BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c91871_g1_i1 len=589 path=[567:0-588]

Length=589
                                                                      Score     E

gb|EYU28594.1|  hypothetical protein MIMGU_mgv1a015213mg              65.1    4e-10   
ref|XP_009415402.1|  PREDICTED: GPI-anchored protein LORELEI-like     64.3    7e-10   
ref|XP_010051915.1|  PREDICTED: GPI-anchored protein LORELEI-like     64.3    9e-10   
gb|KCW89530.1|  hypothetical protein EUGRSUZ_A01815                   63.5    5e-09   
ref|XP_010689291.1|  PREDICTED: GPI-anchored protein LORELEI-like     61.6    6e-09   
ref|XP_010676138.1|  PREDICTED: GPI-anchored protein LORELEI isof...  60.5    3e-08   
ref|XP_003526315.1|  PREDICTED: GPI-anchored protein LORELEI-like     59.7    3e-08   
ref|XP_010676137.1|  PREDICTED: GPI-anchored protein LORELEI isof...  60.5    3e-08   
ref|XP_002272406.1|  PREDICTED: GPI-anchored protein LORELEI          60.1    3e-08   Vitis vinifera
gb|KHN35256.1|  GPI-anchored protein LORELEI                          59.7    3e-08   
gb|EPS65032.1|  hypothetical protein M569_09746                       58.5    3e-08   
ref|XP_010676136.1|  PREDICTED: GPI-anchored protein LORELEI isof...  60.1    5e-08   
ref|XP_008229152.1|  PREDICTED: GPI-anchored protein LORELEI-like     58.9    6e-08   
ref|XP_006376499.1|  hypothetical protein POPTR_0013s13550g           58.9    7e-08   
ref|XP_011086363.1|  PREDICTED: GPI-anchored protein LORELEI-like     58.5    7e-08   
ref|XP_010061373.1|  PREDICTED: GPI-anchored protein LORELEI-like     58.2    8e-08   
ref|XP_010230249.1|  PREDICTED: GPI-anchored protein LORELEI-like     57.8    1e-07   
ref|XP_003618900.1|  GPI-anchored protein                             58.5    1e-07   
ref|XP_009399524.1|  PREDICTED: GPI-anchored protein LORELEI-like     58.2    1e-07   
gb|KFK40442.1|  hypothetical protein AALP_AA3G373700                  58.2    1e-07   
ref|XP_006412975.1|  hypothetical protein EUTSA_v10026448mg           57.4    2e-07   
gb|KFK35897.1|  hypothetical protein AALP_AA4G050600                  57.4    2e-07   
ref|XP_003540907.2|  PREDICTED: GPI-anchored protein LORELEI-like     57.8    2e-07   
ref|XP_009120131.1|  PREDICTED: GPI-anchored protein LORELEI-like     57.0    2e-07   
ref|XP_010928910.1|  PREDICTED: GPI-anchored protein LORELEI          57.4    2e-07   
ref|XP_010268555.1|  PREDICTED: GPI-anchored protein LORELEI-like     57.0    3e-07   
ref|XP_008381250.1|  PREDICTED: GPI-anchored protein LORELEI-like     57.0    3e-07   
ref|XP_010911139.1|  PREDICTED: GPI-anchored protein LORELEI-like     57.0    3e-07   
ref|XP_007132663.1|  hypothetical protein PHAVU_011G114300g           57.0    3e-07   
ref|XP_004137022.1|  PREDICTED: GPI-anchored protein LORELEI-like     57.0    3e-07   
ref|XP_009341970.1|  PREDICTED: GPI-anchored protein LORELEI-like     57.0    3e-07   
ref|XP_010258853.1|  PREDICTED: GPI-anchored protein LORELEI-like     56.6    4e-07   
ref|XP_006299016.1|  hypothetical protein CARUB_v10015143mg           56.6    4e-07   
gb|KDP24134.1|  hypothetical protein JCGZ_25791                       56.2    5e-07   
ref|XP_009417335.1|  PREDICTED: GPI-anchored protein LORELEI-like     56.2    6e-07   
ref|XP_007043591.1|  Lorelei-like-gpi anchored protein 3, putative    56.2    6e-07   
ref|XP_009357848.1|  PREDICTED: GPI-anchored protein LORELEI-like     56.2    6e-07   
ref|XP_008782955.1|  PREDICTED: GPI-anchored protein LORELEI          56.2    6e-07   
emb|CDY06519.1|  BnaC02g12430D                                        56.2    6e-07   
ref|XP_006474767.1|  PREDICTED: GPI-anchored protein LORELEI-like     55.8    7e-07   
ref|XP_009794220.1|  PREDICTED: GPI-anchored protein LORELEI-like     55.8    8e-07   
ref|XP_008455326.1|  PREDICTED: GPI-anchored protein LORELEI-like     55.8    8e-07   
ref|XP_009137777.1|  PREDICTED: GPI-anchored protein LORELEI-like     55.8    8e-07   
ref|XP_006452762.1|  hypothetical protein CICLE_v10009724mg           55.8    8e-07   
emb|CDP13646.1|  unnamed protein product                              55.8    8e-07   
ref|XP_011002848.1|  PREDICTED: GPI-anchored protein LORELEI-like     55.8    8e-07   
emb|CDY11953.1|  BnaC03g13790D                                        55.1    8e-07   
emb|CDY17398.1|  BnaA10g10320D                                        55.1    9e-07   
ref|XP_011037326.1|  PREDICTED: GPI-anchored protein LORELEI-like     55.5    9e-07   
emb|CDY11956.1|  BnaC03g13820D                                        55.5    1e-06   
ref|XP_009793721.1|  PREDICTED: GPI-anchored protein LORELEI          55.5    1e-06   
ref|XP_009602155.1|  PREDICTED: GPI-anchored protein LORELEI-like     54.7    1e-06   
emb|CDY51967.1|  BnaCnng21510D                                        54.7    1e-06   
ref|XP_011100611.1|  PREDICTED: GPI-anchored protein LORELEI-like     54.7    1e-06   
gb|KHG28349.1|  GPI-anchored LORELEI -like protein                    54.7    1e-06   
ref|XP_009126961.1|  PREDICTED: GPI-anchored protein LORELEI-like     55.1    1e-06   
ref|NP_200428.1|  LORELEI-LIKE-GPI-ANCHORED PROTEIN 1                 55.1    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517922.1|  conserved hypothetical protein                   55.1    1e-06   Ricinus communis
ref|XP_010913272.1|  PREDICTED: GPI-anchored protein LORELEI-like     55.1    2e-06   
gb|AAD20925.1|  hypothetical protein                                  55.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009418214.1|  PREDICTED: GPI-anchored protein LORELEI-like     54.7    2e-06   
ref|NP_179662.2|  LORELEI-like glucosylphosphatidylinositol-ancho...  54.7    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004953726.1|  PREDICTED: GPI-anchored protein LORELEI-like     54.7    2e-06   
ref|XP_006346081.1|  PREDICTED: GPI-anchored protein LORELEI-like     54.7    2e-06   
ref|XP_002325596.2|  hypothetical protein POPTR_0019s12470g           54.7    2e-06   Populus trichocarpa [western balsam poplar]
emb|CDY36781.1|  BnaA03g11050D                                        54.7    2e-06   
ref|XP_009620228.1|  PREDICTED: GPI-anchored protein LORELEI          54.7    2e-06   
ref|XP_002886298.1|  hypothetical protein ARALYDRAFT_480904           54.3    3e-06   
ref|XP_009132330.1|  PREDICTED: GPI-anchored protein LORELEI-like     54.3    3e-06   
ref|XP_007206010.1|  hypothetical protein PRUPE_ppa012359mg           54.7    3e-06   
ref|XP_004248165.1|  PREDICTED: GPI-anchored protein LORELEI          54.3    3e-06   
ref|XP_004959558.1|  PREDICTED: GPI-anchored protein LORELEI-like     54.7    3e-06   
ref|XP_010694217.1|  PREDICTED: GPI-anchored protein LORELEI-like     54.3    3e-06   
ref|XP_010110210.1|  hypothetical protein L484_009815                 56.2    3e-06   
ref|XP_004294877.1|  PREDICTED: GPI-anchored protein LORELEI-like     54.3    3e-06   
ref|XP_006409006.1|  hypothetical protein EUTSA_v10002112mg           53.9    3e-06   
ref|XP_010489005.1|  PREDICTED: GPI-anchored protein LORELEI-like...  53.9    3e-06   
ref|XP_010467781.1|  PREDICTED: GPI-anchored protein LORELEI          53.9    4e-06   
emb|CDY18987.1|  BnaC01g20810D                                        53.9    4e-06   
ref|XP_010489006.1|  PREDICTED: GPI-anchored protein LORELEI-like...  53.9    4e-06   
ref|XP_002869512.1|  hypothetical protein ARALYDRAFT_491945           53.1    4e-06   
ref|XP_002864439.1|  hypothetical protein ARALYDRAFT_495704           53.9    4e-06   
ref|XP_007020320.1|  Lorelei-like-gpi-anchored protein 1              53.9    4e-06   
ref|XP_006474766.1|  PREDICTED: GPI-anchored protein LORELEI-like     53.5    4e-06   
ref|XP_009144326.1|  PREDICTED: GPI-anchored protein LORELEI-like     53.9    4e-06   
ref|XP_006366032.1|  PREDICTED: GPI-anchored protein LORELEI-like     53.9    4e-06   
ref|XP_002460426.1|  hypothetical protein SORBIDRAFT_02g027890        53.9    5e-06   Sorghum bicolor [broomcorn]
emb|CDP14779.1|  unnamed protein product                              53.5    5e-06   
gb|AES74690.2|  GPI-anchored lorelei-like protein                     53.1    5e-06   
ref|XP_010438482.1|  PREDICTED: GPI-anchored protein LORELEI-like     53.5    6e-06   
ref|XP_007198874.1|  hypothetical protein PRUPE_ppa021505mg           52.8    6e-06   
ref|XP_002531773.1|  conserved hypothetical protein                   53.1    6e-06   Ricinus communis
ref|XP_006470135.1|  PREDICTED: GPI-anchored protein LORELEI-like     53.9    6e-06   
ref|NP_194557.2|  LORELEI-like-GPI anchored protein 3                 52.8    6e-06   Arabidopsis thaliana [mouse-ear cress]
gb|EMS49601.1|  hypothetical protein TRIUR3_12870                     53.9    6e-06   
ref|NP_001190858.1|  LORELEI-like-GPI anchored protein 3              53.1    7e-06   
ref|XP_009379118.1|  PREDICTED: GPI-anchored protein LORELEI-like     53.1    7e-06   
ref|XP_006447360.1|  hypothetical protein CICLE_v10017701mg           52.4    8e-06   
ref|XP_008344754.1|  PREDICTED: GPI-anchored protein LORELEI-like     52.4    9e-06   
dbj|BAA34247.1|  GPI-anchored protein                                 52.8    1e-05   Vigna radiata [mung bean]
ref|XP_008652853.1|  PREDICTED: GPI-anchored protein LORELEI-like     52.8    1e-05   
gb|AFK37390.1|  unknown                                               52.8    1e-05   
ref|XP_010433242.1|  PREDICTED: GPI-anchored protein LORELEI-like     52.8    1e-05   
ref|XP_010540877.1|  PREDICTED: GPI-anchored protein LORELEI-like     53.5    1e-05   
ref|XP_008353929.1|  PREDICTED: GPI-anchored protein LORELEI          52.8    1e-05   
ref|XP_008219196.1|  PREDICTED: GPI-anchored protein LORELEI          52.8    1e-05   
emb|CDY17399.1|  BnaA10g10330D                                        52.4    1e-05   
emb|CDY67878.1|  BnaC07g50470D                                        52.4    1e-05   
ref|XP_011039872.1|  PREDICTED: GPI-anchored protein LORELEI-like     52.8    1e-05   
ref|XP_010092396.1|  hypothetical protein L484_023775                 54.3    1e-05   
ref|XP_010448003.1|  PREDICTED: GPI-anchored protein LORELEI-like     52.4    2e-05   
ref|XP_009120133.1|  PREDICTED: GPI-anchored protein LORELEI-like     52.4    2e-05   
ref|XP_010545299.1|  PREDICTED: GPI-anchored protein LORELEI          52.4    2e-05   
ref|XP_010536787.1|  PREDICTED: GPI-anchored protein LORELEI isof...  52.0    2e-05   
ref|XP_009346687.1|  PREDICTED: GPI-anchored protein LORELEI isof...  52.4    2e-05   
gb|EYU33747.1|  hypothetical protein MIMGU_mgv1a014802mg              52.4    2e-05   
ref|XP_010497893.1|  PREDICTED: GPI-anchored protein LORELEI-like     50.4    2e-05   
ref|XP_008342975.1|  PREDICTED: GPI-anchored protein LORELEI-like     52.8    2e-05   
ref|XP_003618472.1|  Gpi-anchored protein                             51.6    2e-05   
ref|XP_003618898.1|  GPI-anchored protein                             51.6    2e-05   
ref|XP_009346686.1|  PREDICTED: GPI-anchored protein LORELEI isof...  52.0    2e-05   
ref|XP_008805529.1|  PREDICTED: GPI-anchored protein LORELEI-like     52.8    3e-05   
ref|XP_009769646.1|  PREDICTED: GPI-anchored protein LORELEI-like     51.6    3e-05   
ref|XP_002299077.2|  hypothetical protein POPTR_0001s47550g           51.6    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006284606.1|  hypothetical protein CARUB_v10005837mg           51.6    3e-05   
ref|XP_004499696.1|  PREDICTED: GPI-anchored protein LORELEI-like     51.2    4e-05   
gb|EPS72802.1|  hypothetical protein M569_01956                       50.4    4e-05   
ref|XP_009781682.1|  PREDICTED: GPI-anchored protein LORELEI-like     50.8    5e-05   
ref|XP_009772699.1|  PREDICTED: GPI-anchored protein LORELEI-like     50.4    6e-05   
ref|XP_008349506.1|  PREDICTED: GPI-anchored protein LORELEI-like     50.8    6e-05   
ref|NP_001062806.1|  Os09g0297800                                     50.8    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003598311.1|  GPI-anchored protein LORELEI                     50.4    7e-05   
ref|XP_007148652.1|  hypothetical protein PHAVU_005G003700g           50.4    8e-05   
ref|XP_010061394.1|  PREDICTED: GPI-anchored protein LORELEI          50.8    8e-05   
ref|NP_001137106.1|  GPI-anchored protein precursor                   50.4    8e-05   Zea mays [maize]
ref|XP_004139851.1|  PREDICTED: GPI-anchored protein LORELEI-like     50.4    8e-05   
ref|NP_001278540.1|  LOC100282585 precursor                           50.4    8e-05   
gb|ACG39459.1|  GPI-anchored protein                                  50.4    9e-05   Zea mays [maize]
gb|EMT30210.1|  hypothetical protein F775_16210                       50.1    9e-05   
gb|KHN20567.1|  GPI-anchored protein LORELEI-like protein             49.7    1e-04   
gb|KHN20566.1|  GPI-anchored protein LORELEI-like protein             50.1    1e-04   
ref|XP_010694216.1|  PREDICTED: GPI-anchored protein LORELEI-like     50.4    1e-04   
gb|EYU27506.1|  hypothetical protein MIMGU_mgv1a014908mg              50.1    1e-04   
emb|CDY51971.1|  BnaCnng21550D                                        49.7    1e-04   
ref|XP_010536786.1|  PREDICTED: GPI-anchored protein LORELEI isof...  50.4    1e-04   
ref|XP_004155476.1|  PREDICTED: GPI-anchored protein LORELEI-like     49.3    1e-04   
ref|XP_004139762.1|  PREDICTED: GPI-anchored protein LORELEI-like     50.1    1e-04   
ref|XP_004294295.1|  PREDICTED: GPI-anchored protein LORELEI-like     49.7    2e-04   
ref|XP_010277997.1|  PREDICTED: GPI-anchored protein LORELEI-like     48.9    2e-04   
gb|KFK44900.1|  hypothetical protein AALP_AA1G317500                  49.7    2e-04   
gb|ADU56196.1|  hypothetical protein                                  49.3    2e-04   
emb|CDX92776.1|  BnaC07g40340D                                        49.3    2e-04   
gb|ADD52581.1|  putative GPI-anchored protein                         49.3    2e-04   Paspalum notatum [Bahia grass]
gb|KFK27198.1|  hypothetical protein AALP_AA8G348200                  49.3    2e-04   
ref|XP_009614732.1|  PREDICTED: GPI-anchored protein LORELEI-like     48.9    2e-04   
ref|XP_008447799.1|  PREDICTED: GPI-anchored protein LORELEI-like     48.9    3e-04   
ref|XP_006647809.1|  PREDICTED: GPI-anchored protein LORELEI-like     48.9    3e-04   
ref|XP_003598310.1|  GPI-anchored protein LORELEI                     49.7    3e-04   
ref|XP_003527574.1|  PREDICTED: GPI-anchored protein LORELEI-like     48.9    3e-04   
ref|XP_006378004.1|  hypothetical protein POPTR_0011s17150g           50.1    3e-04   
ref|XP_009588024.1|  PREDICTED: GPI-anchored protein LORELEI-like     48.9    3e-04   
ref|NP_001236034.1|  uncharacterized protein LOC100527178 precursor   48.9    3e-04   
gb|KHN01506.1|  GPI-anchored protein LORELEI                          48.9    3e-04   
gb|EMT24398.1|  hypothetical protein F775_32885                       48.9    3e-04   
ref|XP_010450737.1|  PREDICTED: GPI-anchored protein LORELEI-like     48.5    4e-04   
ref|XP_008796546.1|  PREDICTED: GPI-anchored protein LORELEI-like     48.5    4e-04   
ref|XP_002452637.1|  hypothetical protein SORBIDRAFT_04g029590        48.5    4e-04   Sorghum bicolor [broomcorn]
ref|XP_011097693.1|  PREDICTED: GPI-anchored protein LORELEI-like     48.5    4e-04   
ref|XP_002531774.1|  conserved hypothetical protein                   48.1    5e-04   Ricinus communis
dbj|BAJ85659.1|  predicted protein                                    48.1    6e-04   
ref|XP_010483085.1|  PREDICTED: GPI-anchored protein LORELEI-like     48.1    6e-04   
ref|NP_001235471.1|  uncharacterized protein LOC100305699 precursor   47.8    6e-04   
ref|XP_011095640.1|  PREDICTED: GPI-anchored protein LORELEI-like     48.1    7e-04   
ref|XP_009137738.1|  PREDICTED: GPI-anchored protein LORELEI          47.4    8e-04   
ref|XP_010443262.1|  PREDICTED: GPI-anchored protein LORELEI-like     47.8    8e-04   
emb|CDY42734.1|  BnaA03g48050D                                        47.4    0.001   
emb|CDY39491.1|  BnaA01g24970D                                        46.6    0.001   
gb|EMS45797.1|  hypothetical protein TRIUR3_25551                     47.4    0.001   



>gb|EYU28594.1| hypothetical protein MIMGU_mgv1a015213mg [Erythranthe guttata]
Length=164

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 69/130 (53%), Gaps = 24/130 (18%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCT  383
            G A+SS++  +  +     GRSLL             + K  C+    NMNYT++TSQC 
Sbjct  18   GFASSSYISNEVIEPHGSLGRSLL-------------QQKSSCSVDFENMNYTVITSQC-  63

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCA--FFMFENLHNKGKYPPTILKYLCEQ  212
            + P +Y    CC  LK+L+C  +DQ+N     CA  FF + NL+  GKYPP +   LC++
Sbjct  64   KGP-NYSPERCCPPLKQLLCPVKDQVNDLKSNCADTFFSYVNLY--GKYPPGLFSALCKE  120

Query  211  FEGKKKDLDC  182
             E   + LDC
Sbjct  121  GE---EGLDC  127



>ref|XP_009415402.1| PREDICTED: GPI-anchored protein LORELEI-like [Musa acuminata 
subsp. malaccensis]
Length=167

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 60/126 (48%), Gaps = 20/126 (16%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQ  377
            A S+F+  D  ++    GRSLL             ++K  C     NMNYTI+TS+C + 
Sbjct  22   AGSTFISGDVFESRGSAGRSLL-------------QEKSSCPISFENMNYTIITSKC-KG  67

Query  376  PLSYPVATCCKSLKRLMCKYRDQLNPNP-KCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
            P  YP   CC + K   C Y DQLN     CA  MF  ++  GKYPP +    C +    
Sbjct  68   P-QYPAKLCCGAFKEFACPYADQLNDETNDCASTMFSYINLYGKYPPGLFASECRE---G  123

Query  199  KKDLDC  182
            K+ L C
Sbjct  124  KEGLAC  129



>ref|XP_010051915.1| PREDICTED: GPI-anchored protein LORELEI-like [Eucalyptus grandis]
Length=171

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 20/128 (16%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCT  383
            G+A+SSF+     ++    GRSLL             + KK C+    N NYTI+TSQC 
Sbjct  19   GVASSSFIHDGVFESREAAGRSLL-------------QAKKSCSVDFENQNYTILTSQC-  64

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + P  Y    CC++ K   C + DQ+N     CA  MF  ++  GKYPP +    C++  
Sbjct  65   KGP-QYTAKLCCQAFKEFACPFTDQINDLTTDCASTMFSYINLYGKYPPGLFANECKE--  121

Query  205  GKKKDLDC  182
              K+ LDC
Sbjct  122  -GKEGLDC  128



>gb|KCW89530.1| hypothetical protein EUGRSUZ_A01815 [Eucalyptus grandis]
Length=285

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 20/128 (16%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCT  383
            G+A+SSF+     ++    GRSLL             + KK C+    N NYTI+TSQC 
Sbjct  133  GVASSSFIHDGVFESREAAGRSLL-------------QAKKSCSVDFENQNYTILTSQC-  178

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + P  Y    CC++ K   C + DQ+N     CA  MF  ++  GKYPP +    C++  
Sbjct  179  KGP-QYTAKLCCQAFKEFACPFTDQINDLTTDCASTMFSYINLYGKYPPGLFANECKE--  235

Query  205  GKKKDLDC  182
              K+ LDC
Sbjct  236  -GKEGLDC  242



>ref|XP_010689291.1| PREDICTED: GPI-anchored protein LORELEI-like [Beta vulgaris subsp. 
vulgaris]
Length=166

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 62/126 (49%), Gaps = 20/126 (16%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQ  377
            A+SSF+     ++    GRSLL             + +K C     N NYTI+TSQC + 
Sbjct  19   ASSSFISEAIFESHRSTGRSLL-------------QTQKNCPINFENQNYTIITSQC-KG  64

Query  376  PLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
            P  Y   TCCK+ K   C + D+LN  +  CA  MF  ++  GKYPP I    C++    
Sbjct  65   P-KYSADTCCKAFKEFACPFADELNDMSNNCASTMFSYINLYGKYPPGIFANECKE---G  120

Query  199  KKDLDC  182
            K  L+C
Sbjct  121  KHGLEC  126



>ref|XP_010676138.1| PREDICTED: GPI-anchored protein LORELEI isoform X3 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676139.1| PREDICTED: GPI-anchored protein LORELEI isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=192

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 63/132 (48%), Gaps = 16/132 (12%)
 Frame = -1

Query  538  LDYDTPKTSVEKGRSLLLKN-SYEEAKQMYFE---------DKKQCAFVN--NMNYTIVT  395
            L   TP T+V    +LLL + S  E  Q+              +Q   VN  N+NYTI+T
Sbjct  20   LGLATPVTAVILSITLLLPSASASETDQLLHPRVSAARSLLQAQQGCPVNFENLNYTIIT  79

Query  394  SQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNP-KCAFFMFENLHNKGKYPPTILKYLC  218
            S+C R P  YP   CC++ K L C Y D+LN     CA  MF  ++  G YPP I    C
Sbjct  80   SRC-RGP-RYPPNICCEAFKDLACPYADELNDQTNNCATTMFSYINLNGHYPPGIFANEC  137

Query  217  EQFEGKKKDLDC  182
                  K+ L+C
Sbjct  138  RD-RHSKRGLEC  148



>ref|XP_003526315.1| PREDICTED: GPI-anchored protein LORELEI-like [Glycine max]
Length=166

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 63/127 (50%), Gaps = 20/127 (16%)
 Frame = -1

Query  556  IATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTR  380
            ++++ FL  D  ++    GR+LL             + KK C     N NYT++TSQC +
Sbjct  20   VSSAPFLSDDIFESGASTGRALL-------------QAKKACGVEFENKNYTVLTSQC-K  65

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P  YP   CC++ K+  C + +++N     CA  MF  ++  GKYPP +    C++   
Sbjct  66   GP-QYPPKVCCEAFKQFACPFSNEVNDMTTDCATVMFSYINIYGKYPPGLFANQCKE---  121

Query  202  KKKDLDC  182
              + LDC
Sbjct  122  GNQGLDC  128



>ref|XP_010676137.1| PREDICTED: GPI-anchored protein LORELEI isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=216

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 62/130 (48%), Gaps = 14/130 (11%)
 Frame = -1

Query  538  LDYDTPKTSVEKGRSLLLKNSYEE---------AKQMYFEDKKQCAF-VNNMNYTIVTSQ  389
            L   TP T+V    +LLL ++            A +   + ++ C     N+NYTI+TS+
Sbjct  46   LGLATPVTAVILSITLLLPSASASDQLLHPRVSAARSLLQAQQGCPVNFENLNYTIITSR  105

Query  388  CTRQPLSYPVATCCKSLKRLMCKYRDQLNPNP-KCAFFMFENLHNKGKYPPTILKYLCEQ  212
            C R P  YP   CC++ K L C Y D+LN     CA  MF  ++  G YPP I    C  
Sbjct  106  C-RGP-RYPPNICCEAFKDLACPYADELNDQTNNCATTMFSYINLNGHYPPGIFANECRD  163

Query  211  FEGKKKDLDC  182
                K+ L+C
Sbjct  164  -RHSKRGLEC  172



>ref|XP_002272406.1| PREDICTED: GPI-anchored protein LORELEI [Vitis vinifera]
 emb|CBI21846.3| unnamed protein product [Vitis vinifera]
Length=171

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 62/126 (49%), Gaps = 20/126 (16%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQ  377
            A+SSF+ +D  ++    GR+LL             + KK C      +NYTI+TSQC + 
Sbjct  22   ASSSFISHDVLQSHESTGRTLL-------------QTKKSCPVNFEFLNYTIITSQC-KG  67

Query  376  PLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
            P  Y    CC + K   C Y D+LN     CA  MF  ++  GKYPP +    C++    
Sbjct  68   P-QYSPKLCCGAFKDFACPYADELNDLTNDCASTMFSYINLYGKYPPGLFASECQE---G  123

Query  199  KKDLDC  182
            K+ L+C
Sbjct  124  KEGLEC  129



>gb|KHN35256.1| GPI-anchored protein LORELEI [Glycine soja]
Length=166

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 63/127 (50%), Gaps = 20/127 (16%)
 Frame = -1

Query  556  IATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTR  380
            ++++ FL  D  ++    GR+LL             + KK C     N NYT++TSQC +
Sbjct  20   VSSAPFLSDDIFESGASTGRALL-------------QAKKACGVDFENKNYTVLTSQC-K  65

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P  YP   CC++ K+  C + +++N     CA  MF  ++  GKYPP +    C++   
Sbjct  66   GP-QYPPKVCCEAFKQFACPFSNEVNDMTTDCATVMFSYINIYGKYPPGLFANQCKE---  121

Query  202  KKKDLDC  182
              + LDC
Sbjct  122  GNQGLDC  128



>gb|EPS65032.1| hypothetical protein M569_09746, partial [Genlisea aurea]
Length=106

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 61/111 (55%), Gaps = 24/111 (22%)
 Frame = -1

Query  502  GRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLM  326
            GRSLL             + K  C+    +MNYT++TSQC + P +Y    CC  LK+L+
Sbjct  7    GRSLL-------------QQKTSCSVDFEHMNYTVITSQC-KGP-NYSPERCCAPLKQLL  51

Query  325  CKYRDQLNP-NPKCA--FFMFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
            C  +DQ+N  N  CA  FF + N++  GKYPP +   LC++ E   + LDC
Sbjct  52   CPVKDQVNDLNSNCAETFFSYANIY--GKYPPGLFASLCKEGE---QGLDC  97



>ref|XP_010676136.1| PREDICTED: GPI-anchored protein LORELEI isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=218

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 63/132 (48%), Gaps = 16/132 (12%)
 Frame = -1

Query  538  LDYDTPKTSVEKGRSLLLKN-SYEEAKQMYFE---------DKKQCAFVN--NMNYTIVT  395
            L   TP T+V    +LLL + S  E  Q+              +Q   VN  N+NYTI+T
Sbjct  46   LGLATPVTAVILSITLLLPSASASETDQLLHPRVSAARSLLQAQQGCPVNFENLNYTIIT  105

Query  394  SQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNP-KCAFFMFENLHNKGKYPPTILKYLC  218
            S+C R P  YP   CC++ K L C Y D+LN     CA  MF  ++  G YPP I    C
Sbjct  106  SRC-RGP-RYPPNICCEAFKDLACPYADELNDQTNNCATTMFSYINLNGHYPPGIFANEC  163

Query  217  EQFEGKKKDLDC  182
                  K+ L+C
Sbjct  164  RD-RHSKRGLEC  174



>ref|XP_008229152.1| PREDICTED: GPI-anchored protein LORELEI-like [Prunus mume]
Length=165

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 23/123 (19%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQ---MYFEDKKQCAFVNNMNYTIVTSQCT  383
            ++++FL  D  ++    GRSLL      +AKQ   + FE         N NYTI+TS C 
Sbjct  23   SSATFLSNDIFQSGGSIGRSLL------QAKQNCPVNFE---------NQNYTIITSMC-  66

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + P +YP  +CC++LK   C + D +N     CA  MF  ++  GKYPP +    C   E
Sbjct  67   KGP-NYPAKSCCEALKDFACPFADAINDLKNDCATTMFSYINIYGKYPPGLFASQCR--E  123

Query  205  GKK  197
            GK+
Sbjct  124  GKE  126



>ref|XP_006376499.1| hypothetical protein POPTR_0013s13550g [Populus trichocarpa]
 gb|ERP54296.1| hypothetical protein POPTR_0013s13550g [Populus trichocarpa]
Length=164

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 61/129 (47%), Gaps = 21/129 (16%)
 Frame = -1

Query  559  GIATSS-FLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQC  386
            G+ATSS F+ YD        GR+LL         QM    KK C     N++Y+++T +C
Sbjct  19   GLATSSSFISYDALDVHGSSGRTLL---------QM----KKACNISFENLDYSVLTDKC  65

Query  385  TRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQF  209
             + P  YP   CC + K   C + D +N     CA  MF  ++  GKYPP +    C + 
Sbjct  66   -KGP-QYPAKPCCDAFKEFACPFSDAINDLESDCASTMFSFINLYGKYPPGLFANECRE-  122

Query  208  EGKKKDLDC  182
               K  LDC
Sbjct  123  --DKNGLDC  129



>ref|XP_011086363.1| PREDICTED: GPI-anchored protein LORELEI-like [Sesamum indicum]
Length=167

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 65/131 (50%), Gaps = 25/131 (19%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEK-GRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQC  386
            G A+SS++  +  +      GRSLL             + K  C     +MNYT++TSQC
Sbjct  18   GFASSSYISNEVLEPHHGSVGRSLL-------------QQKTACTVDFEHMNYTVITSQC  64

Query  385  TRQPLSYPVATCCKSLKRLMCKYRDQLN-PNPKC--AFFMFENLHNKGKYPPTILKYLCE  215
             + P +Y    CC  LK+L+C   +Q N P   C   FF + NL+  GKYPP +   LC 
Sbjct  65   -KGP-NYAAERCCLPLKQLICPVHEQFNDPRSNCPETFFSYVNLY--GKYPPGLFASLCR  120

Query  214  QFEGKKKDLDC  182
            + E   K LDC
Sbjct  121  EGE---KGLDC  128



>ref|XP_010061373.1| PREDICTED: GPI-anchored protein LORELEI-like [Eucalyptus grandis]
 gb|KCW68308.1| hypothetical protein EUGRSUZ_F01976 [Eucalyptus grandis]
Length=140

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLN-PNPKCAFFMFENLHNKGKYPP  239
            +NYT++TSQC + P SYP   CCK+ K   C Y   LN PN  CA  MF  ++  GKYPP
Sbjct  61   LNYTVITSQC-KGP-SYPAKACCKAFKEFACPYAHVLNDPNNDCASTMFSYINLYGKYPP  118

Query  238  TILKYLCEQFEGKK  197
             +    C   EGK+
Sbjct  119  GLFATKCR--EGKQ  130



>ref|XP_010230249.1| PREDICTED: GPI-anchored protein LORELEI-like, partial [Brachypodium 
distachyon]
Length=136

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 46/87 (53%), Gaps = 4/87 (5%)
 Frame = -1

Query  466  AKQMYFEDKKQCAFV-NNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLN-PNP  293
            A +   + KK C    +  NYTI+TS+C + PL Y  A CC++LK   C Y   +N P  
Sbjct  5    AGRSLLQTKKDCPVTFDGANYTIITSRC-KGPL-YQAALCCEALKDFACPYAVYINDPAT  62

Query  292  KCAFFMFENLHNKGKYPPTILKYLCEQ  212
             CA  MF  +H  GKYPP +    C +
Sbjct  63   NCAATMFSFIHLYGKYPPGLFANTCRE  89



>ref|XP_003618900.1| GPI-anchored protein [Medicago truncatula]
 gb|AES75118.1| GPI-anchored lorelei-like protein, putative [Medicago truncatula]
 gb|KEH25343.1| GPI-anchored lorelei-like protein, putative [Medicago truncatula]
Length=178

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 20/126 (16%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQ  377
            ++S F   +  +++   GR+LL             +D K C     N NYTI+TSQC + 
Sbjct  29   SSSPFPSDNIFESAASTGRALL-------------QDLKACKVDFENQNYTIITSQC-KA  74

Query  376  PLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
            P  YP  +CC++ K+  C + D+LN     CA  MF  ++  GKYP  +    C +    
Sbjct  75   P-RYPPKSCCEAFKQFACPFADELNDLTTDCAAVMFGYINAYGKYPLGLFASECRE---G  130

Query  199  KKDLDC  182
            KK LDC
Sbjct  131  KKGLDC  136



>ref|XP_009399524.1| PREDICTED: GPI-anchored protein LORELEI-like [Musa acuminata 
subsp. malaccensis]
Length=172

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 59/126 (47%), Gaps = 20/126 (16%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQ  377
            A SSF+  D   +    GRSLL             + K  C      MNYTI+TS+C + 
Sbjct  22   AASSFISGDAFLSHGSGGRSLL-------------QAKTSCPVNFEFMNYTIITSKC-KG  67

Query  376  PLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
            P  YP   CC++LK   C Y ++LN     CA  MF  ++  G+YPP +    C +    
Sbjct  68   P-QYPAKFCCEALKEFACPYAEELNDLTNDCASTMFSYINLYGRYPPGLFASECRE---G  123

Query  199  KKDLDC  182
            K+ L C
Sbjct  124  KEGLSC  129



>gb|KFK40442.1| hypothetical protein AALP_AA3G373700 [Arabis alpina]
Length=164

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 58/120 (48%), Gaps = 18/120 (15%)
 Frame = -1

Query  538  LDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQCTRQPLSYPV  359
            L YD         RSLL      +AK    ED        N NYTI+TS+C + P +YP 
Sbjct  22   LSYDHLDPHAATSRSLL------QAKSTCKED------FANKNYTIITSKC-KGP-NYPA  67

Query  358  ATCCKSLKRLMCKYRDQLNPNP-KCAFFMFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
              CC + K   C + + LN    +CA  MF  ++  G+YPP I   +C++    K+ LDC
Sbjct  68   KVCCAAFKEFACPFAEALNDEKNECASTMFSYINLYGRYPPGIFANMCKE---GKEGLDC  124



>ref|XP_006412975.1| hypothetical protein EUTSA_v10026448mg [Eutrema salsugineum]
 gb|ESQ54428.1| hypothetical protein EUTSA_v10026448mg [Eutrema salsugineum]
Length=159

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 68/145 (47%), Gaps = 18/145 (12%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQCTR  380
            G A+S  +  D  ++     R+LL      +AK    ED        + NYTI+TS+C +
Sbjct  19   GFASSLHISLDEIESHPATSRALL------QAKTPCKED------FASKNYTIITSRC-K  65

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P +YP   CC + K   C + + LN    +CA  MF  ++  G+YPP I   +C++   
Sbjct  66   GP-NYPAKVCCSAFKEFACPFAEALNDEKTECASTMFSYINIYGRYPPGIFANMCKE---  121

Query  202  KKKDLDCFGY*LIYMKQNAAKLVQN  128
             K+ LDC    +      +A LV  
Sbjct  122  GKEGLDCTDVTVASASDASAPLVST  146



>gb|KFK35897.1| hypothetical protein AALP_AA4G050600 [Arabis alpina]
Length=160

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 63/127 (50%), Gaps = 18/127 (14%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQCTR  380
            G A+S  +  D  ++     R+LL      +AK    ED        N NYTI+TS+C +
Sbjct  19   GFASSLHISLDEFESHSTTSRALL------QAKSTCKED------FANKNYTIITSKC-K  65

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P +YP   CC + K   C + + LN    +CA  MF  ++  G+YPP I   +C++   
Sbjct  66   GP-NYPAKICCSAFKDFACPFAEALNDEKTECASTMFSYINLYGRYPPGIFANMCKE---  121

Query  202  KKKDLDC  182
             K+ LDC
Sbjct  122  GKEGLDC  128



>ref|XP_003540907.2| PREDICTED: GPI-anchored protein LORELEI-like [Glycine max]
 gb|KHN31982.1| GPI-anchored protein LORELEI [Glycine soja]
Length=174

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 61/127 (48%), Gaps = 20/127 (16%)
 Frame = -1

Query  556  IATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTR  380
            ++++ FL  D        GR+LL             + KK C     N NYT++TSQC +
Sbjct  26   VSSAPFLSDDIFGAEASTGRALL-------------QAKKACGVDFENQNYTVLTSQC-K  71

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P  YP   CC++ K+  C + +++N     C+  MF  ++  GKYPP +    C++   
Sbjct  72   GP-QYPPKVCCEAFKQFACPFANEINDMTTDCSSVMFSYINIYGKYPPGLFANECKE---  127

Query  202  KKKDLDC  182
              + LDC
Sbjct  128  GNQGLDC  134



>ref|XP_009120131.1| PREDICTED: GPI-anchored protein LORELEI-like [Brassica rapa]
Length=130

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 52/102 (51%), Gaps = 4/102 (4%)
 Frame = -1

Query  496  SLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCK  320
            S+L+K+      +   + KK C      MNYTI+TSQC + P  YP   CC + K   C 
Sbjct  26   SVLIKSETLVNGRNLLQKKKACPVNFEFMNYTIITSQC-KGP-KYPPKKCCSAFKEFACP  83

Query  319  YRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
            Y DQLN     CA  MF  ++  GKYPP +    C++  G K
Sbjct  84   YADQLNDFRNDCATTMFSYINLYGKYPPGLFANSCQEKGGLK  125



>ref|XP_010928910.1| PREDICTED: GPI-anchored protein LORELEI [Elaeis guineensis]
Length=165

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 62/122 (51%), Gaps = 19/122 (16%)
 Frame = -1

Query  556  IATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTR  380
            +  ++F+  D  ++    GR+LL             + KK+C     +MNYTI+TSQC +
Sbjct  23   VTATTFIAGDVLQSHGPTGRNLL-------------QAKKKCEINFESMNYTIITSQC-K  68

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P  Y    CC +LK   C + + LN  +  CA  MF  ++  GKYPP +  + C+  EG
Sbjct  69   GP-QYNANFCCSALKEFACPHAESLNDLSSDCASTMFSYINLYGKYPPGLFAHECK--EG  125

Query  202  KK  197
            K+
Sbjct  126  KE  127



>ref|XP_010268555.1| PREDICTED: GPI-anchored protein LORELEI-like [Nelumbo nucifera]
Length=158

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 62/129 (48%), Gaps = 20/129 (16%)
 Frame = -1

Query  556  IATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTR  380
            +++SSF+  D  +     GR+LL             + KK C     ++NY+I+T+QC +
Sbjct  19   VSSSSFISDDVFECHGATGRNLL-------------QAKKSCPVNFESLNYSIITTQC-K  64

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P  YP   CC +LK   C + D LN     CA  MF  ++  GKYPP +    C +   
Sbjct  65   GP-QYPPKLCCGALKEFACPFADDLNDMTNDCASTMFSYINLYGKYPPGLFASECRE---  120

Query  202  KKKDLDCFG  176
             K+ L C G
Sbjct  121  GKEGLSCDG  129



>ref|XP_008381250.1| PREDICTED: GPI-anchored protein LORELEI-like [Malus domestica]
Length=168

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 21/123 (17%)
 Frame = -1

Query  553  ATSSFLDYDTPKT--SVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCT  383
            ++++FL YD  ++  S   GR+LL             + KK C     N NYTI+TS+C 
Sbjct  20   SSTTFLSYDIFESGGSSTGGRALL-------------QAKKNCPVNFENQNYTIITSKC-  65

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + P +YP  +CC +LK   C + +++N     CA  MF  ++  GKYPP +    C   E
Sbjct  66   KGP-NYPAKSCCDALKDFACPFTEEINDLKNDCASTMFSYINIYGKYPPGLFASQCR--E  122

Query  205  GKK  197
            GK+
Sbjct  123  GKE  125



>ref|XP_010911139.1| PREDICTED: GPI-anchored protein LORELEI-like [Elaeis guineensis]
Length=165

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 61/122 (50%), Gaps = 19/122 (16%)
 Frame = -1

Query  556  IATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTR  380
            +  ++F+  D  ++    GR+LL             + KK+C     +MNYTI+TSQC +
Sbjct  23   VTATTFIAGDVLQSHGPTGRNLL-------------QAKKKCEINFESMNYTIITSQC-K  68

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P  Y    CC +LK   C + + LN  +  CA  MF  ++  GKYPP +  + C   EG
Sbjct  69   GP-QYNANFCCSALKEFACPHAESLNDLSSDCASTMFSYINLYGKYPPGLFAHECR--EG  125

Query  202  KK  197
            K+
Sbjct  126  KE  127



>ref|XP_007132663.1| hypothetical protein PHAVU_011G114300g [Phaseolus vulgaris]
 gb|ESW04657.1| hypothetical protein PHAVU_011G114300g [Phaseolus vulgaris]
Length=167

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 20/126 (16%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQ  377
            + +  +  D  ++    GR+LL             + KK CA    N NYT++TSQC + 
Sbjct  21   SAAPLISDDIFESGASTGRALL-------------QAKKACAVDFENQNYTVLTSQC-KG  66

Query  376  PLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
            P  YP   CC++ K+  C + D++N     CA  MF  ++  GKYPP +    C   +G 
Sbjct  67   P-QYPPKVCCEAFKQFACPFADEINDLTTNCAEVMFSYINIYGKYPPGLFANEC---KGG  122

Query  199  KKDLDC  182
            +  L+C
Sbjct  123  EIGLEC  128



>ref|XP_004137022.1| PREDICTED: GPI-anchored protein LORELEI-like [Cucumis sativus]
 gb|KGN43612.1| hypothetical protein Csa_7G047960 [Cucumis sativus]
Length=174

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 19/118 (16%)
 Frame = -1

Query  547  SSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPL  371
            S FL Y+  K+    GRSLL             + KK C   +   NYTI+TS+C + P 
Sbjct  26   SPFLSYEALKSGQFTGRSLL-------------QAKKSCPVDMEGQNYTILTSKC-KGP-  70

Query  370  SYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
             YP A CC++L    C + D+LN     CA  MF  ++  G+YPP +    C+  EGK
Sbjct  71   KYPAALCCEALLEFCCGFVDELNDMTNNCAETMFSYINLYGQYPPGLFANQCK--EGK  126



>ref|XP_009341970.1| PREDICTED: GPI-anchored protein LORELEI-like [Pyrus x bretschneideri]
Length=168

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 63/123 (51%), Gaps = 21/123 (17%)
 Frame = -1

Query  553  ATSSFLDYDTPKT--SVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCT  383
            ++++F+ YD  +   S   GR+LL             + KK C     N NYTI+TS+C 
Sbjct  21   SSANFISYDILRAGGSSTGGRALL-------------QAKKNCPVNFENQNYTIITSKC-  66

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + P +YP  +CC +LK   C + +++N     CA  MF  ++  GKYPP +    C   E
Sbjct  67   KGP-NYPAKSCCNALKDFACPFTEEINDLKNDCASTMFSYINIYGKYPPGLFASQCR--E  123

Query  205  GKK  197
            GK+
Sbjct  124  GKE  126



>ref|XP_010258853.1| PREDICTED: GPI-anchored protein LORELEI-like [Nelumbo nucifera]
Length=165

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 20/126 (16%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQ  377
            A+SSF+  +  ++    GR+LL             + KK C+      NYTI+TSQC + 
Sbjct  19   ASSSFISDNVFESHGSIGRNLL-------------QAKKGCSVNFEFQNYTIITSQC-KG  64

Query  376  PLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
            P  YP   CC +LK   C++ ++LN     CA  MF  ++  GKYPP +    C +    
Sbjct  65   P-QYPPNICCAALKEFACQFSEELNDLTNDCASTMFSYINLNGKYPPGLFANECRE---G  120

Query  199  KKDLDC  182
            K  L+C
Sbjct  121  KLGLEC  126



>ref|XP_006299016.1| hypothetical protein CARUB_v10015143mg [Capsella rubella]
 gb|EOA31914.1| hypothetical protein CARUB_v10015143mg [Capsella rubella]
Length=164

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 63/122 (52%), Gaps = 20/122 (16%)
 Frame = -1

Query  544  SFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQCTRQPLSY  365
            S+ ++D P T+    R+LL      +A+    ED        + NYTI+TS+C + P +Y
Sbjct  23   SYDEFDRPHTATS--RTLL------QARTTCKED------FASKNYTIITSKC-KGP-NY  66

Query  364  PVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPTILKYLCEQFEGKKKDL  188
            P A CC + K   C + + +N     CA  MF  ++  G+YPP I   +C++    K+ L
Sbjct  67   PAAVCCSAFKDFACPFAEAINDEKSDCASTMFSYINIYGRYPPGIFANMCKE---GKEGL  123

Query  187  DC  182
            DC
Sbjct  124  DC  125



>gb|KDP24134.1| hypothetical protein JCGZ_25791 [Jatropha curcas]
Length=164

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 62/126 (49%), Gaps = 20/126 (16%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQ  377
            ++SSF+ YD        GR+LL             + KK+C     +++Y++ TS+C + 
Sbjct  23   SSSSFISYDVLNPDGHSGRTLL-------------QAKKECNISFESLDYSVFTSKC-KG  68

Query  376  PLSYPVATCCKSLKRLMCKYRDQLNPNP-KCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
            PL YP  +CC + +   C Y   LN     CA  MF  ++  GKYPP +    C+    K
Sbjct  69   PL-YPAKSCCSAFREFACPYVTTLNDRTNNCAETMFSYINLYGKYPPGLFANECKD---K  124

Query  199  KKDLDC  182
            K+ ++C
Sbjct  125  KEGIEC  130



>ref|XP_009417335.1| PREDICTED: GPI-anchored protein LORELEI-like [Musa acuminata 
subsp. malaccensis]
Length=167

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 55/119 (46%), Gaps = 18/119 (15%)
 Frame = -1

Query  559  GIAT-SSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQC  386
            G+AT SSF+  D        GRSLL             +    C      +NYTI+TSQC
Sbjct  19   GLATASSFISDDVLVPRGSGGRSLL-------------QTPTNCPLSFEFLNYTIITSQC  65

Query  385  TRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQ  212
             + PL YPV  CC + K L C Y  +LN     CA  MF  ++  GKYPP +    C  
Sbjct  66   -KGPL-YPVDRCCGAFKELACPYAAELNDLTNNCATNMFSYINLYGKYPPGLFSSECRD  122



>ref|XP_007043591.1| Lorelei-like-gpi anchored protein 3, putative [Theobroma cacao]
 gb|EOX99422.1| Lorelei-like-gpi anchored protein 3, putative [Theobroma cacao]
Length=160

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 7/101 (7%)
 Frame = -1

Query  478  SYEEAKQMYFEDKKQCA-FVNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLN  302
            S+    +   + KK C+    + NYTI+TS C + P  YP   CC++LK   C + D+LN
Sbjct  33   SHGSTGRYLLQAKKACSEDFEHKNYTIITSMC-KGP-EYPAKGCCQALKEFACPFADKLN  90

Query  301  P-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
              +  CA  MF  ++  GKYPP +   +C +    K+ L C
Sbjct  91   DLSTDCASTMFSYINLYGKYPPGLFANMCRE---GKQGLQC  128



>ref|XP_009357848.1| PREDICTED: GPI-anchored protein LORELEI-like [Pyrus x bretschneideri]
 ref|XP_009357882.1| PREDICTED: GPI-anchored protein LORELEI-like [Pyrus x bretschneideri]
Length=168

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 65/126 (52%), Gaps = 22/126 (17%)
 Frame = -1

Query  559  GIATSS-FLDYDTPKT--SVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTS  392
            G A+S+ FL YD  ++  S   GR+LL             + +K C     N NYTI+TS
Sbjct  17   GFASSTTFLSYDIFESGGSSTGGRALL-------------QAQKNCPVNFENQNYTIITS  63

Query  391  QCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCE  215
            +C + P +YP  +CC +LK   C + +++N     CA  MF  ++  GKYPP +    C 
Sbjct  64   KC-KGP-NYPAKSCCDALKDFACPFTNEINDLKNDCASTMFSYINIYGKYPPGLFASQCR  121

Query  214  QFEGKK  197
              EGK+
Sbjct  122  --EGKE  125



>ref|XP_008782955.1| PREDICTED: GPI-anchored protein LORELEI [Phoenix dactylifera]
Length=162

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 6/96 (6%)
 Frame = -1

Query  478  SYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLN  302
            S+    +   + KK+C     +MNYT++TSQC + P  Y    CC +LK   C + + LN
Sbjct  33   SHGTTGRNLLQAKKKCEIDFESMNYTVITSQC-KGP-QYDAKLCCSALKEFACPHAESLN  90

Query  301  P-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
              N  CA  MF  ++  GKYPP +  + C   EGK+
Sbjct  91   DLNSDCASTMFSYINLYGKYPPGLFAHECR--EGKE  124



>emb|CDY06519.1| BnaC02g12430D [Brassica napus]
Length=175

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -1

Query  451  FEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFF  278
             + KK+C+  +  MNYT++TSQC + P  +PV  CC S     C Y +QLN  +  CA  
Sbjct  45   LQAKKKCSLNLEFMNYTVITSQC-KGP-KFPVKECCSSFLEFACPYAEQLNDLSTDCAST  102

Query  277  MFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
            MF  ++  GKYP  +    C   +G K+ L+C
Sbjct  103  MFSYINIYGKYPAGLFSSQC---KGDKEGLEC  131



>ref|XP_006474767.1| PREDICTED: GPI-anchored protein LORELEI-like [Citrus sinensis]
Length=166

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 20/128 (16%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCT  383
            G+++++F+     ++    GR+LL             + KK C      +NYTI+TS+C 
Sbjct  19   GLSSATFISDGIFESHAFTGRNLL-------------QAKKACPVNFEFLNYTIITSKC-  64

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + P  +P   CC + K   C Y DQ+N     CA  MF  ++  GKYPP +    C++  
Sbjct  65   KGP-QFPPDKCCSAFKEFACPYADQINDLTTDCATTMFSYINLYGKYPPGLFASECQE--  121

Query  205  GKKKDLDC  182
              K+ L+C
Sbjct  122  -GKRGLEC  128



>ref|XP_009794220.1| PREDICTED: GPI-anchored protein LORELEI-like [Nicotiana sylvestris]
Length=169

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 67/129 (52%), Gaps = 20/129 (16%)
 Frame = -1

Query  559  GIATSS--FLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQC  386
            G+A+ S  ++  D  +  V+ GR+LL +   +    + FE +         NYTIVTSQC
Sbjct  17   GLASPSPFYIKNDVLEARVQTGRALLQQ---QGNCPVDFEKE---------NYTIVTSQC  64

Query  385  TRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQF  209
             + P  Y    CC + K+L C + D++N     CA  MF  ++  GKYPP +   +C++ 
Sbjct  65   -KGP-HYNETLCCNAFKQLACNHMDEINDVQNGCATIMFNYINLYGKYPPGLFANMCKE-  121

Query  208  EGKKKDLDC  182
               KK L+C
Sbjct  122  --DKKGLNC  128



>ref|XP_008455326.1| PREDICTED: GPI-anchored protein LORELEI-like [Cucumis melo]
Length=175

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 60/124 (48%), Gaps = 20/124 (16%)
 Frame = -1

Query  547  SSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPL  371
            S FL Y+  K+    GRSLL             + KK C   +   NYTI+TS+C + P 
Sbjct  26   SPFLSYEALKSGQFTGRSLL-------------QAKKNCPVDMEGQNYTILTSKC-KGP-  70

Query  370  SYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKKK  194
             YP   CC++L    C + D+LN     CA  MF  ++  G+YPP +    C++    K+
Sbjct  71   KYPATLCCEALLEFCCGFVDELNDMTNNCAETMFSYINLYGQYPPGLFANQCKE---GKQ  127

Query  193  DLDC  182
             L C
Sbjct  128  GLSC  131



>ref|XP_009137777.1| PREDICTED: GPI-anchored protein LORELEI-like [Brassica rapa]
 emb|CDY29895.1| BnaA03g49160D [Brassica napus]
Length=160

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 6/80 (8%)
 Frame = -1

Query  418  NMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYP  242
            N NYTI+TS+C + P +YP   CC + K   C + + LN +  +CA  MF  ++  G+YP
Sbjct  54   NKNYTIITSKC-KGP-NYPAKACCSAFKDFACPFAEALNDDKTECASTMFSYINIYGRYP  111

Query  241  PTILKYLCEQFEGKKKDLDC  182
            P I   +C++    K+ LDC
Sbjct  112  PGIFANMCKE---GKEGLDC  128



>ref|XP_006452762.1| hypothetical protein CICLE_v10009724mg [Citrus clementina]
 gb|ESR66002.1| hypothetical protein CICLE_v10009724mg [Citrus clementina]
Length=166

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 20/128 (16%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCT  383
            G+++++F+     ++    GR+LL             + KK C      +NYTI+TS+C 
Sbjct  19   GLSSATFISDGIFESHAFTGRNLL-------------QAKKACPVNFEFLNYTIITSKC-  64

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + P  +P   CC + K   C Y DQ+N     CA  MF  ++  GKYPP +    C +  
Sbjct  65   KGP-QFPPDKCCSAFKEFACPYADQINDLTTDCATTMFSYINLYGKYPPGLFASECRE--  121

Query  205  GKKKDLDC  182
             +K+ L+C
Sbjct  122  -EKRGLEC  128



>emb|CDP13646.1| unnamed protein product [Coffea canephora]
Length=169

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 18/125 (14%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQCTRQP  374
            + S+FL        + +GR+LL   +   A  + FE +         NYTI+TSQC + P
Sbjct  24   SASTFLSEGIFGHHIAQGRNLLQATT---ACPVNFEFQ---------NYTIITSQC-KGP  70

Query  373  LSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
              YP   CCK+LK   C + +Q+N  +  CA  MF  ++  GKYPP +    C +    K
Sbjct  71   -QYPPNLCCKALKDFACPFAEQVNDLSNDCATTMFSYINLNGKYPPGLFASECRE---GK  126

Query  196  KDLDC  182
            + L+C
Sbjct  127  EGLEC  131



>ref|XP_011002848.1| PREDICTED: GPI-anchored protein LORELEI-like [Populus euphratica]
Length=165

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 61/129 (47%), Gaps = 21/129 (16%)
 Frame = -1

Query  559  GIAT-SSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQC-AFVNNMNYTIVTSQC  386
            G+AT SSF+  D        GR+LL         QM    KK C     N++Y+++T +C
Sbjct  19   GLATPSSFISNDALDVHGGSGRTLL---------QM----KKTCNVSFENLDYSVLTDKC  65

Query  385  TRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQF  209
             + P  YP  +CC + K   C + D +N     CA  MF  ++  GKYPP +    C + 
Sbjct  66   -KGP-QYPAKSCCDAFKEFACPFSDAINDLETDCASTMFSYINLYGKYPPGLFANECRE-  122

Query  208  EGKKKDLDC  182
               K  LDC
Sbjct  123  --DKNGLDC  129



>emb|CDY11953.1| BnaC03g13790D [Brassica napus]
Length=122

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYTI+TSQC + P  +PV  CC +     C Y +QLN  +  CA  MF  ++  GKYPP
Sbjct  12   MNYTIITSQC-KGP-KFPVKECCSAFLDFACPYTEQLNDLSNDCATTMFSYINLYGKYPP  69

Query  238  TILKYLCEQFEGKKKDLDC  182
             +      Q +G K+ L+C
Sbjct  70   GLFA---NQCKGGKEGLEC  85



>emb|CDY17398.1| BnaA10g10320D [Brassica napus]
Length=138

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 41/74 (55%), Gaps = 3/74 (4%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYTI+TSQC + P  YP   CC + K   C Y DQLN     CA  MF  ++  GKYPP
Sbjct  62   MNYTIITSQC-KGP-KYPPKKCCSAFKEFACPYADQLNDFRNDCATTMFSYINLYGKYPP  119

Query  238  TILKYLCEQFEGKK  197
             +    C++  G K
Sbjct  120  GLFANSCQEKGGLK  133



>ref|XP_011037326.1| PREDICTED: GPI-anchored protein LORELEI-like [Populus euphratica]
Length=165

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 61/128 (48%), Gaps = 19/128 (15%)
 Frame = -1

Query  559  GIATSS-FLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQCT  383
            G+ATSS F+ YD         R+LL     ++A  + FE         N++Y+++T +C 
Sbjct  19   GLATSSSFISYDALDAHGGSSRTLL---QMKKACNISFE---------NLDYSVLTDKC-  65

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + P  YP   CC + K   C + D +N     CA  MF  ++  GKYPP +    C +  
Sbjct  66   KGP-QYPAKPCCDAFKEFACPFSDAINDLESDCASTMFSFINLYGKYPPGLFANECRE--  122

Query  205  GKKKDLDC  182
              K  LDC
Sbjct  123  -DKNGLDC  129



>emb|CDY11956.1| BnaC03g13820D [Brassica napus]
Length=168

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYTI+TSQC + P  +PV  CC +     C Y +QLN  +  CA  MF  ++  GKYPP
Sbjct  58   MNYTIITSQC-KGP-KFPVKECCSAFLDFACPYTEQLNDLSNDCATTMFSYINLYGKYPP  115

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C   +G K+ L+C
Sbjct  116  GLFANQC---KGGKEGLEC  131



>ref|XP_009793721.1| PREDICTED: GPI-anchored protein LORELEI [Nicotiana sylvestris]
Length=165

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 58/130 (45%), Gaps = 20/130 (15%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNM-NYTIVTSQCT  383
            G A S+ L           GR+LL             + KK C       NYT++TSQC 
Sbjct  18   GFAASASLSDGIFVNEASTGRNLL-------------QAKKPCPISFEFQNYTVITSQC-  63

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            R P  YP   CC +L +  C + D LN  +  CA  MF  ++  GKYPP +    C   +
Sbjct  64   RGP-QYPAKQCCAALVQFGCPFSDYLNDLSNDCASTMFSYINLHGKYPPGLFASEC---K  119

Query  205  GKKKDLDCFG  176
            G K  L+C G
Sbjct  120  GDKNGLECPG  129



>ref|XP_009602155.1| PREDICTED: GPI-anchored protein LORELEI-like, partial [Nicotiana 
tomentosiformis]
Length=122

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPT  236
            NYTIVTSQC + P  Y    CC + K+L C + D+LN     CA  MF  ++  GKYPP 
Sbjct  9    NYTIVTSQC-KGP-HYNETICCNAFKQLACNHMDELNDVQNGCATIMFNYINLYGKYPPG  66

Query  235  ILKYLCEQFEGKKKDLDC  182
            +   +C++    KK L+C
Sbjct  67   LFANMCKE---DKKGLNC  81



>emb|CDY51967.1| BnaCnng21510D [Brassica napus]
Length=135

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 41/74 (55%), Gaps = 3/74 (4%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYTI+TSQC + P  YP   CC + K   C Y DQLN     CA  MF  ++  GKYPP
Sbjct  59   MNYTIITSQC-KGP-KYPPKKCCSAFKEFACPYADQLNDLRNDCATTMFSYINLYGKYPP  116

Query  238  TILKYLCEQFEGKK  197
             +    C++  G K
Sbjct  117  GLFANSCQEKGGLK  130



>ref|XP_011100611.1| PREDICTED: GPI-anchored protein LORELEI-like [Sesamum indicum]
 ref|XP_011100612.1| PREDICTED: GPI-anchored protein LORELEI-like [Sesamum indicum]
Length=130

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 12/97 (12%)
 Frame = -1

Query  451  FEDKKQCAFVNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMC----KYRDQLNPNPKCA  284
             +  + C  V NMNYT++TSQC + P +Y    CC+ +K+L+C    K+ D  +P   C 
Sbjct  41   LQQDQTCPEVENMNYTVLTSQC-KGP-NYTQERCCEPMKQLLCPIAAKFNDLSSP---CG  95

Query  283  FFMFENLHNKGKYPPTILKYLCEQFEGKKKDLDCFGY  173
               F N+   G YPP +   LC++    KK LDC  Y
Sbjct  96   RIFFCNVDYLGNYPPRLFAGLCKE---GKKGLDCRKY  129



>gb|KHG28349.1| GPI-anchored LORELEI -like protein [Gossypium arboreum]
Length=144

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 51/97 (53%), Gaps = 6/97 (6%)
 Frame = -1

Query  481  NSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQL  305
            +S+    +   + KK C      +NYTI+TSQC + P  YP  +CC + K   C Y +Q+
Sbjct  8    DSFTSTGRHLLQAKKACPVNFEFLNYTIITSQC-KGP-KYPPQSCCSAFKEFACPYAEQI  65

Query  304  NP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
            N    +CA  MF  ++  GKYPP +    C   EGK+
Sbjct  66   NDLTTECASTMFSYINLYGKYPPGLFASECR--EGKE  100



>ref|XP_009126961.1| PREDICTED: GPI-anchored protein LORELEI-like [Brassica rapa]
 emb|CDY65745.1| BnaAnng20980D [Brassica napus]
Length=171

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 7/92 (8%)
 Frame = -1

Query  451  FEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFF  278
             + KK+C+  +  MNYTI+TSQC + P  +P   CC S     C Y DQLN  +  CA  
Sbjct  45   LQAKKKCSLNLEFMNYTIITSQC-KGP-KFPAKECCSSFLDFACPYADQLNDLSTDCAST  102

Query  277  MFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
            MF  ++  GKYP  +    C    G K  L+C
Sbjct  103  MFSYINIYGKYPAGLFANQC---HGNKIGLEC  131



>ref|NP_200428.1| LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 [Arabidopsis thaliana]
 dbj|BAB09299.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN17414.1| putative protein [Arabidopsis thaliana]
 gb|AAN65044.1| putative protein [Arabidopsis thaliana]
 gb|AED96729.1| LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 [Arabidopsis thaliana]
Length=168

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYTI+TS+C + P  YP   CC + K   C Y DQLN  +  CA  MF  ++  GKYPP
Sbjct  56   MNYTIITSKC-KGP-KYPPKECCGAFKDFACPYTDQLNDLSSDCATTMFSYINLYGKYPP  113

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C++    K+ L+C
Sbjct  114  GLFANQCKE---GKEGLEC  129



>ref|XP_002517922.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44440.1| conserved hypothetical protein [Ricinus communis]
Length=162

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 56/125 (45%), Gaps = 20/125 (16%)
 Frame = -1

Query  550  TSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQP  374
            +SS + YD        GR+LL             + KK+C     N++Y+++T  C + P
Sbjct  23   SSSVISYDALSAHEHSGRTLL-------------QVKKECNISFENLDYSVLTKNC-KGP  68

Query  373  LSYPVATCCKSLKRLMCKYRDQLNPNP-KCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
              YPV  CC +L    C Y + LN     CA  MF  ++  GKYPP +    C    G K
Sbjct  69   -QYPVKPCCGALTEFACPYAETLNDRTNNCAETMFSYINLYGKYPPGLFANEC---RGDK  124

Query  196  KDLDC  182
              L C
Sbjct  125  DGLSC  129



>ref|XP_010913272.1| PREDICTED: GPI-anchored protein LORELEI-like [Elaeis guineensis]
Length=167

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 58/126 (46%), Gaps = 20/126 (16%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQ  377
            A S+F+  D  +     GR LL             + KK C      +NYTI+TS+C + 
Sbjct  22   AASTFVSDDVFQYHGSTGRRLL-------------QAKKSCPVSFEFLNYTIITSKC-KG  67

Query  376  PLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
            P  Y    CC +L    C Y D+LN  +  CA  MF  ++  GKYPP +    C   +G 
Sbjct  68   P-QYSAKLCCSALTEFACPYADELNDVSNDCASIMFSYINLYGKYPPGLFAGEC---KGG  123

Query  199  KKDLDC  182
            K+ L C
Sbjct  124  KQGLAC  129



>gb|AAD20925.1| hypothetical protein [Arabidopsis thaliana]
Length=181

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 6/80 (8%)
 Frame = -1

Query  418  NMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYP  242
            N NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YP
Sbjct  68   NKNYTIITSRC-KGP-NYPANVCCSAFKDFACPFAEVLNDEKNDCASTMFSYINLYGRYP  125

Query  241  PTILKYLCEQFEGKKKDLDC  182
            P I   +C++    K+ LDC
Sbjct  126  PGIFANMCKE---GKEGLDC  142



>ref|XP_009418214.1| PREDICTED: GPI-anchored protein LORELEI-like [Musa acuminata 
subsp. malaccensis]
Length=169

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 47/95 (49%), Gaps = 6/95 (6%)
 Frame = -1

Query  475  YEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP  299
            +  A +   + K  C   +  MN TI+T +C + P  YP   CC + K L C + DQLN 
Sbjct  35   HGSAGRSLLQAKTSCPIDLEGMNSTIITGKC-KGP-QYPANLCCAAFKELACPFADQLND  92

Query  298  NP-KCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
                CA  MF  ++  GKYPP +    C   EGK+
Sbjct  93   ETNDCASTMFSYINLYGKYPPGLFASECR--EGKE  125



>ref|NP_179662.2| LORELEI-like glucosylphosphatidylinositol-anchored protein 2 
[Arabidopsis thaliana]
 gb|AAS76219.1| At2g20700 [Arabidopsis thaliana]
 gb|AAS88770.1| At2g20700 [Arabidopsis thaliana]
 gb|AEC07058.1| LORELEI-like glucosylphosphatidylinositol-anchored protein 2 
[Arabidopsis thaliana]
Length=163

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 6/80 (8%)
 Frame = -1

Query  418  NMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYP  242
            N NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YP
Sbjct  50   NKNYTIITSRC-KGP-NYPANVCCSAFKDFACPFAEVLNDEKNDCASTMFSYINLYGRYP  107

Query  241  PTILKYLCEQFEGKKKDLDC  182
            P I   +C++    K+ LDC
Sbjct  108  PGIFANMCKE---GKEGLDC  124



>ref|XP_004953726.1| PREDICTED: GPI-anchored protein LORELEI-like [Setaria italica]
Length=166

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 54/109 (50%), Gaps = 19/109 (17%)
 Frame = -1

Query  517  TSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKS  341
            ++   GRSLL             + KK CA      NYTI+TS+C + P  +P   CC +
Sbjct  36   SAGSTGRSLL-------------QAKKNCAMNFEFQNYTIITSKC-KGP-KFPADQCCGA  80

Query  340  LKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
             K   C +RD +N +   C+  MF  ++  GKYPP +   +C   EGKK
Sbjct  81   FKEFACPFRDYINEDSSDCSSAMFSYINLYGKYPPGLFANMCR--EGKK  127



>ref|XP_006346081.1| PREDICTED: GPI-anchored protein LORELEI-like [Solanum tuberosum]
Length=166

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 42/78 (54%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPT  236
            NYT+VT+QC R P  YP   CC++L +  C Y D +N     CA  MF  ++  GKYPP 
Sbjct  56   NYTVVTTQC-RGP-QYPAKQCCEALAQFACPYSDYVNDLTTDCASTMFSYINLHGKYPPG  113

Query  235  ILKYLCEQFEGKKKDLDC  182
            +    C    G KK L C
Sbjct  114  LFASEC---TGDKKGLPC  128



>ref|XP_002325596.2| hypothetical protein POPTR_0019s12470g [Populus trichocarpa]
 gb|EEE99977.2| hypothetical protein POPTR_0019s12470g [Populus trichocarpa]
Length=165

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 58/125 (46%), Gaps = 20/125 (16%)
 Frame = -1

Query  550  TSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQC-AFVNNMNYTIVTSQCTRQP  374
            +SSF+  D        GR+LL         QM    KK C     N++Y+I+T +C + P
Sbjct  23   SSSFISNDALDVHEGSGRTLL---------QM----KKTCNVSFENLDYSILTDKC-KGP  68

Query  373  LSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
              YP  +CC + K   C + D +N     CA  MF  ++  GKYPP +    C +    K
Sbjct  69   -QYPAKSCCDAFKEFACPFSDAINDLETDCASTMFSYINLYGKYPPGLFANECRE---DK  124

Query  196  KDLDC  182
              LDC
Sbjct  125  NGLDC  129



>emb|CDY36781.1| BnaA03g11050D [Brassica napus]
Length=168

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYTI+TSQC + P  +PV  CC +     C Y +QLN  +  CA  MF  ++  G+YPP
Sbjct  58   MNYTIITSQC-KGP-KFPVKECCSAFLDFACPYTEQLNDLSNDCATTMFSYINLYGQYPP  115

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C   +G K+ L+C
Sbjct  116  GLFANQC---KGGKEGLEC  131



>ref|XP_009620228.1| PREDICTED: GPI-anchored protein LORELEI [Nicotiana tomentosiformis]
Length=175

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 6/80 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPT  236
            NYT++TSQC R P  YP   CC +L +  C + D LN  +  CA  MF  ++  GKYPP 
Sbjct  65   NYTVITSQC-RGP-QYPAKQCCAALVQFGCPFSDYLNDLSNDCASTMFSYINLHGKYPPG  122

Query  235  ILKYLCEQFEGKKKDLDCFG  176
            +    C   +G K  L+C G
Sbjct  123  LFASEC---KGDKMGLECPG  139



>ref|XP_002886298.1| hypothetical protein ARALYDRAFT_480904 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62557.1| hypothetical protein ARALYDRAFT_480904 [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 6/80 (8%)
 Frame = -1

Query  418  NMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYP  242
            N NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YP
Sbjct  50   NKNYTIITSRC-KGP-NYPANVCCSAFKDFACPFAEVLNDEKNDCASTMFSYINLYGRYP  107

Query  241  PTILKYLCEQFEGKKKDLDC  182
            P I   +C++    K+ LDC
Sbjct  108  PGIFANMCKE---GKEGLDC  124



>ref|XP_009132330.1| PREDICTED: GPI-anchored protein LORELEI-like [Brassica rapa]
Length=168

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYTI+TSQC + P  +PV  CC +     C Y +QLN  +  CA  MF  ++  G+YPP
Sbjct  58   MNYTIITSQC-KGP-KFPVKECCSAFLDFACPYTEQLNDLSNDCATTMFSYINLYGQYPP  115

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C   +G K+ L+C
Sbjct  116  GLFANQC---KGGKEGLEC  131



>ref|XP_007206010.1| hypothetical protein PRUPE_ppa012359mg [Prunus persica]
 gb|EMJ07209.1| hypothetical protein PRUPE_ppa012359mg [Prunus persica]
Length=173

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 43/77 (56%), Gaps = 5/77 (6%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYT++TS+C + P  YP A CC + K L C Y D LN    +CA  MF  ++  G YPP
Sbjct  61   LNYTVITSRC-KGP-QYPAAQCCDAFKELACPYTDVLNDLTNECASIMFSYINLYGNYPP  118

Query  238  TILKYLCEQFEGKKKDL  188
             +    C   EGK+  L
Sbjct  119  GLFANECH--EGKEGLL  133



>ref|XP_004248165.1| PREDICTED: GPI-anchored protein LORELEI [Solanum lycopersicum]
Length=169

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 65/130 (50%), Gaps = 22/130 (17%)
 Frame = -1

Query  559  GIATSS--FLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQ  389
            G++ SS  ++ +D  +  V  GR+LL             + +  C       NYTI+TSQ
Sbjct  17   GLSYSSPLYIKHDVLEARVHTGRALL-------------QQQGNCPIDFERENYTIITSQ  63

Query  388  CTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQ  212
            C + P  Y  + CC + K+L CK+  ++N     CA  MF  ++  GKYPP +   +C++
Sbjct  64   C-KGP-HYNSSICCNAFKQLACKHTQEINDVQNGCATTMFNYINLYGKYPPGLFANMCKE  121

Query  211  FEGKKKDLDC  182
                K+ L+C
Sbjct  122  ---DKEGLNC  128



>ref|XP_004959558.1| PREDICTED: GPI-anchored protein LORELEI-like [Setaria italica]
Length=188

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (49%), Gaps = 7/105 (7%)
 Frame = -1

Query  490  LLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYR  314
            LL++  +   +   + KK C       NYTI+TS+C + PL  P A CC +LK   C Y 
Sbjct  46   LLEHGRDATGRSLLQAKKDCPVSFEGANYTIITSRC-KGPLYQP-ALCCGALKDFACPYS  103

Query  313  DQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
              +N     CA  MF  ++  GKYPP +    C + +   K L C
Sbjct  104  TYINDVTTTCAATMFSYINLYGKYPPGLFANTCHEGD---KGLSC  145



>ref|XP_010694217.1| PREDICTED: GPI-anchored protein LORELEI-like [Beta vulgaris subsp. 
vulgaris]
Length=183

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 7/92 (8%)
 Frame = -1

Query  451  FEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFF  278
             + KK C   +   NYT++TSQC R P  YP   CC++ K L C Y   LN     CA  
Sbjct  57   LQAKKDCPIDIQGWNYTVITSQC-RGP-KYPAEICCEAFKELACPYARDLNDLTNNCATT  114

Query  277  MFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
            MF  ++  G YPP +   +C       + L+C
Sbjct  115  MFSYINLYGSYPPGLFANICRD---SHRGLEC  143



>ref|XP_010110210.1| hypothetical protein L484_009815 [Morus notabilis]
 gb|EXC25507.1| hypothetical protein L484_009815 [Morus notabilis]
Length=537

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 7/92 (8%)
 Frame = -1

Query  451  FEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLN-PNPKCAFF  278
             + KK C     + NYTI+TSQC + P  YP   CC++ K   C + D +N     CA  
Sbjct  415  LQAKKSCTINFESQNYTIITSQC-KGP-RYPPQACCQAFKEFACPFTDAINDEQSDCAST  472

Query  277  MFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
            MF  ++  GKYPP +    C   EG K+ LDC
Sbjct  473  MFSYINLYGKYPPGLFALQCR--EG-KEGLDC  501



>ref|XP_004294877.1| PREDICTED: GPI-anchored protein LORELEI-like [Fragaria vesca 
subsp. vesca]
Length=174

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 42/79 (53%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYTI+TSQC + P  YP   CC S K L C Y D LN    +CA  MF  ++  G YPP
Sbjct  62   LNYTIITSQC-KGP-RYPADPCCASFKELACPYTDVLNDLTNECASIMFSYINLYGNYPP  119

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C +    K  L+C
Sbjct  120  GLFANECRE---GKLGLEC  135



>ref|XP_006409006.1| hypothetical protein EUTSA_v10002112mg [Eutrema salsugineum]
 gb|ESQ50459.1| hypothetical protein EUTSA_v10002112mg [Eutrema salsugineum]
Length=161

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P +YP   CC + K   C + + LN +   CA  MF  ++  G+YPP 
Sbjct  52   NYTIITSKC-KGP-NYPAKVCCSAFKDFACPFAEVLNDDKNDCASTMFSYINIYGRYPPG  109

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  110  IFANMCKE---GKEGLDC  124



>ref|XP_010489005.1| PREDICTED: GPI-anchored protein LORELEI-like isoform X1 [Camelina 
sativa]
Length=164

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP 
Sbjct  52   NYTIITSKC-KGP-NYPATVCCSAFKDFACPFAEVLNDEKNDCASTMFSYINIYGRYPPG  109

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  110  IFANMCKE---GKEGLDC  124



>ref|XP_010467781.1| PREDICTED: GPI-anchored protein LORELEI [Camelina sativa]
Length=164

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP 
Sbjct  52   NYTIITSKC-KGP-NYPATVCCSAFKDFACPFAEVLNDEKNDCASTMFSYINIYGRYPPG  109

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  110  IFANMCKE---GKEGLDC  124



>emb|CDY18987.1| BnaC01g20810D [Brassica napus]
Length=160

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP 
Sbjct  56   NYTIITSKC-KGP-NYPAKACCSAFKDFACPFAEALNDEKADCASTMFSYINIYGRYPPG  113

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  114  IFANMCKE---GKEGLDC  128



>ref|XP_010489006.1| PREDICTED: GPI-anchored protein LORELEI-like isoform X2 [Camelina 
sativa]
Length=159

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP 
Sbjct  47   NYTIITSKC-KGP-NYPATVCCSAFKDFACPFAEVLNDEKNDCASTMFSYINIYGRYPPG  104

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  105  IFANMCKE---GKEGLDC  119



>ref|XP_002869512.1| hypothetical protein ARALYDRAFT_491945 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45771.1| hypothetical protein ARALYDRAFT_491945 [Arabidopsis lyrata subsp. 
lyrata]
Length=126

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP 
Sbjct  22   NYTIITSKC-KGP-NYPAKVCCSAFKDFACPFAEVLNDEKTDCASTMFSYINLYGRYPPG  79

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  80   IFANMCKE---GKEGLDC  94



>ref|XP_002864439.1| hypothetical protein ARALYDRAFT_495704 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40698.1| hypothetical protein ARALYDRAFT_495704 [Arabidopsis lyrata subsp. 
lyrata]
Length=169

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYT++TS+C + P  YP   CC + K   C Y DQLN  +  CA  MF  ++  GKYPP
Sbjct  57   MNYTVITSKC-KGP-KYPPKECCGAFKDFACPYTDQLNDLSSDCATTMFSYINLYGKYPP  114

Query  238  TILKYLCEQFEGKK  197
             +    C+  EGK+
Sbjct  115  GLFANECK--EGKE  126



>ref|XP_007020320.1| Lorelei-like-gpi-anchored protein 1 [Theobroma cacao]
 gb|EOY11845.1| Lorelei-like-gpi-anchored protein 1 [Theobroma cacao]
Length=166

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 55/112 (49%), Gaps = 10/112 (9%)
 Frame = -1

Query  526  TPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATC  350
            +  TS+  G    + NS+    +   + KK C      +NYTI+TS+C + P  YP   C
Sbjct  21   SASTSISDG----VFNSFTTTGRNLLQAKKACPVNFEFLNYTIITSRC-KGP-QYPPDQC  74

Query  349  CKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
            C + K   C Y +Q+N     CA  MF  ++  GKYPP +    C   EGK+
Sbjct  75   CSAFKDFACPYAEQINDLTTDCASTMFSYINLYGKYPPGLFASECR--EGKE  124



>ref|XP_006474766.1| PREDICTED: GPI-anchored protein LORELEI-like [Citrus sinensis]
Length=147

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 20/128 (16%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCT  383
            G+++++F+     ++    GR+LL             + KK C      +NYTI+TS+C 
Sbjct  19   GLSSATFISDGIFESHAFTGRNLL-------------QAKKACPVNFEFLNYTIITSKC-  64

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + P  +P   CC + K   C Y DQ+N     CA  MF  ++  GKYPP +    C +  
Sbjct  65   KGP-QFPPDKCCSAFKEFACPYADQINDLTTDCATTMFSYINLYGKYPPGLFASECLK--  121

Query  205  GKKKDLDC  182
              K+ L+C
Sbjct  122  -GKRGLEC  128



>ref|XP_009144326.1| PREDICTED: GPI-anchored protein LORELEI-like [Brassica rapa]
 emb|CDX89190.1| BnaA01g17030D [Brassica napus]
Length=159

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP 
Sbjct  56   NYTIITSKC-KGP-NYPAKACCSAFKDFACPFAEALNDEKADCASTMFSYINIYGRYPPG  113

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  114  IFANMCKE---GKEGLDC  128



>ref|XP_006366032.1| PREDICTED: GPI-anchored protein LORELEI-like [Solanum tuberosum]
Length=168

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 65/131 (50%), Gaps = 23/131 (18%)
 Frame = -1

Query  559  GIATSS---FLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTS  392
            G++ SS   ++ +D  +  V  GR+LL             + +  C       NYTI+TS
Sbjct  17   GLSYSSSPLYIKHDVLEARVHSGRALL-------------QQQGNCPIDFERENYTIITS  63

Query  391  QCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCE  215
            QC + P  Y  + CC + K+L CK+  ++N     CA  MF  ++  GKYPP +   +C+
Sbjct  64   QC-KGP-HYNSSICCNAFKQLACKHTQEINDVQNGCATTMFNYINLYGKYPPGLFANMCK  121

Query  214  QFEGKKKDLDC  182
            +    K+ L+C
Sbjct  122  E---DKEGLNC  129



>ref|XP_002460426.1| hypothetical protein SORBIDRAFT_02g027890 [Sorghum bicolor]
 gb|EER96947.1| hypothetical protein SORBIDRAFT_02g027890 [Sorghum bicolor]
Length=170

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 55/128 (43%), Gaps = 18/128 (14%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCT  383
            G A + F+  D            LL   ++   +   + KK C       NYTI+TS+C 
Sbjct  20   GFAAAGFISNDA-----------LLDRGHDTTGRSLLQAKKDCPVSFEGANYTIITSRC-  67

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + PL  P   CC +LK   C Y   +N     CA  MF  ++  GKYPP +    C + +
Sbjct  68   KGPLYQPT-LCCGALKDFACPYATYINDVTTNCAATMFSYINLYGKYPPGLFANTCHEGD  126

Query  205  GKKKDLDC  182
               K L C
Sbjct  127  ---KGLAC  131



>emb|CDP14779.1| unnamed protein product [Coffea canephora]
Length=162

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 20/128 (16%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCT  383
            G+A+SS++     + S  +GR+LL             + K  C       NYTI+TSQC 
Sbjct  17   GLASSSYISNHALEPSGLRGRTLL-------------QAKASCPVNFEAQNYTIITSQC-  62

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + P +Y    CC + K   C + DQ+N     CA  MF  ++  G YPP +    C++  
Sbjct  63   KGP-NYSPKLCCDAFKEFACPFADQVNDMKNDCASTMFSYINMYGHYPPGLFANFCKE--  119

Query  205  GKKKDLDC  182
               + L+C
Sbjct  120  -GAQGLEC  126



>gb|AES74690.2| GPI-anchored lorelei-like protein [Medicago truncatula]
Length=132

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 63/131 (48%), Gaps = 22/131 (17%)
 Frame = -1

Query  556  IATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCA--FVNNMNYTIVTSQCT  383
            +++S F+  D   +    GRSLL             + +K C   F N  NYTI+T QC 
Sbjct  20   VSSSPFITDDIFGSGASSGRSLL-------------QARKACRVNFENFKNYTILTGQC-  65

Query  382  RQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFE  206
            + P  Y    CC+S K+  C + ++++     CA  MF  ++  GKYP  +    C++  
Sbjct  66   KGP-KYAPKVCCESFKQFACPFAEEISDLTTDCANVMFSYINLHGKYPTGLFAKHCKE--  122

Query  205  GKKKDLDCFGY  173
              K+ LDC GY
Sbjct  123  -GKEGLDC-GY  131



>ref|XP_010438482.1| PREDICTED: GPI-anchored protein LORELEI-like [Camelina sativa]
Length=161

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 60/127 (47%), Gaps = 18/127 (14%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQCTR  380
            G A S  +  D  ++     R+LL      +AK    ED          NYT++TS+C +
Sbjct  19   GFALSLHISLDELESHQATSRALL------QAKATCKED------FATKNYTVITSKC-K  65

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP I   +C++   
Sbjct  66   GP-NYPAKVCCSAFKDFACPFAEALNDEKTDCASTMFSYINLYGRYPPGIFANMCKE---  121

Query  202  KKKDLDC  182
             K+ LDC
Sbjct  122  GKEGLDC  128



>ref|XP_007198874.1| hypothetical protein PRUPE_ppa021505mg, partial [Prunus persica]
 gb|EMJ00073.1| hypothetical protein PRUPE_ppa021505mg, partial [Prunus persica]
Length=116

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 5/75 (7%)
 Frame = -1

Query  418  NMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYP  242
            N NYTI+TS+C + P +YP  +CC +LK   C + D +N     CA  MF  ++  GKYP
Sbjct  7    NQNYTIITSKC-KGP-NYPAKSCCDALKDFACPFADAINDLKNDCATTMFSYINIYGKYP  64

Query  241  PTILKYLCEQFEGKK  197
            P +    C   EGK+
Sbjct  65   PGLFASQCR--EGKE  77



>ref|XP_002531773.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30629.1| conserved hypothetical protein [Ricinus communis]
Length=149

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 40/78 (51%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPT  236
            NYTI+TSQC      YP  TCC + K   C + D LN     CA  MF  ++  GKYPP 
Sbjct  64   NYTIITSQCKGP--KYPPKTCCAAFKEFACPFADVLNDLTNNCASTMFSYINLYGKYPPG  121

Query  235  ILKYLCEQFEGKKKDLDC  182
            +    C++    KK L C
Sbjct  122  LFASACQE---GKKGLHC  136



>ref|XP_006470135.1| PREDICTED: GPI-anchored protein LORELEI-like [Citrus sinensis]
Length=191

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 61/123 (50%), Gaps = 16/123 (13%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQCTRQP  374
            A+SS +  D  ++     R+LL     +E     FEDK         NYTI+TS+C + P
Sbjct  51   ASSSVVSDDIFESYKATSRNLL---QVKEKCPENFEDK---------NYTIITSRC-KGP  97

Query  373  LSYPVATCCKSLKRLMCKYRDQLN-PNPKCAFFMFENLHNKGKYPPTILKYLC-EQFEGK  200
              YP   CC + K   C  RD++N P   CA  MF  ++  G++PP +  + C E  EG 
Sbjct  98   -EYPADQCCPAFKEFACPIRDKINDPKTDCAQTMFSYINLYGRFPPGLFAHKCREGKEGL  156

Query  199  KKD  191
            K D
Sbjct  157  KCD  159



>ref|NP_194557.2| LORELEI-like-GPI anchored protein 3 [Arabidopsis thaliana]
 gb|AAR24700.1| At4g28280 [Arabidopsis thaliana]
 gb|AAS47641.1| At4g28280 [Arabidopsis thaliana]
 gb|AEE85463.1| LORELEI-like-GPI anchored protein 3 [Arabidopsis thaliana]
Length=134

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP 
Sbjct  30   NYTIITSKC-KGP-NYPAKVCCSAFKDFACPFAEVLNDEKTDCASTMFSYINLYGRYPPG  87

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  88   IFANMCKE---GKEGLDC  102



>gb|EMS49601.1| hypothetical protein TRIUR3_12870 [Triticum urartu]
Length=192

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 61/129 (47%), Gaps = 10/129 (8%)
 Frame = -1

Query  556  IATSSFLDY--DTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFV-NNMNYTIVTSQC  386
            I++ S LD+  D P   V+   +L   +S+  A +   + KK+C       NYT++TS+C
Sbjct  28   ISSWSTLDHLTDLPLRPVDADDALQ-SHSHGGAGRSLLQAKKECPVTFEGANYTLITSKC  86

Query  385  TRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQF  209
             + PL  P A CC +L    C Y   +N     CA  MF  +H  GKYP  +    C   
Sbjct  87   -KGPLYQP-ALCCAALTEFACPYDTYINDVATNCAATMFSLIHLYGKYPAGLFANTC---  141

Query  208  EGKKKDLDC  182
            +G    L C
Sbjct  142  KGDNLGLKC  150



>ref|NP_001190858.1| LORELEI-like-GPI anchored protein 3 [Arabidopsis thaliana]
 emb|CAB79630.1| putative GPI-anchored protein [Arabidopsis thaliana]
 gb|AEE85464.1| LORELEI-like-GPI anchored protein 3 [Arabidopsis thaliana]
Length=160

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 60/127 (47%), Gaps = 18/127 (14%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQCTR  380
            G A S  +  D  ++     R+LL      +AK    ED          NYTI+TS+C +
Sbjct  19   GFAFSHHISLDEFESHPSTSRALL------QAKATCKED------FAAKNYTIITSKC-K  65

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP I   +C++   
Sbjct  66   GP-NYPAKVCCSAFKDFACPFAEVLNDEKTDCASTMFSYINLYGRYPPGIFANMCKE---  121

Query  202  KKKDLDC  182
             K+ LDC
Sbjct  122  GKEGLDC  128



>ref|XP_009379118.1| PREDICTED: GPI-anchored protein LORELEI-like [Pyrus x bretschneideri]
Length=174

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 49/102 (48%), Gaps = 7/102 (7%)
 Frame = -1

Query  481  NSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQL  305
            +S     +   + KK C      +NYT +TSQC + P  YP   CC + K L C Y D L
Sbjct  38   DSQASVGRHLLQAKKGCPVNFEFLNYTTITSQC-KGP-QYPAKQCCDAFKELACPYADVL  95

Query  304  NP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
            N    +CA  MF  ++  GKYPP +    C      K+ L+C
Sbjct  96   NDLTNECASIMFSYINLYGKYPPGLFANECHD---GKEGLEC  134



>ref|XP_006447360.1| hypothetical protein CICLE_v10017701mg, partial [Citrus clementina]
 gb|ESR60600.1| hypothetical protein CICLE_v10017701mg, partial [Citrus clementina]
Length=140

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 13/89 (15%)
 Frame = -1

Query  451  FEDKKQCAFVNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLN-PNPKCAFFM  275
            FEDK         NYTI+TS+C + P  YP   CC + K   C  RD++N P   CA  M
Sbjct  31   FEDK---------NYTIITSRC-KGP-EYPADQCCPAFKEFACPIRDKINDPKTDCAQTM  79

Query  274  FENLHNKGKYPPTILKYLC-EQFEGKKKD  191
            F  ++  G++PP +  + C E  EG K D
Sbjct  80   FSYINLYGRFPPGLFAHKCREGKEGLKCD  108



>ref|XP_008344754.1| PREDICTED: GPI-anchored protein LORELEI-like [Malus domestica]
Length=126

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYT +T+QC + P  YP   CC + K L C Y D LN    +CA  MF  ++  GKYPP
Sbjct  13   LNYTTITTQC-KGP-RYPAKQCCDAFKELACPYADVLNDLTNECASIMFSYINLYGKYPP  70

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C +    K+ L+C
Sbjct  71   GLFANECHE---GKEGLEC  86



>dbj|BAA34247.1| GPI-anchored protein [Vigna radiata]
Length=169

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 7/102 (7%)
 Frame = -1

Query  481  NSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQL  305
            +S   A +   + KK C+     +NYTI+TS+C + P  YP   CC + K   C Y D L
Sbjct  38   DSQAHAGRNLLQAKKGCSVNFEFLNYTIITSKC-KGP-QYPPKECCGAFKEFACPYADVL  95

Query  304  NP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
            N    +CA  MF  ++  GKYPP +    C      K+ L+C
Sbjct  96   NDLTNECASTMFSYINLYGKYPPGLFASECHD---TKRGLEC  134



>ref|XP_008652853.1| PREDICTED: GPI-anchored protein LORELEI-like [Zea mays]
 tpg|DAA61970.1| TPA: hypothetical protein ZEAMMB73_418540 [Zea mays]
Length=172

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (49%), Gaps = 7/105 (7%)
 Frame = -1

Query  490  LLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYR  314
            LL+  ++   +   + KK C       NYT++TS+C + PL  P   CC +LK   C Y 
Sbjct  33   LLERGHDTTGRSLLQAKKDCPVSFEGANYTVITSRC-KGPLYQPT-LCCGALKDFACPYS  90

Query  313  DQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
              +N  +  CA  MF  ++  GKYPP +    C + +   K L C
Sbjct  91   TYINDVSTNCAATMFSYINLYGKYPPGLFANTCHEGD---KGLTC  132



>gb|AFK37390.1| unknown [Lotus japonicus]
Length=171

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYTI+TS+C + P SYP   CC + K   C Y D LN     CA  MF  ++  GKYPP
Sbjct  63   LNYTIITSKC-KGP-SYPPKDCCGAFKEFACPYVDVLNDLTNDCASTMFSYINLYGKYPP  120

Query  238  TILKYLCEQFEGKK  197
             +  + C   EGK+
Sbjct  121  GLFAHECR--EGKE  132



>ref|XP_010433242.1| PREDICTED: GPI-anchored protein LORELEI-like [Camelina sativa]
Length=161

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP 
Sbjct  56   NYTIITSKC-KGP-NYPAKICCSAFKDFACPFAEALNDEKTDCASTMFSYINLYGRYPPG  113

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  114  IFANMCKE---GKEGLDC  128



>ref|XP_010540877.1| PREDICTED: GPI-anchored protein LORELEI-like [Tarenaya hassleriana]
Length=224

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 62/127 (49%), Gaps = 18/127 (14%)
 Frame = -1

Query  559  GIATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQCTR  380
            G A S  L +D  +T     R+LL      +AK    ED        N NYT++TS+C +
Sbjct  82   GFALSLPLSHDALETHAATSRALL------QAKMPCKED------FANKNYTVITSRC-K  128

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P +Y    CC++ K   C   + +N +   CA  MF  ++  G+YPP I   +C+  EG
Sbjct  129  GP-NYQAGMCCEAFKEFACPLAEAINDDKTDCATTMFSYINLYGRYPPGIFANMCK--EG  185

Query  202  KKKDLDC  182
             K  LDC
Sbjct  186  -KDGLDC  191



>ref|XP_008353929.1| PREDICTED: GPI-anchored protein LORELEI [Malus domestica]
Length=174

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYT +T+QC + P  YP   CC + K L C Y D LN    +CA  MF  ++  GKYPP
Sbjct  61   LNYTTITTQC-KGP-RYPAKQCCDAFKELACPYADVLNDLTNECASIMFSYINLYGKYPP  118

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C +    K+ L+C
Sbjct  119  GLFANECHE---GKEGLEC  134



>ref|XP_008219196.1| PREDICTED: GPI-anchored protein LORELEI [Prunus mume]
Length=173

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 3/72 (4%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYT++TS+C + P  YP   CC + K L C Y D LN    +CA  MF  ++  G YPP
Sbjct  61   LNYTVITSRC-KGP-RYPAVQCCAAFKELACPYTDVLNDLTNECASIMFSYINLYGNYPP  118

Query  238  TILKYLCEQFEG  203
             +    C + +G
Sbjct  119  GLFANECHEGKG  130



>emb|CDY17399.1| BnaA10g10330D [Brassica napus]
Length=157

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYTI+TS C + P  +P   CC + K   C Y D LN  +  CA  MF  ++  GKYPP
Sbjct  46   MNYTIITSLC-KGP-KFPAKECCGAFKDFACPYADDLNDLSNDCATTMFSYINLYGKYPP  103

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C++    K+ L+C
Sbjct  104  GLFANQCQE---GKEGLEC  119



>emb|CDY67878.1| BnaC07g50470D [Brassica napus]
Length=160

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPT  236
            NYTI+T++C + P +YP   CC + K   C + + LN    +CA  MF  ++  G+YPP 
Sbjct  56   NYTIITNKC-KGP-NYPAKACCSAFKDFACPFAEALNDEKTECASTMFSYINIYGRYPPG  113

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  114  IFANMCKE---GKEGLDC  128



>ref|XP_011039872.1| PREDICTED: GPI-anchored protein LORELEI-like [Populus euphratica]
 ref|XP_011039873.1| PREDICTED: GPI-anchored protein LORELEI-like [Populus euphratica]
 ref|XP_011039875.1| PREDICTED: GPI-anchored protein LORELEI-like [Populus euphratica]
 ref|XP_011007054.1| PREDICTED: GPI-anchored protein LORELEI-like [Populus euphratica]
 ref|XP_011007055.1| PREDICTED: GPI-anchored protein LORELEI-like [Populus euphratica]
Length=171

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 57/125 (46%), Gaps = 20/125 (16%)
 Frame = -1

Query  550  TSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQP  374
             S+F+     ++    GR+LL             + KK C      +NYTI+TSQC + P
Sbjct  26   ASTFISDGVFESHASTGRNLL-------------QTKKACPVNFEFLNYTIITSQC-KGP  71

Query  373  LSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
              Y  + CC S K   C Y D LN     CA  MF  ++  GKYPP +    C++    K
Sbjct  72   -QYTPSRCCGSFKEFACPYADVLNDLTNDCASIMFSYINLYGKYPPGLFANECKE---GK  127

Query  196  KDLDC  182
              L+C
Sbjct  128  LGLEC  132



>ref|XP_010092396.1| hypothetical protein L484_023775 [Morus notabilis]
 gb|EXB51072.1| hypothetical protein L484_023775 [Morus notabilis]
Length=793

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 41/74 (55%), Gaps = 5/74 (7%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYTI+TSQC + P  YP   CCK+ K   C Y D LN     CA  MF  ++  GKYPP
Sbjct  682  LNYTIITSQC-KGP-HYPADRCCKAFKDFACPYVDVLNDLTNDCASTMFSYINLYGKYPP  739

Query  238  TILKYLCEQFEGKK  197
             +    C   EGK+
Sbjct  740  GLFASECR--EGKQ  751



>ref|XP_010448003.1| PREDICTED: GPI-anchored protein LORELEI-like [Camelina sativa]
Length=162

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPT  236
            NYT++TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP 
Sbjct  57   NYTVITSKC-KGP-NYPAKVCCSAFKDFACPFAEALNDEKTDCASTMFSYINLYGRYPPG  114

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  115  IFANMCKE---GKEGLDC  129



>ref|XP_009120133.1| PREDICTED: GPI-anchored protein LORELEI-like [Brassica rapa]
Length=170

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYTI+TS C + P  +P   CC + K   C Y D LN  +  CA  MF  ++  GKYPP
Sbjct  59   MNYTIITSLC-KGP-KFPAKECCGAFKDFACPYADDLNDLSNDCATTMFSYINLYGKYPP  116

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C++    K+ L+C
Sbjct  117  GLFANQCQE---GKEGLEC  132



>ref|XP_010545299.1| PREDICTED: GPI-anchored protein LORELEI [Tarenaya hassleriana]
Length=169

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYTI+T +C + P  YP   CC + K   C Y DQ+N  +  CA  MF  ++  GKYPP
Sbjct  58   MNYTIITGRC-KGP-KYPPKDCCSAFKDFACPYADQINDLSTDCATTMFSYINLYGKYPP  115

Query  238  TILKYLCEQFEGKK  197
             +    C+  EGK+
Sbjct  116  GLFANQCK--EGKE  127



>ref|XP_010536787.1| PREDICTED: GPI-anchored protein LORELEI isoform X2 [Tarenaya 
hassleriana]
Length=167

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 58/119 (49%), Gaps = 20/119 (17%)
 Frame = -1

Query  556  IATSSFLDYDT--PKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQC  386
            +++SSF+      P+TSV  GR+LL             +  K C      MNYT++T +C
Sbjct  22   LSSSSFISDGVFQPQTSV-TGRNLL-------------QAMKPCPVNFEFMNYTVITGRC  67

Query  385  TRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQ  212
             + P  YP   CC SLK   C +   LN  +  CA  MF  +   GKYPP +  + C++
Sbjct  68   -KGP-EYPPKECCSSLKEFACPFAKVLNDLSNDCAIVMFSYIRLHGKYPPGLFAHECKE  124



>ref|XP_009346687.1| PREDICTED: GPI-anchored protein LORELEI isoform X2 [Pyrus x bretschneideri]
Length=172

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 41/79 (52%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYT++TSQC + P  YP   CC + K L C Y D LN    +CA  MF  ++  G YPP
Sbjct  61   LNYTVITSQC-KGP-QYPAKQCCGAFKELACPYADVLNDLTNECASIMFSYINLYGNYPP  118

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C      K+ L C
Sbjct  119  GLFANECHD---GKEGLIC  134



>gb|EYU33747.1| hypothetical protein MIMGU_mgv1a014802mg [Erythranthe guttata]
Length=177

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 6/76 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPT  236
            NYTI+TSQC ++P  Y V  CC S K+  C + D L+  +  CA  MF  +++ G YPP 
Sbjct  62   NYTIITSQC-KEP--YLVQLCCSSFKQFACPFVDYLDELSNDCAEIMFGYINSHGNYPPG  118

Query  235  ILKYLCEQFEGKKKDL  188
            +   LC   EGK+  L
Sbjct  119  LFASLCR--EGKEGLL  132



>ref|XP_010497893.1| PREDICTED: GPI-anchored protein LORELEI-like, partial [Camelina 
sativa]
Length=83

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 42/73 (58%), Gaps = 5/73 (7%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P +YP   CC + K   C + + LN     CA  MF  ++  G+YPP 
Sbjct  13   NYTIITSKC-KGP-NYPATVCCSAFKDFACPFAEVLNDEKNDCASTMFSYINIYGRYPPG  70

Query  235  ILKYLCEQFEGKK  197
            I   +C+  EGK+
Sbjct  71   IFANMCK--EGKE  81



>ref|XP_008342975.1| PREDICTED: GPI-anchored protein LORELEI-like [Malus domestica]
Length=223

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 5/75 (7%)
 Frame = -1

Query  418  NMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYP  242
            N NYTI+TS+C + P +YP  +CC +LK   C + +++N     CA  MF  ++  GKYP
Sbjct  111  NQNYTIITSKC-KGP-NYPAKSCCDALKDFACPFTEEINDLKNDCASTMFSYINIYGKYP  168

Query  241  PTILKYLCEQFEGKK  197
            P +    C   EGK+
Sbjct  169  PGLFASQCR--EGKE  181



>ref|XP_003618472.1| Gpi-anchored protein [Medicago truncatula]
Length=139

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 58/124 (47%), Gaps = 22/124 (18%)
 Frame = -1

Query  535  DYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCA--FVNNMNYTIVTSQCTRQPLSYP  362
             YD   +    GRSLL             + +K C   F N  NYTI+T QC + P  Y 
Sbjct  34   SYDIFGSGASSGRSLL-------------QARKACRVNFENFKNYTILTGQC-KGP-KYA  78

Query  361  VATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKKKDLD  185
               CC+S K+  C + ++++     CA  MF  ++  GKYP  +    C++    K+ LD
Sbjct  79   PKVCCESFKQFACPFAEEISDLTTDCANVMFSYINLHGKYPTGLFAKHCKE---GKEGLD  135

Query  184  CFGY  173
            C GY
Sbjct  136  C-GY  138



>ref|XP_003618898.1| GPI-anchored protein [Medicago truncatula]
 gb|AES75116.1| GPI-anchored lorelei-like protein [Medicago truncatula]
Length=156

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 7/102 (7%)
 Frame = -1

Query  481  NSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQL  305
             S   + +   + KK C       NYTI+TSQC + P  YP   CC + K+  C + D++
Sbjct  21   GSGASSGRALLQAKKPCGINFETQNYTILTSQC-KGP-QYPPKVCCDAFKQFACPHVDEI  78

Query  304  NP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
            +     C+  MF  ++  GKYPP +    C++    K+ LDC
Sbjct  79   SDLTTDCSNVMFSYINLYGKYPPGLFANQCKE---GKEGLDC  117



>ref|XP_009346686.1| PREDICTED: GPI-anchored protein LORELEI isoform X1 [Pyrus x bretschneideri]
Length=179

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 5/74 (7%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYT++TSQC + P  YP   CC + K L C Y D LN    +CA  MF  ++  G YPP
Sbjct  61   LNYTVITSQC-KGP-QYPAKQCCGAFKELACPYADVLNDLTNECASIMFSYINLYGNYPP  118

Query  238  TILKYLCEQFEGKK  197
             +    C   +GK+
Sbjct  119  GLFANECH--DGKE  130



>ref|XP_008805529.1| PREDICTED: GPI-anchored protein LORELEI-like [Phoenix dactylifera]
Length=250

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 58/126 (46%), Gaps = 20/126 (16%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQ  377
            A S+F+  D  +     GRSLL             + KK C      +NYTI+TS+C + 
Sbjct  104  AASTFISDDVFQCHGPTGRSLL-------------QTKKSCPVNFEFLNYTIITSKC-KG  149

Query  376  PLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
            P  Y    CC + K   C Y ++LN +   CA  MF  ++  GKYPP +    C +    
Sbjct  150  P-QYSAKLCCGAFKEFACPYAEELNDSTNDCASTMFSYINLYGKYPPGLFASECRE---G  205

Query  199  KKDLDC  182
            K+ L C
Sbjct  206  KEGLAC  211



>ref|XP_009769646.1| PREDICTED: GPI-anchored protein LORELEI-like [Nicotiana sylvestris]
Length=165

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 62/121 (51%), Gaps = 14/121 (12%)
 Frame = -1

Query  559  GIATSS--FLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQC  386
            G+A+SS  ++ Y   + S   GR LL +   +    + FE +         +YT +TSQC
Sbjct  19   GLASSSPTYIKYSVLRQSHAPGRGLLQQYLVKNDCPINFEKE---------DYTPLTSQC  69

Query  385  TRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPPTILKYLCEQF  209
             + P  Y  A CC   K + C+Y +++N     CA  MF +++  GKYP  + + +C++ 
Sbjct  70   -KGP-QYNPALCCNGFKTIACRYTNEINDESNGCATGMFISINESGKYPTGLFENICKEA  127

Query  208  E  206
            E
Sbjct  128  E  128



>ref|XP_002299077.2| hypothetical protein POPTR_0001s47550g [Populus trichocarpa]
 gb|EEE83882.2| hypothetical protein POPTR_0001s47550g [Populus trichocarpa]
Length=171

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 55/119 (46%), Gaps = 19/119 (16%)
 Frame = -1

Query  550  TSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQP  374
             S+F+     ++    GR+LL             + KK C      +NYTI+TSQC + P
Sbjct  26   ASTFISDGVFESHASTGRNLL-------------QTKKACPVNFEFLNYTIITSQC-KGP  71

Query  373  LSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
              Y  + CC S K   C Y D +N     CA  MF  ++  GKYPP +    C+  EGK
Sbjct  72   -QYTPSRCCGSFKEFACPYADVINDLTNDCASIMFSYINLYGKYPPGLFANECK--EGK  127



>ref|XP_006284606.1| hypothetical protein CARUB_v10005837mg [Capsella rubella]
 gb|EOA17504.1| hypothetical protein CARUB_v10005837mg [Capsella rubella]
Length=183

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPN-PKCAFFMFENLHNKGKYPPT  236
            NYT++TS+C + P +YP   CC + K   C + + +N     CA  MF  ++  G+YPP 
Sbjct  79   NYTVITSKC-KGP-NYPAKVCCSAFKDFACPFAEAINDEKTDCASTMFSYINIYGRYPPG  136

Query  235  ILKYLCEQFEGKKKDLDC  182
            I   +C++    K+ LDC
Sbjct  137  IFANMCKE---GKEGLDC  151



>ref|XP_004499696.1| PREDICTED: GPI-anchored protein LORELEI-like [Cicer arietinum]
Length=170

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 46/95 (48%), Gaps = 7/95 (7%)
 Frame = -1

Query  472  EEAKQMYFEDKKQCAFVNN--MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP  299
            +E K  +    KQ   VN   +NYTI+TS+C + P  YP   CC S K   C Y D LN 
Sbjct  40   QELKGRHLLQAKQGCSVNFEFLNYTIITSKC-KGP-RYPAKPCCASFKEFACPYADVLND  97

Query  298  -NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
                CA  MF  ++  G YPP +    C   EGK 
Sbjct  98   LTNDCASTMFSYINLYGHYPPGLFASECR--EGKS  130



>gb|EPS72802.1| hypothetical protein M569_01956, partial [Genlisea aurea]
Length=125

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 48/88 (55%), Gaps = 4/88 (5%)
 Frame = -1

Query  469  EAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-N  296
            + ++   + KK+C      ++Y+++TSQC + P  YP ++CC + KR  C + D LN   
Sbjct  29   QIERRLLQIKKKCPVNFEFLDYSVITSQC-KGP-QYPPSSCCSAFKRFACPFVDSLNDLT  86

Query  295  PKCAFFMFENLHNKGKYPPTILKYLCEQ  212
              CA  MF  ++  GKYPP +    C +
Sbjct  87   NNCASTMFSYINLYGKYPPGLFASECRE  114



>ref|XP_009781682.1| PREDICTED: GPI-anchored protein LORELEI-like [Nicotiana sylvestris]
Length=170

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPT  236
            NY ++TSQC + P  +P   CC +  +  C + D LN  +  C+  MF  ++ +GKYPP 
Sbjct  58   NYRVITSQC-KGP-QFPAKQCCDAFVQFACPFADLLNDLSNDCSTTMFSYINLRGKYPPG  115

Query  235  ILKYLCEQFEGKKKDLDC  182
            +   +C    G K+ LDC
Sbjct  116  LFASIC---TGTKQGLDC  130



>ref|XP_009772699.1| PREDICTED: GPI-anchored protein LORELEI-like [Nicotiana sylvestris]
Length=158

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 69/129 (53%), Gaps = 18/129 (14%)
 Frame = -1

Query  559  GIATSS--FLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQC  386
            G+A+SS  F+ YD  ++ V+ GR LL +   ++   + FE +         +Y  +TSQC
Sbjct  18   GLASSSPSFIKYDVLESHVQ-GRGLLQQYLIKDNCPINFEKE---------DYRPLTSQC  67

Query  385  TRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQF  209
             + P  Y  A CC + K + CK+ +++N  +  CA  MF  ++  GKYP  +   +C++ 
Sbjct  68   -KGP-QYNAAICCNAFKIVACKHTNEINDVDNGCADSMFYYINLNGKYPIGLFANICKED  125

Query  208  EGKKKDLDC  182
            E   + LDC
Sbjct  126  E---EGLDC  131



>ref|XP_008349506.1| PREDICTED: GPI-anchored protein LORELEI-like [Malus domestica]
Length=172

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 5/74 (7%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYT++TSQC + P  YP   CC + K L C Y D +N    +CA  MF  ++  G YPP
Sbjct  61   LNYTVITSQC-KGP-QYPAKQCCXAFKELACPYADVINDLTNECASIMFSYINLYGNYPP  118

Query  238  TILKYLCEQFEGKK  197
             +    C   +GK+
Sbjct  119  GLFANECH--DGKE  130



>ref|NP_001062806.1| Os09g0297800 [Oryza sativa Japonica Group]
 dbj|BAD33221.1| putative GPI-anchored protein [Oryza sativa Japonica Group]
 dbj|BAD32982.1| putative GPI-anchored protein [Oryza sativa Japonica Group]
 dbj|BAF24720.1| Os09g0297800 [Oryza sativa Japonica Group]
 gb|EAZ08507.1| hypothetical protein OsI_30779 [Oryza sativa Indica Group]
 dbj|BAG89181.1| unnamed protein product [Oryza sativa Japonica Group]
Length=174

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 4/82 (5%)
 Frame = -1

Query  451  FEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLN-PNPKCAFF  278
             + KK C       NYT++TS+C + P+ YP A CC++LK L C +   +N     CA  
Sbjct  46   LQAKKDCPVNFEEANYTVITSRC-KGPM-YPPALCCQALKDLACPFTAYINDAQTTCAAS  103

Query  277  MFENLHNKGKYPPTILKYLCEQ  212
            MF  ++  GKYPP +    C++
Sbjct  104  MFSYINLYGKYPPGLFANTCKE  125



>ref|XP_003598311.1| GPI-anchored protein LORELEI [Medicago truncatula]
 gb|AES68562.1| lorelei-like-GPI-anchored protein [Medicago truncatula]
 gb|AFK45249.1| unknown [Medicago truncatula]
Length=170

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 54/114 (47%), Gaps = 10/114 (9%)
 Frame = -1

Query  520  KTSVEKGRSLLLKNSYEEAKQM----YFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVA  356
              SV       L N+  +A+ +      + KK C+     +NYTI+TS+C + P  YP  
Sbjct  21   AVSVSSFHPTFLPNTIFDAETLTGRHLLQAKKGCSVNFEFLNYTIITSKC-KGP-KYPPK  78

Query  355  TCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
             CC S K   C Y D +N     CA  MF  ++  G+YPP +    C   EGK+
Sbjct  79   ECCGSFKEFACPYADVINDLTNDCASTMFSYINLYGRYPPGLFASECR--EGKE  130



>ref|XP_007148652.1| hypothetical protein PHAVU_005G003700g [Phaseolus vulgaris]
 gb|ESW20646.1| hypothetical protein PHAVU_005G003700g [Phaseolus vulgaris]
Length=169

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 55/119 (46%), Gaps = 19/119 (16%)
 Frame = -1

Query  550  TSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQP  374
            T +FL      +    GR+LL             + KK C+     +NYTI+TS+C + P
Sbjct  28   TPTFLSDHVFDSQALTGRNLL-------------QAKKGCSVNFEFLNYTIITSKC-KGP  73

Query  373  LSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
              YP   CC S K   C Y D +N    +CA  MF  ++  GKYPP +    C   EGK
Sbjct  74   -HYPPKECCNSFKEFACPYADVINDLTNECATTMFSYINLYGKYPPGLFSNECR--EGK  129



>ref|XP_010061394.1| PREDICTED: GPI-anchored protein LORELEI [Eucalyptus grandis]
 gb|KCW68332.1| hypothetical protein EUGRSUZ_F01994 [Eucalyptus grandis]
Length=178

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYTI+T +C + P +YP   CC + K   C Y D +N     CA  MF  ++  GKYPP
Sbjct  61   LNYTIITGKC-KGP-TYPANVCCGAFKEFACPYVDVINDLTNDCASTMFSYINLYGKYPP  118

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C +    K+ L+C
Sbjct  119  GLFAAECRE---GKQGLEC  134



>ref|NP_001137106.1| GPI-anchored protein precursor [Zea mays]
 gb|ACF83272.1| unknown [Zea mays]
 gb|ACG25928.1| GPI-anchored protein [Zea mays]
 gb|ACG26139.1| GPI-anchored protein [Zea mays]
 gb|AFW73183.1| GPI-anchored protein [Zea mays]
Length=170

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNP-KCAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P  +P + CC +LK   C + + LN    +CA  MF  ++  GKYPP 
Sbjct  62   NYTIITSKC-KGP-KFPASQCCAALKEFACPFNNYLNDESNECASTMFSYINLYGKYPPG  119

Query  235  ILKYLCEQFEGKKKDLDC  182
            +    C++    K  L C
Sbjct  120  LFSSECKE---GKMGLSC  134



>ref|XP_004139851.1| PREDICTED: GPI-anchored protein LORELEI-like [Cucumis sativus]
 ref|XP_004156391.1| PREDICTED: GPI-anchored protein LORELEI-like [Cucumis sativus]
 gb|KGN44099.1| hypothetical protein Csa_7G186180 [Cucumis sativus]
Length=169

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYTI+TS+C + P  Y    CC +L +L+C Y D LN     CA  +F  ++  GKYPP
Sbjct  60   LNYTIITSKC-KGP-QYSPKLCCSALTQLVCPYVDALNDMTTDCASTIFSYINIYGKYPP  117

Query  238  TILKYLC-EQFEG  203
             +   +C E  EG
Sbjct  118  GLFSSICREGAEG  130



>ref|NP_001278540.1| LOC100282585 precursor [Zea mays]
 gb|ACG33665.1| GPI-anchored protein [Zea mays]
 gb|ACN28461.1| unknown [Zea mays]
 gb|AFW63673.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=169

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 41/78 (53%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P  +P   CC +LK   C Y   LN     CA  MF  ++  GKYPP 
Sbjct  61   NYTIITSKC-KGP-KFPAGPCCAALKEFACPYYTYLNDESNDCASTMFSYINLYGKYPPG  118

Query  235  ILKYLCEQFEGKKKDLDC  182
            +    C++    K+ L C
Sbjct  119  LFSSECKE---GKQGLSC  133



>gb|ACG39459.1| GPI-anchored protein [Zea mays]
Length=170

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNP-KCAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P  +P + CC +LK   C + + LN    +CA  MF  ++  GKYPP 
Sbjct  62   NYTIITSKC-KGP-KFPASQCCAALKEFACPFNNYLNDESNECASTMFSYINLYGKYPPG  119

Query  235  ILKYLCEQFEGKKKDLDC  182
            +    C++    K  L C
Sbjct  120  LFSSECKE---GKMGLSC  134



>gb|EMT30210.1| hypothetical protein F775_16210 [Aegilops tauschii]
Length=150

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 36/81 (44%), Gaps = 6/81 (7%)
 Frame = -1

Query  418  NMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP--NPKCAFFMFENLHNKGKY  245
              NYT++TS+C   P     A CC + K   C Y D +N      CA  MF  +   G Y
Sbjct  56   GANYTVLTSRCRWPPFD--PAPCCAAFKDFACPYADYINDVNGTDCAAVMFHYIDLHGGY  113

Query  244  PPTILKYLCEQFEGKKKDLDC  182
            PP +    C   EG  K L C
Sbjct  114  PPGVFYLNCR--EGPNKGLKC  132



>gb|KHN20567.1| GPI-anchored protein LORELEI-like protein [Glycine soja]
Length=146

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 45/86 (52%), Gaps = 6/86 (7%)
 Frame = -1

Query  451  FEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFF  278
             + KK C+     +NYTI+TS+C + P  YP   CC + K   C Y D LN    +CA  
Sbjct  25   LQAKKSCSVNFEFLNYTIITSKC-KGP-HYPPKECCGAFKEFACPYVDVLNDLTNECAST  82

Query  277  MFENLHNKGKYPPTILKYLCEQFEGK  200
            MF  ++  GKYPP +    C   EGK
Sbjct  83   MFSYINLYGKYPPGLFASECH--EGK  106



>gb|KHN20566.1| GPI-anchored protein LORELEI-like protein [Glycine soja]
Length=163

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 49/100 (49%), Gaps = 6/100 (6%)
 Frame = -1

Query  490  LLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYR  314
            +  +    A +   + KK C      +NYTI+TS+C + P  YP   CC +LK   C Y 
Sbjct  38   VFDSQAAHAGRNLLQAKKSCPVNFEFLNYTIITSKC-KGP-QYPPKQCCAALKEFACPYA  95

Query  313  DQLNPNPK-CAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
            + LN +   CA  MF  ++  GKYP      +C Q  GKK
Sbjct  96   NALNDSTNDCAAIMFSYINLYGKYPFGFFASVCRQ--GKK  133



>ref|XP_010694216.1| PREDICTED: GPI-anchored protein LORELEI-like [Beta vulgaris subsp. 
vulgaris]
Length=186

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%)
 Frame = -1

Query  424  VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGK  248
            V N+NYT++TS+C + P  YP   CC++ + L C Y  ++N     CA  MF  ++  G+
Sbjct  72   VENLNYTVITSKC-KGP-RYPPNLCCEAYRELACPYSVEVNDLTNNCATTMFSYINLYGR  129

Query  247  YPPTILKYLCEQFEGKKKDLDC  182
            YPP +   +C      ++ L+C
Sbjct  130  YPPGLFANVCRD---SRRGLEC  148



>gb|EYU27506.1| hypothetical protein MIMGU_mgv1a014908mg [Erythranthe guttata]
Length=174

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P  YP   CC + K   C + D+LN     CA  MF  ++  GKYPP 
Sbjct  58   NYTIITSKC-KGP-QYPPNLCCSAFKDFSCPFADELNDLTNDCASTMFSYINLYGKYPPG  115

Query  235  ILKYLCEQFEGKKKDLDC  182
            +   +C +    K  L+C
Sbjct  116  LFASMCRE---GKDGLEC  130



>emb|CDY51971.1| BnaCnng21550D [Brassica napus]
Length=156

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYTI+TS C + P  +P   CC + K   C Y D L+  +  CA  MF  ++  GKYPP
Sbjct  45   MNYTIITSLC-KGP-KFPAKECCGAFKDFACPYADDLSDLSNDCATTMFSYINLYGKYPP  102

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C++    K+ L+C
Sbjct  103  GLFANQCQE---GKEGLEC  118



>ref|XP_010536786.1| PREDICTED: GPI-anchored protein LORELEI isoform X1 [Tarenaya 
hassleriana]
Length=195

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYT++T +C + P  YP   CC SLK   C +   LN  +  CA  MF  +   GKYPP
Sbjct  86   MNYTVITGRC-KGP-EYPPKECCSSLKEFACPFAKVLNDLSNDCAIVMFSYIRLHGKYPP  143

Query  238  TILKYLCEQ  212
             +  + C++
Sbjct  144  GLFAHECKE  152



>ref|XP_004155476.1| PREDICTED: GPI-anchored protein LORELEI-like [Cucumis sativus]
Length=120

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 5/76 (7%)
 Frame = -1

Query  424  VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGK  248
            +   NYTI+TS+C + P  YP A CC++L    C + D+LN     CA  MF  ++  G+
Sbjct  1    MEGQNYTILTSKC-KGP-KYPAALCCEALLEFCCGFVDELNDMTNNCAETMFSYINLYGQ  58

Query  247  YPPTILKYLCEQFEGK  200
            YPP +    C+  EGK
Sbjct  59   YPPGLFANQCK--EGK  72



>ref|XP_004139762.1| PREDICTED: GPI-anchored protein LORELEI-like [Cucumis sativus]
 gb|KGN44100.1| hypothetical protein Csa_7G186190 [Cucumis sativus]
Length=169

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYTI+TS+C + P  YP   CC +LK   C Y + LN     CA  MF  ++  GKYPP
Sbjct  59   LNYTIITSKC-KGP-RYPPKFCCSALKEFACPYVEDLNDLTNDCASTMFSYINLYGKYPP  116

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C++    K+ L+C
Sbjct  117  GLFSSECKE---GKEGLEC  132



>ref|XP_004294295.1| PREDICTED: GPI-anchored protein LORELEI-like [Fragaria vesca 
subsp. vesca]
Length=173

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 62/129 (48%), Gaps = 24/129 (19%)
 Frame = -1

Query  553  ATSSFLD---YDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQC  386
            ++++FL    +D P+     GRSLL             + +K C     N NYT++TS+C
Sbjct  27   SSATFLSNHIFDPPRGPF--GRSLL-------------QTQKSCPVNFENQNYTVLTSKC  71

Query  385  TRQPLSYPVATCCKSLKRLMCKYRDQL-NPNPKCAFFMFENLHNKGKYPPTILKYLCEQF  209
             + P +YP   CC +LK   C + +Q+ +    CA  MF  ++  GKYPP +    C   
Sbjct  72   -KGP-NYPPKICCDALKEFACPFAEQVSDEKSDCAATMFSYINIYGKYPPGLFASQCH--  127

Query  208  EGKKKDLDC  182
            E  K  L C
Sbjct  128  EDNKVGLKC  136



>ref|XP_010277997.1| PREDICTED: GPI-anchored protein LORELEI-like [Nelumbo nucifera]
Length=125

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 39/72 (54%), Gaps = 5/72 (7%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPT  236
            NYTI+TSQC  + L YP   CC +LK+  C +  +LN     CA  M   ++  GKYPP 
Sbjct  54   NYTIITSQC--KGLKYPPKLCCGALKKFACPFAKELNDLTNDCASTMSSYINLYGKYPPG  111

Query  235  ILKYLCEQFEGK  200
            +    C   EGK
Sbjct  112  LFSSECR--EGK  121



>gb|KFK44900.1| hypothetical protein AALP_AA1G317500 [Arabis alpina]
Length=184

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYT +TS+C + P  YP   CC + K   C Y D+LN  +  CA  MF  L+  GKYPP
Sbjct  59   MNYTDITSRC-KGP-KYPAKKCCAAFKDFACPYADELNDLSTDCASTMFSYLNLYGKYPP  116

Query  238  TILKYLCEQ  212
             +    C+ 
Sbjct  117  GLFANKCKD  125



>gb|ADU56196.1| hypothetical protein [Jatropha curcas]
 gb|KDP36318.1| hypothetical protein JCGZ_09533 [Jatropha curcas]
Length=169

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 47/95 (49%), Gaps = 6/95 (6%)
 Frame = -1

Query  478  SYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLN  302
            S+    +   + KK C      MNYTI+TS+C + P  Y  ++CC + K   C Y D +N
Sbjct  36   SHASTARNLLQAKKACPVNFEFMNYTIITSRC-KGP-DYLPSSCCAAFKDFACPYADVIN  93

Query  301  P-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGK  200
                 CA  MF  ++  GKYPP +    C   EGK
Sbjct  94   DLTSDCASTMFSYINLYGKYPPGLFASECR--EGK  126



>emb|CDX92776.1| BnaC07g40340D [Brassica napus]
Length=160

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 49/105 (47%), Gaps = 18/105 (17%)
 Frame = -1

Query  520  KTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCK  344
            +TSV  GRSLL               KKQC     + NYT +T QC R P +YP   CC 
Sbjct  30   RTSVS-GRSLL-------------SAKKQCEVDFQSKNYTDLTRQC-RGP-TYPATECCA  73

Query  343  SLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQ  212
            + K+  C Y  Q+N  N  CA  MF  +   G YP  +    C++
Sbjct  74   AFKQFACPYAHQINDLNTDCAKVMFSYITVHGNYPLGLFASECKE  118



>gb|ADD52581.1| putative GPI-anchored protein [Paspalum notatum]
Length=169

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNP-KCAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P  +P + CC +LK   C Y   LN +   CA  MF  ++  GKYPP 
Sbjct  60   NYTIITSKC-KGP-KFPASECCAALKEFACPYYMYLNDDSNDCASTMFSYINLYGKYPPG  117

Query  235  ILKYLCEQFEGKKKDLDC  182
            +    C +    K+ L C
Sbjct  118  LFSSECRE---GKEGLSC  132



>gb|KFK27198.1| hypothetical protein AALP_AA8G348200 [Arabis alpina]
Length=169

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNYT++ +QC + P  YP   CC + K   C Y +++N  +  CA  MF  ++  GKYPP
Sbjct  59   MNYTVIKNQC-KGP-KYPPKECCAAFKDFACPYTEEINDLSTDCATTMFSYINLYGKYPP  116

Query  238  TILKYLCEQFEGKKKDLDC  182
             I    C++    K+ L+C
Sbjct  117  GIFANQCKE---GKEGLEC  132



>ref|XP_009614732.1| PREDICTED: GPI-anchored protein LORELEI-like [Nicotiana tomentosiformis]
Length=157

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 66/125 (53%), Gaps = 16/125 (13%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQCTRQP  374
            ++ SF+ YD  ++ V+ GR LL +   ++   + FE +         +Y  +TSQC + P
Sbjct  21   SSPSFIKYDVLESHVQ-GRGLLQQYLVKDNCPINFEKE---------DYKPLTSQC-KGP  69

Query  373  LSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKK  197
              Y  A CC + K + CK+ +++N  +  CA  MF  ++  GKYP  +   +C++ E   
Sbjct  70   -QYNAAICCNAFKIVACKHTNEINDVDNGCADSMFYYINLNGKYPIGLFANICKEDE---  125

Query  196  KDLDC  182
            + LDC
Sbjct  126  EGLDC  130



>ref|XP_008447799.1| PREDICTED: GPI-anchored protein LORELEI-like [Cucumis melo]
Length=169

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYTI+TS+C + P  YP   CC +LK   C Y + +N     CA  MF  ++  GKYPP
Sbjct  59   LNYTIITSKC-KGP-RYPPKLCCSALKEFACPYVEDINDLTNDCASTMFSYINLYGKYPP  116

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C++    K+ L+C
Sbjct  117  GLFSSECKE---GKEGLEC  132



>ref|XP_006647809.1| PREDICTED: GPI-anchored protein LORELEI-like [Oryza brachyantha]
Length=168

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 57/129 (44%), Gaps = 21/129 (16%)
 Frame = -1

Query  553  ATSSFLDYDTPKTSV-EKGRSLLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTR  380
            A+ SFL     + SV   GRSLL             + KK C       NYTI+TS+C +
Sbjct  23   ASPSFLSDGVFQGSVGSTGRSLL-------------QAKKSCPVNFEFQNYTIITSKC-K  68

Query  379  QPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPPTILKYLCEQFEG  203
             P  +P   CC + K   C +   +N     CA  MF  ++  GKYPP +    C +   
Sbjct  69   GP-RFPAKECCNAFKEFACPFAQYINDESNDCASTMFSYINLYGKYPPGLFASECRE---  124

Query  202  KKKDLDCFG  176
             K+ L C G
Sbjct  125  GKQGLSCDG  133



>ref|XP_003598310.1| GPI-anchored protein LORELEI [Medicago truncatula]
Length=214

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 5/74 (7%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYTI+TS+C + P  YP   CC S K   C Y D +N     CA  MF  ++  G+YPP
Sbjct  61   LNYTIITSKC-KGP-KYPPKECCGSFKEFACPYADVINDLTNDCASTMFSYINLYGRYPP  118

Query  238  TILKYLCEQFEGKK  197
             +    C   EGK+
Sbjct  119  GLFASECR--EGKE  130



>ref|XP_003527574.1| PREDICTED: GPI-anchored protein LORELEI-like [Glycine max]
Length=165

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 45/86 (52%), Gaps = 6/86 (7%)
 Frame = -1

Query  451  FEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFF  278
             + KK C+     +NYT++TS+C + P  YP   CC + K   C Y D LN    +CA  
Sbjct  44   LQAKKSCSVNFEFLNYTVITSKC-KGP-HYPPKECCGAFKEFACPYVDVLNDLTNECAST  101

Query  277  MFENLHNKGKYPPTILKYLCEQFEGK  200
            MF  ++  GKYPP +    C   EGK
Sbjct  102  MFSYINLYGKYPPGLFASECH--EGK  125



>ref|XP_006378004.1| hypothetical protein POPTR_0011s17150g, partial [Populus trichocarpa]
 gb|ERP55801.1| hypothetical protein POPTR_0011s17150g, partial [Populus trichocarpa]
Length=354

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 42/79 (53%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYTI+TSQC + P  YP + CC S K   C Y   +N    +CA  MF  ++  GKYPP
Sbjct  17   LNYTIITSQC-KGP-QYPPSRCCGSFKEFACPYAYLINDLTNECASIMFTYINLNGKYPP  74

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C+     K  L+C
Sbjct  75   GLFANECKD---GKLGLEC  90



>ref|XP_009588024.1| PREDICTED: GPI-anchored protein LORELEI-like [Nicotiana tomentosiformis]
Length=164

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (52%), Gaps = 18/129 (14%)
 Frame = -1

Query  559  GIATSS--FLDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFVNNMNYTIVTSQC  386
            G+A+SS  ++ Y   ++ V  GR LL +   +    + FE +         NY+ +TSQC
Sbjct  19   GLASSSPSYIKYSVLQSHV-PGRGLLQQYLVKNDCPINFEKE---------NYSPLTSQC  68

Query  385  TRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQF  209
             + P  Y  A CC + K + C+Y +++N  N  CA  MF  ++  GKYP  +   +C++ 
Sbjct  69   -KGP-QYNAALCCNAFKVVACRYTNEINDENNGCATSMFYFINQSGKYPVGLFDNICKED  126

Query  208  EGKKKDLDC  182
            E   + L+C
Sbjct  127  E---EGLNC  132



>ref|NP_001236034.1| uncharacterized protein LOC100527178 precursor [Glycine max]
 gb|ACU16228.1| unknown [Glycine max]
Length=170

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 45/86 (52%), Gaps = 6/86 (7%)
 Frame = -1

Query  451  FEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFF  278
             + KK C+     +NYT++TS+C + P  YP   CC + K   C Y D LN    +CA  
Sbjct  48   LQAKKGCSVNFEFLNYTVITSKC-KGP-RYPPKECCGAFKEFACPYADVLNDLTNECAST  105

Query  277  MFENLHNKGKYPPTILKYLCEQFEGK  200
            MF  ++  GKYPP +    C   EGK
Sbjct  106  MFSYINLYGKYPPGLFASECR--EGK  129



>gb|KHN01506.1| GPI-anchored protein LORELEI [Glycine soja]
Length=170

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            +NYT++TS+C + P  YP   CC + K   C Y D LN    +CA  MF  ++  GKYPP
Sbjct  61   LNYTVITSKC-KGP-RYPPKECCGAFKEFACPYADVLNDLTNECASTMFSYINLYGKYPP  118

Query  238  TILKYLCEQFEGK  200
             +    C   EGK
Sbjct  119  GLFASECR--EGK  129



>gb|EMT24398.1| hypothetical protein F775_32885 [Aegilops tauschii]
Length=184

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 51/121 (42%), Gaps = 20/121 (17%)
 Frame = -1

Query  538  LDYDTPKTSVEKGRSLLLKNSYEEAKQMYFEDKKQCAFV-NNMNYTIVTSQCTRQPLSYP  362
            LD      S   GRSLL             + KK+C       NYT++TS+C + PL  P
Sbjct  40   LDSHDALQSHSHGRSLL-------------QAKKECPVTFEGANYTLITSKC-KGPLYQP  85

Query  361  VATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKKKDLD  185
             A CC +L    C Y   +N     CA  MF  +H  GKYP  +    C   +G    L 
Sbjct  86   -ALCCAALAEFACPYDTYINDLATNCAATMFSLIHLYGKYPAGLFANTC---KGDNLGLK  141

Query  184  C  182
            C
Sbjct  142  C  142



>ref|XP_010450737.1| PREDICTED: GPI-anchored protein LORELEI-like [Camelina sativa]
Length=168

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNY I+T +C + P  +P   CC + K   C Y D+LN  + +CA  MF  ++  GKYPP
Sbjct  59   MNYKIITDKC-KGP-KFPPKECCAAFKEFSCPYADELNDLSTECATTMFSYINLYGKYPP  116

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C++    K+ L+C
Sbjct  117  GLFANQCKE---GKEGLEC  132



>ref|XP_008796546.1| PREDICTED: GPI-anchored protein LORELEI-like [Phoenix dactylifera]
Length=176

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 41/78 (53%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPT  236
            NYT+VTS+C + P  Y V  CC + K   C + +QLN  +  CA  +F  L+  GKYPP 
Sbjct  66   NYTVVTSKC-KGP-HYAVNLCCAAFKEFACPFAEQLNDVSNNCASDLFSYLNVHGKYPPG  123

Query  235  ILKYLCEQFEGKKKDLDC  182
            +    C      K+ L C
Sbjct  124  LFASECHD---TKEGLTC  138



>ref|XP_002452637.1| hypothetical protein SORBIDRAFT_04g029590 [Sorghum bicolor]
 gb|EES05613.1| hypothetical protein SORBIDRAFT_04g029590 [Sorghum bicolor]
Length=168

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPP  239
            +NYTI+T +C + P  +P + CC +LK   C Y   LN     CA  MF  ++  GKYPP
Sbjct  59   LNYTIITGKC-KGP-KFPASQCCAALKEFACPYYMYLNDESNDCASTMFSYINLYGKYPP  116

Query  238  TILKYLCEQFEGK  200
             +    C+  EGK
Sbjct  117  GLFSSECK--EGK  127



>ref|XP_011097693.1| PREDICTED: GPI-anchored protein LORELEI-like [Sesamum indicum]
Length=175

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 6/78 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPT  236
            NYTI+TSQC + P +Y    CC + K   C + D+LN  +  C   MF  ++  GKYP  
Sbjct  59   NYTIITSQC-KGP-NYSPKLCCSAFKDFACPFVDELNDLSNSCVTTMFSYININGKYPQG  116

Query  235  ILKYLCEQFEGKKKDLDC  182
            +   LC +   KK+ L+C
Sbjct  117  LFASLCRE---KKEGLEC  131



>ref|XP_002531774.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30630.1| conserved hypothetical protein [Ricinus communis]
Length=168

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 49/102 (48%), Gaps = 7/102 (7%)
 Frame = -1

Query  481  NSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQL  305
            +S+    +   + KK C       NYT++TSQC + P  Y   TCC + K   C + D L
Sbjct  36   DSHGSIGRNLLQAKKACPVNFEFQNYTVITSQC-KGP-KYAPETCCAAFKEFACPFADVL  93

Query  304  NP-NPKCAFFMFENLHNKGKYPPTILKYLCEQFEGKKKDLDC  182
            N     CA  MF  ++  GKYPP +    C +    K+ L+C
Sbjct  94   NDLTNDCASTMFSYINLYGKYPPGLFASECRE---GKEGLEC  132



>dbj|BAJ85659.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 38/72 (53%), Gaps = 5/72 (7%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNP-KCAFFMFENLHNKGKYPPT  236
            NYT++TS+C + P  YP   CC S K   C +   +N     CA  MF  ++  GKYPP 
Sbjct  59   NYTVITSRC-KGP-KYPAKDCCDSFKEFACPFNTYINDESNDCASTMFSYINLYGKYPPG  116

Query  235  ILKYLCEQFEGK  200
            +  + C   EGK
Sbjct  117  LFAHECR--EGK  126



>ref|XP_010483085.1| PREDICTED: GPI-anchored protein LORELEI-like [Camelina sativa]
Length=169

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNY I+T +C + P  +P   CC + K   C Y D+LN  +  CA  MF  ++  GKYPP
Sbjct  59   MNYKIITDKC-KGP-KFPPKECCAAFKEFSCPYADELNDLSSDCATTMFSYINLYGKYPP  116

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C++    K+ L+C
Sbjct  117  GLFANQCKE---GKEGLEC  132



>ref|NP_001235471.1| uncharacterized protein LOC100305699 precursor [Glycine max]
 gb|ACU13521.1| unknown [Glycine max]
Length=163

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 5/74 (7%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPP  239
            +NYT++TS+C + P  YP   CC + K   C Y + LN +   CA  MF  ++  GKYP 
Sbjct  64   LNYTVITSKC-KGP-QYPPKQCCAAFKEFACPYANALNDSTNDCAAIMFSYINLYGKYPF  121

Query  238  TILKYLCEQFEGKK  197
                 +C Q  GKK
Sbjct  122  GFFASVCRQ--GKK  133



>ref|XP_011095640.1| PREDICTED: GPI-anchored protein LORELEI-like [Sesamum indicum]
Length=173

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 40/72 (56%), Gaps = 5/72 (7%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPPT  236
            NYTI+TS+C + P  YP   CC +LK   C + D++N     CA  MF  ++  GKYPP 
Sbjct  59   NYTIITSRC-KGP-QYPPKLCCPALKDFACPFADEINDVTNDCASTMFSYINLYGKYPPG  116

Query  235  ILKYLCEQFEGK  200
            +    C   EGK
Sbjct  117  LFASECR--EGK  126



>ref|XP_009137738.1| PREDICTED: GPI-anchored protein LORELEI [Brassica rapa]
Length=155

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (48%), Gaps = 4/96 (4%)
 Frame = -1

Query  493  LLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKY  317
            ++ K+    + +     KKQC     + NYT +T QC R P +YP   CC + K+  C Y
Sbjct  25   IVFKSQTSISGRNLLNAKKQCEVDFESKNYTDLTRQC-RGP-TYPATECCAAFKQFACPY  82

Query  316  RDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQ  212
              Q+N  N  CA  MF  +   G YP  +    C++
Sbjct  83   AHQINDLNTDCAKVMFSYITVHGNYPLGLFASECKE  118



>ref|XP_010443262.1| PREDICTED: GPI-anchored protein LORELEI-like [Camelina sativa]
Length=171

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -1

Query  415  MNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNP-NPKCAFFMFENLHNKGKYPP  239
            MNY I+T +C + P  +P   CC + K   C Y D+LN  +  CA  MF  ++  GKYPP
Sbjct  59   MNYKIITEKC-KGP-KFPPKECCAAFKEFSCPYADKLNDLSTDCATTMFSYINLYGKYPP  116

Query  238  TILKYLCEQFEGKKKDLDC  182
             +    C++    K+ L+C
Sbjct  117  GLFANQCKE---GKEGLEC  132



>emb|CDY42734.1| BnaA03g48050D [Brassica napus]
Length=158

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (48%), Gaps = 4/96 (4%)
 Frame = -1

Query  493  LLLKNSYEEAKQMYFEDKKQCAF-VNNMNYTIVTSQCTRQPLSYPVATCCKSLKRLMCKY  317
            ++ K+    + +     KKQC     + NYT +T QC R P +YP   CC + K+  C Y
Sbjct  28   IVFKSQTSISGRNLLNAKKQCEVDFESKNYTDLTRQC-RGP-TYPATECCAAFKQFACPY  85

Query  316  RDQLNP-NPKCAFFMFENLHNKGKYPPTILKYLCEQ  212
              Q+N  N  CA  MF  +   G YP  +    C++
Sbjct  86   AHQINDLNTDCAKVMFSYITVHGNYPLGLFASECKE  121



>emb|CDY39491.1| BnaA01g24970D [Brassica napus]
Length=128

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 56/116 (48%), Gaps = 21/116 (18%)
 Frame = -1

Query  514  SVEKGRSLLLKNSYEEAKQMYFEDKKQCAF---VNNMNYTIVTSQCTRQPLSYPVATCCK  344
            +V   R+LLL+            +K QC     +  +NYTI+TSQC + PL YP   CC 
Sbjct  28   TVHSSRNLLLQT-----------EKVQCPLDFQIPYLNYTIITSQC-KGPL-YPYPQCCA  74

Query  343  SLKRLMCKYRDQLN-PNPKCAFFMFENLHNKGKY-PPTILKYLCEQFEGKKKDLDC  182
            + K L C Y++ LN  +  C   M  +++  G Y P  +    C Q    ++ +DC
Sbjct  75   AFKELACPYKNYLNDESTDCLTLMLTDINLYGGYFPAGLFGNTCLQ---GRQHIDC  127



>gb|EMS45797.1| hypothetical protein TRIUR3_25551 [Triticum urartu]
Length=167

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%), Gaps = 6/80 (8%)
 Frame = -1

Query  412  NYTIVTSQCTRQPLSYPVATCCKSLKRLMCKYRDQLNPNPK-CAFFMFENLHNKGKYPPT  236
            +YT++TS+C + P  YP   CC S K   C + + +N     CA  MF  ++  GKYPP 
Sbjct  59   DYTVITSRC-KGP-KYPAKDCCDSFKEFACPFNNYINDESNDCASTMFSYINLYGKYPPG  116

Query  235  ILKYLCEQFEGKKKDLDCFG  176
            +  + C +    K  L C G
Sbjct  117  LFAHECRE---GKLGLSCEG  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 708494689705