Q  R++D     + GE++E
Sbjct  182  MKIEELINELK--NKYTIIIVTHNMQQAGRVSDYTAFFLNGELIE  224



>ref|WP_003484679.1| phosphate ABC transporter ATP-binding protein [Clostridium sporogenes]
 gb|EDU36308.1| phosphate ABC transporter, ATP-binding protein [Clostridium sporogenes 
ATCC 15579]
Length=249

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 131/215 (61%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-----TVFLDGKDIC-DLDV  447
            L  I +DI +  +  +IGPSG GKSTFLR LNR+ +  ++     +V+ +GKDI  D DV
Sbjct  19   LKNINIDIEKNKVTALIGPSGCGKSTFLRTLNRMNDLIDSVKIEGSVYYEGKDIYKDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR K+GM+FQ P  F  ++ DNI YGP + G K  +     +       + +      
Sbjct  79   IDLRKKIGMVFQNPNPFPMSIYDNIAYGPRIHGIKTKEKLDQIVEKSLKGAALWEEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +ARTLA EPE+LL+DEPTSALDPIST  IE+++  LK   + T
Sbjct  139  LKKNALGLSGGQQQRLCIARTLAVEPEILLMDEPTSALDPISTLKIEELMDELK--NKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            + +V+H+++Q  RI+D     + GEI+EV K ++L
Sbjct  197  VIIVTHNMQQAGRISDNTAFFLNGEIIEVGKTEEL  231



>ref|WP_014643751.1| ABC transporter ATP-binding protein [Halobacillus halophilus]
 ref|YP_006181136.1| ABC-type transport system ATP-binding protein [Halobacillus halophilus 
DSM 2266]
 emb|CCG45862.1| ABC-type transport system ATP-binding protein [Halobacillus halophilus 
DSM 2266]
Length=228

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 126/209 (60%), Gaps = 2/209 (1%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCK  465
            L  +T  I +   + + GPSG+GKST L   NRL EP +  ++ +GK I D  V  LR  
Sbjct  12   LTNLTFTIEKKEKVILFGPSGAGKSTLLYLFNRLSEPDSGAIYFNGKSIKDYSVTELRRN  71

Query  466  VGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQ  645
            VG++ Q P LF GTV DN++YGP L G+         LL    L SS+ +K    LS G+
Sbjct  72   VGLVLQAPHLFPGTVLDNLKYGPSLFGE-WEQGNAETLLEYVQLPSSYLHKDVSHLSGGE  130

Query  646  AQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQ  825
             QRV+LARTLAN PEVLLLDEPTSALD  + + IE+VL  L KE  MT+ MV+H++ Q +
Sbjct  131  EQRVSLARTLANSPEVLLLDEPTSALDYQTAEEIEEVLEGLIKEHEMTMVMVTHNLNQAR  190

Query  826  RIADVVCLLVEGEIVE-VLKPDQLSQAKH  909
            R+ D    +++G + E    PD L   K+
Sbjct  191  RLGDRGLFIMDGNLQEDGTIPDMLDHPKN  219



>ref|WP_012342103.1| phosphate ABC transporter ATP-binding protein [Clostridium botulinum]
 ref|YP_001787839.1| phosphate transporter ATP-binding protein [Clostridium botulinum 
A3 str. Loch Maree]
 gb|ACA53931.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
A3 str. Loch Maree]
Length=249

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 130/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-----TVFLDGKDIC-DLDV  447
            L  I +DI +  +  +IGPSG GKSTFLR LNR+ +  ++     +V+ +GKDI  D DV
Sbjct  19   LKNINIDIEKNKVTALIGPSGCGKSTFLRTLNRMNDLIDSVKIKGSVYYEGKDIYKDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR K+GM+FQ P  F  ++ DNI YGP + G K  D     +       + +      
Sbjct  79   IDLRKKIGMVFQNPNPFPMSIYDNIAYGPRIHGIKTKDKLDEIVEKSLKGGALWEEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +ARTLA EPE+LL+DEPTSALDPIST  IE+++  LK   + T
Sbjct  139  LKKNALGLSGGQQQRLCIARTLAVEPEILLMDEPTSALDPISTLKIEELMDELK--NKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            + +V+H+++Q  RI+D     + GEI+EV K  +L
Sbjct  197  VIIVTHNMQQAGRISDNTAFFLNGEIIEVGKTGEL  231



>ref|WP_035982992.1| choline transporter [Bradyrhizobium sp. STM 3843]
Length=226

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 131/201 (65%), Gaps = 1/201 (0%)
 Frame = +1

Query  274  GLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLS  453
            G  L++ +++ I RG I+ ++GPSG+GKS+FLR LNRL EP + TV L   D   +    
Sbjct  17   GRRLVSDVSVQIGRGEIVAVVGPSGAGKSSFLRLLNRLDEPTSGTVLLQSIDYRTIAPQE  76

Query  454  LRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGEL  633
            LR +VGM+ Q   LF GTVA NI +GP  RG+ L  D ++ LL    L   F ++  G L
Sbjct  77   LRRRVGMVMQTAYLFPGTVAANIGFGPRQRGQVLPHDNIVALLERVGLAG-FADRDIGHL  135

Query  634  SVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSI  813
            S G+AQRVALARTLAN PEVLLLDEPTSALD    + IE++++ + +E++MT  +V+H+ 
Sbjct  136  SGGEAQRVALARTLANAPEVLLLDEPTSALDEALVRGIEELILGIVRERQMTCIIVTHNR  195

Query  814  KQIQRIADVVCLLVEGEIVEV  876
             Q +R+A    L+  G +V +
Sbjct  196  AQAERMAGRTMLMEAGRLVTI  216



>gb|KHO62793.1| phosphate ABC transporter ATP-binding protein, PhoT family [Thermoanaerobacter 
sp. YS13]
Length=249

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 98/225 (44%), Positives = 139/225 (62%), Gaps = 15/225 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            KIQVK L       +  L +I LD+    ++ +IGPSG GKSTF+R LNR+ +       
Sbjct  3    KIQVKDLDLFYGD-VQALKKINLDVEENSVLALIGPSGCGKSTFVRTLNRMNDLIEGVKI  61

Query  400  NATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG----KKLSDd  564
            + TV LDG+DI  ++DV+ LR +VGM+FQ P  F  TV DN+ YGP + G    KKL++ 
Sbjct  62   SGTVLLDGQDIYKEVDVIELRKRVGMVFQKPNPFPMTVYDNVAYGPRIHGIKDKKKLNEI  121

Query  565  qvlrllslad--ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST  738
                L++ A         +K    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST
Sbjct  122  VEKSLMAAALWDEVKDRLSKSALSLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPIST  181

Query  739  QNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
              IE+++  LK   + TI +V+H+++Q  R++D     + GE++E
Sbjct  182  MKIEELINELK--NKYTIIIVTHNMQQAGRVSDYTAFFLNGELIE  224



>ref|WP_027577887.1| choline transporter [Bradyrhizobium sp. Ai1a-2]
Length=224

 Score =   157 bits (398),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 139/223 (62%), Gaps = 8/223 (4%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            ++ + L+R   + L L+N +++ +  G I  ++GPSG+GKS+FLR LNRL EP   TV L
Sbjct  4    LETRHLSRSVGQRL-LVNDVSVQVSAGEIFAVVGPSGAGKSSFLRLLNRLDEPTAGTVLL  62

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladl  597
               D   +    LR +VGM+ Q   LF GT++ NI +GP  RG+ ++  Q+  LL    L
Sbjct  63   QNVDYRSIAPQELRRRVGMVMQTAFLFPGTISANIAFGPRQRGEVMAPTQIATLLERVGL  122

Query  598  dssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKE  777
               F ++  G LS G+AQRVALARTLAN PEVLLLDEPTSALD  S + +E++++ + +E
Sbjct  123  SG-FADRDIGNLSGGEAQRVALARTLANAPEVLLLDEPTSALDEASVRGVEELVLGIVRE  181

Query  778  KRMTIAMVSHSIKQIQRIADVVCLLVEGEIV------EVLKPD  888
            +RM   +V+H+ +Q  R+AD   ++  G +V      EVL  D
Sbjct  182  RRMACVIVTHNREQAVRLADRTMIMEAGRLVAIGPTREVLHAD  224



>ref|WP_028986193.1| hypothetical protein [Thermicanus aegyptius]
Length=247

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 127/200 (64%), Gaps = 0/200 (0%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRC  462
            +L  IT +I  G  + +IGPSG+GKST L  LNR+ +P    +   GK + + D+L LR 
Sbjct  21   ILKGITGEIQEGSFIALIGPSGAGKSTLLMLLNRMQDPDEGEIVYKGKPLPEWDILVLRR  80

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVG  642
            ++GM+FQ   + EGTVA+NIR G  LRG+++ D ++   L    LD     +    LS G
Sbjct  81   EIGMVFQKATMLEGTVAENIRLGFSLRGEEMDDSRIAACLEEVGLDGKMAERDARTLSGG  140

Query  643  QAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQI  822
            + QRVALAR+LA  P +LLLDE TSALDP S Q +E  L+RL +EK  TI M++H+I+Q 
Sbjct  141  EMQRVALARSLAVNPILLLLDEVTSALDPHSVQAVESTLLRLHREKGKTIVMITHNIEQA  200

Query  823  QRIADVVCLLVEGEIVEVLK  882
            +R++  V  L  GE++E  K
Sbjct  201  RRLSSEVWHLSGGELIETGK  220



>ref|WP_008116785.1| phosphate ABC transporter ATP-binding protein [[Bacteroides] 
pectinophilus]
 gb|EEC56285.1| phosphate ABC transporter, ATP-binding protein [[Bacteroides] 
pectinophilus ATCC 43243]
Length=226

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 127/210 (60%), Gaps = 14/210 (7%)
 Frame = +1

Query  301  LDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC-DLDVLSLRC  462
            +DI +  I   IGPSG GKSTFL+ LNR+ +       +  ++LDG DI  D+D +SLR 
Sbjct  1    MDIAKNEITAFIGPSGCGKSTFLKTLNRMNDLVEGVKIDGNIYLDGVDIYNDMDAISLRH  60

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------CNKPG  624
            +VGM+FQ P  F  +V DNI YGP L G +   +    +       + +        K  
Sbjct  61   RVGMVFQQPNPFPKSVYDNIAYGPRLFGVRKKAELDEIVERSLRQAAIWDELKDRLKKSA  120

Query  625  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVS  804
              LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST  IED++V LK  K+ TI MV+
Sbjct  121  LGLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPISTSKIEDLVVELK--KKYTIVMVT  178

Query  805  HSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            H+++Q  R++D     + GE++E    ++L
Sbjct  179  HNMQQATRVSDKTVFFLLGEVIEAAPTEEL  208



>gb|KCZ72960.1| ABC-type phosphate transport system, ATPase component [Candidatus 
Methanoperedens nitroreducens]
Length=225

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 126/195 (65%), Gaps = 1/195 (1%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRC  462
            +L  + L +  G ++ I+GPSGSGKST LR +NRL E  + T+ L+GKDI D D L LR 
Sbjct  28   ILYNLDLTVQHGELVTIMGPSGSGKSTLLRLINRLSETDSGTILLNGKDIRDYDPLELRR  87

Query  463  KVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVG  642
            +VGM+FQ+P +F G+V DN+ +G  L G  + D  +  L   A +  +  +     LSVG
Sbjct  88   RVGMVFQVPVVFRGSVRDNLAFGMRLWGNDI-DIDIETLARDAGIPENLLDADADPLSVG  146

Query  643  QAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQI  822
            + QRV +AR LAN+PEVLLLDEPTSALD  S   IE++L+ +++E+++T+  V+H + Q 
Sbjct  147  EKQRVCIARALANKPEVLLLDEPTSALDAESAHRIEELLLSMRRERKLTMLWVTHELAQA  206

Query  823  QRIADVVCLLVEGEI  867
             RI     +L EG +
Sbjct  207  GRIDGRRFMLREGRL  221



>ref|WP_036782122.1| phosphate ABC transporter ATP-binding protein [Pontibacillus 
chungwhensis]
Length=232

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 123/196 (63%), Gaps = 1/196 (1%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLSLRCK  465
            L+ +   I RG  + + GPSG+GKST L   NRL +P   +++  GKD+    +  LR +
Sbjct  17   LHSLNFSIKRGENVMLFGPSGAGKSTLLHLFNRLSDPEKGSIYYLGKDLQSYSITELRKQ  76

Query  466  VGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGELSVGQ  645
            VG++ Q P LF GTV DN++YGP L G   +D +   LL    L + + ++   +LS G+
Sbjct  77   VGLVMQAPNLFPGTVLDNLKYGPSLDGD-WNDARAEALLEDVQLPADYIDRSVDQLSGGE  135

Query  646  AQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQ  825
             QRV+LARTLAN+P VLLLDEPTSALD  +T+ IE VL  L  E+ +T+ MV+H + Q +
Sbjct  136  QQRVSLARTLANKPSVLLLDEPTSALDQHTTEEIEQVLEGLAVEQGVTLIMVTHHLDQAK  195

Query  826  RIADVVCLLVEGEIVE  873
            R+      L EGEIVE
Sbjct  196  RLGSRGIFLSEGEIVE  211



>ref|WP_033842551.1| glycine/betaine ABC transporter ATP-binding protein [Geobacillus 
subterraneus]
Length=375

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 139/223 (62%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  I L+I +G ++ +IGPSG GK+T +R +NRL EP + TV++
Sbjct  2    IRFENVTKQYEDGFVALKTINLEIHKGELVALIGPSGCGKTTTMRMINRLIEPTSGTVYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            DG+DI  LD + LR  +G + Q   LF   T+A+NI   P L+  + S  +      L  
Sbjct  62   DGQDISTLDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKSAYEKRVDELLDL  121

Query  595  ld---ssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP ++L+DEP SALDPIS + ++D +VR
Sbjct  122  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPNIILMDEPFSALDPISREQLQDDIVR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E R TI  V+H + +  +IAD + L+ +GE+V+   PDQ+
Sbjct  182  LQEEIRKTIVFVTHDMDEAIKIADRIALMKDGEVVQFATPDQM  224



>ref|WP_008512452.1| phosphate ABC transporter, ATP-binding protein [Methanobacterium 
sp. Maddingley MBC34]
 gb|EKQ55354.1| phosphate ABC transporter, ATP-binding protein [Methanobacterium 
sp. Maddingley MBC34]
Length=251

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 136/226 (60%), Gaps = 16/226 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            +I+V+ L    D+ L +L  ++L IP+  +  +IGPSG GKSTF+R LNR+ +       
Sbjct  4    RIEVENLNVYFDE-LHILKDVSLKIPKNTVTSLIGPSGCGKSTFIRTLNRMNDMISTFKM  62

Query  400  NATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
            + TV LDGKDI D  +DV+ LR KVGM+FQ P  F  ++ DN+ YG  + G    D    
Sbjct  63   DGTVLLDGKDIYDPKIDVVELRKKVGMVFQKPNPFPKSIFDNVAYGLRVHGINDKDILEQ  122

Query  574  rllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
            ++       + +       +K    LS GQ QR+ +ART+A EPEV+L+DEP SALDPIS
Sbjct  123  KVEESLRSAALWDEVKNILDKSAMGLSGGQQQRLCIARTMAVEPEVILMDEPCSALDPIS  182

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            T  IED++ +LK +   TI +V+H+++Q  R++      + GEIVE
Sbjct  183  TTKIEDLIHKLKND--FTIIIVTHNMQQATRVSKHTAFFLHGEIVE  226



>ref|WP_035690482.1| choline transporter [Bradyrhizobium elkanii]
Length=222

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 139/223 (62%), Gaps = 8/223 (4%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            ++ + L+R   + L L+N +++ +  G I+ ++G SG+GKS+FLR LNRL EP   TV L
Sbjct  2    LETRHLSRSVGQRL-LVNDVSVQVSAGEILAVVGASGAGKSSFLRLLNRLDEPTAGTVLL  60

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladl  597
               D   +    LR +VGM+ Q   LF GT+A NI +GP  RG+ ++  Q+  LL    L
Sbjct  61   ASTDYRSIAPQELRRRVGMVMQTAFLFPGTIAANIAFGPRQRGEVMAPTQIATLLERVGL  120

Query  598  dssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKE  777
               F ++  G LS G+AQRVALARTLAN PE+LLLDEPTSALD  S + +E++++ + +E
Sbjct  121  SG-FADRDVGNLSGGEAQRVALARTLANAPEILLLDEPTSALDETSVRGVEELILGIIRE  179

Query  778  KRMTIAMVSHSIKQIQRIADVVCLLVEGEIV------EVLKPD  888
            +RM   +V+H+ +Q  R+AD   ++  G +V      EVL  D
Sbjct  180  RRMACVIVTHNREQAIRLADKTTIMEAGRLVAIGATREVLHAD  222



>ref|WP_033023717.1| glycine/betaine ABC transporter ATP-binding protein [Geobacillus 
sp. G1w1]
 gb|KFX30858.1| glycine/betaine ABC transporter ATP-binding protein [Geobacillus 
sp. G1w1]
Length=375

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 140/223 (63%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  I L+I +G ++ +IGPSG GK+T +R +NRL EP + TV++
Sbjct  2    IRFENVTKQYEDGFVALKTINLEIHKGELVALIGPSGCGKTTTMRMINRLIEPTSGTVYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            DG+DI  LD + LR  +G + Q   LF   T+A+NI   P L+  + S  +      L  
Sbjct  62   DGQDISTLDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKCEKSAYEKRVDELLDL  121

Query  595  l---dssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP+++L+DEP SALDPIS + ++D +VR
Sbjct  122  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPDIILMDEPFSALDPISREQLQDDIVR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E R TI  V+H + +  +IAD + L+ +GE+V+   PDQ+
Sbjct  182  LQEEIRKTIVFVTHDMDEAIKIADRIALMKDGEVVQFATPDQM  224



>ref|WP_031405910.1| glycine/betaine ABC transporter ATP-binding protein [Geobacillus 
vulcani]
Length=375

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 139/223 (62%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  I L+I +G ++ +IGPSG GK+T +R +NRL EP + TV++
Sbjct  2    IRFENVTKQYEDGFVALKNINLEIRKGELVALIGPSGCGKTTTMRMINRLIEPTSGTVYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            DG+DI  LD + LR  +G + Q   LF   T+A+NI   P L+  + S  +      L  
Sbjct  62   DGQDISTLDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKSAYEKRVDELLDL  121

Query  595  ld---ssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP ++L+DEP SALDPIS + ++D +VR
Sbjct  122  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPNIILMDEPFSALDPISREQLQDDIVR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E R TI  V+H + +  +IAD + L+ +GE+V+   PDQ+
Sbjct  182  LQEEIRKTIVFVTHDMDEAIKIADRIALMKDGEVVQFATPDQM  224



>ref|WP_011025854.1| phosphate ABC transporter ATP-binding protein [Caldanaerobacter 
subterraneus]
 ref|NP_623226.1| phosphate transporter ATP-binding protein [Caldanaerobacter subterraneus 
subsp. tengcongensis MB4]
 sp|Q8R9I2.1|PSTB2_THETN RecName: Full=Phosphate import ATP-binding protein PstB 2; AltName: 
Full=ABC phosphate transporter 2; AltName: Full=Phosphate-transporting 
ATPase 2 [Caldanaerobacter subterraneus subsp. 
tengcongensis MB4]
 gb|AAM24830.1| ABC-type phosphate transport system, ATPase component [Caldanaerobacter 
subterraneus subsp. tengcongensis MB4]
 gb|ERM92824.1| phosphate ABC transporter ATP-binding protein [Caldanaerobacter 
subterraneus subsp. yonseiensis KB-1]
Length=249

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 130/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC-DLDV  447
            L +I LD+    ++ +IGPSG GKSTF+R LNR+ +       + TV LDGKDI  ++DV
Sbjct  19   LKKINLDVEPNSVLALIGPSGCGKSTFIRTLNRMNDLIEGVKISGTVLLDGKDIYKEVDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR KVGM+FQ P  F  TV DN+ YGP + G +        +       + +      
Sbjct  79   IELRKKVGMVFQKPNPFPMTVYDNVAYGPRIHGIRDKRTLNEIVEKSLKAAALWDEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             +     LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST  IE+++  LK  K+ T
Sbjct  139  LHHSALSLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPISTMKIEELIEELK--KKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            I +V+H+++Q  R++D     + GE+VE    DQ+
Sbjct  197  IIIVTHNMQQAGRVSDYTAFFLNGELVEWGPTDQV  231



>dbj|BAQ16648.1| YbbL ABC transporter ATP-binding protein [Methyloceanibacter 
caenitepidi]
Length=235

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 130/207 (63%), Gaps = 1/207 (0%)
 Frame = +1

Query  274  GLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLS  453
            G  L + I++ + +G ++ I+GPSGSGKS+FLR LNRL EP    V +DG+D   +    
Sbjct  26   GKILTDNISVQVKKGDVLAIVGPSGSGKSSFLRLLNRLDEPTRGVVKVDGEDYRSISPEI  85

Query  454  LRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGEL  633
            LR +VGM+ Q   LF GTV +N+ +GP  RGK L D   +  L      S + ++    L
Sbjct  86   LRRRVGMVMQSAYLFPGTVGENVAFGPAQRGKSLPD-TRIDALLERVGLSEYGDRDVDNL  144

Query  634  SVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSI  813
            S G+AQRV++ARTLANEPE+LLLDEPTSALD  +   IE ++  + +E+ MT  +V+HS 
Sbjct  145  SGGEAQRVSIARTLANEPEILLLDEPTSALDESTALEIETLVRDIIRERHMTCVIVTHSN  204

Query  814  KQIQRIADVVCLLVEGEIVEVLKPDQL  894
             Q +R+A    ++  G++ ++   D++
Sbjct  205  AQARRVASRTMIIESGKLAKIGPTDEV  231



>gb|AIS52689.1| phosphate import ATP-binding protein PstB 2 [Thermoanaerobacter 
kivui]
Length=249

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/225 (44%), Positives = 140/225 (62%), Gaps = 15/225 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            KIQV+ L     + +  L +I LD+    ++ +IGPSG GKSTF+R LNR+ +       
Sbjct  3    KIQVRDLDLFYGE-VQALKKINLDVEENSVLALIGPSGCGKSTFIRTLNRMNDLIEGVKI  61

Query  400  NATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG----KKLSDd  564
              TV LDG+DI  ++DV+ LR KVGM+FQ P  F  TV DN+ YGP + G    KKL++ 
Sbjct  62   KGTVLLDGQDIYKEVDVIELRKKVGMVFQKPNPFPMTVYDNVAYGPRIHGIKDKKKLNEI  121

Query  565  qvlrllslad--ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST  738
              + L++ A         +K    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST
Sbjct  122  VEMSLVAAALWDEVKDRLHKSALGLSGGQQQRLCIARTLAIEPEVILMDEPTSALDPIST  181

Query  739  QNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
              IE+++  LK   + TI +V+H+++Q  R++D     + GE++E
Sbjct  182  MKIEELIDELK--NKYTIIIVTHNMQQAGRVSDYTAFFLNGELIE  224



>ref|WP_012269192.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Thermoanaerobacter]
 ref|YP_001664823.1| phosphate transporter ATP-binding protein [Thermoanaerobacter 
pseudethanolicus ATCC 33223]
 ref|YP_004185823.1| phosphate ABC transporter ATPase subunit [Thermoanaerobacter 
brockii subsp. finnii Ako-1]
 gb|ABY94487.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacter 
pseudethanolicus ATCC 33223]
 gb|ADV79440.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacter 
brockii subsp. finnii Ako-1]
Length=249

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/225 (44%), Positives = 139/225 (62%), Gaps = 15/225 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            KIQVK L       +  L +I LD+    ++ +IGPSG GKSTF+R LNR+ +       
Sbjct  3    KIQVKDLDLFYGD-VQALKKINLDVEANSVLALIGPSGCGKSTFIRTLNRMNDLIEGVKI  61

Query  400  NATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG----KKLSDd  564
            + TV LDG+D+  ++DV+ LR +VGM+FQ P  F  TV DN+ YGP + G    KKL++ 
Sbjct  62   SGTVLLDGQDVYKEVDVIELRKRVGMVFQKPNPFPMTVYDNVAYGPRIHGIKDKKKLNEI  121

Query  565  qvlrllsla--dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST  738
                L + A  D      +K    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST
Sbjct  122  VEKSLKAAALWDEVKDRLDKSALSLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPIST  181

Query  739  QNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
              IE+++  LK   + TI +V+H+++Q  R++D     + GE++E
Sbjct  182  MKIEELINELK--NKYTIIIVTHNMQQAGRVSDYTAFFLNGELIE  224



>ref|WP_015009064.1| phosphate ABC transporter ATP-binding protein [Amphibacillus 
xylanus]
 ref|YP_006844220.1| phosphate ABC transporter ATP-binding protein [Amphibacillus 
xylanus NBRC 15112]
 dbj|BAM46458.1| phosphate ABC transporter ATP-binding protein [Amphibacillus 
xylanus NBRC 15112]
Length=256

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/216 (41%), Positives = 130/216 (60%), Gaps = 15/216 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDICD--LD  444
            L +I+L+IP   +  +IGPSG GKSTFLR LNRL +          + +DG+DI D  +D
Sbjct  25   LYEISLEIPEREVFALIGPSGCGKSTFLRTLNRLNDLIHKSKVTGKIEIDGQDIYDPSVD  84

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF-----  609
            V+ LR  VGM+FQ P  F  ++ DN+ YGP   G K        +       + +     
Sbjct  85   VVQLRTAVGMVFQKPNPFPSSIFDNVAYGPRAHGIKDKQKLNEIVERSLKQAALWDEVKD  144

Query  610  -CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRM  786
              + PG  LS GQ QR+ +AR +A EP+V+L+DEPTSALDP++T  IE+++  L+  ++ 
Sbjct  145  RLDAPGTSLSGGQQQRLCIARVMAVEPDVILMDEPTSALDPLATTKIENLINELR--EKY  202

Query  787  TIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            TI +V+H+++Q  RI+D     ++GE+VEV   DQL
Sbjct  203  TIVIVTHNMEQAARISDKTAFFLDGEVVEVGSTDQL  238



>ref|WP_011986851.1| phosphate ABC transporter ATP-binding protein [Clostridium botulinum]
 ref|YP_001255020.1| phosphate transporter ATP-binding protein [Clostridium botulinum 
A str. ATCC 3502]
 ref|YP_001384703.1| phosphate transporter ATP-binding protein [Clostridium botulinum 
A str. ATCC 19397]
 ref|YP_001388224.1| phosphate transporter ATP-binding protein [Clostridium botulinum 
A str. Hall]
 ref|YP_001391820.1| phosphate transporter ATP-binding protein [Clostridium botulinum 
F str. Langeland]
 ref|YP_001782067.1| phosphate transporter ATP-binding protein [Clostridium botulinum 
B1 str. Okra]
 ref|YP_002804969.1| phosphate transporter ATP-binding protein [Clostridium botulinum 
A2 str. Kyoto]
 ref|YP_005675423.1| phosphate ABC transporter ATP-binding protein [Clostridium botulinum 
F str. 230613]
 emb|CAL84076.1| phosphate import ATP-binding protein [Clostridium botulinum A 
str. ATCC 3502]
 gb|ABS34218.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
A str. ATCC 19397]
 gb|ABS37439.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
A str. Hall]
 gb|ABS39792.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
F str. Langeland]
 gb|ACA43387.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
B1 str. Okra]
 gb|ACO86984.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
A2 str. Kyoto]
 gb|ADG00223.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
F str. 230613]
 gb|EPS55743.1| phosphate transporter ATP-binding protein [Clostridium botulinum 
Af84]
 gb|KEJ02647.1| phosphate ABC transporter ATP-binding protein [Clostridium botulinum 
A2B3 87]
 dbj|BAQ14193.1| putative phosphate transporter ATP-binding protein [Clostridium 
botulinum]
Length=249

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 130/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-----TVFLDGKDIC-DLDV  447
            L  I +DI +  +  +IGPSG GKSTFLR LNR+ +  ++     +V+ +GKDI  D DV
Sbjct  19   LKNINIDIEKNKVTALIGPSGCGKSTFLRTLNRMNDLIDSVKIEGSVYYEGKDIYKDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR K+GM+FQ P  F  ++ DNI YGP + G K  +     +       + +      
Sbjct  79   IDLRKKIGMVFQNPNPFPMSIYDNIAYGPRIHGIKTKEKLDEIVEKSLKGGALWEEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +ARTLA EPE+LL+DEPTSALDPIST  IE+++  LK   + T
Sbjct  139  LKKNALGLSGGQQQRLCIARTLAVEPEILLMDEPTSALDPISTLKIEELMDELK--NKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            + +V+H+++Q  RI+D     + GEI+EV K  +L
Sbjct  197  VIIVTHNMQQAGRISDNTAFFLNGEIIEVGKTGEL  231



>ref|WP_004441523.1| phosphate ABC transporter ATP-binding protein [Clostridium botulinum]
 ref|YP_002863514.1| phosphate transporter ATP-binding protein [Clostridium botulinum 
Ba4 str. 657]
 gb|EDT86200.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
Bf]
 gb|ACQ52232.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
Ba4 str. 657]
 gb|AJD27068.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
CDC_297]
 gb|AJE10725.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
CDC_1436]
Length=249

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 130/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-----TVFLDGKDIC-DLDV  447
            L  I +DI +  +  +IGPSG GKSTFLR LNR+ +  ++     +V+ +GKDI  D DV
Sbjct  19   LKNINIDIEKNKVTALIGPSGCGKSTFLRTLNRMNDLIDSVKIKGSVYYEGKDIYKDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR K+GM+FQ P  F  ++ DNI YGP + G K  +     +       + +      
Sbjct  79   IDLRKKIGMVFQNPNPFPMSIYDNIAYGPRIHGIKTKEKLDEIVEKSLKGGALWEEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +ARTLA EPE+LL+DEPTSALDPIST  IE+++  LK   + T
Sbjct  139  LKKNALGLSGGQQQRLCIARTLAVEPEILLMDEPTSALDPISTLKIEELMDELK--NKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            + +V+H+++Q  RI+D     + GEI+EV K  +L
Sbjct  197  VIIVTHNMQQAGRISDNTAFFLNGEIIEVGKTGEL  231



>ref|WP_004440590.1| phosphate ABC transporter ATP-binding protein [Clostridium botulinum]
 gb|EDT80446.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
NCTC 2916]
Length=249

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 130/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-----TVFLDGKDIC-DLDV  447
            L  I +DI +  +  +IGPSG GKSTFLR LNR+ +  ++     +V+ +GKDI  D DV
Sbjct  19   LKNINIDIEKNKVTALIGPSGCGKSTFLRTLNRMNDLIDSVKIEGSVYYEGKDIYKDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR K+GM+FQ P  F  ++ DNI YGP + G K  +     +       + +      
Sbjct  79   IDLRKKIGMVFQNPNPFPMSIYDNIAYGPRIHGIKTKEKLDEIVEKSLKGGALWEEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +ARTLA EPE+LL+DEPTSALDPIST  IE+++  LK   + T
Sbjct  139  LKKNALGLSGGQQQRLCIARTLAVEPEILLMDEPTSALDPISTLKIEELMDELK--NKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            + +V+H+++Q  RI+D     + GEI+EV K  +L
Sbjct  197  VIIVTHNMQQAGRISDNTAFFLNGEIIEVGKTGEL  231



>ref|WP_022207138.1| phosphate ABC transporter ATP-binding protein PhoT family (TC 
3.A.1.7.1) [Eubacterium sp. CAG:252]
 emb|CDB67770.1| phosphate ABC transporter ATP-binding protein PhoT family (TC 
3.A.1.7.1) [Eubacterium sp. CAG:252]
Length=264

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 140/233 (60%), Gaps = 15/233 (6%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----P  396
             K ++K L  +       L  I ++I +  I   IGPSG GKSTFL+ LNR+ +      
Sbjct  17   NKFEIKNLN-LHYGDFHALKNINMNIKKNQITAFIGPSGCGKSTFLKTLNRMNDLVENVK  75

Query  397  ANATVFLDGKDI-CDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG-KKLSD---  561
             +  V+LDGK+I  D+D ++LR +VGM+FQ P  F  +V DNI YGP L G +K +D   
Sbjct  76   IDGEVYLDGKNIFTDMDDITLRHRVGMVFQQPNPFPKSVYDNIAYGPRLFGVRKKADLDI  135

Query  562  --dqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
              ++ L+  ++ D       K    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIS
Sbjct  136  IVERALKQAAIWDEVKDRLKKSALGLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPIS  195

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            T  IED+ + LK +   TI MV+H+++Q  RI+D     + GE++E    +QL
Sbjct  196  TSRIEDLAIELKNQ--YTIVMVTHNMQQATRISDNTAFFLLGEMIEYGNTEQL  246



>ref|WP_014521289.1| phosphate ABC transporter ATP-binding protein [Clostridium botulinum]
 ref|YP_005679095.1| phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1) [Clostridium 
botulinum H04402 065]
 emb|CBZ04361.1| phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1) [Clostridium 
botulinum H04402 065]
Length=249

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 130/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-----TVFLDGKDIC-DLDV  447
            L  I +DI +  +  +IGPSG GKSTFLR LNR+ +  ++     +V+ +GKDI  D DV
Sbjct  19   LKNINIDIEKNKVTALIGPSGCGKSTFLRTLNRMNDLIDSVKIEGSVYYEGKDIYKDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR K+GM+FQ P  F  ++ DNI YGP + G K  +     +       + +      
Sbjct  79   IDLRKKIGMVFQNPNPFPMSIYDNIAYGPRIHGIKTKEKLDEIVEKSLKGGALWEEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +ARTLA EPE+LL+DEPTSALDPIST  IE+++  LK   + T
Sbjct  139  LKKNALGLSGGQQQRLCIARTLAVEPEILLMDEPTSALDPISTLKIEELMDELK--NKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            + +++H+++Q  RI+D     + GEI+EV K  +L
Sbjct  197  VIIITHNMQQAGRISDNTAFFLNGEIIEVGKTGEL  231



>ref|WP_015323674.1| phosphate ABC transporter, ATP-binding protein [Methanomethylovorans 
hollandica]
 ref|YP_007312035.1| phosphate ABC transporter, ATP-binding protein [Methanomethylovorans 
hollandica DSM 15978]
 gb|AGB48505.1| phosphate ABC transporter, ATP-binding protein [Methanomethylovorans 
hollandica DSM 15978]
Length=257

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 141/233 (61%), Gaps = 15/233 (6%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----P  396
            T+I+V+GL     +   L + +++DIP+  +  +IGPSG GKSTFLR LNR+ +      
Sbjct  10   TEIEVRGLNLWYGENHAL-HDVSIDIPKNSVTALIGPSGCGKSTFLRCLNRMNDLVKNCR  68

Query  397  ANATVFLDGKDIC--DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG--KKLSDd  564
               +V +D KDI   D+DV+ LR +VGM+FQ P  F  ++ DNI YGP + G  KK  D 
Sbjct  69   IQGSVKIDNKDIYSKDIDVVDLRKRVGMVFQKPNPFPMSIQDNIAYGPKIHGVAKKDIDG  128

Query  565  qvlrllsladldssFCNK---PGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
             V   L    L      +      +LS GQ QR+ +ARTLA  PEV+L DEP SALDPIS
Sbjct  129  VVEDALRSGALWEEVAERLTTSALDLSGGQQQRLCIARTLAVRPEVILFDEPCSALDPIS  188

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            T  IE++++ LK  K+ TI +V+H+++Q  RI+D     + G+I+E  K +Q+
Sbjct  189  TSKIEELIMELK--KKYTIVIVTHNMQQAARISDHTAFFLTGDIIEYGKTEQI  239



>ref|WP_003404686.1| phosphate transporter ATP-binding protein, partial [Clostridium 
botulinum]
 gb|EKX78601.1| phosphate transporter ATP-binding protein, partial [Clostridium 
botulinum CFSAN001628]
Length=227

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 128/211 (61%), Gaps = 14/211 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-----TVFLDGKDIC-DLDV  447
            L  I +DI +  +  +IGPSG GKSTFLR LNR+ +  ++     +V+ +GKDI  D DV
Sbjct  19   LKNINIDIEKNKVTALIGPSGCGKSTFLRTLNRMNDLIDSVKIEGSVYYEGKDIYKDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR K+GM+FQ P  F  ++ DNI YGP + G K  +     +       + +      
Sbjct  79   IDLRKKIGMVFQNPNPFPMSIYDNIAYGPRIHGIKTKEKLDEIVEKSLKGGALWEEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +ARTLA EPE+LL+DEPTSALDPIST  IE+++  LK   + T
Sbjct  139  LKKNALGLSGGQQQRLCIARTLAVEPEILLMDEPTSALDPISTLKIEELMDELK--NKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            + +V+H+++Q  RI+D     + GEI+EV K
Sbjct  197  VIIVTHNMQQAGRISDNTAFFLNGEIIEVGK  227



>ref|WP_020958513.1| glycine/betaine ABC transporter ATPase [Geobacillus sp. JF8]
 ref|YP_008416243.1| glycine/betaine ABC transporter ATPase [Geobacillus sp. JF8]
 gb|AGT30701.1| glycine/betaine ABC transporter ATPase [Geobacillus sp. JF8]
Length=375

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 135/223 (61%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  I LDI +G ++ +IGPSG GK+T +R +NRL EP +  V++
Sbjct  2    IRFENVTKQYEDGFVALKNINLDIRKGELVALIGPSGCGKTTTMRMINRLIEPTSGKVYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRG---KKLSDdqvlrlls  585
            DG+DI  LD + LR  +G + Q   LF   T+A+NI   P L+              L  
Sbjct  62   DGQDISQLDPVDLRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKHTYEKRVDELLEL  121

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP+++L+DEP SALDPIS + ++D +VR
Sbjct  122  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPDIILMDEPFSALDPISREQLQDDIVR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E   TI  V+H + +  +IAD + L+ +GEIV+   PDQ+
Sbjct  182  LQEEIHKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPDQM  224



>emb|CCE09909.1| ABC transporter, ATPase subunit precursor [Bradyrhizobium sp. 
STM 3843]
Length=278

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 131/201 (65%), Gaps = 1/201 (0%)
 Frame = +1

Query  274  GLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLDVLS  453
            G  L++ +++ I RG I+ ++GPSG+GKS+FLR LNRL EP + TV L   D   +    
Sbjct  69   GRRLVSDVSVQIGRGEIVAVVGPSGAGKSSFLRLLNRLDEPTSGTVLLQSIDYRTIAPQE  128

Query  454  LRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGEL  633
            LR +VGM+ Q   LF GTVA NI +GP  RG+ L  D ++ LL    L   F ++  G L
Sbjct  129  LRRRVGMVMQTAYLFPGTVAANIGFGPRQRGQVLPHDNIVALLERVGLAG-FADRDIGHL  187

Query  634  SVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSI  813
            S G+AQRVALARTLAN PEVLLLDEPTSALD    + IE++++ + +E++MT  +V+H+ 
Sbjct  188  SGGEAQRVALARTLANAPEVLLLDEPTSALDEALVRGIEELILGIVRERQMTCIIVTHNR  247

Query  814  KQIQRIADVVCLLVEGEIVEV  876
             Q +R+A    L+  G +V +
Sbjct  248  AQAERMAGRTMLMEAGRLVTI  268



>ref|WP_022142004.1| phosphate ABC transporter ATP-binding protein PhoT family (TC 
3.A.1.7.1) [Clostridium sp. CAG:230]
 emb|CDA86896.1| phosphate ABC transporter ATP-binding protein PhoT family (TC 
3.A.1.7.1) [Clostridium sp. CAG:230]
Length=269

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 126/220 (57%), Gaps = 14/220 (6%)
 Frame = +1

Query  271  KGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPA-----NATVFLDGKDIC  435
            K    L  +++DIP+  I   IGPSG GKSTFL+ LNR+ +          V L+G+DI 
Sbjct  34   KDFHALKSVSMDIPQKKITAFIGPSGCGKSTFLKTLNRMNDLVEGCRITGDVQLNGEDIY  93

Query  436  -DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF-  609
             D+DV  LR +VGM+FQ P  F  ++ DNI YGP   G +        +       + + 
Sbjct  94   GDMDVNHLRKRVGMVFQNPNPFPMSIYDNIAYGPRTHGIRSKQKLDAIVEKSLRQAAIWD  153

Query  610  -----CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
                   K    LS GQ QR+ +AR LA EPEV+L+DEPTSALDPIST  IED+ + LKK
Sbjct  154  ELKDRLKKSALGLSGGQQQRLCIARALAIEPEVILMDEPTSALDPISTSRIEDLAMELKK  213

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            E   TI MV+H+++Q  RI+D     + GE+VE    DQL
Sbjct  214  E--YTIIMVTHNMQQATRISDKTAFFLLGEMVEYADTDQL  251



>ref|WP_015739023.1| phosphate ABC transporter ATP-binding protein [Ammonifex degensii]
 ref|YP_003238996.1| phosphate ABC transporter ATPase [Ammonifex degensii KC4]
 gb|ACX52146.1| phosphate ABC transporter, ATPase subunit [Ammonifex degensii 
KC4]
Length=251

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 131/209 (63%), Gaps = 15/209 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC--DLD  444
            L  I +DI    I  +IGPSG GK+TFLR LNRL +          V LDG+DI   D+D
Sbjct  20   LKNINIDIEANKITALIGPSGCGKTTFLRVLNRLCDLVEGARVEGKVLLDGQDIFAPDVD  79

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG---KKLSDdqvlrllsladldssFC-  612
            V++LR +VGM+FQ P  F  ++ DN+ +GP + G   K+  D+ V   L  A L    C 
Sbjct  80   VVALRKRVGMVFQRPNPFPMSIYDNVAFGPRIHGIKDKRRLDEIVEASLRGAALWDEVCD  139

Query  613  --NKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRM  786
              ++    LS GQ QR+ +AR LA EPEVLL+DEPTSALDPIST  IE++L +LK  KR 
Sbjct  140  RLHRSALSLSGGQQQRLCIARLLAVEPEVLLMDEPTSALDPISTMKIEELLQQLK--KRY  197

Query  787  TIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            TI +V+H+++Q  R++DV    + GE++E
Sbjct  198  TIVIVTHNMQQAARVSDVTAFFLSGELIE  226



>ref|WP_013298212.1| phosphate ABC transporter ATP-binding protein [Thermoanaerobacterium 
thermosaccharolyticum]
 ref|YP_003852330.1| phosphate ABC transporter ATPase [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
 ref|YP_007299073.1| phosphate ABC transporter ATP-binding protein, PhoT family [Thermoanaerobacterium 
thermosaccharolyticum M0795]
 gb|ADL69246.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacterium 
thermosaccharolyticum DSM 571]
 gb|AGB19376.1| phosphate ABC transporter ATP-binding protein, PhoT family [Thermoanaerobacterium 
thermosaccharolyticum M0795]
Length=249

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 136/232 (59%), Gaps = 15/232 (6%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            KI+V+ L     + +  L +I LD+    +M +IGPSG GKSTFLR LNR+ +       
Sbjct  3    KIEVRDLDLYYGQ-MQALKKINLDVEENSVMALIGPSGCGKSTFLRTLNRMNDLIDGVTI  61

Query  400  NATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlr  576
              TV +D ++I  D+D + LR +VGM+FQ P  F  T+ DNI YGP + G+K        
Sbjct  62   RGTVMIDNQNIYKDVDAIELRKRVGMVFQKPNPFPMTIYDNIAYGPRIHGQKNKKILNEI  121

Query  577  llsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST  738
            +       + +       N     LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST
Sbjct  122  VEKSLKDAALWDEVKDRLNDSALGLSGGQQQRLCIARTLAIEPEVILMDEPTSALDPIST  181

Query  739  QNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
              IE+++ +LK   + TI +V+H+++Q  RI+D     + GEI+E  K + +
Sbjct  182  MKIEELIDQLK--NKYTIVIVTHNMQQAGRISDSTSFFLNGEIIETGKTEDI  231



>ref|WP_024736676.1| phosphate ABC transporter ATP-binding protein [Clostridiales 
bacterium VE202-15]
Length=253

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 133/233 (57%), Gaps = 22/233 (9%)
 Frame = +1

Query  256  TRVSDKGLTL-------LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            T++S + L L       L  I+LD+    I   IGPSG GKSTFL+ LNR+ +       
Sbjct  5    TKISARSLNLYYGENHALKDISLDLYEHKITAFIGPSGCGKSTFLKTLNRMNDLVAGVKI  64

Query  400  NATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
            + TV LD +DI D  +D   LR K+GM+FQ P  F  ++ DN+ YGP + G K       
Sbjct  65   DGTVLLDEEDIYDPQVDTTLLRKKIGMVFQQPNPFPMSIYDNVAYGPRIHGIKNKARLDE  124

Query  574  rllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
             + S     + +        KP   LS GQ QR+ +AR LA EPEVLL+DEPTSALDPIS
Sbjct  125  IVESSLRGAALWDEVSDRLRKPALGLSGGQQQRLCIARALAVEPEVLLMDEPTSALDPIS  184

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            T  IED++  LK   R T+A+V+H+++Q  RIAD     + GE+VE    D+L
Sbjct  185  TLKIEDLMDDLK--SRYTVAIVTHNMQQAARIADYTAFFLVGEVVEYAATDEL  235



>ref|WP_013237907.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Clostridium]
 ref|YP_003779412.1| phosphate import ATP-binding protein [Clostridium ljungdahlii 
DSM 13528]
 ref|YP_008700783.1| phosphate ABC transporter, ATPase subunit [Clostridium autoethanogenum 
DSM 10061]
 gb|ADK14310.1| phosphate import ATP-binding protein [Clostridium ljungdahlii 
DSM 13528]
 gb|AGY77527.1| phosphate ABC transporter, ATPase subunit [Clostridium autoethanogenum 
DSM 10061]
Length=249

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 131/215 (61%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANAT-----VFLDGKDIC-DLDV  447
            L +++L++ +  +  +IGPSG GKSTFLR LNR+ +   +      VF +GKDI  D DV
Sbjct  19   LKKVSLNVEKNSVTALIGPSGCGKSTFLRTLNRMNDLIESVRIEGKVFFEGKDIYQDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR ++GM+FQ P  F  ++ DN+ YGP + G K        + +     + +      
Sbjct  79   IDLRKRIGMVFQSPNPFPMSIYDNVAYGPRIHGIKDKSKLDELVENSLKGAAIWDEIKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             N+    LS GQ QR+ +ARTLA EPEVLL+DEPTSALDPIST  IE+++  LK  K+ T
Sbjct  139  LNRSALGLSGGQQQRLCIARTLAVEPEVLLMDEPTSALDPISTLKIEELMDVLK--KKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            I +V+H+++Q  RI+D     + GE++E  K + +
Sbjct  197  IIIVTHNMQQAGRISDYTAFFLNGEVIEAQKTENI  231



>ref|WP_009144708.1| phosphate ABC transporter ATP-binding protein [Phascolarctobacterium 
succinatutens]
 gb|EFY05691.1| phosphate ABC transporter, ATP-binding protein [Phascolarctobacterium 
succinatutens YIT 12067]
Length=255

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 138/238 (58%), Gaps = 15/238 (6%)
 Frame = +1

Query  217  DEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-  393
            ++ A TK  V+ L     K    L +I LDI    I  +IGPSG GKSTFL+ LNR+ + 
Sbjct  3    NDKAATKFLVQDLDLYYGK-FQALKKINLDIKEKEITALIGPSGCGKSTFLKTLNRMNDL  61

Query  394  ----PANATVFLDGKDI-CDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLS  558
                    ++ LDGKDI  ++D +SLR +VGM+FQ P  F  ++ DN+ YGP + G    
Sbjct  62   EEGVRIEGSIALDGKDIFAEIDPISLRHRVGMVFQQPNPFPKSIYDNVAYGPRIHGVTKK  121

Query  559  DdqvlrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSA  720
             +    +       + +       NK    LS GQ QR+ +ARTLA +PEV+L+DEPTSA
Sbjct  122  SELDEIVERSLRQAAIWDELKDRLNKSALGLSGGQQQRLCIARTLAVQPEVILMDEPTSA  181

Query  721  LDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            LDPIST  IED+ + LKK+   TI +V+H+++Q  RI+D     + GE++E  +  QL
Sbjct  182  LDPISTMKIEDLALELKKD--YTIVIVTHNMQQAARISDKTAFFLLGELIEFNETKQL  237



>ref|WP_009854954.1| phosphate ABC transporter ATP-binding protein [Streptococcus 
gallolyticus]
 ref|YP_004288829.1| phosphate ABC transporter ATP-binding protein [Streptococcus 
gallolyticus subsp. gallolyticus ATCC BAA-2069]
 ref|YP_006034759.1| phosphate ABC transporter ATP-binding protein [Streptococcus 
gallolyticus subsp. gallolyticus ATCC 43143]
 gb|EFM28751.1| phosphate ABC transporter, ATP-binding protein [Streptococcus 
gallolyticus subsp. gallolyticus TX20005]
 emb|CBZ49085.1| phosphate transport system ATP-binding protein [Streptococcus 
gallolyticus subsp. gallolyticus ATCC BAA-2069]
 dbj|BAK28800.1| phosphate transport system ATP-binding protein [Streptococcus 
gallolyticus subsp. gallolyticus ATCC 43143]
Length=250

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 126/215 (59%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPA-----NATVFLDGKDI-CDLDV  447
            L  I L+IP   I   IGPSG GKST L++LNR+ +          V LDG+DI CDLD+
Sbjct  20   LKSIHLEIPANEITAFIGPSGCGKSTLLKSLNRMNDLVKDCRITGKVLLDGEDIYCDLDI  79

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
              LR KVGM+FQ P  F  ++ DNI +GP   G     +    +       + +      
Sbjct  80   NKLRKKVGMVFQKPNPFPMSIYDNIAFGPRTHGIHAKTELDEIVERSLKQAAIWDEVKDR  139

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             +K    LS GQ QR+ +AR LA EP+VLL+DEPTSALDPIST  IED+++ LK  K+ +
Sbjct  140  LSKSAMGLSGGQQQRLCIARALAIEPDVLLMDEPTSALDPISTSKIEDLVIELK--KKYS  197

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            I MV+H+++Q  RI+D     + GE+VE  K  QL
Sbjct  198  IVMVTHNMQQAVRISDKTAFFLMGEVVEFNKTSQL  232



>ref|WP_012962486.1| phosphate ABC transporter ATP-binding protein [Streptococcus 
gallolyticus]
 ref|YP_003431371.1| phosphate ABC transporter ATP-binding protein [Streptococcus 
gallolyticus UCN34]
 emb|CBI14454.1| putative phosphate ABC transporter, ATP-binding protein [Streptococcus 
gallolyticus UCN34]
Length=249

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 126/215 (59%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPA-----NATVFLDGKDI-CDLDV  447
            L  I L+IP   I   IGPSG GKST L++LNR+ +          V LDG+DI CDLD+
Sbjct  19   LKSIHLEIPANEITAFIGPSGCGKSTLLKSLNRMNDLVKDCRITGKVLLDGEDIYCDLDI  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
              LR KVGM+FQ P  F  ++ DNI +GP   G     +    +       + +      
Sbjct  79   NKLRKKVGMVFQKPNPFPMSIYDNIAFGPRTHGIHAKTELDEIVERSLKQAAIWDEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             +K    LS GQ QR+ +AR LA EP+VLL+DEPTSALDPIST  IED+++ LK  K+ +
Sbjct  139  LSKSAMGLSGGQQQRLCIARALAIEPDVLLMDEPTSALDPISTSKIEDLVIELK--KKYS  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            I MV+H+++Q  RI+D     + GE+VE  K  QL
Sbjct  197  IVMVTHNMQQAVRISDKTAFFLMGEVVEFNKTSQL  231



>ref|WP_020156624.1| hypothetical protein [Caldibacillus debilis]
Length=244

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 130/201 (65%), Gaps = 0/201 (0%)
 Frame = +1

Query  265  SDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDICDLD  444
            S  G+ +L  IT   P+G I  ++GPSG+GKST  R  N L  P +  ++++ K I D D
Sbjct  18   SASGVPILKNITGIFPKGKITAVVGPSGAGKSTLFRLCNGLRPPDSGEIYVNEKPIADYD  77

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPG  624
               LR KVG+  Q   + +GTV DN+     L+GK+LS+ +  + + L  L+S F + P 
Sbjct  78   PPELRRKVGIAMQNAPMVDGTVMDNLELPKKLQGKRLSEREAFQWMDLVGLESRFLHHPA  137

Query  625  GELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVS  804
             ELS GQ Q+V++ARTL N PE+LLLDE TS+LDP+STQ+IE++++R+  E   TI  ++
Sbjct  138  KELSGGQRQKVSIARTLVNRPEILLLDEITSSLDPVSTQDIEELILRINGEFGTTILWIT  197

Query  805  HSIKQIQRIADVVCLLVEGEI  867
            H+++Q  RI +   +L++GE+
Sbjct  198  HALEQAIRIGNYTWVLMDGEL  218



>ref|WP_008393288.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Clostridiales]
 ref|YP_007790622.1| phosphate ABC transporter ATP-binding protein, PhoT family (TC 
3.A.1.7.1) [butyrate-producing bacterium SSC/2]
 gb|EDS21290.1| phosphate ABC transporter, ATP-binding protein [Clostridium sp. 
SS2/1]
 emb|CBL39627.1| phosphate ABC transporter ATP-binding protein, PhoT family (TC 
3.A.1.7.1) [butyrate-producing bacterium SSC/2]
 gb|EFV15797.1| phosphate ABC transporter [Lachnospiraceae bacterium 5_1_63FAA]
 gb|EKY22344.1| phosphate ABC transporter, ATP-binding protein [Anaerostipes 
hadrus DSM 3319]
 emb|CDA33062.1| phosphate ABC transporter [Lachnospiraceae bacterium CAG:25]
Length=250

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 134/233 (58%), Gaps = 15/233 (6%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----P  396
            +K++V+ L     K    L  I LD+P+  I   IGPSG GKST L++LNR+ +      
Sbjct  3    SKMKVENLDLYYGK-FKALKNINLDLPKNEITAFIGPSGCGKSTLLKSLNRMNDLVEGCK  61

Query  397  ANATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG----KKLSD  561
                V LDG DI  D+DV  LR +VGM+FQ P  F  ++ DNI YGP   G     KL D
Sbjct  62   ITGKVTLDGDDIYGDMDVNLLRKRVGMVFQKPNPFPMSIYDNIAYGPRTHGIRSKAKLDD  121

Query  562  dqvlrllsla--dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
                 L + A  D       K    LS GQ QR+ +AR LA EPEVLL+DEPTSALDPIS
Sbjct  122  IVEKSLRNAAIWDELKDRLKKSALGLSGGQQQRLCIARALAVEPEVLLMDEPTSALDPIS  181

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            T  IED+ V LK   + TI MV+H+++Q  RI+D     + GE+VE  K DQL
Sbjct  182  TSKIEDLAVELK--SKYTIIMVTHNMQQAVRISDNTAFFLLGEMVEYGKSDQL  232



>ref|WP_013897826.1| phosphate ABC transporter ATP-binding protein [Methanosalsum 
zhilinae]
 ref|YP_004615606.1| phosphate ABC transporter ATPase [Methanosalsum zhilinae DSM 
4017]
 gb|AEH60387.1| phosphate ABC transporter, ATPase subunit [Methanosalsum zhilinae 
DSM 4017]
Length=259

 Score =   156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 129/216 (60%), Gaps = 15/216 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDICD--LD  444
            L  I++DIPR  +  +IGPSG GKSTF+R LNR+ +          V +DG++I D  +D
Sbjct  28   LKDISIDIPRNKVTSLIGPSGCGKSTFIRCLNRMNDLIRSCRIEGEVLVDGENIYDDNVD  87

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF-----  609
            V+ LR +VGM+FQ P  F  ++ DNI YGP + G+K                + +     
Sbjct  88   VVELRKRVGMVFQKPNPFPMSIGDNISYGPRIHGEKNKKRLESITEEALKSAALWDEVSD  147

Query  610  -CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRM  786
              NK   +LS GQ QR+ +ARTLA +PE++L DEP SALDPIST  IE++++ LK E   
Sbjct  148  RLNKSALDLSGGQQQRLCIARTLAVKPEIILFDEPCSALDPISTAKIEELIMDLKNE--Y  205

Query  787  TIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            TI +V+H+++Q  RI+D     + GE+VE    +Q+
Sbjct  206  TIVIVTHNMQQAARISDYTAYFLLGELVEYGDTEQI  241



>dbj|GAK38737.1| glycine betaine/L-proline ABC transporter ATP-binding protein 
[Paenibacillus sp. TCA20]
Length=385

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 138/231 (60%), Gaps = 6/231 (3%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ KG+ +V D G   L  I L+I RG I   IGPSG GK+T +R +NRL  P++  + +
Sbjct  2    IEFKGVKKVYDDGFEALKGINLEIKRGEITVFIGPSGCGKTTTMRMINRLNVPSHGQILI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALFEG-TVADNIRYGPLLRG---KKLSDdqvlrlls  585
            +G DI  +D + LR K+G + Q   LF   T+A N+   P L+    +K+       +  
Sbjct  62   NGDDISKMDAVELRRKIGYVIQSVGLFPNMTIAKNVGVVPRLQKWDKEKIDSRVNELMNQ  121

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +     +F N+   ELS GQ QR+ + R LA +P+++LLDEP SALDPIS + ++D L+R
Sbjct  122  VRLSPETFGNRYPSELSGGQQQRIGVIRALAADPDIILLDEPFSALDPISREELQDELIR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHPMA  918
            L+ E + TI  V+H + +  ++AD + L+ +G+I +V  PDQ+   +HP +
Sbjct  182  LQTEVKKTIVFVTHDMDEAIKLADTIVLMKDGQIEQVGTPDQI--LRHPAS  230



>ref|WP_013822279.1| phosphate ABC transporter ATP-binding protein [Desulfotomaculum 
kuznetsovii]
 ref|YP_004516565.1| phosphate ABC transporter ATPase [Desulfotomaculum kuznetsovii 
DSM 6115]
 gb|AEG14764.1| phosphate ABC transporter, ATPase subunit [Desulfotomaculum kuznetsovii 
DSM 6115]
Length=253

 Score =   156 bits (394),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 141/233 (61%), Gaps = 16/233 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            KI VK L  +  K    L  I LDI    I  +IGPSG GKSTFLR LNR+ +       
Sbjct  6    KIAVKDLN-LYYKDFHALKDINLDIKANKITALIGPSGCGKSTFLRTLNRMNDLIEGVRI  64

Query  400  NATVFLDGKDIC--DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG---KKLSDd  564
              TV LDG+DI   D+DV+ LR +VGM+FQ P  F  +V DN+ YGP + G   K+L D+
Sbjct  65   EGTVLLDGRDIYAPDVDVVYLRKRVGMVFQRPNPFPMSVYDNVAYGPRVHGIKNKRLLDE  124

Query  565  qvlrllsladldssFCN---KPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
             V R L  A L     +   K    LS GQ QR+ +AR LA EPEVLL+DEP+SALDPIS
Sbjct  125  IVERSLRNAALWDEVQDRLFKSALGLSGGQQQRLCIARLLAVEPEVLLMDEPSSALDPIS  184

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            T  IE+++  LKK+   TI +V+H+++Q  R++D+    + GE+VE    D++
Sbjct  185  TLKIEELIQVLKKD--YTIVIVTHNMQQAARVSDITAYFLNGELVEWGTTDEI  235



>ref|WP_004030715.1| phosphate ABC transporter ATP-binding protein [Methanobacterium 
formicicum]
 gb|EKF85831.1| phosphate ABC transporter ATP-binding protein [Methanobacterium 
formicicum DSM 3637]
Length=251

 Score =   156 bits (394),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 135/226 (60%), Gaps = 16/226 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            +I+V+ L    D+ L +L  ++L IP+  +  +IGPSG GKSTF+R LNR+ +       
Sbjct  4    RIEVENLNVYFDE-LHILKDVSLKIPKNAVTSLIGPSGCGKSTFIRTLNRMNDMISTFKM  62

Query  400  NATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
            + TV LDG DI D  +DV+ LR KVGM+FQ P  F  ++ DN+ YG  + G    D    
Sbjct  63   DGTVLLDGNDIYDPKVDVVELRKKVGMVFQKPNPFPKSIFDNVAYGLRVHGINDKDILEQ  122

Query  574  rllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
            ++       + +       +K    LS GQ QR+ +ART+A EPEV+L+DEP SALDPIS
Sbjct  123  KVEESLRSAALWDEVKNILDKSAMGLSGGQQQRLCIARTMAVEPEVILMDEPCSALDPIS  182

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            T  IED++ +LK +   TI +V+H+++Q  R++      + GEIVE
Sbjct  183  TTKIEDLIHKLKND--FTIIIVTHNMQQATRVSKHTAFFLHGEIVE  226



>ref|WP_038067937.1| phosphate ABC transporter ATP-binding protein [Thermotoga neapolitana]
 gb|KFZ21121.1| phosphate ABC transporter ATP-binding protein [Thermotoga neapolitana 
LA10]
Length=250

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 122/208 (59%), Gaps = 14/208 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEP----ANATVFLDGKDICD--LDV  447
            +  +T+ I +  I  IIGPSG GK+T LR++NR+ +         ++  G+DI D  LDV
Sbjct  20   VKNVTMKIFKNQITAIIGPSGCGKTTLLRSINRMNDHIRFQVEGKIYFKGQDIYDPKLDV  79

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
               R KVGM+FQ P  F  ++ DN+ +GP + G K        +       + +      
Sbjct  80   TEYRKKVGMVFQKPTPFPMSIYDNVAFGPRIHGTKSKHVLDRIVEESLKKAALWDEVKSE  139

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             NKPG +LS GQ QR+ +AR LA EPEV+LLDEPTSALDPI+TQ IE +L  L   +  T
Sbjct  140  LNKPGTKLSGGQQQRLCIARALAVEPEVILLDEPTSALDPIATQRIEKLLEELS--ENYT  197

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            I +V+H+I Q  RIAD +  +  GE+VE
Sbjct  198  IVIVTHNIGQAIRIADYIAFMYRGELVE  225



>ref|WP_012058019.1| phosphate ABC transporter ATP-binding protein [Thermosipho melanesiensis]
 ref|YP_001307046.1| phosphate ABC transporter ATP-binding protein [Thermosipho melanesiensis 
BI429]
 gb|ABR31661.1| phosphate ABC transporter, ATPase subunit [Thermosipho melanesiensis 
BI429]
Length=250

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 135/227 (59%), Gaps = 16/227 (7%)
 Frame = +1

Query  283  LLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDICD--L  441
            ++  ++ DI +  I  IIGPSG GKST LR++NR+ +          ++ +GKDI D  +
Sbjct  18   VVKNVSFDIFKNKITAIIGPSGCGKSTLLRSVNRINDNIPGFKIEGNIYFEGKDIYDGDV  77

Query  442  DVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF----  609
            DV  LR K+GM+FQ P  F  ++ DN+ +G  + G K  +     +       + +    
Sbjct  78   DVTILRKKIGMVFQKPVPFPMSIYDNVSFGLKIHGIKRKEKLDEIVEKSLKQAALWDEVR  137

Query  610  --CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKR  783
               N+P  ELS GQ QR+ +ARTLA +PEVLLLDEPTSALDPI+TQ IE +L +L   + 
Sbjct  138  QELNEPASELSGGQQQRLCIARTLAIQPEVLLLDEPTSALDPIATQKIEALLEKL--SEF  195

Query  784  MTIAMVSHSIKQIQRIADVVCLLVEGEIVEVL-KPDQLSQAKHPMAQ  921
             TIA+V+H++ Q  RI+D V  + +GE++E    P  + + +H + +
Sbjct  196  YTIAIVTHNLSQAIRISDYVAFMYQGELIEFADTPTIVKKPQHKLTE  242



>ref|WP_006308556.1| phosphate ABC transporter ATP-binding protein [Facklamia languida]
 gb|EHR37900.1| phosphate ABC transporter, ATP-binding protein [Facklamia languida 
CCUG 37842]
Length=253

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 129/230 (56%), Gaps = 16/230 (7%)
 Frame = +1

Query  223  AAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE---  393
            A  TK  +K L         L N I++DI   L+   IGPSG GKSTFL+ LNR+ +   
Sbjct  2    ANNTKFLIKDLDFYYGDFHALKN-ISMDIQENLVTAFIGPSGCGKSTFLKILNRMQDLTP  60

Query  394  --PANATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSD  561
                  +V LDG DI D  +DV  LR +VGM+FQ P  F  ++ DNI YGP   G K  D
Sbjct  61   GTKVKGSVQLDGMDIYDKRMDVNDLRKRVGMVFQQPNPFPKSIYDNIAYGPRTHGIKDKD  120

Query  562  dqvlrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSAL  723
                 +       + +       ++    +S GQ QR+ +AR +ANEPEV+L+DEPTSAL
Sbjct  121  RLDQIVEESLRGAAIWDEVKDKLHQDATAVSGGQQQRICIARAIANEPEVILMDEPTSAL  180

Query  724  DPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            DPIST  IED++  LK   + T+ +V+H+++Q  RI+D      EG +VE
Sbjct  181  DPISTNKIEDLVHDLK--SKYTVVIVTHNMQQAARISDKTAFFYEGVVVE  228



>ref|WP_022438357.1| putative uncharacterized protein [Clostridium sp. CAG:411]
 emb|CDE45953.1| putative uncharacterized protein [Clostridium sp. CAG:411]
Length=250

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 133/232 (57%), Gaps = 15/232 (6%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            KI V+ L    D+    L  I ++IP   I   IGPSG GKSTFL++LNR+ +       
Sbjct  4    KITVENLQLFYDQ-FHALKDINMNIPERQITAFIGPSGCGKSTFLKSLNRMNDLVEGCKI  62

Query  400  NATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlr  576
               V LDG+DI   +DV +LR +VGM+FQ P  F  +V DNI YGP   G K  +     
Sbjct  63   TGNVRLDGEDIYGKMDVNTLRKRVGMVFQNPNPFPMSVYDNIAYGPRTHGIKKREQLDAI  122

Query  577  llsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST  738
            +       + +        K    LS GQ QR+ +AR LA EPEV+L+DEPTSALDPIST
Sbjct  123  VEKSLKQAAIWDELKDRLKKSALGLSGGQQQRLCIARALAVEPEVILMDEPTSALDPIST  182

Query  739  QNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
              IED+ + LKK+   TI MV+H+++Q  RI+D     + G++VE  + D+L
Sbjct  183  SKIEDLTLELKKD--FTIIMVTHNMQQATRISDNTAFFLLGQVVEYDRTDKL  232



>emb|CEA13097.1| Phosphate import ATP-binding protein PstB [Methanobacterium formicicum]
 gb|AIS31599.1| phosphate transport system ATP-binding protein PstB [Methanobacterium 
formicicum]
Length=251

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 135/226 (60%), Gaps = 16/226 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            +I+V+ L    D+ L +L  ++L IP+  +  +IGPSG GKSTF+R LNR+ +       
Sbjct  4    RIEVEDLNVYFDE-LHILKDVSLKIPKNAVTSLIGPSGCGKSTFIRTLNRMNDMISTFKM  62

Query  400  NATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
              TV LDGKDI D  +DV+ LR KVGM+FQ P  F  ++ DN+ YG  + G    D    
Sbjct  63   EGTVLLDGKDIYDPKIDVVELRKKVGMVFQKPNPFPKSIFDNVAYGLRVHGISDKDVLAQ  122

Query  574  rllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
            ++       + +       +K    LS GQ QR+ +ART+A EPEV+L+DEP SALDPIS
Sbjct  123  KVEESLKGAALWDEVKNILDKSAMGLSGGQQQRLCIARTIAVEPEVILMDEPCSALDPIS  182

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            T  +ED++ +LK +   TI +V+H+++Q  R++      + GEIVE
Sbjct  183  TTKVEDLIHKLKND--FTIIIVTHNMQQATRVSKHTAFFLNGEIVE  226



>ref|WP_008881428.1| glycine/betaine ABC transporter ATPase [Geobacillus sp. G11MC16]
 gb|EDY04753.1| glycine betaine/L-proline ABC transporter, ATPase subunit [Geobacillus 
sp. G11MC16]
Length=377

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 136/223 (61%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  I L+I +G ++ +IGPSG GK+T +R +NRL EP +  V++
Sbjct  2    IRFENVTKQYEDGFVALKNINLEIRKGELVALIGPSGCGKTTTMRMINRLIEPTSGKVYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRG---KKLSDdqvlrlls  585
            DG+DI +LD + LR  +G + Q   LF   T+A+NI   P L+              L  
Sbjct  62   DGQDISELDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKHAYEKRVDELLEL  121

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP+++L+DEP SALDPIS + ++D ++R
Sbjct  122  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPDIILMDEPFSALDPISREQLQDDIIR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E   TI  V+H + +  +IAD + L+ +GEIV+   PDQ+
Sbjct  182  LQEEIHKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPDQM  224



>ref|WP_011886704.1| glycine/betaine ABC transporter ATPase [Geobacillus thermodenitrificans]
 ref|YP_001124405.1| glycine betaine/carnitine/choline ABC transporter ATP-binding 
protein [Geobacillus thermodenitrificans NG80-2]
 gb|ABO65660.1| Glycine betaine/carnitine/choline ABC transporter ATP-binding 
protein [Geobacillus thermodenitrificans NG80-2]
Length=377

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 136/223 (61%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  I L+I +G ++ +IGPSG GK+T +R +NRL EP +  V++
Sbjct  2    IRFENVTKQYEDGFVALKNINLEIRKGELVALIGPSGCGKTTTMRMINRLIEPTSGKVYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRG---KKLSDdqvlrlls  585
            DG+DI +LD + LR  +G + Q   LF   T+A+NI   P L+              L  
Sbjct  62   DGQDISELDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKHAYEKRVDELLEL  121

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP+++L+DEP SALDPIS + ++D ++R
Sbjct  122  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPDIILMDEPFSALDPISREQLQDDIIR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E   TI  V+H + +  +IAD + L+ +GEIV+   PDQ+
Sbjct  182  LQEEIHKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPDQM  224



>ref|WP_012311192.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Thermotoga]
 ref|YP_001739578.1| phosphate ABC transporter ATP-binding protein [Thermotoga sp. 
RQ2]
 ref|YP_002534854.1| phosphate ABC transporter ATP-binding protein [Thermotoga neapolitana 
DSM 4359]
 gb|ACB09895.1| phosphate ABC transporter, ATPase subunit [Thermotoga sp. RQ2]
 gb|ACM23488.1| Phosphate import ATP-binding protein pstB [Thermotoga neapolitana 
DSM 4359]
Length=251

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 122/209 (58%), Gaps = 15/209 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEP-----ANATVFLDGKDICD--LD  444
            +  +T+ I +  I  IIGPSG GK+T LR++NR+ +          ++  G+DI D  LD
Sbjct  20   VKNVTMKIFKNQITAIIGPSGCGKTTLLRSINRMNDHIPGFRVEGKIYFKGQDIYDPKLD  79

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF-----  609
            V   R KVGM+FQ P  F  ++ DN+ +GP + G K        +       + +     
Sbjct  80   VTEYRKKVGMVFQKPTPFPMSIYDNVAFGPRIHGTKSKHVLDRIVEESLKKAALWDEVKS  139

Query  610  -CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRM  786
              NKPG +LS GQ QR+ +AR LA EPEV+LLDEPTSALDPI+TQ IE +L  L   +  
Sbjct  140  ELNKPGTKLSGGQQQRLCIARALAVEPEVILLDEPTSALDPIATQRIEKLLEELS--ENY  197

Query  787  TIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            TI +V+H+I Q  RIAD +  +  GE+VE
Sbjct  198  TIVIVTHNIGQAIRIADYIAFMYRGELVE  226



>ref|WP_011229819.1| MULTISPECIES: glycine/betaine ABC transporter ATPase [Geobacillus]
 ref|YP_146167.1| glycine betaine/carnitine/choline ABC transporter ATP-binding 
protein [Geobacillus kaustophilus HTA426]
 ref|YP_004980826.1| glycine betaine/L-proline ABC transporter, ATPase subunit [Geobacillus 
thermoleovorans CCB_US3_UF5]
 dbj|BAD74599.1| glycine betaine/carnitine/choline ABC transporter (ATP-binding 
protein) [Geobacillus kaustophilus HTA426]
 gb|AEV17726.1| Glycine betaine/L-proline ABC transporter, ATPase subunit [Geobacillus 
thermoleovorans CCB_US3_UF5]
 dbj|GAD15080.1| glycine betaine/carnitine/choline ABC transporter ATP-binding 
protein [Geobacillus kaustophilus GBlys]
 gb|EQB94357.1| glycine/betaine ABC transporter ATPase [Geobacillus sp. A8]
 gb|ESU73658.1| glycine/betaine ABC transporter ATPase [Geobacillus sp. MAS1]
 dbj|GAJ60341.1| glycine betainecarnitinecholine ABC transporter ATP-binding protein 
[Geobacillus thermoleovorans B23]
Length=375

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 135/223 (61%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  I L+I +G ++ +IGPSG GK+T +R +NRL EP +  V++
Sbjct  2    IRFENVTKQYEDGFVALKNINLEIRKGELVALIGPSGCGKTTTMRMINRLIEPTSGKVYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRG---KKLSDdqvlrlls  585
            DG+DI  LD + LR  +G + Q   LF   T+A+NI   P L+              L  
Sbjct  62   DGQDISQLDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKHAYEKRVDELLEL  121

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP+++L+DEP SALDPIS + ++D +VR
Sbjct  122  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPDIILMDEPFSALDPISREQLQDDIVR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E   TI  V+H + +  +IAD + L+ +GEIV+   PDQ+
Sbjct  182  LQEEIHKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPDQM  224



>ref|WP_011498866.1| phosphate ABC transporter ATP-binding protein [Methanococcoides 
burtonii]
 ref|YP_565460.1| ABC phosphate transporter, ATPase subunit [Methanococcoides burtonii 
DSM 6242]
 sp|Q12XW6.1|PSTB_METBU RecName: Full=Phosphate import ATP-binding protein PstB; AltName: 
Full=ABC phosphate transporter; AltName: Full=Phosphate-transporting 
ATPase [Methanococcoides burtonii DSM 6242]
 gb|ABE51710.1| Phosphate import ABC transporter ATPase subunit [Methanococcoides 
burtonii DSM 6242]
Length=255

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 129/221 (58%), Gaps = 26/221 (12%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDICD--LD  444
            L  I+LDIP   +  +IGPSG GKSTFLR LNR+ +          V +DG++I D  +D
Sbjct  25   LKDISLDIPEKSVTALIGPSGCGKSTFLRCLNRMNDLVKSCSIEGEVLVDGENIYDKDVD  84

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG-----------KKLSDdqvlrllsla  591
            V+ LR  VGM+FQ P  F  ++ DNI YGP + G           K L D  ++  +   
Sbjct  85   VVDLRKNVGMVFQKPNPFPMSIYDNIAYGPKIHGCSKSETEERVHKALDDAALMGEVQDR  144

Query  592  dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLK  771
              D +F       LS GQ QR+ +ARTLA +PE+LL DEP SALDPIST  IED+++ LK
Sbjct  145  LGDQAF------SLSGGQQQRLCIARTLAVKPEILLFDEPCSALDPISTSKIEDLILELK  198

Query  772  KEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            K+   TI +V+H+++Q  RI+D     + GEI+E  K   +
Sbjct  199  KD--YTIVIVTHNMQQAARISDHTAFFLHGEIIEFGKTKHI  237



>ref|WP_006701710.1| phosphate ABC transporter ATP-binding protein [Facklamia ignava]
 gb|EKB55576.1| phosphate import ATP-binding protein PstB [Facklamia ignava CCUG 
37419]
Length=252

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 126/210 (60%), Gaps = 15/210 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANAT-----VFLDGKDICD--LD  444
            L++I +DI   L+  +IGPSG GKSTFL+ LNR+ +    T     V LDG+DI     D
Sbjct  21   LHKINMDIEEKLVTALIGPSGCGKSTFLKILNRMQDLIPGTRVEGDVLLDGQDIFQKGYD  80

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF-----  609
            V  LR +VGM+FQ P  F  ++ DNI YGP   G K S +    +       + +     
Sbjct  81   VNQLRKQVGMVFQHPNPFPKSIYDNIAYGPRTHGIKDSTELDRIVEESLKSAAIWDEVKD  140

Query  610  -CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRM  786
              +KP   +S GQ QR+ +AR +AN+PEVLL+DEPTSALDPIST  IE+++  LK  K  
Sbjct  141  KLDKPATAISGGQQQRICIARAIANQPEVLLMDEPTSALDPISTGKIEELIEELK--KTY  198

Query  787  TIAMVSHSIKQIQRIADVVCLLVEGEIVEV  876
            T+ +V+H+++Q  RI+D     + GE++E 
Sbjct  199  TVVIVTHNMQQAARISDKTAFFLTGEMIEF  228



>ref|WP_033009966.1| glycine/betaine ABC transporter ATP-binding protein [Geobacillus 
stearothermophilus]
 gb|KFL16164.1| glycine/betaine ABC transporter ATP-binding protein [Geobacillus 
stearothermophilus]
 gb|KFX36190.1| glycine/betaine ABC transporter ATP-binding protein [Geobacillus 
stearothermophilus]
Length=375

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 137/223 (61%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  I L+I +G ++ +IGPSG GK+T +R +NRL EP +  V++
Sbjct  2    IRFENVTKQYEDGFVALKNINLEIRKGELVALIGPSGCGKTTTMRMINRLIEPTSGKVYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRGKK---LSDdqvlrlls  585
            DG+DI  LD + LR  +G + Q   LF   T+A+NI   P L+  +           L  
Sbjct  62   DGQDISQLDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKHVYEKRVDELLEL  121

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP+++L+DEP SALDPIS + ++D +VR
Sbjct  122  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPDIILMDEPFSALDPISREQLQDDIVR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E + TI  V+H + +  +IAD + L+ +GEIV+   PDQ+
Sbjct  182  LQEEIQKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPDQM  224



>gb|AHI25216.1| phosphate transporter ATP-binding protein [Komagataeibacter xylinus 
E25]
Length=265

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 131/222 (59%), Gaps = 17/222 (8%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLW-----EPANATVFLDGKDICD--LD  444
            L  I+LD P   + G+IGPSG GKST LR LNR++     + A   V  DG++I    LD
Sbjct  34   LKDISLDFPVHQVTGMIGPSGCGKSTLLRVLNRMYDLYPGQRATGEVLFDGRNILSPGLD  93

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNK--  618
            V  LR ++GM+FQ P  F  ++ DNI +G  L  ++LS   + + +       +  N+  
Sbjct  94   VNVLRSRIGMVFQKPTPFPMSIYDNIAFGVRLH-ERLSRADMDQRVESVLRRVALWNEVK  152

Query  619  -----PGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKR  783
                     LS GQ QR+ +ART+A  PEV+LLDEPTSALDPIST  IE++L  LK+E  
Sbjct  153  DRLNASAAALSGGQQQRLCIARTIATRPEVILLDEPTSALDPISTARIEELLDELKQE--  210

Query  784  MTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKH  909
             +IA+V+H+++Q  R AD V     GE+VEV   D++  A H
Sbjct  211  FSIAIVTHNLQQAARCADRVAFFYMGELVEVDTADKMFTAPH  252



>ref|WP_003494413.1| phosphate ABC transporter ATP-binding protein [Clostridium sporogenes]
 gb|EHN14431.1| phosphate transporter ATP-binding protein [Clostridium sporogenes 
PA 3679]
 gb|KCZ67037.1| phosphate import ATP-binding protein PstB [Clostridium sporogenes]
 gb|AJD32031.1| phosphate ABC transporter, ATP-binding protein [Clostridium botulinum 
Prevot_594]
Length=249

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 130/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-----TVFLDGKDIC-DLDV  447
            L  I +DI +  +  +IGPSG GKSTFLR LNR+ +  ++     +V+ + KDI  D DV
Sbjct  19   LKNINIDIEKNKVTALIGPSGCGKSTFLRTLNRMNDLIDSVKIEGSVYYEEKDIYKDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR K+GM+FQ P  F  ++ DNI YGP + G K  +     +       + +      
Sbjct  79   IDLRKKIGMVFQNPNPFPMSIYDNIAYGPRIHGIKTKEKLDEIVEKSLKGAALWEEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +ARTLA EP++LL+DEPTSALDPIST  IE+++  LK   + T
Sbjct  139  LKKNALGLSGGQQQRLCIARTLAVEPKILLMDEPTSALDPISTLKIEELMNELK--NKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            + +V+H+++Q  RI+D     + GEI+EV K ++L
Sbjct  197  VIIVTHNMQQAGRISDNTAFFLNGEIIEVGKTEEL  231



>ref|WP_022024271.1| phosphate ABC transporter [Clostridium sp. CAG:75]
 emb|CCZ55475.1| phosphate ABC transporter [Clostridium sp. CAG:75]
Length=267

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 131/236 (56%), Gaps = 15/236 (6%)
 Frame = +1

Query  223  AAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPA-  399
            A+ TK  V GL    DK    L  I +DIP   I   IGPSG GKSTFL++LNR+ +   
Sbjct  17   ASDTKFHVAGLDLYYDK-FHALKDINIDIPEKQITAFIGPSGCGKSTFLKSLNRMNDLVE  75

Query  400  ----NATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDd  564
                   V L  +DI  D+D+  LR +VGM+FQ P  F  ++ DNI YGP   G      
Sbjct  76   GCRITGEVKLGEQDIYGDIDINHLRKRVGMVFQNPNPFPMSIYDNIAYGPRTHGIHSKQK  135

Query  565  qvlrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALD  726
              + +       + +        K    LS GQ QR+ +AR LA EPEV+L+DEPTSALD
Sbjct  136  LDVIVEKSLRQAAIWDELKDRLKKSALGLSGGQQQRLCIARALAVEPEVILMDEPTSALD  195

Query  727  PISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            PIST  IED+ + LKK+   TI MV+H+++Q  RI+D     + GE+VE    D+L
Sbjct  196  PISTSRIEDLAIELKKD--YTIIMVTHNMQQATRISDRTAFFLLGEMVEYGATDKL  249



>ref|WP_013787856.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Thermoanaerobacterium]
 ref|YP_004470786.1| phosphate ABC transporter ATPase [Thermoanaerobacterium xylanolyticum 
LX-11]
 ref|YP_006392193.1| phosphate ABC transporter ATPase [Thermoanaerobacterium saccharolyticum 
JW/SL-YS485]
 gb|AEF17114.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacterium 
xylanolyticum LX-11]
 gb|AFK86594.1| phosphate ABC transporter, ATPase subunit [Thermoanaerobacterium 
saccharolyticum JW/SL-YS485]
 gb|ETO38392.1| phosphate ABC transporter ATPase [Thermoanaerobacterium aotearoense 
SCUT27]
Length=249

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 136/232 (59%), Gaps = 15/232 (6%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            KI+V+ L     + +  L +I +D+    +M +IGPSG GKSTFLR LNR+ +       
Sbjct  3    KIEVRDLDLFYGQ-MQALKKINIDVEENSVMALIGPSGCGKSTFLRTLNRMNDLIDGVTI  61

Query  400  NATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlr  576
              TV +D ++I  D+D + LR +VGM+FQ P  F  T+ DNI YGP + G+K        
Sbjct  62   KGTVMIDNQNIYKDVDAIELRKRVGMVFQKPNPFPMTIYDNIAYGPRIHGQKNKKILNEI  121

Query  577  llsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST  738
            +       + +       N     LS GQ QR+ +ARTLA EPE++L+DEPTSALDPIST
Sbjct  122  VEKSLKDAALWDEVKDRLNDSALGLSGGQQQRLCIARTLAIEPEIILMDEPTSALDPIST  181

Query  739  QNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
              IE+++ +LK   + TI +V+H+++Q  R++D     + GEI+E  K + +
Sbjct  182  MKIEELIDQLK--NKYTIVIVTHNMQQAGRVSDSTSFFLNGEIIETGKTEDI  231



>ref|WP_006303385.1| phosphate ABC transporter ATP-binding protein [Atopobium vaginae]
 gb|EGF22849.1| phosphate ABC transporter, ATP-binding protein [Atopobium vaginae 
DSM 15829]
Length=299

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/240 (41%), Positives = 138/240 (58%), Gaps = 16/240 (7%)
 Frame = +1

Query  229  GTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-  405
             TK+ +  L  V       L  ITLDI    ++ +IGPSG GKSTFLR LNR+ +  ++ 
Sbjct  50   STKMHISHLN-VFYGATHALQNITLDIYNHSVLALIGPSGCGKSTFLRCLNRMNDTLSSA  108

Query  406  ----TVFLDGKDIC--DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG--KKLS-  558
                 V LDGKDI   + +V+ LR +VGM+FQ P  F  ++ DN+ YGP + G  KK S 
Sbjct  109  RISGNVLLDGKDIYAPNSNVIRLRKRVGMVFQQPNPFPMSIYDNVEYGPRVHGITKKSSL  168

Query  559  ---DdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDP  729
                 + L+  ++ +      N     LS GQ QR+ +AR LA EPEVLL+DEPTSALDP
Sbjct  169  DEIVTRSLQRAAIYNEVKDHLNDSALSLSGGQQQRLCIARALAVEPEVLLMDEPTSALDP  228

Query  730  ISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKH  909
            IST  IE+++  LK+    T+ +V+H+++Q  R++D     + GE+VE     QL    H
Sbjct  229  ISTAKIEELIASLKEH--YTVVIVTHNMQQAARVSDYTAFFLLGEMVETNSTYQLFHEPH  286



>ref|WP_003537096.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Erysipelotrichaceae]
 gb|EDS18662.1| phosphate ABC transporter, ATP-binding protein [Erysipelatoclostridium 
ramosum DSM 1402]
 gb|EEO32992.1| phosphate import ATP-binding protein PstB 2 [Coprobacillus sp. 
D7]
 gb|EHM89951.1| phosphate import ATP-binding protein PstB 2 [Coprobacillus sp. 
3_3_56FAA]
 emb|CCZ31490.1| phosphate import ATP-binding protein PstB 2 [Coprobacillus sp. 
CAG:183]
Length=251

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 133/232 (57%), Gaps = 20/232 (9%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPA----  399
             KI+ K L     +   L N ++LDI    I   IGPSG GKSTFL+ LNR+ +      
Sbjct  3    NKIEAKNLDLYYGEKHALKN-VSLDIKTNKITAFIGPSGCGKSTFLKTLNRMNDYVKDIK  61

Query  400  -NATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKK------  552
               +V LDG+DI D  +D   LR KVGM+FQ P  F  ++ DNI YGP + G K      
Sbjct  62   ITGSVVLDGEDIYDSRVDTTVLRKKVGMVFQQPNPFPMSIYDNIAYGPRIHGIKNKKQLD  121

Query  553  --LSDdqvlrllsladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALD  726
              + D      L     D    +  G  LS GQ QR+ +AR LA EP+V+LLDEPTSALD
Sbjct  122  KIVKDSLEAAALYEEVKDRLHSSALG--LSGGQQQRLCIARALAVEPDVILLDEPTSALD  179

Query  727  PISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            PIST  IE++L+ LK  ++ TIA+V+H+++Q  RIAD     + GE+VE  K
Sbjct  180  PISTLKIEELLMELK--EKYTIAIVTHNMQQASRIADYTAFFLVGEMVEYGK  229



>ref|WP_013522855.1| MULTISPECIES: glycine/betaine ABC transporter ATPase [Geobacillus]
 ref|YP_003252310.1| glycine betaine/L-proline ABC transporter ATPase [Geobacillus 
sp. Y412MC61]
 ref|YP_004130945.1| glycine betaine/L-proline ABC transporter ATPase [Geobacillus 
sp. Y412MC52]
 gb|ACX77828.1| glycine betaine/L-proline ABC transporter, ATPase subunit [Geobacillus 
sp. Y412MC61]
 gb|ADU92802.1| glycine betaine/L-proline ABC transporter, ATPase subunit [Geobacillus 
sp. Y412MC52]
Length=375

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 135/223 (61%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  I L++ +G ++ +IGPSG GK+T +R +NRL EP +  V++
Sbjct  2    IRFENVTKQYEDGFVALKNINLEVRKGELVALIGPSGCGKTTTMRMINRLIEPTSGKVYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRG---KKLSDdqvlrlls  585
            DG+DI  LD + LR  +G + Q   LF   T+A+NI   P L+              L  
Sbjct  62   DGQDISQLDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKHAYEKRVDELLEL  121

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP+++L+DEP SALDPIS + ++D +VR
Sbjct  122  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPDIILMDEPFSALDPISREQLQDDIVR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E   TI  V+H + +  +IAD + L+ +GEIV+   PDQ+
Sbjct  182  LQEEIHKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPDQM  224



>ref|WP_028828552.1| glycine/betaine ABC transporter ATP-binding protein [Proteocatella 
sphenisci]
Length=373

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 142/229 (62%), Gaps = 6/229 (3%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+V D G   LN I L+I +  +M +IGPSGSGK+T ++ +NRL EP    +++
Sbjct  2    IKFENVTKVYDDGFKALNNINLEIKKAELMVLIGPSGSGKTTTMKMINRLIEPTEGNIYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRGKK---LSDdqvlrlls  585
            +GK I + + + LR  +G + Q   LF   T+++N+   P L+ +     ++     L  
Sbjct  62   NGKSIMEQNPVKLRRDIGYVIQQIGLFPHMTISENVALVPKLKKEDPAVYTEKVNELLDM  121

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +      + N+   ELS GQ QR+ + R LA++P ++L+DEP SALDPIS + ++D LV+
Sbjct  122  VGLDPEIYQNRYPNELSGGQQQRIGVIRALASDPSIILMDEPFSALDPISREQLQDELVK  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKHP  912
            L+++ + TI  V+H + +  +IAD +C++ +GEIV++  PD++   +HP
Sbjct  182  LQEDIKKTIVFVTHDMDEALKIADRICIMKDGEIVQIGTPDRI--LRHP  228



>gb|KGO13471.1| phosphate ABC transporter ATP-binding protein [Clostridium botulinum]
Length=249

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 129/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-----TVFLDGKDIC-DLDV  447
            L  I++DI +  +  +IGPSG GKSTFLR LNR+ +  ++     +V+ +GKDI    DV
Sbjct  19   LKNISIDIEKNKVTALIGPSGCGKSTFLRTLNRMNDLIDSVKIEGSVYYEGKDIYKHYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR K+GM+FQ P  F  ++ DNI YGP + G K        +       + +      
Sbjct  79   IDLRKKIGMVFQSPNPFPMSIYDNIAYGPRIHGIKTKGKLDEIVEKSLKGGALWEEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +ARTLA EPE+LL+DEPTSALDPIST  IE+++  LK   + T
Sbjct  139  LKKNALGLSGGQQQRLCIARTLAVEPEILLMDEPTSALDPISTLKIEELMDELK--NKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            + +V+H+++Q  RI+D     + GEI+EV K  +L
Sbjct  197  VIIVTHNMQQAGRISDNTAFFLNGEIIEVGKTGEL  231



>ref|WP_027293996.1| phosphate ABC transporter ATP-binding protein [Robinsoniella 
sp. KNHs210]
Length=254

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 132/229 (58%), Gaps = 19/229 (8%)
 Frame = +1

Query  259  RVSDKGLTL-----LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANAT  408
            RV D  L       LN+I ++IP+  I+  IGPSG GKSTFL+ +NR+ +          
Sbjct  10   RVEDLNLYYGDFKALNKINMNIPKNEIVAFIGPSGCGKSTFLKTINRMNDLIEGVKVEGK  69

Query  409  VFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrlls  585
            ++LD  DI  D+DV+ LR +VGM+FQ P  F  ++ DN+ YGP + G K   +    +  
Sbjct  70   IYLDDVDIYGDIDVIKLRQRVGMVFQQPNPFPMSIYDNVAYGPRIHGIKKKQELDEIVER  129

Query  586  ladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNI  747
                 + +        K    +S GQ QR+ +AR LA EPEV+L+DEPTSALDPIST  I
Sbjct  130  SLKQAAIWDEAKDRLKKNALGMSGGQQQRICIARALAVEPEVILMDEPTSALDPISTLKI  189

Query  748  EDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            ED+ V LK  ++ TI +V+H+++Q  RI+D     + G++VE     Q+
Sbjct  190  EDLAVELK--EKYTIVIVTHNMQQASRISDKTAFFLTGDVVEYGNTTQI  236



>ref|WP_013798447.1| phosphate ABC transporter ATP-binding protein [Methanotorris 
igneus]
 ref|YP_004483903.1| phosphate ABC transporter ATPase [Methanotorris igneus Kol 5]
 gb|AEF95838.1| phosphate ABC transporter, ATPase subunit [Methanotorris igneus 
Kol 5]
Length=252

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 128/216 (59%), Gaps = 15/216 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDICD--LD  444
            L  I + I    I  IIGPSG GKSTFLR LNR+ +          V+LDGK+I D  +D
Sbjct  21   LKNINMPIYENRITAIIGPSGCGKSTFLRCLNRMNDLIPNVRIKGEVYLDGKNIYDKDVD  80

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF-----  609
            V++LR +VGM+FQ P  F  ++ DN+ YGP + G K  D     +       + +     
Sbjct  81   VVALRKRVGMVFQKPNPFPMSIYDNVAYGPRIHGIKDKDKLDEIVEWALKKAALWDEVKD  140

Query  610  -CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRM  786
               K    LS GQ QR+ +AR +A +PEV+L+DEP SALDPIST  IED++V LKK+   
Sbjct  141  DLKKSALRLSGGQQQRLCIARAIAVKPEVILMDEPCSALDPISTLKIEDLMVELKKD--Y  198

Query  787  TIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            TI +V+H+++Q  R++D     + GE+VE  K +++
Sbjct  199  TIVIVTHNMQQASRVSDYTAFFMMGELVEFDKTEKI  234



>ref|WP_028044787.1| phosphate ABC transporter ATP-binding protein [Candidatus Stoquefichus 
massiliensis]
Length=251

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 129/212 (61%), Gaps = 15/212 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPAN-----ATVFLDGKDICD--LD  444
            L  ++LDI    I   IGPSG GKSTFL+ LNR+ +  N      +V LD ++I D  +D
Sbjct  20   LKDVSLDIVENKITAFIGPSGCGKSTFLKTLNRMNDYVNNVKVSGSVLLDDENIYDSRVD  79

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG---KKLSDdqvlrllsladldssFCN  615
               LR KVGM+FQ P  F  ++ DNI YGP + G   KK  D  V + L  A L     +
Sbjct  80   TTILRKKVGMVFQQPNPFPMSIYDNIAYGPRIHGIKNKKQLDIIVEKSLKAAALYDEVAD  139

Query  616  KPGGE---LSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRM  786
            +       LS GQ QR+ +AR LA EPEV+LLDEPTSALDPIST  IE++L+ LK  K+ 
Sbjct  140  RLHSSALGLSGGQQQRLCIARCLAVEPEVILLDEPTSALDPISTLKIEELLMELK--KKY  197

Query  787  TIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            TIA+V+H+++Q  RIAD     + GE+VE  K
Sbjct  198  TIAIVTHNMQQASRIADFTAFFLVGEMVEYGK  229



>ref|WP_033006926.1| MULTISPECIES: glycine/betaine ABC transporter ATP-binding protein 
[Geobacillus]
 gb|KDE50374.1| glycine/betaine ABC transporter ATP-binding protein [Geobacillus 
sp. CAMR5420]
Length=375

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 136/223 (61%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  + L+I +G ++ +IGPSG GK+T +R +NRL EP +  V++
Sbjct  2    IRFENVTKQYEDGFVALKNMNLEIRKGELVALIGPSGCGKTTTMRMINRLIEPTSGKVYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRG---KKLSDdqvlrlls  585
            DG+DI +LD + LR  +G + Q   LF   T+A+NI   P L+              L  
Sbjct  62   DGQDISELDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKHAYEKRVDELLEL  121

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP ++L+DEP SALDPIS + ++D +VR
Sbjct  122  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPNIILMDEPFSALDPISREQLQDDIVR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E + TI  V+H + +  +IAD + L+ +GEIV+   PDQ+
Sbjct  182  LQEEIQKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPDQM  224



>ref|WP_004836897.1| phosphate ABC transporter ATP-binding protein [Anaerococcus tetradius]
 gb|EEI81959.1| phosphate ABC transporter, ATP-binding protein [Anaerococcus 
tetradius ATCC 35098]
Length=263

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 125/213 (59%), Gaps = 15/213 (7%)
 Frame = +1

Query  277  LTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANAT-----VFLDGKDIC--  435
               L  I +DI +G +   IGPSG GKST LR  NR+ +  +A      + +DG+DI   
Sbjct  29   FNALKNINMDIKKGRVTAFIGPSGCGKSTMLRCFNRMNDLVDACKIDGLITIDGEDIYKK  88

Query  436  DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF--  609
            D+DV+ LR KVGM+FQ P  F  ++ DNI YGP + G K  D+    +       + +  
Sbjct  89   DVDVVQLRRKVGMVFQAPNPFSKSIYDNISYGPKISGIKNKDELDYIVEKSLKAAAIWDE  148

Query  610  ----CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKE  777
                 N+     S GQ QR+ +ARTL+  P+++L+DEPTSALDPIST  IED++  LK E
Sbjct  149  VKDKLNQNALAFSGGQQQRICIARTLSVNPKIILMDEPTSALDPISTSAIEDLMDGLKNE  208

Query  778  KRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEV  876
               TI +V+H+++Q  RI+D     + GE+VE+
Sbjct  209  --YTIVIVTHNMQQAARISDQTAFFLTGEVVEM  239



>gb|AIY89491.1| Phosphate transport ATP-binding protein PstB [Geoglobus acetivorans]
Length=227

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 133/214 (62%), Gaps = 0/214 (0%)
 Frame = +1

Query  256  TRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFLDGKDIC  435
             R + KG  +L  + L + +  +M I GPSGSGKST LR +NRL E  +  + +DG  I 
Sbjct  7    VRKNIKGKEILRGVNLTVAKKEVMVIAGPSGSGKSTLLRCINRLTEIDDGEILIDGISIR  66

Query  436  DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCN  615
            D D + LR  VGM+ Q P +FEG+V +NI +G     K  S +  +  L+         +
Sbjct  67   DYDPIRLRRIVGMVSQFPVMFEGSVRENIAWGLKHFSKDGSIEWTVEKLAAEIGIGDLLD  126

Query  616  KPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIA  795
            +  G+LS G+ QRVA+ARTLA +PE+LLLDEPT++LDP + + IE+++++L + + +T+ 
Sbjct  127  EDAGKLSGGEQQRVAIARTLALKPEILLLDEPTASLDPENARKIENLILKLVRARELTVL  186

Query  796  MVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLS  897
             V+H ++Q +RI D V ++  G IV +  P ++S
Sbjct  187  WVTHDVEQAKRIGDRVAVMKAGRIVAINVPGRVS  220



>ref|WP_010507524.1| phosphate ABC transporter ATP-binding protein [Komagataeibacter 
europaeus]
Length=265

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 132/222 (59%), Gaps = 17/222 (8%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLW-----EPANATVFLDGKDICD--LD  444
            L  I+LD P   + G+IGPSG GKST LR LNR++     + A   V  DG++I    LD
Sbjct  34   LKDISLDFPIHQVTGMIGPSGCGKSTLLRILNRMYDLYPGQRATGEVLFDGRNILSPGLD  93

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNK--  618
            V  LR ++GM+FQ P  F  ++ DNI +G  L  ++LS  ++ + +       +  N+  
Sbjct  94   VNVLRSRIGMVFQKPTPFPMSIYDNIAFGVRLH-ERLSRTEMDQRVEGVLRRVALWNEVK  152

Query  619  -----PGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKR  783
                     LS GQ QR+ +ART+A  PEV+LLDEPTSALDPIST  IE++L  LK+E  
Sbjct  153  DRLNASAAALSGGQQQRLCIARTIATRPEVILLDEPTSALDPISTARIEELLDELKQE--  210

Query  784  MTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKH  909
             +IA+V+H+++Q  R AD V     GE+VEV   D++  A H
Sbjct  211  FSIAIVTHNLQQAARCADRVAFFYMGELVEVDTADKMFTAPH  252



>dbj|BAM70829.1| phosphate ABC transporter ATP-binding subunit [Methanothermobacter 
thermautotrophicus CaT2]
Length=250

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 133/226 (59%), Gaps = 16/226 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            +I+V+ L    D+   +L  I L IP+  +  +IGPSG GKSTF+R LNR+ +       
Sbjct  3    RIEVEDLNVYFDEA-HILKDINLKIPKNTVTALIGPSGCGKSTFIRTLNRMNDVISGFRH  61

Query  400  NATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
               V+LDGKDI D  +DV+ LR KVGM+FQ P  F  ++ +N+ YG  + G    D    
Sbjct  62   EGHVYLDGKDIYDPDMDVVELRKKVGMVFQKPNPFPKSIFENVAYGLRVHGYDDRDFIEE  121

Query  574  rllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
            R+       + +       +K    LS GQ QR+ +ART+A EPEV+L+DEP SALDPIS
Sbjct  122  RVEESLRAAALWDEVKDKLDKSALGLSGGQQQRLCIARTIAIEPEVILMDEPCSALDPIS  181

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            T  IED++ +LK +   TI +V+H+++Q  R++      + GEIVE
Sbjct  182  TTKIEDLIHKLKND--YTIIIVTHNMQQATRVSKYTAFFLHGEIVE  225



>ref|WP_036740494.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Paenibacillus]
Length=255

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 137/237 (58%), Gaps = 16/237 (7%)
 Frame = +1

Query  223  AAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE---  393
            A  TKI+V GL          L+ I LDI    +  +IGPSG GKSTFLR LNR+ +   
Sbjct  4    ATDTKIKVNGLDLFYGDN-QALHSIDLDIAPNTVSALIGPSGCGKSTFLRTLNRMNDLID  62

Query  394  --PANATVFLDGKDIC--DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSD  561
                N T+ +DG+DI   + D++SLR +VGM+FQ P  F  ++ DNI YGP + G+K   
Sbjct  63   SVRINGTIKVDGQDIYSPESDIVSLRKRVGMVFQRPNPFPMSIYDNIAYGPRIHGQKKRA  122

Query  562  dqvlrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSAL  723
                 +       + +       NK    LS GQ QR+ +AR LA EPEVLL+DEPTSAL
Sbjct  123  VLDEIVERSLRQAALWDEVKDRLNKSALGLSGGQQQRLCIARLLAVEPEVLLMDEPTSAL  182

Query  724  DPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            DPIST  +E++   LK  +R TI +V+H+++Q  RI+D     + G +VE  + D++
Sbjct  183  DPISTLKVEELTQTLK--ERYTIIIVTHNMQQAARISDRTSFFLNGILVETDQTDKI  237



>gb|EPR26305.1| Glycine betaine transport ATP-binding protein [Geobacillus sp. 
WSUCF1]
Length=377

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 136/223 (61%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  + L+I +G ++ +IGPSG GK+T +R +NRL EP +  V++
Sbjct  4    IRFENVTKQYEDGFVALKNMNLEIRKGELVALIGPSGCGKTTTMRMINRLIEPTSGKVYI  63

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRG---KKLSDdqvlrlls  585
            DG+DI +LD + LR  +G + Q   LF   T+A+NI   P L+              L  
Sbjct  64   DGQDISELDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKHAYEKRVDELLEL  123

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP ++L+DEP SALDPIS + ++D +VR
Sbjct  124  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPNIILMDEPFSALDPISREQLQDDIVR  183

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E + TI  V+H + +  +IAD + L+ +GEIV+   PDQ+
Sbjct  184  LQEEIQKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPDQM  226



>gb|EGL20223.1| phosphate ABC transporter, ATP-binding protein [Paenibacillus 
sp. HGF7]
 gb|EPD82286.1| phosphate import ATP-binding protein PstB [Paenibacillus sp. 
HGH0039]
Length=260

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 137/237 (58%), Gaps = 16/237 (7%)
 Frame = +1

Query  223  AAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE---  393
            A  TKI+V GL          L+ I LDI    +  +IGPSG GKSTFLR LNR+ +   
Sbjct  9    ATDTKIKVNGLDLFYGDN-QALHSIDLDIAPNTVSALIGPSGCGKSTFLRTLNRMNDLID  67

Query  394  --PANATVFLDGKDIC--DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSD  561
                N T+ +DG+DI   + D++SLR +VGM+FQ P  F  ++ DNI YGP + G+K   
Sbjct  68   SVRINGTIKVDGQDIYSPESDIVSLRKRVGMVFQRPNPFPMSIYDNIAYGPRIHGQKKRA  127

Query  562  dqvlrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSAL  723
                 +       + +       NK    LS GQ QR+ +AR LA EPEVLL+DEPTSAL
Sbjct  128  VLDEIVERSLRQAALWDEVKDRLNKSALGLSGGQQQRLCIARLLAVEPEVLLMDEPTSAL  187

Query  724  DPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            DPIST  +E++   LK  +R TI +V+H+++Q  RI+D     + G +VE  + D++
Sbjct  188  DPISTLKVEELTQTLK--ERYTIIIVTHNMQQAARISDRTSFFLNGILVETDQTDKI  242



>ref|WP_010272026.1| phosphate ABC transporter ATP-binding protein [Paenibacillus 
senegalensis]
Length=253

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 130/219 (59%), Gaps = 15/219 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC--DLD  444
            LN I LDIP   I  +IGPSG GKSTFLR LNR+ +          V +DG+ I   D+D
Sbjct  22   LNNIHLDIPEKSICALIGPSGCGKSTFLRTLNRMNDLIHGVKITGKVLVDGQQIYNQDMD  81

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF-----  609
            V SLR +VGM+FQ P  F  ++ DN+ YGP + G +   + V  +       + +     
Sbjct  82   VASLRKRVGMVFQRPNPFPMSIFDNVAYGPRIHGIRKKSELVPIVERSLRQAALWDEVKD  141

Query  610  -CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRM  786
              NK    LS GQ QR+ +AR LA EP+VLL+DEPTSALDPIST  +E++  +LK  +R 
Sbjct  142  RLNKSALGLSGGQQQRLCIARLLAVEPDVLLMDEPTSALDPISTLKVEELTQQLK--ERY  199

Query  787  TIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQA  903
            TI  V+H+++Q  RI+D     + G++VE  + D++  A
Sbjct  200  TIITVTHNMQQAARISDYTSFFLNGQLVETDQTDRMFTA  238



>ref|WP_015868090.1| phosphate ABC transporter ATP-binding protein [Kosmotoga olearia]
 ref|YP_002940428.1| phosphate ABC transporter ATPase [Kosmotoga olearia TBF 19.5.1]
 gb|ACR79424.1| phosphate ABC transporter, ATPase subunit [Kosmotoga olearia 
TBF 19.5.1]
Length=251

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 126/208 (61%), Gaps = 15/208 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDICDLDVL  450
            L  +T  +PR  I  ++GPSG GKSTFLR LNR+ +         TV LDG+DI  LD +
Sbjct  22   LKNVTCTVPRNKITAVVGPSGCGKSTFLRVLNRMNDLIPGYRVEGTVKLDGEDIMTLDPV  81

Query  451  SLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNKPGGE  630
             LR KVGM+FQ P  F  +V DN+ YGP + G K  ++    +       + + ++  GE
Sbjct  82   VLRKKVGMVFQKPNPFPKSVFDNVAYGPRIHGVKNKEELRNIVERSLKQAALW-DEVKGE  140

Query  631  L-------SVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
            L       S GQ QR+ +AR +A EPEVLLLDEPTSALDPI+TQ IE ++  L   ++ T
Sbjct  141  LKKNAINFSGGQQQRLCIARAIAVEPEVLLLDEPTSALDPIATQKIEKLIEEL--SEKYT  198

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            I +V+H+++Q  RI+D +     GE+VE
Sbjct  199  IVIVTHNLQQALRISDYMMFFYMGELVE  226



>ref|WP_017509637.1| phosphate ABC transporter ATP-binding protein [beta proteobacterium 
L13]
Length=254

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 138/237 (58%), Gaps = 18/237 (8%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            K+QVK L     K   L N I LDIP G +   IGPSG GKST LR  NR++E      A
Sbjct  7    KLQVKNLNFYYGKFHALKN-INLDIPAGQVTAFIGPSGCGKSTLLRTFNRMFELYPGMSA  65

Query  400  NATVFLDGKDIC--DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
               + LD +++    +DV  LR KVGM+FQ P  F  ++ DNI +G  L  + LS  ++ 
Sbjct  66   EGEIILDSQNLLAKSVDVNMLRAKVGMVFQKPTPFPMSIYDNITFGVKLY-ESLSKAEMD  124

Query  574  rllsladldssFCN-------KPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPI  732
              +  A   ++  N       + G  LS GQ QR+ +AR +A  PEVLLLDEPTSALDPI
Sbjct  125  DRVEWALRKAALWNEVKDKLKQSGNSLSGGQQQRLCIARAVATRPEVLLLDEPTSALDPI  184

Query  733  STQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQA  903
            ST +IE+++  LK++   TIA+V+H+++Q  R++D    +  GE+VE  + D +  A
Sbjct  185  STGHIEELIHELKQD--YTIAIVTHNMQQAARVSDYTAYMYLGELVEFGETDGIFTA  239



>ref|WP_012942658.1| choline transporter [Haloterrigena turkmenica]
 ref|YP_003403026.1| ABC transporter [Haloterrigena turkmenica DSM 5511]
 gb|ADB60353.1| ABC transporter related protein [Haloterrigena turkmenica DSM 
5511]
Length=222

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 134/220 (61%), Gaps = 2/220 (1%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVF  414
            K++ + LTRV D G  +++ +++ +P   +  ++GPSG+GKS+FLR LNRL EP   TV+
Sbjct  3    KLETENLTRVVD-GERIVDSVSVRVPTAEVTAVVGPSGAGKSSFLRLLNRLDEPTAGTVY  61

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            LDG+D  ++D L LR +VG + Q PAL  GTVADN+  G  LR + + D + +  L    
Sbjct  62   LDGRDYREIDPLRLRRRVGFVPQAPALQSGTVADNVGIGDRLRDEPVDD-RRIDRLLERV  120

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
                + ++   +LS G+ QRVA+ RTL  +PEV+LLDEPT+ LD  +   IE +L  L +
Sbjct  121  GLDGYRDERVDDLSGGERQRVAVTRTLYVDPEVVLLDEPTAHLDSETEARIEGLLAELIR  180

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            E  +T  +V+H   Q +R+ D +    +G +  V  P ++
Sbjct  181  EDDLTCVVVTHDTDQARRLGDRIVAFEDGRVTAVGTPQEV  220



>ref|WP_015373835.1| osmoprotectant ABC transporter ATP-binding protein [Geobacillus 
sp. GHH01]
 ref|YP_007400647.1| osmoprotectant ABC transporter ATP-binding protein [Geobacillus 
sp. GHH01]
 gb|AGE20896.1| osmoprotectant ABC transporter ATP-binding protein [Geobacillus 
sp. GHH01]
Length=375

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 137/223 (61%), Gaps = 4/223 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANATVFL  417
            I+ + +T+  + G   L  + L+I +G ++ +IGPSG GK+T +R +NRL EP +  V++
Sbjct  2    IRFENVTKQYEDGFVALKNMNLEIRKGELVALIGPSGCGKTTTMRMINRLIEPTSGKVYI  61

Query  418  DGKDICDLDVLSLRCKVGMLFQLPALF-EGTVADNIRYGPLLRGKK---LSDdqvlrlls  585
            DG+DI +LD + LR  +G + Q   LF   T+A+NI   P L+  +           L  
Sbjct  62   DGQDISELDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLKKWEKHVYEKRVDELLEL  121

Query  586  ladldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVR  765
            +    ++F ++   ELS GQ QRV + R LA EP ++L+DEP SALDPIS + ++D +VR
Sbjct  122  VGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPNIILMDEPFSALDPISREQLQDDIVR  181

Query  766  LKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            L++E + TI  V+H + +  +IAD + L+ +GEIV+   PDQ+
Sbjct  182  LQEEIQKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPDQM  224



>ref|WP_010877337.1| phosphate ABC transporter ATP-binding protein [Methanothermobacter 
thermautotrophicus]
 ref|NP_276841.1| phosphate ABC transporter ATP-binding protein [Methanothermobacter 
thermautotrophicus str. Delta H]
 sp|O27764.1|PSTB_METTH RecName: Full=Phosphate import ATP-binding protein PstB; AltName: 
Full=ABC phosphate transporter; AltName: Full=Phosphate-transporting 
ATPase [Methanothermobacter thermautotrophicus 
str. Delta H]
 gb|AAB86201.1| phosphate transport system ATP-binding [Methanothermobacter thermautotrophicus 
str. Delta H]
Length=253

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 133/226 (59%), Gaps = 16/226 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            +I+V+ L    D+   +L  I L IP+  +  +IGPSG GKSTF+R LNR+ +       
Sbjct  6    RIEVEDLNVYFDEA-HILKDINLKIPKNTVTALIGPSGCGKSTFIRTLNRMNDVISGFRH  64

Query  400  NATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
               V+LDGKDI D  +DV+ LR KVGM+FQ P  F  ++ +N+ YG  + G    D    
Sbjct  65   EGHVYLDGKDIYDPDMDVVELRKKVGMVFQKPNPFPKSIFENVAYGLRVHGYDDRDFIEE  124

Query  574  rllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
            R+       + +       +K    LS GQ QR+ +ART+A EPEV+L+DEP SALDPIS
Sbjct  125  RVEESLRAAALWDEVKDKLDKSALGLSGGQQQRLCIARTIAIEPEVILMDEPCSALDPIS  184

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            T  IED++ +LK +   TI +V+H+++Q  R++      + GEIVE
Sbjct  185  TTKIEDLIHKLKND--YTIIIVTHNMQQATRVSKYTAFFLHGEIVE  228



>ref|WP_012065580.1| phosphate ABC transporter ATP-binding protein [Alkaliphilus metalliredigens]
 ref|YP_001322351.1| phosphate ABC transporter ATPase [Alkaliphilus metalliredigens 
QYMF]
 gb|ABR50692.1| phosphate ABC transporter, ATPase subunit [Alkaliphilus metalliredigens 
QYMF]
Length=250

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 132/227 (58%), Gaps = 16/227 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANAT--  408
            KI V+GL    D    L N IT +I    +  +IGPSG GKSTFLR LNR+ +  +    
Sbjct  3    KICVEGLNLYYDDFQALKN-ITFNIEEKKVTALIGPSGCGKSTFLRTLNRMNDLIDGVKI  61

Query  409  ---VFLDGKDIC--DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
               V L+ +DI   D+DV+SLR ++GM+FQ P  F  ++ +N+ YGP   G K       
Sbjct  62   VGEVKLEEQDIYHKDVDVVSLRRRIGMVFQKPNPFPKSIYENVAYGPKRHGIKNKKQLDE  121

Query  574  rllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
             +       + +       NK    LS GQ QR+ +AR LA EPEVLL+DEPTSALDPI+
Sbjct  122  MVEKSLRKAALWDEVKDRLNKSALGLSGGQQQRLCIARALAMEPEVLLMDEPTSALDPIA  181

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEV  876
            T  IE+++  LKKE   TI +V+HS++Q  RI+D     + GE++EV
Sbjct  182  TAKIEELITELKKE--YTIVIVTHSMQQAARISDETAFFLMGEVIEV  226



>ref|WP_026485547.1| phosphate ABC transporter ATP-binding protein [Caldanaerobius 
polysaccharolyticus]
Length=249

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 133/215 (62%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC-DLDV  447
            L  + +++    +M +IGPSG GKSTFLR +NR+ +         TV LDG DI  D DV
Sbjct  19   LKNVNIEVKANTVMALIGPSGCGKSTFLRVINRMNDLIPGVKITGTVKLDGVDIYNDFDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG---KKLSDdqvlrllsladldssFCNK  618
            L LR +VGM+FQ P  F  +V DN+ YGP + G   KK  D+ V R L  A L     ++
Sbjct  79   LELRKRVGMVFQKPNPFPMSVYDNVAYGPRIHGIKNKKKLDEIVERSLKAAALWDEVKDR  138

Query  619  PGGE---LSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             G     LS GQ QR+ +ARTLA EP+V+L+DEPTSALDPIST  IED++  LK  K+ T
Sbjct  139  LGRSAMGLSGGQQQRLCIARTLAIEPDVILMDEPTSALDPISTAKIEDLIDILK--KKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            I +V+H+++Q  RI+D     + GE+VE    D++
Sbjct  197  IIIVTHNMQQAGRISDFTSFFLNGEVVESGPTDEV  231



>ref|WP_003453508.1| phosphate ABC transporter ATP-binding protein [Clostridium perfringens]
 ref|NP_561556.1| phosphate transporter ATP-binding protein [Clostridium perfringens 
str. 13]
 ref|YP_695074.1| phosphate transporter ATP-binding protein [Clostridium perfringens 
ATCC 13124]
 ref|YP_697934.1| phosphate transporter ATP-binding protein [Clostridium perfringens 
SM101]
 sp|Q8XMP8.1|PSTB_CLOPE RecName: Full=Phosphate import ATP-binding protein PstB; AltName: 
Full=ABC phosphate transporter; AltName: Full=Phosphate-transporting 
ATPase [Clostridium perfringens str. 13]
 sp|Q0SVB6.1|PSTB_CLOPS RecName: Full=Phosphate import ATP-binding protein PstB; AltName: 
Full=ABC phosphate transporter; AltName: Full=Phosphate-transporting 
ATPase [Clostridium perfringens SM101]
 sp|Q0TTG6.1|PSTB_CLOP1 RecName: Full=Phosphate import ATP-binding protein PstB; AltName: 
Full=ABC phosphate transporter; AltName: Full=Phosphate-transporting 
ATPase [Clostridium perfringens ATCC 13124]
 dbj|BAB80346.1| probable phosphate ABC transporter [Clostridium perfringens str. 
13]
 gb|ABG84192.1| phosphate ABC transporter, ATP-binding protein [Clostridium perfringens 
ATCC 13124]
 gb|ABG85328.1| phosphate ABC transporter, ATP-binding protein [Clostridium perfringens 
SM101]
 gb|EDS79272.1| phosphate ABC transporter, ATP-binding protein [Clostridium perfringens 
C str. JGS1495]
 gb|EDT14541.1| phosphate ABC transporter, ATP-binding protein [Clostridium perfringens 
E str. JGS1987]
 gb|EDT22303.1| phosphate ABC transporter, ATP-binding protein [Clostridium perfringens 
B str. ATCC 3626]
 gb|EDT25871.1| phosphate ABC transporter, ATP-binding protein [Clostridium perfringens 
CPE str. F4969]
 gb|EDT71474.1| phosphate ABC transporter, ATP-binding protein [Clostridium perfringens 
D str. JGS1721]
 gb|EDT77313.1| phosphate ABC transporter, ATP-binding protein [Clostridium perfringens 
NCTC 8239]
 gb|EHP50102.1| phosphate import ATP-binding protein PstB [Clostridium perfringens 
WAL-14572]
 gb|EIA17882.1| phosphate transporter ATP-binding protein [Clostridium perfringens 
F262]
Length=253

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 135/226 (60%), Gaps = 15/226 (7%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----P  396
            TKIQV+ L         L  +I +DI    +  +IGPSG GKSTFLR LNR+ +      
Sbjct  6    TKIQVRDLDLFYASNHAL-KKINIDIKENEVTALIGPSGCGKSTFLRTLNRMNDLIPIVR  64

Query  397  ANATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG---KKLSDd  564
                + +DGKDI  D DV++LR KVGM+FQ P LF  ++ DN+ YGP + G   KK+ D 
Sbjct  65   IEGEIQVDGKDIYKDDDVIALRTKVGMVFQKPNLFPMSIYDNVAYGPRVHGIKDKKVLDK  124

Query  565  qvlrllsladldssFCNKPGGE---LSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
             V   L  A +     N+       LS GQ QR+ +AR +A  PE++L+DEPTSALDPIS
Sbjct  125  IVEESLRDAAIWDEVKNRLKSSALGLSGGQQQRICIARAIAMNPEIILMDEPTSALDPIS  184

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            T  +E+++ +L  E + TI +V+H+++Q  RI+D     + GE+VE
Sbjct  185  TLKVEELIRKL--EDKYTIVIVTHNMQQAARISDKTAFFLNGELVE  228



>ref|WP_008790934.1| phosphate ABC transporter ATP-binding protein [Coprobacillus 
sp. 8_2_54BFAA]
 gb|EHQ47315.1| phosphate import ATP-binding protein PstB 2 [Coprobacillus sp. 
8_2_54BFAA]
Length=251

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 135/230 (59%), Gaps = 16/230 (7%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPA----  399
             KI+ K L     +   L N ++LDI    I   IGPSG GKSTFL+ LNR+ +      
Sbjct  3    NKIEAKNLDLYYGEKHALKN-VSLDIKTNKITAFIGPSGCGKSTFLKTLNRMNDYVKDIK  61

Query  400  -NATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG---KKLSD  561
               +V LDG+DI D  +D   LR KVGM+FQ P  F  ++ DNI YGP + G   KK  D
Sbjct  62   ITGSVVLDGEDIYDSRVDTTVLRKKVGMVFQQPNPFPMSIYDNIAYGPRIHGIKNKKQLD  121

Query  562  dqvlrllsladldssFCNKPGGE---LSVGQAQRVALARTLANEPEVLLLDEPTSALDPI  732
              V   L  A L     ++       LS GQ QR+ +AR LA EP+V+LLDEPTSALDPI
Sbjct  122  KIVKDSLEAAALYEEVKDRLRSSALGLSGGQQQRLCIARALAVEPDVILLDEPTSALDPI  181

Query  733  STQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            ST  IE++L+ LK  ++ TIA+V+H+++Q  RIAD     + GE+VE  K
Sbjct  182  STLKIEELLMELK--EKYTIAIVTHNMQQASRIADYTAFFLVGEMVEYGK  229



>ref|WP_008930462.1| phosphate ABC transporter ATP-binding protein [Alcanivorax hongdengensis]
 gb|EKF72896.1| phosphate transporter ATP-binding protein [Alcanivorax hongdengensis 
A-11-3]
Length=270

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 141/250 (56%), Gaps = 20/250 (8%)
 Frame = +1

Query  202  MVDGDDEAAG----TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFL  369
            + D DD AA     TK++V  L          L  I++DIP   +   IGPSG GKST L
Sbjct  8    LSDIDDSAANVETDTKLRVDNLNFFYGD-FHALKDISMDIPANKVTAFIGPSGCGKSTLL  66

Query  370  RALNRLWE-----PANATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRY  528
            R  NR+ +          + LDG+DI D  LD+  LR ++GM+FQ P  F  +V +NI +
Sbjct  67   RCFNRIHDLYPGLSNTGQILLDGQDINDPKLDIHLLRARIGMVFQKPTPFPMSVYENIAF  126

Query  529  GPLLRGKKLSDdqvlrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPE  690
            G  L  +  S     R+       + +       NK G  LS GQ QR+ +ART+A +PE
Sbjct  127  GVRLYERMSSSRMAERVEWALRKAALWDEVKDKLNKSGLALSGGQQQRLCIARTIAVKPE  186

Query  691  VLLLDEPTSALDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIV  870
            V+LLDEPTSALDPIST  IE+++  LKK+   TIA+V+H+++Q  R++D+   +  GE+V
Sbjct  187  VILLDEPTSALDPISTSAIEELIHELKKD--YTIAIVTHNMQQAARVSDMTAFMYLGEMV  244

Query  871  EVLKPDQLSQ  900
            E    +Q+ Q
Sbjct  245  EFGATEQIFQ  254



>ref|WP_015529353.1| phosphate ABC transporter ATP-binding protein, PhoT family (TC 
3.A.1.7.1) [[Ruminococcus] torques]
 ref|YP_007787281.1| phosphate ABC transporter ATP-binding protein, PhoT family (TC 
3.A.1.7.1) [Ruminococcus torques L2-14]
 emb|CBL26773.1| phosphate ABC transporter ATP-binding protein, PhoT family (TC 
3.A.1.7.1) [Ruminococcus torques L2-14]
 emb|CDC14510.1| phosphate ABC transporter ATP-binding protein PhoT family (TC 
3.A.1.7.1) [Ruminococcus sp. CAG:55]
Length=256

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 126/215 (59%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC-DLDV  447
            L  + + I    I   IGPSG GKSTFL+ LNR+ +       +  V LDGKDI  ++D 
Sbjct  26   LKDVNMKIEANKITAFIGPSGCGKSTFLKTLNRMNDLVENCKIDGNVLLDGKDIFKEMDE  85

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            ++LR +VGM+FQ P  F  +V DN+ YGP + G K        +       + +      
Sbjct  86   ITLRHRVGMVFQQPNPFPKSVYDNVAYGPRIAGIKKKSQLDEIVERSLRQAAIWDELKDR  145

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             NK    LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST  IED+ + LKK+   T
Sbjct  146  LNKSALGLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPISTSKIEDLAMELKKD--YT  203

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            I MV+H+++Q  R++D     + GE++E    ++L
Sbjct  204  IVMVTHNMQQAVRVSDNTAFFLLGEVIEYNDTEKL  238



>ref|WP_005332270.1| phosphate ABC transporter ATP-binding protein [Dorea formicigenerans]
 gb|EDR47328.1| phosphate ABC transporter, ATP-binding protein [Dorea formicigenerans 
ATCC 27755]
Length=265

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 133/238 (56%), Gaps = 15/238 (6%)
 Frame = +1

Query  217  DEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-  393
            D++   K  +  L  +   G   L  + + I    I   IGPSG GKSTFL+ LNR+ + 
Sbjct  13   DQSKKYKFDISNLN-LHYGGFHALKDVNMQIEANKITAFIGPSGCGKSTFLKTLNRMNDL  71

Query  394  ----PANATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLS  558
                  +  V LDG DI  D+D ++LR +VGM+FQ P  F  +V DN+ YGP + G K  
Sbjct  72   VENCKIDGKVLLDGTDIYKDMDEITLRYRVGMVFQQPNPFPKSVYDNVAYGPRIAGIKKK  131

Query  559  DdqvlrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSA  720
                  +       + +       +K    LS GQ QR+ +ARTLA EPEV+L+DEPTSA
Sbjct  132  SQLDEIVERSLRQAAIWDELKDRLHKSALGLSGGQQQRLCIARTLAVEPEVILMDEPTSA  191

Query  721  LDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            LDPIST  IED+ + LKK+   TI MV+H+++Q  R++D     + GE++E    ++L
Sbjct  192  LDPISTSKIEDLAMELKKD--YTIVMVTHNMQQAVRVSDNTAFFLLGEVIEYNDTEKL  247



>ref|WP_039736044.1| phosphate ABC transporter ATP-binding protein [Komagataeibacter 
intermedius]
 gb|KIE60442.1| phosphate ABC transporter ATP-binding protein [Komagataeibacter 
intermedius AF2]
Length=265

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 131/222 (59%), Gaps = 17/222 (8%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLW-----EPANATVFLDGKDICD--LD  444
            L  I+LD P   + G+IGPSG GKST LR LNR++     + A   V  DG++I    LD
Sbjct  34   LKDISLDFPARQVTGMIGPSGCGKSTLLRILNRMYDLYPGQRATGEVLFDGRNILSPSLD  93

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNK--  618
            V  LR ++GM+FQ P  F  ++ DNI +G  L  ++LS   + + +       +  N+  
Sbjct  94   VNVLRSRIGMVFQKPTPFPMSIYDNIAFGVRLH-ERLSRTDMDQRVEGVLRRVALWNEVK  152

Query  619  -----PGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKR  783
                     LS GQ QR+ +ART+A  PE++LLDEPTSALDPIST  IE++L  LK+E  
Sbjct  153  DRLGASAAALSGGQQQRLCIARTIATRPEIILLDEPTSALDPISTARIEELLDELKQE--  210

Query  784  MTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKH  909
             +IA+V+H+++Q  R AD V     GE+VEV   D++  A H
Sbjct  211  FSIAIVTHNLQQAARCADRVAFFYMGELVEVDTADKMFTAPH  252



>ref|WP_010517153.1| phosphate ABC transporter ATP-binding protein [Komagataeibacter 
oboediens]
Length=265

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 131/222 (59%), Gaps = 17/222 (8%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLW-----EPANATVFLDGKDICD--LD  444
            L  I+LD P   + G+IGPSG GKST LR LNR++     + A   V  DG++I    LD
Sbjct  34   LKDISLDFPARQVTGMIGPSGCGKSTLLRILNRMYDLYPGQRATGEVLFDGRNILSPSLD  93

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNK--  618
            V  LR ++GM+FQ P  F  ++ DNI +G  L  ++LS   + + +       +  N+  
Sbjct  94   VNVLRSRIGMVFQKPTPFPMSIYDNIAFGVRLH-ERLSRTDMDQRVEGVLRRVALWNEVK  152

Query  619  -----PGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKR  783
                     LS GQ QR+ +ART+A  PE++LLDEPTSALDPIST  IE++L  LK+E  
Sbjct  153  DRLGASAAALSGGQQQRLCIARTIATRPEIILLDEPTSALDPISTARIEELLDELKQE--  210

Query  784  MTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQAKH  909
             +IA+V+H+++Q  R AD V     GE+VEV   D++  A H
Sbjct  211  FSIAIVTHNLQQAARCADRVAFFYMGELVEVDTADKMFTAPH  252



>emb|CCZ23722.1| phosphate import ATP-binding protein PstB 2 [Coprobacillus sp. 
CAG:235]
Length=251

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 128/210 (61%), Gaps = 15/210 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPAN-----ATVFLDGKDICD--LD  444
            L  ++LDI +  I   IGPSG GKSTFL+ LNR+ +  +       V LDG+DI D  +D
Sbjct  20   LKDVSLDIKKNKITAFIGPSGCGKSTFLKTLNRMNDYVDNVKIEGDVILDGEDIYDSRVD  79

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG---KKLSDdqvlrllsladldssFCN  615
               LR KVGM+FQ P  F  ++ DN+ YGP + G   KK  D  V   L  A L     +
Sbjct  80   TTLLRKKVGMVFQQPNPFPMSIYDNVAYGPRIHGIKNKKQLDKIVEDSLKAAALYDEVSD  139

Query  616  KPGGE---LSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRM  786
            +       LS GQ QR+ +AR LA +PEV+LLDEPTSALDPIST  IE++L++LK +   
Sbjct  140  RLHSSALGLSGGQQQRLCIARALAVQPEVILLDEPTSALDPISTLKIEELLLQLKDQ--Y  197

Query  787  TIAMVSHSIKQIQRIADVVCLLVEGEIVEV  876
            TIA+V+H+++Q  RIAD     + GE+VE 
Sbjct  198  TIAIVTHNMQQASRIADYTAFFLVGEMVEY  227



>ref|WP_005006689.1| Phosphate import ATP-binding protein pstB 1 [Nitrospina gracilis]
 emb|CCQ89845.1| Phosphate import ATP-binding protein pstB 1 [Nitrospina gracilis 
3/211]
Length=246

 Score =   153 bits (386),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 136/212 (64%), Gaps = 4/212 (2%)
 Frame = +1

Query  238  IQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANA-TVF  414
            +QV+ L+    +G  +LN ++ D+ +G ++ ++GPSGSGKS  LR+LNRL EP +A TV 
Sbjct  2    LQVRELS--VTRGRPILNGVSFDVEKGEMLVVLGPSGSGKSMLLRSLNRL-EPFDAGTVR  58

Query  415  LDGKDICDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllslad  594
            L+G+D   ++VL LR ++GM+FQ PAL    V DNI  GP LRG+ + D +   LL+   
Sbjct  59   LNGQDTARMNVLELRRRMGMVFQAPALLPFRVRDNIALGPGLRGEVMEDAKCEHLLNQVG  118

Query  595  ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKK  774
            L  ++  +    LS G+ QRVALA+ LAN PE+LL+DEPTSALDP +   IE+++  + +
Sbjct  119  LSKTYLTRQAETLSGGEQQRVALAQMLANGPELLLMDEPTSALDPTAALTIENLIKHINR  178

Query  775  EKRMTIAMVSHSIKQIQRIADVVCLLVEGEIV  870
            +  +    V+H + Q  R   +  +L+EG IV
Sbjct  179  DLGIAAVWVTHDVPQALRFDAMTMVLIEGRIV  210



>ref|WP_013432749.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Caldicellulosiruptor]
 ref|YP_004026583.1| phosphate ABC transporter ATPase subunit [Caldicellulosiruptor 
kristjanssonii I77R1B]
 ref|YP_004798482.1| phosphate ABC transporter ATPase [Caldicellulosiruptor lactoaceticus 
6A]
 gb|ADQ40970.1| phosphate ABC transporter, ATPase subunit [Caldicellulosiruptor 
kristjanssonii I77R1B]
 gb|AEM73505.1| phosphate ABC transporter, ATPase subunit [Caldicellulosiruptor 
lactoaceticus 6A]
Length=249

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 124/211 (59%), Gaps = 14/211 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC-DLDV  447
            L  I + I    I  +IGPSG GKSTFLR LNR+ +          V+ +GKDI  ++DV
Sbjct  19   LKNINIKINEKAITALIGPSGCGKSTFLRTLNRMNDLIENVKIEGNVYFEGKDIYKEIDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            ++LR K+GM+FQ P  F  ++ DN+ YGP + G K  +     + S       +      
Sbjct  79   ITLRKKIGMVFQKPNPFPMSIYDNVAYGPRIHGIKKKEVLDEIVESSLKKAYLWDEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +AR LA EPEV+LLDEPTSALDPIST  IE++L +LK  K  T
Sbjct  139  LRKSAFSLSGGQQQRLCIARVLAVEPEVILLDEPTSALDPISTLKIEELLEQLK--KNYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            I +V+H+++Q  RI+D     + GE+VE  K
Sbjct  197  IIIVTHNMQQAARISDFTGFFLNGELVEFDK  227



>ref|WP_007862246.1| phosphate ABC transporter ATP-binding protein [[Clostridium] 
citroniae]
 gb|EHE98722.1| phosphate import ATP-binding protein pstB [ [[Clostridium] citroniae 
WAL-17108]
Length=253

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 131/234 (56%), Gaps = 16/234 (7%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----P  396
            TKI  + L     +   L N I LD+    I   IGPSG GKST+L+ LNR+ +      
Sbjct  5    TKIATRNLNLYYGENHALKN-INLDLYENKITAFIGPSGCGKSTYLKTLNRMNDLVPGVK  63

Query  397  ANATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqv  570
             + TV LD +DI D  +D   LR K+GM+FQ P  F  ++ DN+ YGP + G K      
Sbjct  64   IDGTVLLDNEDIYDPQVDTTLLRKKIGMVFQQPNPFPMSIYDNVAYGPRIHGIKNKSQLD  123

Query  571  lrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPI  732
              + S     + +        K    LS GQ QR+ +AR LA EPEVLL+DEPTSALDPI
Sbjct  124  EIVESSLRGAALWDEVADRLKKSALGLSGGQQQRLCIARALAVEPEVLLMDEPTSALDPI  183

Query  733  STQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            ST  IED++  LK   + T+A+V+H+++Q  RIAD     + GE+VE    D+L
Sbjct  184  STLKIEDLMDDLK--SKYTVAIVTHNMQQATRIADYTAFFLVGEVVEYAATDEL  235



>ref|WP_039693739.1| phosphate ABC transporter ATP-binding protein [Streptococcus 
gallolyticus]
 emb|CDO17782.1| Putative phosphate ABC transporter, ATP-binding p rotein [Streptococcus 
gallolyticus]
Length=249

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 125/215 (58%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPA-----NATVFLDGKDI-CDLDV  447
            L  I L+IP   I   IGPSG GKST L++LNR+ +          V LDG+DI CDLD+
Sbjct  19   LKSIHLEIPANEITAFIGPSGCGKSTLLKSLNRMNDLVKDCRITGKVLLDGEDIYCDLDI  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
              LR KVGM+FQ P  F  ++ DNI +G    G     +    +       + +      
Sbjct  79   NKLRKKVGMVFQKPNPFPMSIYDNIAFGQRTHGIHAKTELDEIVERSLKQAAIWDEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             +K    LS GQ QR+ +AR LA EP+VLL+DEPTSALDPIST  IED+++ LK  K+ +
Sbjct  139  LSKSAMGLSGGQQQRLCIARALAIEPDVLLMDEPTSALDPISTSKIEDLVIELK--KKYS  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            I MV+H+++Q  RI+D     + GE+VE  K  QL
Sbjct  197  IVMVTHNMQQAVRISDKTAFFLMGEVVEFNKTSQL  231



>ref|WP_021719575.1| phosphate ABC transporter ATP-binding protein [Phascolarctobacterium 
succinatutens]
 emb|CDD11422.1| phosphate ABC transporter ATP-binding protein [Phascolarctobacterium 
succinatutens CAG:287]
Length=255

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 138/238 (58%), Gaps = 15/238 (6%)
 Frame = +1

Query  217  DEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-  393
            ++ A TK+ V+ L     K    L +I LDI    I  +IGPSG GKSTFL+ LNR+ + 
Sbjct  3    NDNAATKLLVQDLDLYYGK-FQALKKINLDIKEKEITALIGPSGCGKSTFLKTLNRMNDL  61

Query  394  ----PANATVFLDGKDI-CDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLS  558
                    ++ L GKDI  ++D +SLR +VGM+FQ P  F  ++ DN+ YGP + G    
Sbjct  62   EEGVRIEGSIALYGKDIFAEIDPISLRHRVGMVFQQPNPFPKSIYDNVAYGPRIHGVTKK  121

Query  559  DdqvlrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSA  720
             +    +       + +       NK    LS GQ QR+ +ARTLA +PEV+L+DEPTSA
Sbjct  122  SELDEIVERSLLQAAIWDELKDRLNKSALGLSGGQQQRLCIARTLAVQPEVILMDEPTSA  181

Query  721  LDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            LDPIST  IED+ + LKK+   TI +V+H+++Q  RI+D     + GE++E  +  QL
Sbjct  182  LDPISTMKIEDLALELKKD--YTIVIVTHNMQQAARISDKTAFFLLGELIEFNETKQL  237



>ref|WP_021868767.1| phosphate import ATP-binding protein pstB [Clostridium sp. CAG:7]
 emb|CCY41404.1| phosphate import ATP-binding protein pstB [Clostridium sp. CAG:7]
Length=253

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 123/216 (57%), Gaps = 15/216 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDICD--LD  444
            L  I LD+    I   IGPSG GKST+L+ LNR+ +         TV LDG+DI D  +D
Sbjct  22   LKNINLDLYENKITAFIGPSGCGKSTYLKTLNRMNDLVPNVKIEGTVLLDGEDIYDPQVD  81

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF-----  609
               LR KVGM+FQ P  F  ++ DN+ YGP + G K        +       + +     
Sbjct  82   TTLLRKKVGMVFQQPNPFPMSIYDNVAYGPRIHGIKNKAQLDEIVERSLKGAALWDEVSD  141

Query  610  -CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRM  786
               K    LS GQ QR+ +AR LA EPEVLL+DEPTSALDPIST  IED++  LK   + 
Sbjct  142  RLKKSALGLSGGQQQRLCIARALAVEPEVLLMDEPTSALDPISTLKIEDLMDDLK--SKY  199

Query  787  TIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            T+A+V+H+++Q  RIAD     + GE+VE    D+L
Sbjct  200  TVAIVTHNMQQATRIADYTAFFLVGEVVEYATTDEL  235



>ref|WP_035376183.1| phosphate ABC transporter ATP-binding protein [Acetobacter nitrogenifigens]
Length=253

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 132/220 (60%), Gaps = 17/220 (8%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLW-----EPANATVFLDGKDIC--DLD  444
            L+ IT+D P+  + G+IGPSG GKST LR LNR++     + A   V  DG++I    +D
Sbjct  22   LHGITMDFPKRKVTGMIGPSGCGKSTLLRVLNRMYDLYPGQRATGEVMFDGRNIVAPGMD  81

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFCNK--  618
            +  LR +VGM+FQ P  F  ++ DNI +G  L  +KLS  ++   +       +  ++  
Sbjct  82   LNRLRARVGMVFQKPTPFPMSIYDNIAFGVKLH-EKLSRAEMDARVEDVLHRVALWSEVK  140

Query  619  -----PGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKR  783
                     LS GQ QR+ +ART+A  PEV+LLDEPTSALDP+ST  IE++L  LKKE  
Sbjct  141  DRLKSSATALSGGQQQRLCIARTIATRPEVVLLDEPTSALDPVSTARIEELLDELKKE--  198

Query  784  MTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQLSQA  903
             TIA+V+H+++Q  R AD V     GE+VE+   D++  A
Sbjct  199  FTIAIVTHNMQQAARCADQVAFFYLGELVEIDSTDRMFTA  238



>ref|WP_021288553.1| phosphate ABC transporter ATP-binding protein [Sulfurimonas sp. 
AST-10]
 gb|EQB34277.1| phosphate ABC transporter ATP-binding protein [Sulfurimonas sp. 
AST-10]
Length=255

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 135/229 (59%), Gaps = 17/229 (7%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----P  396
            +KI +K L         L N I   + +  I  +IGPSG GKSTFLR +NR+ E      
Sbjct  6    SKINIKNLNLFYGDNQALYN-INASLYKNKITALIGPSGCGKSTFLRCINRMNELIPIVK  64

Query  397  ANATVFLDGKDICDLDV--LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG----KKLS  558
             + ++ +DGK+I D DV  +S+R K+GM+FQ P  F  ++ DN+ Y PL  G     +  
Sbjct  65   TDGSITIDGKNIYDKDVDEVSVRKKIGMVFQQPNPFAKSIYDNVAYAPLKHGIVKKGREC  124

Query  559  DdqvlrllsladldssFCNK---PGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDP  729
            D+ V   L  + L     +K   PG  LS GQ QR+ +ART+A  PEV+L+DEPTSALDP
Sbjct  125  DELVESSLKKSGLWDEVKDKLKTPGTSLSGGQQQRLCIARTIAISPEVILMDEPTSALDP  184

Query  730  ISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEV  876
            ISTQ IE +++ LKK+   TI +V+H+++Q  R+AD       GE++E 
Sbjct  185  ISTQKIEALMLELKKD--YTIVIVTHNMQQAARVADYTAFFHLGELIEY  231



>ref|WP_004609391.1| phosphate ABC transporter ATP-binding protein [[Clostridium] 
spiroforme]
 gb|EDS75684.1| phosphate ABC transporter, ATP-binding protein [ [[Clostridium] 
spiroforme DSM 1552]
Length=251

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 132/227 (58%), Gaps = 16/227 (7%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANAT-  408
             KI+ K L     +   L N ++L+I    I   IGPSG GKSTFL+ LNR+ +      
Sbjct  3    NKIEAKNLDLYYGEKHALKN-VSLNIKTNKITAFIGPSGCGKSTFLKTLNRMNDYVKGIK  61

Query  409  ----VFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqv  570
                V LDG+DI D  +D   LR KVGM+FQ P  F  ++ DN+ YGP + G K   +  
Sbjct  62   ITGDVKLDGEDIYDSRVDTTVLRKKVGMVFQQPNPFPMSIYDNVAYGPRIHGIKNKKELD  121

Query  571  lrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPI  732
              +    +  + +       N     LS GQ QR+ +AR LA +PEV+LLDEPTSALDPI
Sbjct  122  KIVKESLEAAALYEEVKDRLNTSALGLSGGQQQRLCIARALAVQPEVILLDEPTSALDPI  181

Query  733  STQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            ST  IE++L++LK  K+ TIA+V+H+++Q  RIAD     + GE+VE
Sbjct  182  STLKIEELLLQLK--KKYTIAIVTHNMQQASRIADYTAFFLVGEMVE  226



>ref|WP_013430199.1| MULTISPECIES: phosphate ABC transporter ATP-binding protein [Caldicellulosiruptor]
 ref|YP_002573354.1| phosphate ABC transporter ATPase [Caldicellulosiruptor bescii 
DSM 6725]
 ref|YP_004023907.1| phosphate ABC transporter ATPase subunit [Caldicellulosiruptor 
kronotskyensis 2002]
 gb|ACM60581.1| phosphate ABC transporter, ATPase subunit [Caldicellulosiruptor 
bescii DSM 6725]
 gb|ADQ46088.1| phosphate ABC transporter, ATPase subunit [Caldicellulosiruptor 
kronotskyensis 2002]
Length=249

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 124/211 (59%), Gaps = 14/211 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC-DLDV  447
            L  I + I    I  +IGPSG GKSTFLR LNR+ +         TV+ +GK+I  ++DV
Sbjct  19   LKNINIKINEKAITALIGPSGCGKSTFLRTLNRMNDLIENVKIEGTVYFEGKNIYKEIDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR K+GM+FQ P  F  ++ DN+ YGP + G K  +     + S       +      
Sbjct  79   IQLRKKIGMVFQKPNPFPMSIYDNVAYGPRIHGIKKKEVLDEIVESSLKKAYLWDEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +AR LA EPEV+LLDEPTSALDPIST  IE++L +LK  K  T
Sbjct  139  LKKSAFSLSGGQQQRLCIARVLAVEPEVILLDEPTSALDPISTLKIEELLEQLK--KNYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            I +V+H+++Q  RI+D     + GE+VE  K
Sbjct  197  IIIVTHNMQQAARISDFTGFFLNGELVEFDK  227



>ref|WP_028597807.1| phosphate ABC transporter ATP-binding protein [Paenibacillus 
pasadenensis]
Length=252

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 125/216 (58%), Gaps = 15/216 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDI--CDLD  444
            L  I LDIP   I   IGPSG GKSTFLR LNR+ +       + +V LDG+DI   + D
Sbjct  21   LKNIELDIPEKTITAFIGPSGCGKSTFLRTLNRMNDLVAGVKIDGSVKLDGEDIYGAETD  80

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF-----  609
            V SLR +VGM+FQ P  F  ++ DN+ YGP L G +        +       S +     
Sbjct  81   VESLRKRVGMVFQQPNPFPKSIFDNVAYGPRLHGIRDKATLNEIVERSLRGASLWEEVKD  140

Query  610  -CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRM  786
               K    LS GQ QR+ +AR LA EPEVLL+DE TSALDPIST  IE+++  LKKE   
Sbjct  141  LLGKSALSLSGGQQQRLCIARALAVEPEVLLMDEATSALDPISTLKIEELVRELKKE--Y  198

Query  787  TIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            TI MV+H++ Q  R++D     + GE+VE  + ++L
Sbjct  199  TIVMVTHNMHQAARVSDRTVFFLNGELVEADETEKL  234



>ref|WP_005213541.1| phosphate ABC transporter, ATP-binding protein [Clostridium celatum]
 gb|EKY26650.1| phosphate ABC transporter, ATP-binding protein [Clostridium celatum 
DSM 1785]
Length=254

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 132/232 (57%), Gaps = 15/232 (6%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            +IQV+ L         L N I LDI    +  +IGPSG GKSTFLR LNR+ +       
Sbjct  8    EIQVRNLELFYGDNKALKN-INLDIESKKVTALIGPSGCGKSTFLRTLNRMNDLIEGVKI  66

Query  400  NATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlr  576
            N  + +DGKDI  + D + LR KVGM+FQ P  F  ++ DNI YGP + G K        
Sbjct  67   NGQILIDGKDIYKEYDEIDLRKKVGMVFQKPNPFPMSIYDNIAYGPRIHGIKDKRTLDEI  126

Query  577  llsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST  738
            +       + F        K    LS GQ QR+ +ART+A  PE++L+DEPTSALDPIST
Sbjct  127  VEKSLRGAALFDEVKDRLKKSALGLSGGQQQRLCIARTIAVSPEIILMDEPTSALDPIST  186

Query  739  QNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
              +E+++ +LKK+   T+ +V+H+++Q  RIAD     + GE+VE  K + +
Sbjct  187  NKMEELMDQLKKQ--YTVVIVTHNMQQAGRIADKTAFFLSGEVVEYGKTEDI  236



>ref|WP_013076474.1| phosphate ABC transporter ATP-binding protein [Kyrpidia tusciae]
 ref|YP_003590335.1| phosphate ABC transporter ATPase [Kyrpidia tusciae DSM 2912]
 gb|ADG07191.1| phosphate ABC transporter, ATPase subunit [Kyrpidia tusciae DSM 
2912]
Length=258

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 139/238 (58%), Gaps = 17/238 (7%)
 Frame = +1

Query  223  AAG-TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE--  393
            AAG  KI V+ L         L N +++ + R  I  +IGPSG GKSTFLR LNR+ +  
Sbjct  6    AAGEVKIDVEQLNLFYGSAQALFN-VSMGVHRRAITALIGPSGCGKSTFLRTLNRMNDLI  64

Query  394  ---PANATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG----  546
                   TV +DG DI    +DV+ LR +VGM+FQ P  F  +V DN+ YGP + G    
Sbjct  65   AGVRITGTVRIDGIDIYGPRIDVVDLRKRVGMVFQRPNPFPMSVYDNVAYGPRIHGTRSK  124

Query  547  KKLSDdqvlrllslad--ldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSA  720
            KKL +     L   A         ++P   LS GQ QR+ +AR LA EPEV+L+DEPTSA
Sbjct  125  KKLDEIVERSLRRAALWDEIKDRLHEPALGLSGGQQQRLCIARLLAVEPEVVLMDEPTSA  184

Query  721  LDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            LDPIST  IE+++  LK+    TI +V+H+++Q  R++D     + GE+VEV + D+L
Sbjct  185  LDPISTLRIEELITELKES--YTIVIVTHNMQQAARVSDYTAFFLNGELVEVNRTDEL  240



>ref|WP_039651694.1| phosphate ABC transporter ATP-binding protein [Clostridium tyrobutyricum]
Length=249

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 130/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANAT-----VFLDGKDIC-DLDV  447
            L ++ L+  +  +  +IGPSG GKSTFLR +NR+ +  ++      VF + KDI  D DV
Sbjct  19   LKKVNLNAEKNSVTALIGPSGCGKSTFLRTINRMNDLIDSVRIEGEVFFEDKDIYKDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR ++GM+FQ P  F  ++ DN+ YGP + G K  +     +       + +      
Sbjct  79   IELRKRIGMVFQNPNPFPMSIYDNVAYGPRIHGMKNKNTLDEIVEKSLKGAAIWDEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             N+    LS GQ QR+ +ARTLA EPEVLL+DEPTSALDPIST  IE+++  LK  K+ T
Sbjct  139  LNRSALGLSGGQQQRLCIARTLAVEPEVLLMDEPTSALDPISTLKIEELMDILK--KKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            I +V+H+++Q  RI+D     + GEIVE  K +++
Sbjct  197  IIIVTHNMQQAGRISDYTAFFLNGEIVEDGKTEEI  231



>ref|WP_008412356.1| amino-acid transporter subunit ; ATP-binding component of ABC 
superfamily [Desulfotomaculum hydrothermale]
 emb|CCO08759.1| amino-acid transporter subunit ; ATP-binding component of ABC 
superfamily [Desulfotomaculum hydrothermale Lam5 = DSM 18033]
Length=251

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/226 (42%), Positives = 133/226 (59%), Gaps = 16/226 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            KI V+ L  +  + L  L+ I LDI    +  +IGPSG GKSTFLR LNR+ +       
Sbjct  4    KITVRDLN-LFYRDLQALSNINLDIEEKKVTALIGPSGCGKSTFLRTLNRMNDLIEGVRV  62

Query  400  NATVFLDGKDIC--DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
               V LDG+D+   D+DV++LR +VGM+FQ P  F  TV DNI YGP + G+K       
Sbjct  63   EGKVMLDGQDLYGPDIDVVALRKRVGMVFQRPNPFPMTVYDNIAYGPRIHGQKDRRILDQ  122

Query  574  rllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
             +       + +       +K    LS GQ QR+ +AR LA EPEVLL+DEPTSALDPIS
Sbjct  123  IVEKSLKAAALWDEVKDRLHKTALGLSGGQQQRLCIARLLAVEPEVLLMDEPTSALDPIS  182

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            T  +E+++  LK +   TI +V+H+++Q  R++D     + GE++E
Sbjct  183  TLKVEELIRELKNQ--YTIVIVTHNMQQAARVSDSTAFFLNGELIE  226



>ref|WP_022446182.1| phosphate ABC transporter ATP-binding protein [Faecalibacterium 
sp. CAG:74]
 emb|CDE47595.1| phosphate ABC transporter ATP-binding protein [Faecalibacterium 
sp. CAG:74]
Length=270

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/238 (43%), Positives = 133/238 (56%), Gaps = 15/238 (6%)
 Frame = +1

Query  217  DEAAGTKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-  393
            D  A  KI +K L  +       L+ I LDI RG I   IGPSG GKST L+ LNR+ + 
Sbjct  18   DTLADVKIAIKDLN-LYYGAFHALHGINLDIERGKITAFIGPSGCGKSTLLKTLNRMNDL  76

Query  394  ----PANATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLS  558
                    ++ LDG+DI   +DV  LR +VGM+FQ P  F  +V DNI YGP   G    
Sbjct  77   IPDCRVEGSITLDGEDIYGSMDVNLLRKRVGMVFQKPNPFPMSVYDNIAYGPRTHGIHRK  136

Query  559  DdqvlrllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSA  720
                  + S     + +       NK    LS GQ QR+ +AR LA EPEVLL+DEPTSA
Sbjct  137  AQLDEIVESSLRNAAIWDELKDRLNKSALGLSGGQQQRLCIARALAVEPEVLLMDEPTSA  196

Query  721  LDPISTQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            LDPIST  IE++ + LK   + TI +V+H+++Q  RIAD     + G++VEV   DQL
Sbjct  197  LDPISTSKIEELCMELK--GKYTIVIVTHNMQQALRIADTTAFFLLGDMVEVGATDQL  252



>ref|WP_022375181.1| phosphate ABC transporter [Firmicutes bacterium CAG:270]
 emb|CDD70213.1| phosphate ABC transporter [Firmicutes bacterium CAG:270]
Length=250

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 135/233 (58%), Gaps = 15/233 (6%)
 Frame = +1

Query  232  TKIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----P  396
            +K++V+ L     K    L  I LD+P+  I   IGPSG GKST L++LNR+ +      
Sbjct  3    SKMKVENLDLYYGK-FKALKNINLDLPKNEITAFIGPSGCGKSTLLKSLNRMNDLVEGCK  61

Query  397  ANATVFLDGKDIC-DLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG----KKLSD  561
                V LDG+DI  D+DV  LR +VGM+FQ P  F  ++ DNI YGP   G     KL +
Sbjct  62   ITGKVTLDGEDIYGDMDVNLLRKRVGMVFQKPNPFPMSIYDNIAYGPRTHGIHNKAKLDE  121

Query  562  dqvlrllsla--dldssFCNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
                 L + A  D       K    LS GQ QR+ +AR LA EPEVLL+DEPTSALDPIS
Sbjct  122  IVEKSLRNAAIWDELKDRLKKSALGLSGGQQQRLCIARALAVEPEVLLMDEPTSALDPIS  181

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            T  IED+ V LK   + TI MV+H+++Q  RI+D     + GE+VE  + +QL
Sbjct  182  TSKIEDLAVELK--SKYTIIMVTHNMQQAVRISDNTAFFLLGEMVEYGRSEQL  232



>ref|WP_028498018.1| phosphate ABC transporter ATP-binding protein [Microvirgula aerodenitrificans]
Length=255

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 132/233 (57%), Gaps = 16/233 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PA  399
            K+QVK L          L  I + IP G +   IGPSG GKST LR  NR++E      A
Sbjct  8    KLQVKDLNFYYG-AFHALKHIDMTIPEGKVTAFIGPSGCGKSTLLRTFNRMFELYPGLRA  66

Query  400  NATVFLDGKDI--CDLDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
               + LDGK++   D+DV  LR KVGM+FQ P  F  ++ DN+ +G  L  +    +   
Sbjct  67   EGEILLDGKNLLASDIDVNLLRAKVGMVFQKPTPFPMSIYDNVAFGVKLYERMNKSELDE  126

Query  574  rllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
            R+       + +       N+ G  LS GQ QR+ +AR +A++PEVLLLDEPTSALDPIS
Sbjct  127  RVEWALRKAAIWEEVKDKLNQSGNSLSGGQQQRLCIARAVASKPEVLLLDEPTSALDPIS  186

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            T  IE+++  LK  +  TIA+V+H+++Q  R++D    +  GE++E    D +
Sbjct  187  TAQIEELVHELK--ENYTIAIVTHNMQQAARVSDYTAYMYLGELIEFGHTDSI  237



>ref|WP_013412189.1| phosphate ABC transporter ATP-binding protein [Caldicellulosiruptor 
owensensis]
 ref|YP_004002620.1| phosphate ABC transporter ATPase subunit [Caldicellulosiruptor 
owensensis OL]
 gb|ADQ04820.1| phosphate ABC transporter, ATPase subunit [Caldicellulosiruptor 
owensensis OL]
Length=249

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 124/211 (59%), Gaps = 14/211 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC-DLDV  447
            L  I + I    I  +IGPSG GKSTFLR LNR+ +          V+ +GKD+  ++DV
Sbjct  19   LKNINIKINEKAITALIGPSGCGKSTFLRTLNRMNDLIENVKIEGKVYFEGKDVYKEIDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            ++LR K+GM+FQ P  F  ++ DN+ YGP + G K  +     + +       +      
Sbjct  79   ITLRKKIGMVFQKPNPFPMSIYDNVAYGPRIHGIKKKEVLDEIVENSLKKAYLWDEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +AR LA EPEV+LLDEPTSALDPIST  IE++L +LK  K  T
Sbjct  139  LKKSAFSLSGGQQQRLCIARVLAVEPEVILLDEPTSALDPISTLKIEELLEQLK--KNYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            I +V+H+++Q  RI+D     + GE+VE  K
Sbjct  197  IIIVTHNMQQAARISDFTGFFLNGELVEFDK  227



>ref|WP_023992669.1| Phosphate import ATP-binding protein PstB [Methanobacterium sp. 
MB1]
 emb|CDG65640.1| Phosphate import ATP-binding protein PstB [Methanobacterium sp. 
MB1]
Length=251

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 136/226 (60%), Gaps = 16/226 (7%)
 Frame = +1

Query  235  KIQVKGLTRVSDKGLTLLNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPAN----  402
            +I+V+ L    D+ L +L  ++L IP+  +  +IGPSG GKSTF+R LNR+ +  +    
Sbjct  4    RIEVEDLNVYFDE-LHILKDVSLKIPKNAVTSLIGPSGCGKSTFIRTLNRMNDMISTFRM  62

Query  403  -ATVFLDGKDICD--LDVLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvl  573
              TV L+GKDI D  +DV+ LR KVGM+FQ P  F  ++ DN+ YG  + G    D    
Sbjct  63   EGTVLLEGKDIYDPKVDVVDLRKKVGMVFQKPNPFPKSIFDNVAYGLRVHGINDKDILAQ  122

Query  574  rllsladldssF------CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIS  735
            ++       + +       +K    LS GQ QR+ +ART+A EPEV+L+DEP SALDPIS
Sbjct  123  KVEESLRGAALWDEVKNILDKSAMGLSGGQQQRLCIARTIAVEPEVILMDEPCSALDPIS  182

Query  736  TQNIEDVLVRLKKEKRMTIAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            T  +ED++ +LK +   TI +V+H+++Q  R++      + GEIVE
Sbjct  183  TTKVEDLIHKLKND--YTIIIVTHNMQQATRVSKHTAFFLNGEIVE  226



>ref|WP_013290370.1| phosphate ABC transporter ATP-binding protein [Caldicellulosiruptor 
obsidiansis]
 ref|YP_003840356.1| phosphate ABC transporter ATPase [Caldicellulosiruptor obsidiansis 
OB47]
 gb|ADL42370.1| phosphate ABC transporter, ATPase subunit [Caldicellulosiruptor 
obsidiansis OB47]
Length=249

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 124/211 (59%), Gaps = 14/211 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC-DLDV  447
            L  I + I    I  +IGPSG GKSTFLR LNR+ +          V+ +GKD+  ++DV
Sbjct  19   LKNINIKINEKAITALIGPSGCGKSTFLRTLNRMNDLIENVKIEGKVYFEGKDVYKEIDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            ++LR K+GM+FQ P  F  ++ DN+ YGP + G K  +     + S       +      
Sbjct  79   ITLRKKIGMVFQKPNPFPMSIYDNVAYGPRIHGIKKKEVLDEIVESSLKKAYLWDEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
              K    LS GQ QR+ +AR LA EPEV+LLDEPTSALDPIST  IE++L +LK  K  T
Sbjct  139  LKKSAFSLSGGQQQRLCIARVLAVEPEVILLDEPTSALDPISTLKIEELLEQLK--KNYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLK  882
            I +V+H+++Q  RI+D     + GE+VE  K
Sbjct  197  IIIVTHNMQQAARISDFTGFFLNGELVEFDK  227



>ref|WP_017750683.1| phosphate ABC transporter ATP-binding protein [Clostridium tyrobutyricum]
 emb|CDL90099.1| Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1) [Clostridium 
tyrobutyricum DIVETGP]
Length=249

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 130/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWEPANAT-----VFLDGKDIC-DLDV  447
            L ++ L+  +  +  +IGPSG GKSTFLR +NR+ +  ++      VF + KDI  D DV
Sbjct  19   LKKVNLNAEKNSVTALIGPSGCGKSTFLRTINRMNDLIDSVRIEGEVFFEDKDIYKDYDV  78

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssF------  609
            + LR ++GM+FQ P  F  ++ DN+ YGP + G K  +     +       + +      
Sbjct  79   IELRKRIGMVFQNPNPFPMSIYDNVAYGPRIHGMKNKNTLDEIVERSLKGAAIWDEVKDR  138

Query  610  CNKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
             N+    LS GQ QR+ +ARTLA EPEVLL+DEPTSALDPIST  IE+++  LK  K+ T
Sbjct  139  LNRSALGLSGGQQQRLCIARTLAVEPEVLLMDEPTSALDPISTLKIEELMDILK--KKYT  196

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
            I +V+H+++Q  RI+D     + GEIVE  K +++
Sbjct  197  IIIVTHNMQQAGRISDYTAFFLNGEIVEDGKTEEI  231



>ref|WP_026196620.1| phosphate ABC transporter ATP-binding protein [Fangia hongkongensis]
Length=253

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 134/217 (62%), Gaps = 17/217 (8%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDICD--LD  444
            L+ I     R  I  +IGPSGSGKST LRALNR++E      A   + L+G+++ D  +D
Sbjct  24   LHNINASFERNKITALIGPSGSGKSTLLRALNRIYELYPKQKATGEILLEGQNLLDSSVD  83

Query  445  VLSLRCKVGMLFQLPALFEGTVADNIRYGPLLRGKKLSDdqvlrllsladldssFC----  612
            +  LR ++GM+FQ P  F  ++ +NI +   L  +KLS  ++   +  +   ++      
Sbjct  84   LNQLRKEIGMVFQKPTPFPMSIFENIAFAVRLH-EKLSKSEIANRVEESLKKAALWDEVK  142

Query  613  ---NKPGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKR  783
               ++PG +LS GQ QR+ +ART+A +PE+LLLDEPTSALDPIST+ IE ++  LK  + 
Sbjct  143  DKLHQPGTKLSGGQQQRLCIARTIAVKPEILLLDEPTSALDPISTKKIEALVTELK--EH  200

Query  784  MTIAMVSHSIKQIQRIADVVCLLVEGEIVEVLKPDQL  894
             TI MV+H++KQ +R++D    +++GEIVE     Q 
Sbjct  201  YTIIMVTHNLKQAERLSDNTMFMIDGEIVEYQSTKQF  237



>ref|WP_033316561.1| phosphate ABC transporter ATP-binding protein [Terrisporobacter 
glycolicus]
Length=252

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 129/208 (62%), Gaps = 14/208 (7%)
 Frame = +1

Query  286  LNQITLDIPRGLIMGIIGPSGSGKSTFLRALNRLWE-----PANATVFLDGKDIC-DLDV  447
            LN+I +DI    +  +IGPSG GKSTFLR LNR+ +          V +DG DI  + DV
Sbjct  22   LNKINMDIKPNKVTALIGPSGCGKSTFLRTLNRMNDLIEDVKIKGIVKVDGDDIYKNNDV  81

Query  448  LSLRCKVGMLFQLPALFEGTVADNIRYGPLLRG---KKLSDdqvlrllsladldssFCNK  618
            + LR K+GM+FQ P LF  ++ DN+ YGP + G   KK  D  V   L  A +     ++
Sbjct  82   IKLRTKIGMVFQKPNLFPMSIYDNVAYGPRVHGIKDKKTLDKIVEESLKGAAIWDEVKDR  141

Query  619  ---PGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVRLKKEKRMT  789
               P   LS GQ QRV +ART+A +P+V+L+DEPTSALDPIST  +E+++  LKK+   T
Sbjct  142  LKSPALGLSGGQQQRVCIARTIAMKPDVILMDEPTSALDPISTAKVEELIFELKKD--YT  199

Query  790  IAMVSHSIKQIQRIADVVCLLVEGEIVE  873
            I +V+H+++Q  RI+D     + GE++E
Sbjct  200  IVIVTHNMQQAARISDETGFFLNGELIE  227



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1936310281356