BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c91828_g1_i1 len=898 path=[1:0-897]

Length=898
                                                                      Score     E

ref|XP_006348623.1|  PREDICTED: basic leucine zipper 63-like            157   4e-43   
ref|XP_009774323.1|  PREDICTED: basic leucine zipper 43-like            154   9e-42   
ref|XP_009611005.1|  PREDICTED: basic leucine zipper 43-like            154   1e-41   
emb|CDP00505.1|  unnamed protein product                                152   3e-41   
ref|XP_011077776.1|  PREDICTED: basic leucine zipper 43-like            152   7e-41   
ref|XP_009794536.1|  PREDICTED: basic leucine zipper 43-like            151   7e-41   
ref|XP_004239003.1|  PREDICTED: basic leucine zipper 43                 149   5e-40   
gb|KDP31428.1|  hypothetical protein JCGZ_11804                         144   4e-38   
ref|XP_002311422.1|  bZIP family protein                                140   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_008446497.1|  PREDICTED: basic leucine zipper 63                 140   1e-36   
ref|XP_002514552.1|  Ocs element-binding factor, putative               140   1e-36   Ricinus communis
ref|XP_004237067.1|  PREDICTED: basic leucine zipper 43-like            140   1e-36   
ref|XP_004135134.1|  PREDICTED: ocs element-binding factor 1-like       139   4e-36   
ref|XP_011021268.1|  PREDICTED: basic leucine zipper 43-like            139   5e-36   
gb|KGN52012.1|  hypothetical protein Csa_5G608000                       141   7e-36   
ref|XP_007045693.1|  Basic leucine-zipper 42                            139   7e-36   
ref|NP_001236950.1|  bZIP transcription factor bZIP35                   138   8e-36   
ref|XP_009612533.1|  PREDICTED: basic leucine zipper 43-like            137   1e-35   
ref|XP_004155288.1|  PREDICTED: uncharacterized protein LOC101224302    137   2e-35   
emb|CAN76820.1|  hypothetical protein VITISV_032595                     136   4e-35   Vitis vinifera
ref|XP_002269495.1|  PREDICTED: basic leucine zipper 43                 136   5e-35   Vitis vinifera
ref|XP_006437815.1|  hypothetical protein CICLE_v10032777mg             136   5e-35   
ref|XP_011009140.1|  PREDICTED: basic leucine zipper 43-like            136   8e-35   
ref|XP_002315989.1|  bZIP family protein                                135   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_003518809.1|  PREDICTED: ocs element-binding factor 1-like       134   2e-34   
ref|XP_010681295.1|  PREDICTED: basic leucine zipper 43-like            134   3e-34   
gb|KDO70208.1|  hypothetical protein CISIN_1g043159mg                   134   4e-34   
ref|XP_007157937.1|  hypothetical protein PHAVU_002G110600g             134   4e-34   
ref|XP_010257863.1|  PREDICTED: basic leucine zipper 43-like            134   5e-34   
ref|XP_006373522.1|  hypothetical protein POPTR_0017s14490g             133   7e-34   
ref|XP_011070884.1|  PREDICTED: basic leucine zipper 43-like            132   2e-33   
ref|XP_008379475.1|  PREDICTED: basic leucine zipper 63-like            132   2e-33   
ref|XP_011021132.1|  PREDICTED: basic leucine zipper 43-like            132   2e-33   
ref|XP_007032940.1|  Basic leucine-zipper 42                            131   3e-33   
ref|XP_009356481.1|  PREDICTED: basic leucine zipper 10-like            130   1e-32   
ref|XP_010029442.1|  PREDICTED: basic leucine zipper 43                 129   2e-32   
gb|KCW56356.1|  hypothetical protein EUGRSUZ_I02090                     129   2e-32   
gb|AAK01953.1|  bZIP                                                    129   2e-32   Phaseolus acutifolius
ref|XP_002278738.1|  PREDICTED: basic leucine zipper 43                 129   4e-32   Vitis vinifera
emb|CDP02366.1|  unnamed protein product                                128   5e-32   
ref|XP_009378305.1|  PREDICTED: basic leucine zipper 63-like            128   5e-32   
gb|EYU28915.1|  hypothetical protein MIMGU_mgv1a014639mg                128   5e-32   
ref|XP_011099071.1|  PREDICTED: basic leucine zipper 43                 127   7e-32   
ref|XP_010694542.1|  PREDICTED: basic leucine zipper 43                 127   7e-32   
gb|KDP24311.1|  hypothetical protein JCGZ_25607                         127   9e-32   
gb|ADL36621.1|  BZIP domain class transcription factor                  127   1e-31   
ref|XP_006482346.1|  PREDICTED: ocs element-binding factor 1-like       127   1e-31   
ref|XP_004297182.1|  PREDICTED: G-box-binding factor 3-like             127   1e-31   
ref|XP_006363571.1|  PREDICTED: light-inducible protein CPRF2-like      127   1e-31   
ref|XP_010032584.1|  PREDICTED: basic leucine zipper 43-like            127   3e-31   
ref|XP_002530800.1|  Ocs element-binding factor, putative               126   3e-31   Ricinus communis
ref|XP_008230330.1|  PREDICTED: ocs element-binding factor 1-like       126   3e-31   
ref|XP_007215978.1|  hypothetical protein PRUPE_ppa011644mg             126   3e-31   
ref|XP_006417112.1|  hypothetical protein EUTSA_v10008825mg             126   3e-31   
ref|XP_006430890.1|  hypothetical protein CICLE_v10013334mg             125   4e-31   
ref|XP_008389357.1|  PREDICTED: basic leucine zipper 63-like            125   6e-31   
ref|XP_002892761.1|  bZIP transcription factor family protein           125   9e-31   
ref|NP_172817.2|  basic leucine-zipper 58                               125   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010100890.1|  Ocs element-binding factor 1                       125   2e-30   
ref|XP_004141481.1|  PREDICTED: transcription factor HBP-1a-like        124   2e-30   
ref|XP_009117984.1|  PREDICTED: ocs element-binding factor 1-like       124   2e-30   
emb|CDY45336.1|  BnaC01g30400D                                          124   3e-30   
gb|KEH22053.1|  BZIP transcription factor                               123   3e-30   
emb|CDY16099.1|  BnaC08g40240D                                          122   4e-30   
gb|AFO63290.1|  bZIP11                                                  124   4e-30   
ref|XP_008377571.1|  PREDICTED: light-inducible protein CPRF2-like      123   4e-30   
ref|XP_010554251.1|  PREDICTED: basic leucine zipper 43-like            123   4e-30   
ref|XP_006303717.1|  hypothetical protein CARUB_v10011839mg             123   5e-30   
gb|KEH18256.1|  BZIP transcription factor                               122   5e-30   
ref|XP_010495411.1|  PREDICTED: basic leucine zipper 43-like            123   5e-30   
ref|XP_010458808.1|  PREDICTED: basic leucine zipper 43-like            123   6e-30   
ref|XP_010476364.1|  PREDICTED: basic leucine zipper 43-like            123   6e-30   
ref|XP_009373742.1|  PREDICTED: ocs element-binding factor 1-like       122   8e-30   
ref|XP_010528016.1|  PREDICTED: basic leucine zipper 43                 122   8e-30   
ref|XP_008459417.1|  PREDICTED: basic leucine zipper 63-like            122   9e-30   
ref|XP_010523524.1|  PREDICTED: basic leucine zipper 43-like            122   9e-30   
ref|XP_010528445.1|  PREDICTED: basic leucine zipper 43-like            121   1e-29   
ref|XP_008341823.1|  PREDICTED: ocs element-binding factor 1-like       122   1e-29   
ref|XP_009355720.1|  PREDICTED: basic leucine zipper 63                 122   1e-29   
ref|XP_010091673.1|  Ocs element-binding factor 1                       122   2e-29   
emb|CDY37559.1|  BnaA02g20110D                                          122   2e-29   
gb|KFK43613.1|  hypothetical protein AALP_AA1G149300                    121   2e-29   
gb|KDO72256.1|  hypothetical protein CISIN_1g042014mg                   120   2e-29   
ref|XP_006395249.1|  hypothetical protein EUTSA_v10005423mg             120   3e-29   
emb|CDY66911.1|  BnaA06g39730D                                          120   3e-29   
emb|CDX85297.1|  BnaC07g26080D                                          120   3e-29   
ref|XP_009129054.1|  PREDICTED: ocs element-binding factor 1            120   3e-29   
ref|XP_010514686.1|  PREDICTED: basic leucine zipper 43-like            120   3e-29   
ref|XP_010425193.1|  PREDICTED: basic leucine zipper 43-like            120   3e-29   
ref|XP_010503013.1|  PREDICTED: basic leucine zipper 43-like            120   3e-29   
emb|CDX99780.1|  BnaC02g35400D                                          120   3e-29   
ref|XP_009603686.1|  PREDICTED: basic leucine zipper 43-like            120   3e-29   
ref|XP_011012258.1|  PREDICTED: basic leucine zipper 43-like            120   4e-29   
ref|XP_009792002.1|  PREDICTED: basic leucine zipper 43-like            120   5e-29   
ref|XP_010502422.1|  PREDICTED: basic leucine zipper 43-like            119   5e-29   
ref|XP_008243767.1|  PREDICTED: basic leucine zipper 63                 120   6e-29   
ref|NP_189674.1|  basic leucine-zipper 42                               119   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006384243.1|  bZIP transcription factor family protein           120   7e-29   
ref|XP_010316197.1|  PREDICTED: basic leucine zipper 43                 119   7e-29   
ref|XP_007223457.1|  hypothetical protein PRUPE_ppa011589mg             120   8e-29   
ref|XP_006291935.1|  hypothetical protein CARUB_v10018121mg             119   1e-28   
ref|XP_004137148.1|  PREDICTED: ocs element-binding factor 1-like       118   1e-28   
ref|XP_002875554.1|  bZIP transcription factor family protein           118   1e-28   
emb|CDY35775.1|  BnaC02g38190D                                          118   1e-28   
gb|KFK39850.1|  hypothetical protein AALP_AA3G296300                    117   3e-28   
ref|XP_006338314.1|  PREDICTED: light-inducible protein CPRF2-like      117   3e-28   
ref|XP_009148651.1|  PREDICTED: ocs element-binding factor 1-like       118   4e-28   
gb|EYU44259.1|  hypothetical protein MIMGU_mgv1a018568mg                116   5e-28   
gb|AFK43945.1|  unknown                                                 117   5e-28   
ref|XP_010496052.1|  PREDICTED: basic leucine zipper 43-like            117   6e-28   
ref|XP_009129683.1|  PREDICTED: ocs element-binding factor 1-like       116   8e-28   
gb|EPS60120.1|  hypothetical protein M569_14683                         114   2e-27   
ref|XP_010514166.1|  PREDICTED: basic leucine zipper 43-like            115   2e-27   
ref|XP_006292701.1|  hypothetical protein CARUB_v10018947mg             115   2e-27   
ref|XP_004304176.1|  PREDICTED: basic leucine zipper 63-like            116   2e-27   
ref|XP_004490322.1|  PREDICTED: light-inducible protein CPRF2-like      115   3e-27   
ref|XP_007151433.1|  hypothetical protein PHAVU_004G045800g             115   3e-27   
gb|EPS71175.1|  hypothetical protein M569_03582                         115   4e-27   
emb|CDY71548.1|  BnaCnng73390D                                          114   4e-27   
ref|XP_006395651.1|  hypothetical protein EUTSA_v10005000mg             114   5e-27   
ref|XP_009588233.1|  PREDICTED: basic leucine zipper 43-like            114   6e-27   
ref|XP_002875253.1|  hypothetical protein ARALYDRAFT_484308             112   1e-26   
ref|XP_009152133.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...    113   1e-26   
ref|NP_001235209.1|  uncharacterized protein LOC100500497               113   2e-26   
ref|XP_010044346.1|  PREDICTED: basic leucine zipper 43                 113   2e-26   
gb|KEH21784.1|  BZIP transcription factor                               113   2e-26   
gb|KHN02655.1|  Ocs element-binding factor 1                            114   2e-26   
ref|NP_178489.1|  basic leucine-zipper 48                               112   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549959.1|  PREDICTED: basic leucine zipper 43                 112   3e-26   
ref|XP_009778656.1|  PREDICTED: basic leucine zipper 43-like            112   4e-26   
emb|CDY33124.1|  BnaC09g22200D                                          112   4e-26   
gb|ABI34652.1|  bZIP transcription factor bZIP73B                       111   8e-26   Glycine max [soybeans]
ref|NP_001235322.1|  uncharacterized protein LOC100527640               111   8e-26   
gb|KGN49810.1|  hypothetical protein Csa_5G137430                       110   9e-26   
ref|XP_010558536.1|  PREDICTED: basic leucine zipper 43-like            110   9e-26   
ref|XP_008466040.1|  PREDICTED: light-inducible protein CPRF2           111   9e-26   
ref|XP_010525137.1|  PREDICTED: basic leucine zipper 43-like            110   1e-25   
gb|EYU39353.1|  hypothetical protein MIMGU_mgv1a024017mg                109   1e-25   
ref|XP_007139371.1|  hypothetical protein PHAVU_008G023800g             110   2e-25   
ref|XP_010552351.1|  PREDICTED: basic leucine zipper 43-like            110   2e-25   
ref|XP_004507268.1|  PREDICTED: basic leucine zipper 63-like            110   4e-25   
ref|XP_004149503.1|  PREDICTED: uncharacterized protein LOC101222428    110   4e-25   
ref|NP_001235016.1|  bZIP transcription factor bZIP73A                  109   4e-25   
gb|KHN13783.1|  Ocs element-binding factor 1                            109   5e-25   
ref|XP_006346868.1|  PREDICTED: light-inducible protein CPRF2-like      108   9e-25   
ref|XP_003635906.1|  BZIP transcription factor bZIP73A                  108   1e-24   
ref|NP_197087.1|  basic leucine-zipper 3                                108   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237100.1|  uncharacterized protein LOC100527256               108   2e-24   
ref|XP_010681298.1|  PREDICTED: basic leucine zipper 43-like            107   2e-24   
ref|XP_010492432.1|  PREDICTED: basic leucine zipper 43-like            107   3e-24   
ref|XP_003555028.1|  PREDICTED: basic leucine zipper 63-like            108   3e-24   
ref|XP_002871687.1|  hypothetical protein ARALYDRAFT_488428             107   3e-24   
ref|XP_011085668.1|  PREDICTED: basic leucine zipper 43-like            106   3e-24   
ref|XP_009114126.1|  PREDICTED: ocs element-binding factor 1-like       106   5e-24   
ref|XP_004164850.1|  PREDICTED: uncharacterized protein LOC101227590    110   5e-24   
ref|XP_006284650.1|  hypothetical protein CARUB_v10005907mg             105   6e-24   
ref|XP_010453732.1|  PREDICTED: basic leucine zipper 43-like            105   1e-23   
ref|XP_010496567.1|  PREDICTED: basic leucine zipper 43                 103   3e-23   
ref|XP_006288751.1|  hypothetical protein CARUB_v10002068mg             103   4e-23   
ref|XP_009126070.1|  PREDICTED: G-box-binding factor 3-like             103   4e-23   
ref|XP_010420260.1|  PREDICTED: basic leucine zipper 43-like            103   5e-23   
emb|CDX90970.1|  BnaC02g06270D                                          103   1e-22   
gb|KFK36518.1|  hypothetical protein AALP_AA4G134500                    101   2e-22   
ref|XP_006844140.1|  hypothetical protein AMTR_s00006p00259200          102   3e-22   
gb|AAO22653.1|  putative bZIP family transcription factor               100   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198696.1|  basic leucine-zipper 43                               100   6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868752.1|  bZIP transcription factor family protein         99.8    9e-22   
ref|XP_006400109.1|  hypothetical protein EUTSA_v10015835mg             100   1e-21   
ref|XP_006405699.1|  hypothetical protein EUTSA_v10028235mg           99.8    1e-21   
ref|XP_009151747.1|  PREDICTED: ocs element-binding factor 1-like     99.4    1e-21   
ref|XP_010435789.1|  PREDICTED: basic leucine zipper 43-like          99.0    2e-21   
emb|CDX70656.1|  BnaC03g07400D                                        97.8    9e-21   
emb|CDY26467.1|  BnaC09g42010D                                        97.4    9e-21   
ref|XP_009131503.1|  PREDICTED: ocs element-binding factor 1-like     96.3    3e-20   
ref|XP_008804405.1|  PREDICTED: basic leucine zipper 63-like          96.3    4e-20   
emb|CDX70639.1|  BnaC03g07230D                                        95.9    4e-20   
ref|XP_009121541.1|  PREDICTED: ocs element-binding factor 1          95.1    6e-20   
emb|CDX69495.1|  BnaA10g18440D                                        95.1    6e-20   
ref|XP_008807020.1|  PREDICTED: ocs element-binding factor 1-like     90.5    2e-18   
ref|XP_010942236.1|  PREDICTED: basic leucine zipper 43-like          89.7    3e-18   
ref|XP_010943359.1|  PREDICTED: basic leucine zipper 43               90.5    3e-18   
ref|XP_008783104.1|  PREDICTED: ocs element-binding factor 1-like     86.7    2e-17   
ref|XP_010929454.1|  PREDICTED: basic leucine zipper 43-like          86.3    2e-17   
gb|AFW73238.1|  putative bZIP transcription factor superfamily pr...  87.8    2e-17   
ref|XP_004953778.1|  PREDICTED: ocs element-binding factor 1-like     87.4    2e-17   
ref|XP_009391277.1|  PREDICTED: basic leucine zipper 63               87.0    2e-17   
ref|XP_008646194.1|  PREDICTED: uncharacterized protein LOC103627679  88.2    5e-17   
ref|NP_177054.1|  basic leucine-zipper 8                              83.6    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003570460.1|  PREDICTED: basic leucine zipper 43-like          83.6    6e-16   
ref|XP_002888689.1|  bZIP transcription factor family protein         82.0    8e-16   
ref|XP_002454348.1|  hypothetical protein SORBIDRAFT_04g029210        82.8    1e-15   Sorghum bicolor [broomcorn]
ref|NP_001150379.1|  G-box-binding factor 1                           82.8    1e-15   Zea mays [maize]
ref|XP_009417568.1|  PREDICTED: ocs element-binding factor 1-like     82.0    2e-15   
ref|XP_006840454.1|  hypothetical protein AMTR_s00045p00175090        80.9    4e-15   
ref|XP_010927984.1|  PREDICTED: basic leucine zipper 43-like          80.9    4e-15   
ref|XP_009407232.1|  PREDICTED: G-box-binding factor 3-like           80.1    8e-15   
ref|XP_007042116.1|  Basic leucine-zipper 44                          79.7    9e-15   
ref|XP_010106904.1|  Ocs element-binding factor 1                     80.5    1e-14   
gb|AEW08358.1|  hypothetical protein 2_6996_01                        79.0    1e-14   
ref|XP_009400114.1|  PREDICTED: uncharacterized protein LOC103984352  81.6    1e-14   
ref|XP_008445746.1|  PREDICTED: ocs element-binding factor 1-like     79.3    2e-14   
ref|XP_001766270.1|  predicted protein                                76.3    4e-14   
ref|XP_010441010.1|  PREDICTED: basic leucine zipper 43-like          78.2    4e-14   
ref|XP_001773106.1|  predicted protein                                76.3    4e-14   
ref|XP_008679087.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  78.2    5e-14   
gb|ADL36616.1|  BZIP domain class transcription factor                76.6    1e-13   
ref|NP_001233865.1|  bZIP transcription factor                        76.6    1e-13   
ref|XP_010039111.1|  PREDICTED: basic leucine zipper 43-like          77.8    1e-13   
ref|XP_010546230.1|  PREDICTED: basic leucine zipper 43-like          76.3    3e-13   
ref|XP_008650521.1|  PREDICTED: uncharacterized protein LOC103631376  76.3    3e-13   
gb|KCW49021.1|  hypothetical protein EUGRSUZ_K02632                   74.7    4e-13   
ref|XP_006362037.1|  PREDICTED: ocs element-binding factor 1-like     75.1    4e-13   
ref|XP_010671337.1|  PREDICTED: ocs element-binding factor 1-like     75.1    5e-13   
ref|XP_004291844.1|  PREDICTED: ocs element-binding factor 1-like     74.7    6e-13   
ref|XP_010914566.1|  PREDICTED: LOW QUALITY PROTEIN: ocs element-...  74.3    6e-13   
ref|XP_006466428.1|  PREDICTED: ocs element-binding factor 1-like     75.1    7e-13   
ref|XP_006426133.1|  hypothetical protein CICLE_v10027584mg           75.1    7e-13   
ref|XP_010254730.1|  PREDICTED: ocs element-binding factor 1-like     74.3    8e-13   
ref|XP_006341974.1|  PREDICTED: ocs element-binding factor 1-like     73.9    9e-13   
ref|XP_008797570.1|  PREDICTED: ocs element-binding factor 1-like     73.2    1e-12   
ref|XP_009802821.1|  PREDICTED: ocs element-binding factor 1-like     74.3    1e-12   
ref|XP_006301639.1|  hypothetical protein CARUB_v10022082mg           73.2    1e-12   
ref|XP_009623220.1|  PREDICTED: ocs element-binding factor 1-like     73.6    2e-12   
gb|ABR16645.1|  unknown                                               73.6    2e-12   Picea sitchensis
ref|XP_004289640.1|  PREDICTED: ocs element-binding factor 1-like     73.6    2e-12   
gb|AAN61914.1|AF430372_1  bZIP transcription factor                   73.6    2e-12   Capsicum chinense [bonnet pepper]
gb|AAD21199.1|  putative bZIP DNA-binding protein                     73.6    2e-12   Capsicum chinense [bonnet pepper]
gb|AEO12092.1|  putative bZIP-like DNA-binding protein                73.6    2e-12   
ref|XP_009339530.1|  PREDICTED: transcriptional activator TAF-1       73.2    2e-12   
ref|XP_008812527.1|  PREDICTED: ocs element-binding factor 1-like     72.8    2e-12   
ref|XP_009335873.1|  PREDICTED: ocs element-binding factor 1          73.2    2e-12   
ref|XP_009619503.1|  PREDICTED: ocs element-binding factor 1-like     73.2    2e-12   
ref|XP_007047594.1|  Basic leucine-zipper 5, putative                 73.6    3e-12   
ref|XP_009410287.1|  PREDICTED: DNA-binding protein EMBP-1-like       73.9    3e-12   
ref|NP_001281289.1|  ocs element-binding factor 1                     72.8    3e-12   
ref|XP_007037689.1|  Basic leucine-zipper 70, putative                73.6    3e-12   
ref|XP_004238299.1|  PREDICTED: ocs element-binding factor 1          72.8    3e-12   
ref|NP_001238344.1|  bZIP transcription factor bZIP124                72.8    3e-12   
ref|XP_008393381.1|  PREDICTED: ocs element-binding factor 1-like     73.2    3e-12   
ref|XP_008377201.1|  PREDICTED: ocs element-binding factor 1-like     72.8    3e-12   
gb|EAY87376.1|  hypothetical protein OsI_08779                        72.8    3e-12   Oryza sativa Indica Group [Indian rice]
gb|ADL36602.1|  BZIP domain class transcription factor                73.2    3e-12   
ref|XP_010511910.1|  PREDICTED: basic leucine zipper 43-like          72.4    3e-12   
ref|XP_010105351.1|  Ocs element-binding factor 1                     72.4    3e-12   
gb|KDP32105.1|  hypothetical protein JCGZ_12566                       73.2    3e-12   
gb|KHN25400.1|  Ocs element-binding factor 1                          72.8    3e-12   
ref|XP_008237492.1|  PREDICTED: light-inducible protein CPRF2-like    73.6    4e-12   
ref|XP_002283667.1|  PREDICTED: ocs element-binding factor 1          72.4    4e-12   Vitis vinifera
ref|XP_010936666.1|  PREDICTED: ocs element-binding factor 1-like     72.4    4e-12   
ref|XP_010275577.1|  PREDICTED: ocs element-binding factor 1-like     72.4    4e-12   
ref|XP_008236935.1|  PREDICTED: ocs element-binding factor 1-like     72.4    4e-12   
ref|XP_002533570.1|  Ocs element-binding factor, putative             73.2    4e-12   Ricinus communis
ref|XP_007200420.1|  hypothetical protein PRUPE_ppa012739mg           72.4    4e-12   
emb|CDY51629.1|  BnaCnng21210D                                        72.8    5e-12   
gb|EMS55278.1|  G-box-binding factor 1                                72.4    5e-12   
ref|XP_004965226.1|  PREDICTED: transcription factor HBP-1a-like      72.4    6e-12   
ref|XP_007205896.1|  hypothetical protein PRUPE_ppa011366mg           72.8    6e-12   
ref|XP_002512945.1|  Ocs element-binding factor, putative             72.0    6e-12   Ricinus communis
emb|CAN70943.1|  hypothetical protein VITISV_002866                   72.0    6e-12   Vitis vinifera
ref|XP_008374962.1|  PREDICTED: transcriptional activator TAF-1       71.6    6e-12   
ref|XP_009378662.1|  PREDICTED: ocs element-binding factor 1-like     72.0    6e-12   
ref|XP_010649106.1|  PREDICTED: ocs element-binding factor 1-like     71.6    7e-12   
ref|XP_004509055.1|  PREDICTED: ocs element-binding factor 1-like     72.0    8e-12   
emb|CBI37685.3|  unnamed protein product                              72.4    8e-12   
ref|XP_006374787.1|  hypothetical protein POPTR_0014s00790g           70.9    8e-12   
ref|XP_009380390.1|  PREDICTED: ocs element-binding factor 1-like     71.2    8e-12   
emb|CAN73127.1|  hypothetical protein VITISV_016463                   71.6    8e-12   Vitis vinifera
ref|XP_011047964.1|  PREDICTED: ocs element-binding factor 1-like     71.2    9e-12   
ref|XP_002313781.1|  bZIP transcription factor family protein         71.2    1e-11   Populus trichocarpa [western balsam poplar]
gb|KFK41324.1|  hypothetical protein AALP_AA2G115200                  70.9    1e-11   
ref|XP_002310886.1|  bZIP transcription factor family protein         71.2    1e-11   Populus trichocarpa [western balsam poplar]
gb|AAX20038.1|  bZIP protein                                          71.6    1e-11   Capsicum annuum
gb|EYU37819.1|  hypothetical protein MIMGU_mgv1a015476mg              71.2    1e-11   
ref|XP_009136401.1|  PREDICTED: G-box-binding factor 1-like           71.6    1e-11   
ref|XP_011007850.1|  PREDICTED: basic leucine zipper 43-like          72.4    1e-11   
ref|XP_008240060.1|  PREDICTED: ocs element-binding factor 1-like     71.6    1e-11   
ref|XP_007209676.1|  hypothetical protein PRUPE_ppa012281mg           71.2    1e-11   
ref|XP_008377260.1|  PREDICTED: ocs element-binding factor 1-like     70.9    1e-11   
gb|KDO65625.1|  hypothetical protein CISIN_1g041582mg                 70.5    2e-11   
emb|CDY02193.1|  BnaA03g39740D                                        71.2    2e-11   
ref|XP_006485842.1|  PREDICTED: ocs element-binding factor 1-like     71.2    2e-11   
ref|XP_011041724.1|  PREDICTED: basic leucine zipper 43-like          71.2    2e-11   
ref|XP_009395539.1|  PREDICTED: ocs element-binding factor 1-like     70.5    2e-11   
ref|XP_009362602.1|  PREDICTED: light-inducible protein CPRF2         71.2    2e-11   
ref|XP_006440834.1|  hypothetical protein CICLE_v10024105mg           70.9    2e-11   
gb|ADL36619.1|  BZIP domain class transcription factor                70.5    2e-11   
gb|KEH40186.1|  BZIP transcription factor bZIP124                     70.5    2e-11   
ref|XP_002981958.1|  hypothetical protein SELMODRAFT_17886            68.9    2e-11   
ref|NP_001236565.1|  bZIP transcription factor ATB2                   70.5    2e-11   
ref|XP_010522314.1|  PREDICTED: basic leucine zipper 43               70.9    2e-11   
ref|XP_007135953.1|  hypothetical protein PHAVU_009G005800g           70.1    2e-11   
gb|AFK39574.1|  unknown                                               70.1    3e-11   
ref|XP_003606980.1|  BZIP transcription factor ATB2                   70.1    3e-11   
ref|XP_008349913.1|  PREDICTED: ocs element-binding factor 1-like     70.1    3e-11   
ref|NP_001237177.1|  bZIP transcription factor bZIP123                69.7    3e-11   
ref|XP_007131800.1|  hypothetical protein PHAVU_011G042600g           70.1    3e-11   
gb|AFK48507.1|  unknown                                               70.1    3e-11   
ref|XP_010259311.1|  PREDICTED: ocs element-binding factor 1          69.7    3e-11   
ref|XP_004957101.1|  PREDICTED: basic leucine zipper 63-like          70.5    3e-11   
ref|XP_011073675.1|  PREDICTED: basic leucine zipper 43               70.5    3e-11   
ref|XP_010023331.1|  PREDICTED: LOW QUALITY PROTEIN: ocs element-...  70.5    3e-11   
emb|CDP20069.1|  unnamed protein product                              69.7    4e-11   
ref|XP_010029747.1|  PREDICTED: ocs element-binding factor 1-like     69.7    4e-11   
ref|XP_003634372.1|  PREDICTED: ocs element-binding factor 1          69.7    4e-11   
ref|XP_009419228.1|  PREDICTED: ocs element-binding factor 1          68.9    4e-11   
gb|KCW59582.1|  hypothetical protein EUGRSUZ_H02330                   69.7    4e-11   
ref|XP_009388225.1|  PREDICTED: ocs element-binding factor 1-like     69.3    4e-11   
ref|XP_008444748.1|  PREDICTED: ocs element-binding factor 1          69.7    4e-11   
ref|NP_001287928.1|  uncharacterized protein LOC101514947             69.7    4e-11   
ref|XP_008460967.1|  PREDICTED: ocs element-binding factor 1-like     69.7    4e-11   
ref|XP_009403896.1|  PREDICTED: ocs element-binding factor 1          69.3    4e-11   
ref|XP_006487251.1|  PREDICTED: ocs element-binding factor 1-like     69.7    5e-11   
ref|XP_002306888.1|  bZIP transcription factor family protein         69.3    5e-11   
ref|XP_006423361.1|  hypothetical protein CICLE_v10029834mg           69.7    5e-11   
ref|XP_002510435.1|  Ocs element-binding factor, putative             69.3    5e-11   
ref|XP_006847527.1|  hypothetical protein AMTR_s00014p00097990        69.3    5e-11   
ref|XP_003576641.1|  PREDICTED: DNA-binding protein EMBP-1-like       69.7    5e-11   
ref|XP_009150749.1|  PREDICTED: ocs element-binding factor 1-like     69.3    5e-11   
ref|XP_011100973.1|  PREDICTED: ocs element-binding factor 1-like     69.3    5e-11   
ref|XP_007017624.1|  Basic leucine-zipper 44                          69.3    6e-11   
ref|XP_011031320.1|  PREDICTED: basic leucine zipper 43-like          70.1    6e-11   
ref|XP_010066147.1|  PREDICTED: ocs element-binding factor 1-like     69.3    6e-11   
ref|XP_011083621.1|  PREDICTED: ocs element-binding factor 1          69.3    6e-11   
emb|CDY29220.1|  BnaA06g25370D                                        68.9    6e-11   
ref|XP_009782351.1|  PREDICTED: ocs element-binding factor 1-like     68.9    7e-11   
ref|XP_004137610.1|  PREDICTED: light-inducible protein CPRF3-like    70.1    7e-11   
gb|ACJ86156.1|  unknown                                               67.4    8e-11   
ref|XP_010672920.1|  PREDICTED: ocs element-binding factor 1-like     69.3    9e-11   
ref|XP_009353399.1|  PREDICTED: ocs element-binding factor 1-like     68.6    9e-11   
ref|XP_007223601.1|  hypothetical protein PRUPE_ppa012507mg           68.6    9e-11   
ref|XP_008454802.1|  PREDICTED: light-inducible protein CPRF3-like    69.7    1e-10   
ref|XP_002462527.1|  hypothetical protein SORBIDRAFT_02g027410        68.6    1e-10   
emb|CDX85891.1|  BnaC06g22430D                                        68.9    1e-10   
ref|XP_008784951.1|  PREDICTED: ocs element-binding factor 1-like     68.6    1e-10   
ref|XP_004148829.1|  PREDICTED: ocs element-binding factor 1-like     68.6    1e-10   
ref|XP_009414018.1|  PREDICTED: ocs element-binding factor 1-like     68.6    1e-10   
ref|XP_009386477.1|  PREDICTED: ocs element-binding factor 1-like     68.2    1e-10   
ref|XP_010552081.1|  PREDICTED: basic leucine zipper 43               67.8    1e-10   
gb|KDP31401.1|  hypothetical protein JCGZ_11777                       68.9    1e-10   
emb|CDY42835.1|  BnaAnng06600D                                        68.6    1e-10   
ref|XP_002982937.1|  hypothetical protein SELMODRAFT_17884            67.0    1e-10   
ref|XP_004152685.1|  PREDICTED: ocs element-binding factor 1-like     68.2    1e-10   
gb|KDP41759.1|  hypothetical protein JCGZ_26777                       67.8    2e-10   
ref|XP_004305578.1|  PREDICTED: light-inducible protein CPRF3-like    67.8    2e-10   
ref|XP_011100775.1|  PREDICTED: ocs element-binding factor 1-like     67.8    2e-10   
ref|XP_002514590.1|  DNA binding protein, putative                    68.2    2e-10   
ref|XP_008797454.1|  PREDICTED: ocs element-binding factor 1-like     67.4    2e-10   
ref|XP_009388838.1|  PREDICTED: ocs element-binding factor 1-like     67.8    2e-10   
ref|XP_008378822.1|  PREDICTED: light-inducible protein CPRF2-like    68.2    2e-10   
ref|XP_010647186.1|  PREDICTED: basic leucine zipper 1-like           68.2    2e-10   
ref|NP_001237649.1|  bZIP transcription factor bZIP125                67.4    2e-10   
ref|XP_010931749.1|  PREDICTED: ocs element-binding factor 1-like     67.4    2e-10   
gb|EYU32895.1|  hypothetical protein MIMGU_mgv1a015265mg              67.4    2e-10   
ref|XP_006394562.1|  hypothetical protein EUTSA_v10005347mg           67.8    2e-10   
ref|XP_006435056.1|  hypothetical protein CICLE_v10002731mg           67.4    2e-10   
ref|XP_002302016.2|  bZIP transcription factor family protein         67.4    3e-10   
ref|XP_004499193.1|  PREDICTED: ocs element-binding factor 1-like     67.4    3e-10   
ref|XP_010028614.1|  PREDICTED: ocs element-binding factor 1-like     67.8    3e-10   
ref|XP_011048821.1|  PREDICTED: ocs element-binding factor 1-like     67.4    3e-10   
dbj|BAD34015.1|  hypothetical protein                                 67.4    3e-10   
gb|KDO84653.1|  hypothetical protein CISIN_1g041765mg                 67.4    3e-10   
ref|XP_006409191.1|  hypothetical protein EUTSA_v10022883mg           67.4    3e-10   
ref|NP_001046158.2|  Os02g0191600                                     68.2    3e-10   
ref|XP_010548308.1|  PREDICTED: ocs element-binding factor 1-like     67.4    3e-10   
ref|XP_009348038.1|  PREDICTED: transcriptional activator TAF-1-like  67.0    3e-10   
ref|XP_011028895.1|  PREDICTED: ocs element-binding factor 1-like     67.0    3e-10   
ref|XP_007156692.1|  hypothetical protein PHAVU_002G009200g           67.4    3e-10   
ref|XP_006473552.1|  PREDICTED: ocs element-binding factor 1-like     67.0    4e-10   
gb|EAY84825.1|  hypothetical protein OsI_06191                        67.0    4e-10   
gb|ABI34668.1|  bZIP transcription factor bZIP126                     67.0    4e-10   
gb|AAG13064.1|AC023754_2  similar to DNA-binding protein              67.0    4e-10   
ref|XP_002320675.2|  bZIP transcription factor family protein         66.6    4e-10   
ref|XP_002887591.1|  bZIP transcription factor family protein         67.0    4e-10   
gb|AFG60879.1|  hypothetical protein 0_3567_01                        66.6    4e-10   
emb|CDX81569.1|  BnaC02g18730D                                        66.2    4e-10   
ref|XP_009104708.1|  PREDICTED: ocs element-binding factor 1-like     67.0    4e-10   
ref|XP_002305442.1|  hypothetical protein POPTR_0004s16560g           66.6    4e-10   
gb|AFG60876.1|  hypothetical protein 0_3567_01                        66.6    4e-10   
ref|XP_003608557.1|  Ocs element-binding factor                       67.0    4e-10   
ref|XP_010110029.1|  Ocs element-binding factor 1                     66.6    4e-10   
ref|NP_177672.2|  basic leucine-zipper 44                             67.0    5e-10   
ref|XP_009127682.1|  PREDICTED: ocs element-binding factor 1          65.9    5e-10   
emb|CDX87188.1|  BnaC09g05030D                                        67.8    5e-10   
ref|XP_006573673.1|  PREDICTED: light-inducible protein CPRF2-like    67.0    5e-10   
ref|XP_010686844.1|  PREDICTED: G-box-binding factor 3-like           67.4    5e-10   
ref|XP_006390310.1|  hypothetical protein EUTSA_v10019604mg           67.0    5e-10   
ref|XP_011010367.1|  PREDICTED: basic leucine zipper 10-like          67.4    5e-10   
ref|XP_008791143.1|  PREDICTED: ocs element-binding factor 1-like     66.6    5e-10   
gb|KFK40204.1|  hypothetical protein AALP_AA3G343500                  66.6    5e-10   
emb|CDP02628.1|  unnamed protein product                              67.8    5e-10   
gb|KHN36318.1|  G-box-binding factor 1                                66.6    5e-10   
emb|CDP07476.1|  unnamed protein product                              66.6    5e-10   
ref|XP_009375134.1|  PREDICTED: basic leucine zipper 1-like           66.2    5e-10   
emb|CDY46312.1|  BnaA07g01890D                                        66.6    5e-10   
ref|XP_006363804.1|  PREDICTED: basic leucine zipper 63-like          67.4    6e-10   
gb|ACN71235.1|  bZIP transcription factor                             66.2    6e-10   
ref|XP_010316032.1|  PREDICTED: basic leucine zipper 63               67.4    6e-10   
ref|NP_001077826.1|  basic leucine-zipper 44                          65.9    6e-10   
gb|AFW63773.1|  putative bZIP transcription factor superfamily pr...  66.2    6e-10   
gb|KHN01733.1|  G-box-binding factor 1                                66.6    6e-10   
ref|XP_010470838.1|  PREDICTED: basic leucine zipper 43-like          65.9    6e-10   
ref|XP_008377948.1|  PREDICTED: basic leucine zipper 1-like           66.2    6e-10   
ref|XP_008347595.1|  PREDICTED: basic leucine zipper 1-like           65.9    7e-10   
ref|XP_002321470.2|  hypothetical protein POPTR_0015s03580g           66.2    7e-10   
ref|XP_009382501.1|  PREDICTED: ocs element-binding factor 1-like     65.9    7e-10   
ref|XP_010922822.1|  PREDICTED: ocs element-binding factor 1-like     66.2    7e-10   
emb|CDY20909.1|  BnaC06g01290D                                        66.2    8e-10   
gb|ABA99797.2|  bZIP transcription factor family protein, expressed   67.0    8e-10   
ref|XP_010428558.1|  PREDICTED: ocs element-binding factor 1-like     66.2    8e-10   
ref|NP_179408.1|  basic leucine-zipper 2                              66.2    8e-10   
ref|XP_009384424.1|  PREDICTED: ocs element-binding factor 1          65.5    9e-10   
ref|XP_007155196.1|  hypothetical protein PHAVU_003G181500g           66.6    9e-10   
ref|XP_002886152.1|  G-box binding factor 5                           66.2    9e-10   
ref|XP_002885711.1|  bZIP transcription factor family protein         66.2    9e-10   
ref|XP_006391082.1|  hypothetical protein EUTSA_v10019568mg           65.5    9e-10   
ref|XP_010229875.1|  PREDICTED: basic leucine zipper 43-like          65.1    9e-10   
ref|XP_010248350.1|  PREDICTED: ocs element-binding factor 1-like     65.9    9e-10   
emb|CAN62264.1|  hypothetical protein VITISV_018458                   67.8    1e-09   
ref|XP_006281849.1|  hypothetical protein CARUB_v10028041mg           66.2    1e-09   
ref|XP_010413979.1|  PREDICTED: ocs element-binding factor 1-like     65.9    1e-09   
ref|XP_007155805.1|  hypothetical protein PHAVU_003G233200g           65.9    1e-09   
gb|KGN53291.1|  hypothetical protein Csa_4G045060                     65.5    1e-09   
ref|XP_010489514.1|  PREDICTED: ocs element-binding factor 1-like     65.9    1e-09   
ref|XP_010415508.1|  PREDICTED: basic leucine zipper 43               65.1    1e-09   
ref|XP_010999906.1|  PREDICTED: basic leucine zipper 43               65.5    1e-09   
ref|XP_009778344.1|  PREDICTED: ocs element-binding factor 1-like     65.1    1e-09   
ref|XP_008452107.1|  PREDICTED: ocs element-binding factor 1          65.5    1e-09   
ref|XP_010471646.1|  PREDICTED: ocs element-binding factor 1-like     65.9    1e-09   
ref|XP_006302882.1|  hypothetical protein CARUB_v10021012mg           65.9    1e-09   
ref|XP_009418466.1|  PREDICTED: basic leucine zipper 1-like           65.5    1e-09   
gb|EYU31181.1|  hypothetical protein MIMGU_mgv1a015148mg              65.5    1e-09   
ref|XP_009102266.1|  PREDICTED: ocs element-binding factor 1          65.5    1e-09   
ref|XP_009417031.1|  PREDICTED: ocs element-binding factor 1-like     65.1    2e-09   
tpg|DAA47412.1|  TPA: putative bZIP transcription factor superfam...  65.9    2e-09   
gb|EAY83788.1|  hypothetical protein OsI_39004                        67.4    2e-09   
ref|XP_006383159.1|  hypothetical protein POPTR_0005s12130g           65.1    2e-09   
ref|XP_009111959.1|  PREDICTED: basic leucine zipper 25-like          65.9    2e-09   
ref|XP_010548067.1|  PREDICTED: ocs element-binding factor 1-like     65.1    2e-09   
ref|XP_009589486.1|  PREDICTED: basic leucine zipper 43-like          65.9    2e-09   
ref|XP_004500793.1|  PREDICTED: ocs element-binding factor 1-like     65.1    2e-09   
gb|KFK41975.1|  hypothetical protein AALP_AA2G196000                  65.1    2e-09   
ref|XP_010526773.1|  PREDICTED: ocs element-binding factor 1          65.1    2e-09   
emb|CDY16837.1|  BnaA09g05450D                                        65.9    2e-09   
gb|ABA99796.2|  bZIP transcription factor family protein, expressed   67.0    2e-09   
ref|XP_002297692.2|  bZIP transcription factor 3 family protein       67.8    2e-09   
gb|AFG52926.1|  hypothetical protein 0_7512_01                        64.3    2e-09   
ref|XP_010530816.1|  PREDICTED: ocs element-binding factor 1-like     64.7    2e-09   
ref|NP_200891.1|  basic leucine-zipper 70                             65.5    2e-09   
ref|XP_011018470.1|  PREDICTED: transcription factor HBP-1a           67.4    2e-09   
emb|CDP01018.1|  unnamed protein product                              64.7    2e-09   
ref|XP_007018448.1|  Basic leucine-zipper 4, putative                 64.3    3e-09   
dbj|BAB10103.1|  unnamed protein product                              65.1    3e-09   
ref|XP_006299149.1|  hypothetical protein CARUB_v10015292mg           64.7    3e-09   
ref|XP_011037478.1|  PREDICTED: ocs element-binding factor 1-like     64.3    3e-09   
ref|NP_001142918.1|  uncharacterized protein LOC100275351             66.6    3e-09   
ref|NP_001045798.1|  Os02g0132500                                     64.3    3e-09   
ref|XP_008338147.1|  PREDICTED: light-inducible protein CPRF2-like    65.1    3e-09   
ref|XP_009421414.1|  PREDICTED: ocs element-binding factor 1-like     64.3    3e-09   
ref|XP_003611541.1|  Protein ABSCISIC ACID-INSENSITIVE                64.3    3e-09   
ref|XP_010087331.1|  G-box-binding factor 1                           65.5    3e-09   
ref|XP_011028519.1|  PREDICTED: ocs element-binding factor 1-like     64.3    3e-09   
ref|XP_009341787.1|  PREDICTED: light-inducible protein CPRF2-like    65.1    3e-09   
ref|XP_002864706.1|  bZIP transcription factor family protein         64.7    3e-09   
gb|AHI85805.1|  basic leucine zipper protein                          63.9    4e-09   
ref|XP_002304358.1|  bZIP transcription factor 3 family protein       67.0    4e-09   
ref|XP_010526918.1|  PREDICTED: ocs element-binding factor 1-like     63.9    4e-09   
ref|XP_003527681.2|  PREDICTED: ocs element-binding factor 1-like     63.9    4e-09   
gb|AFG52928.1|  hypothetical protein 0_7512_01                        63.5    4e-09   
ref|XP_010531056.1|  PREDICTED: ocs element-binding factor 1-like     64.3    4e-09   
ref|XP_008792810.1|  PREDICTED: ocs element-binding factor 1-like     63.9    4e-09   
ref|XP_010533482.1|  PREDICTED: ocs element-binding factor 1-like     64.3    4e-09   
gb|EPS69448.1|  hypothetical protein M569_05319                       62.8    4e-09   
ref|XP_011028102.1|  PREDICTED: transcription factor HBP-1a           67.0    4e-09   
ref|XP_004232435.1|  PREDICTED: ocs element-binding factor 1-like     63.9    4e-09   
ref|XP_009414907.1|  PREDICTED: ocs element-binding factor 1-like     63.9    4e-09   
ref|XP_008781106.1|  PREDICTED: LOW QUALITY PROTEIN: ocs element-...  63.5    5e-09   
ref|XP_009792283.1|  PREDICTED: basic leucine zipper 43-like          64.7    5e-09   
gb|AES74222.2|  BZIP transcription factor bZIP124                     63.9    5e-09   
ref|XP_010483738.1|  PREDICTED: basic leucine zipper 43-like          64.3    5e-09   
ref|XP_011083326.1|  PREDICTED: ocs element-binding factor 1-like     63.9    5e-09   
gb|AFG52929.1|  hypothetical protein 0_7512_01                        63.2    5e-09   
ref|XP_004287866.1|  PREDICTED: ocs element-binding factor 1-like     63.5    6e-09   
ref|XP_007160724.1|  hypothetical protein PHAVU_001G011800g           63.5    6e-09   
ref|XP_010028071.1|  PREDICTED: basic leucine zipper 34-like          65.1    6e-09   
ref|XP_002442478.1|  hypothetical protein SORBIDRAFT_08g020600        65.9    6e-09   
ref|XP_004171858.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  63.9    6e-09   
gb|EEC84743.1|  hypothetical protein OsI_31740                        63.9    6e-09   
ref|XP_010456776.1|  PREDICTED: basic leucine zipper 43-like          63.9    6e-09   
ref|XP_010416418.1|  PREDICTED: ocs element-binding factor 1-like     63.9    6e-09   
ref|NP_001063454.1|  Os09g0474000                                     63.9    6e-09   
ref|NP_001062099.1|  Os08g0487100                                     64.7    6e-09   
ref|XP_004973757.1|  PREDICTED: G-box-binding factor 1-like           64.7    7e-09   
ref|XP_010443890.1|  PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like ...  63.9    7e-09   
ref|XP_010911133.1|  PREDICTED: ocs element-binding factor 1-like     63.2    7e-09   
ref|XP_006660738.1|  PREDICTED: basic leucine zipper 9-like           63.9    7e-09   
tpg|DAA47409.1|  TPA: putative bZIP transcription factor superfam...  64.3    7e-09   
ref|XP_009394698.1|  PREDICTED: ocs element-binding factor 1-like     63.2    7e-09   
ref|XP_003579247.1|  PREDICTED: ocs element-binding factor 1-like     63.5    7e-09   
gb|KDP30714.1|  hypothetical protein JCGZ_15542                       66.2    7e-09   
ref|XP_010940118.1|  PREDICTED: ocs element-binding factor 1-like     63.2    7e-09   



>ref|XP_006348623.1| PREDICTED: basic leucine zipper 63-like [Solanum tuberosum]
Length=194

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 138/195 (71%), Gaps = 19/195 (10%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTF-NSSSPAIDFTRFLNINNNHHQNALPIITPPD  623
            MIPS E    +YFS+E+  +L PLDF F  +SSP++ F+R+L        N LP     D
Sbjct  1    MIPS-ETAATHYFSSENP-SLLPLDFNFMQNSSPSLHFSRYLT-------NILPNYPVND  51

Query  622  Fsls--asisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVL  449
            F+    + IS+NSTSDE++EQQ +IIDERK+RRM+SNRESARRSRMRK+R LDELWSQVL
Sbjct  52   FNNLLPSCISSNSTSDETDEQQFKIIDERKKRRMISNRESARRSRMRKQRQLDELWSQVL  111

Query  448  AFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLE  269
              RTEN NL+D+LN +SE HDKVL EN++LKEE S LR+++ +L+    + PF DL DLE
Sbjct  112  RLRTENHNLIDKLNHVSECHDKVLQENSQLKEETSDLRQMLTDLQ---FNSPFPDLCDLE  168

Query  268  DIKCSFQR*IIHLSA  224
            D+ C+      HL A
Sbjct  169  DVPCT----TAHLKA  179



>ref|XP_009774323.1| PREDICTED: basic leucine zipper 43-like [Nicotiana sylvestris]
Length=197

 Score =   154 bits (389),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 130/187 (70%), Gaps = 16/187 (9%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTF-NSSSPAIDFTRFLNINNNHHQNALPI----I  635
            MIPS E   I+YF++E+   LP LDF F +++ P++ F+R+L  N  ++  +LP+     
Sbjct  1    MIPS-EAAAIHYFASENTSPLP-LDFNFMHNNLPSLQFSRYL-TNLPNYPTSLPVHDFNN  57

Query  634  TPPDFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQ  455
             PP      S S+ +       QQ RIIDERK+RRM+SNRESARRSRMRK+RHLDELWSQ
Sbjct  58   MPPSCISGNSTSDEADE-----QQLRIIDERKKRRMISNRESARRSRMRKQRHLDELWSQ  112

Query  454  VLAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
            VL  RTEN NL+D+LNQ+S+ H++VL ENA LK+EAS LR+++  L+    + PF DL D
Sbjct  113  VLRLRTENHNLIDKLNQVSDCHERVLQENAELKQEASDLRQMLTHLQ---INSPFPDLFD  169

Query  274  LEDIKCS  254
            L+D+ C+
Sbjct  170  LDDVPCN  176



>ref|XP_009611005.1| PREDICTED: basic leucine zipper 43-like [Nicotiana tomentosiformis]
Length=197

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 137/185 (74%), Gaps = 12/185 (6%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTF-NSSSPAIDFTRFLNINNNHHQNALPIITPPD  623
            MIPS E   ++YF++E+   LP LDF F +++ P++ F+R+L  N  ++   LP+    D
Sbjct  1    MIPS-EAAAVHYFASENTSPLP-LDFNFMHNNLPSLHFSRYL-TNLPNYPTTLPVH---D  54

Query  622  Fsls--asisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVL  449
            FS    + IS NSTSDE++EQQ RIIDERK+RRM+SNRESARRSRMRK++HLDELWSQVL
Sbjct  55   FSNMPLSCISGNSTSDEADEQQLRIIDERKKRRMISNRESARRSRMRKQKHLDELWSQVL  114

Query  448  AFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLE  269
              RTEN NL+D+LNQ+S+ HDKVL ENA+LKEEAS LR+++  L+       F DL DLE
Sbjct  115  RLRTENHNLIDKLNQVSDCHDKVLQENAQLKEEASDLRQMLTVLQFNSI---FPDLCDLE  171

Query  268  DIKCS  254
            D+ C+
Sbjct  172  DVPCT  176



>emb|CDP00505.1| unnamed protein product [Coffea canephora]
Length=196

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 130/183 (71%), Gaps = 11/183 (6%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHHQNALPI--ITPP  626
            MIPS E TGI+YF+ E      P     +SS PA   +R L  N  ++Q+  PI   TP 
Sbjct  1    MIPS-EATGIHYFTPEDPSPFTPNFSLMHSSFPAFQISRLL-TNLPNYQSPPPIHEFTP-  57

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
                S+ +SNNSTSDE+++QQ  +IDERKQRRM+SNRESARRSRMRK+RHLDELWSQVL 
Sbjct  58   ---QSSCLSNNSTSDEADDQQLNVIDERKQRRMISNRESARRSRMRKQRHLDELWSQVLR  114

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
             RTEN NL+D+LN +SE HD+V+ ENARLKEEAS LR+++ + + G    P++ L DLE+
Sbjct  115  LRTENHNLIDKLNHVSESHDRVVQENARLKEEASDLRQMLTDFQLGS---PYNTLSDLEE  171

Query  265  IKC  257
            + C
Sbjct  172  LPC  174



>ref|XP_011077776.1| PREDICTED: basic leucine zipper 43-like [Sesamum indicum]
Length=197

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHHQNALPIITPPDF  620
            MIPS E  G+N+F+ E+L   P       SS PA+ F+RF + N  ++Q +LP I   +F
Sbjct  1    MIPS-EIQGMNFFAPENLPAFPANFGLTESSFPALHFSRF-STNLPNYQTSLPGIH--EF  56

Query  619  s-lsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAF  443
            S +S  IS+NSTSDE+E+ Q  IIDERKQRRM+SNRESARRSRMRK+RHLDELWSQVL  
Sbjct  57   SPISMCISSNSTSDEAEDHQLSIIDERKQRRMISNRESARRSRMRKQRHLDELWSQVLRL  116

Query  442  RTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
            RTEN NL+D+LN +SE HD+V+ EN RLKEEAS LR+++ +L+   +   +  LRDLEDI
Sbjct  117  RTENHNLIDKLNHVSESHDRVVQENTRLKEEASDLRQMLTDLQISNS---YGFLRDLEDI  173

Query  262  KC  257
             C
Sbjct  174  PC  175



>ref|XP_009794536.1| PREDICTED: basic leucine zipper 43-like [Nicotiana sylvestris]
Length=192

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 133/192 (69%), Gaps = 13/192 (7%)
 Frame = -1

Query  790  SVENTGINYFSAESLFTLPPLDFTF-NSSSPAIDFTRFLNINN-NHHQNALPIITPPDFs  617
            S E   I+YF+ E+  +  P DF F + + PA  +  FL  NN  ++Q + P+    DFS
Sbjct  3    SSEAAAIHYFAPENNPSSFPTDFGFMHKNLPAFQYNTFLTNNNIQNYQASFPV---QDFS  59

Query  616  ls-asisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFR  440
               + IS+NSTSDESEEQQ R+IDERKQRRMVSNRESARRSRMRK+RHLDELWSQVL  R
Sbjct  60   QQPSCISSNSTSDESEEQQIRVIDERKQRRMVSNRESARRSRMRKQRHLDELWSQVLRLR  119

Query  439  TENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIK  260
            TEN NL+++LNQ++E HD+V+ EN +LKEEAS LRR++ +++    D PF    D +++ 
Sbjct  120  TENQNLMNKLNQVTESHDRVIQENMQLKEEASDLRRMITDIQ---IDSPFHAFSDFDEVT  176

Query  259  CSFQR*IIHLSA  224
            C+      HL A
Sbjct  177  CN----TAHLKA  184



>ref|XP_004239003.1| PREDICTED: basic leucine zipper 43 [Solanum lycopersicum]
Length=194

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 135/195 (69%), Gaps = 19/195 (10%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSS-PAIDFTRFLNINNNHHQNALPIITPPD  623
            MIPS E    +YF++++   LP LDF F  ++ P++ F+R+L        N LP     D
Sbjct  1    MIPS-EAAATHYFASQNPSPLP-LDFNFMQNNLPSLHFSRYLT-------NILPSYPVND  51

Query  622  Fsl--sasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVL  449
            F+    + IS NSTSDE++EQQ +IIDERK+RRM+SNRESARRSRMRK+R LDELWSQV+
Sbjct  52   FNNLIPSCISGNSTSDETDEQQLKIIDERKKRRMISNRESARRSRMRKQRQLDELWSQVV  111

Query  448  AFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLE  269
              RTEN NL+D+LN +SE HDKVL ENA+LKEE S LR+++ +L+    + PF DL +LE
Sbjct  112  RLRTENHNLIDKLNHVSECHDKVLQENAQLKEETSDLRQMITDLQ---FNSPFPDLCELE  168

Query  268  DIKCSFQR*IIHLSA  224
            D+ C+      HL A
Sbjct  169  DVPCT----TAHLKA  179



>gb|KDP31428.1| hypothetical protein JCGZ_11804 [Jatropha curcas]
Length=199

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 126/183 (69%), Gaps = 14/183 (8%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHHQNALPIITP-PD  623
            MIP  E TGI+YFS E+   +P   F   ++ P+  F   L    N HQN+ P   P  D
Sbjct  1    MIPG-EITGIHYFSPEN--PIPFSGFLHQNNIPSFHFNTLLT---NFHQNS-PFPQPVQD  53

Query  622  FslsasisnnstsdeseEQ-QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
            F+   S  +N+++ +  E+ Q  IIDERKQRRM+SNRESARRSRMRK++HLDELWSQV+ 
Sbjct  54   FTTQTSSLSNNSTSDEAEETQLSIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVVR  113

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPF--SDLRDL  272
             RTEN NL+D+LN +SE HD+VL ENARLKEEAS LR+++ E++ G    PF  + LRDL
Sbjct  114  LRTENHNLMDKLNHVSECHDRVLQENARLKEEASDLRQMLTEMQIGS---PFTATALRDL  170

Query  271  EDI  263
            E++
Sbjct  171  EEV  173



>ref|XP_002311422.1| bZIP family protein [Populus trichocarpa]
 gb|EEE88789.1| bZIP family protein [Populus trichocarpa]
Length=200

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 127/185 (69%), Gaps = 11/185 (6%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTF--NSSSPAIDFTRFLNINNNHHQNALPIITPP  626
            M+P  E TGI+Y + +      P +F     SS PA  F R LN   N   ++ P     
Sbjct  1    MLPG-ELTGIHYIAPDQSLIPFPANFGMMQQSSIPAFHFNRLLN---NLQSSSFPQPVRE  56

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
                S+S+SNNSTSDESEE Q  IIDERKQRRM+SNRESARRSRMRK++HLDELW+QV+ 
Sbjct  57   FTPQSSSLSNNSTSDESEEHQLSIIDERKQRRMISNRESARRSRMRKQKHLDELWTQVVR  116

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPF--SDLRDL  272
             RTEN NL+D+LN +SE HD+VL ENARLK+EAS LR+++ +L+ G    P+  + LRDL
Sbjct  117  LRTENHNLIDKLNHVSECHDRVLQENARLKKEASDLRQMITDLQIGS---PYTATALRDL  173

Query  271  EDIKC  257
            E++ C
Sbjct  174  EEVPC  178



>ref|XP_008446497.1| PREDICTED: basic leucine zipper 63 [Cucumis melo]
 ref|XP_008446498.1| PREDICTED: basic leucine zipper 63 [Cucumis melo]
Length=200

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 127/183 (69%), Gaps = 9/183 (5%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPP-LDFTFNSSSPAIDFTRFL-NINNNHHQNALPIITPP  626
            M+P  E +GI +F +E+ F +P  +D   NS      F  FL N+  +H    +P  +  
Sbjct  1    MLPG-EISGIQFFPSENSFQIPSNIDMMQNSFQTLHHFNGFLGNLPMSH----VPHPSHE  55

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
                S+S S NSTSD++EEQQ  IIDERKQRRM+SNRESARRSRMRK++HLDELWSQVL 
Sbjct  56   FLKQSSSFSYNSTSDDAEEQQKSIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVLR  115

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
             RTEN  L+D+LN +S++H+KVLLENARLKEEAS LR+++ +L+ G    P   L +LED
Sbjct  116  LRTENHKLIDKLNHVSDNHEKVLLENARLKEEASDLRQMLSDLQIGSPYTPC--LSNLED  173

Query  265  IKC  257
            I C
Sbjct  174  IPC  176



>ref|XP_002514552.1| Ocs element-binding factor, putative [Ricinus communis]
 gb|EEF47658.1| Ocs element-binding factor, putative [Ricinus communis]
Length=200

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 128/189 (68%), Gaps = 19/189 (10%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFN------SSSPAIDFTRFLNINNNHHQNALPI  638
            M+P  E TGI Y + E+     P+ F+ N      +S P   + R   I+N +   + P 
Sbjct  1    MLPG-ELTGIQYLAPEN-----PIPFSANLGLMQQTSMPTFHYNRL--ISNFYSNPSFPQ  52

Query  637  ITPPDFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWS  458
                    S+S+SNNSTSDE+EE Q  IIDERKQRRM+SNRESARRSRMRK++HLDELWS
Sbjct  53   PVQDFTQQSSSLSNNSTSDEAEENQLSIIDERKQRRMISNRESARRSRMRKQKHLDELWS  112

Query  457  QVLAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPF--SD  284
            QV+  RTEN NL+D+LN +SE HD+VL ENARLKEEAS LR+++ +L+ G    PF  S 
Sbjct  113  QVVRLRTENHNLIDKLNHVSECHDRVLQENARLKEEASDLRQMLTDLQIGS---PFTASA  169

Query  283  LRDLEDIKC  257
            LRDLED+ C
Sbjct  170  LRDLEDVPC  178



>ref|XP_004237067.1| PREDICTED: basic leucine zipper 43-like [Solanum lycopersicum]
Length=191

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 123/172 (72%), Gaps = 4/172 (2%)
 Frame = -1

Query  790  SVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHHQNALPIITPPDFsls  611
            S E   I+Y + E+  +LP +D+TF   +   + T FL   NN+     PI        +
Sbjct  3    SSEAATIHYLAQENPSSLP-IDYTFTHKNFQFNNT-FLT--NNYQSFTFPIQDLISTQPA  58

Query  610  asisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTEN  431
            + IS+NSTSDESEEQQHRIIDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  RTEN
Sbjct  59   SCISSNSTSDESEEQQHRIIDERKQRRMISNRESARRSRMRKQRHLDELWSQVVRLRTEN  118

Query  430  CNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             NL+++LNQ+SE H+KV+ EN +LK+EA  LRRL+V+++     + FS++ D
Sbjct  119  NNLINKLNQVSESHEKVVQENMQLKDEAYDLRRLLVDIQVATPFNGFSNIDD  170



>ref|XP_004135134.1| PREDICTED: ocs element-binding factor 1-like [Cucumis sativus]
Length=200

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 125/183 (68%), Gaps = 9/183 (5%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPP-LDFTFNSSSPAIDFTRFL-NINNNHHQNALPIITPP  626
            M+P  E +GI +F +E+ F  P  +D   NS      F  FL N+  +H    +P  +  
Sbjct  1    MLPG-EISGIQFFPSENSFQFPSNIDMMQNSFQTLHHFNGFLGNLPMSH----VPHPSHE  55

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
                S+S S NSTSD++EEQQ  IIDERKQRRM+SNRESARRSRMRK++HLDELWSQVL 
Sbjct  56   FLKQSSSFSYNSTSDDAEEQQKSIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVLR  115

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
             RTEN  L+D+LN +S++H+KVLLENARLKEEAS LR+++ +L+ G    P   L  LED
Sbjct  116  LRTENHKLIDKLNHVSDNHEKVLLENARLKEEASDLRQMLTDLQIGSPYTPC--LSILED  173

Query  265  IKC  257
            I C
Sbjct  174  IPC  176



>ref|XP_011021268.1| PREDICTED: basic leucine zipper 43-like [Populus euphratica]
Length=200

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 125/185 (68%), Gaps = 11/185 (6%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTF--NSSSPAIDFTRFLNINNNHHQNALPIITPP  626
            M+P  E TGI+Y + +      P +F     SS PA  F R LN   N   ++ P     
Sbjct  1    MLPG-ELTGIHYIAPDQSLIPFPANFGMMQQSSIPAFHFNRLLN---NLQSSSFPQPVRE  56

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
                S+S+SNNSTSDESEE Q  IIDERKQRRM+SNRESARRSRMRK++HLDELW+QV+ 
Sbjct  57   FTPQSSSLSNNSTSDESEEHQLSIIDERKQRRMISNRESARRSRMRKQKHLDELWTQVVR  116

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPF--SDLRDL  272
             RTEN NL+D+LN +SE HD+VL ENARLK EAS LR++V +L+ G    P+  + LRDL
Sbjct  117  LRTENHNLIDKLNHVSECHDRVLQENARLKNEASDLRQMVTDLQIGS---PYTATALRDL  173

Query  271  EDIKC  257
             ++ C
Sbjct  174  AEVPC  178



>gb|KGN52012.1| hypothetical protein Csa_5G608000 [Cucumis sativus]
Length=276

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 124/183 (68%), Gaps = 7/183 (4%)
 Frame = -1

Query  802  NMIPSVENTGINYFSAESLFTLPP-LDFTFNSSSPAIDFTRFLNINNNHHQNALPIITPP  626
            NM+P  E +GI +F +E+ F  P  +D   NS      F  FL    N   + +P  +  
Sbjct  76   NMLPG-EISGIQFFPSENSFQFPSNIDMMQNSFQTLHHFNGFLG---NLPMSHVPHPSHE  131

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
                S+S S NSTSD++EEQQ  IIDERKQRRM+SNRESARRSRMRK++HLDELWSQVL 
Sbjct  132  FLKQSSSFSYNSTSDDAEEQQKSIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVLR  191

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
             RTEN  L+D+LN +S++H+KVLLENARLKEEAS LR+++ +L+ G    P   L  LED
Sbjct  192  LRTENHKLIDKLNHVSDNHEKVLLENARLKEEASDLRQMLTDLQIGSPYTPC--LSILED  249

Query  265  IKC  257
            I C
Sbjct  250  IPC  252



>ref|XP_007045693.1| Basic leucine-zipper 42 [Theobroma cacao]
 gb|EOY01525.1| Basic leucine-zipper 42 [Theobroma cacao]
Length=197

 Score =   139 bits (349),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 128/183 (70%), Gaps = 10/183 (5%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFL-NINNNHHQNALPIITPPD  623
            MIP  E TG+ Y + E+   +P       ++ P  +F RFL N+  +H    +P+     
Sbjct  1    MIPG-ELTGLRYLAPENPILIPANLGMMQNTIPDFNFNRFLSNLPISH----IPLPAHEF  55

Query  622  FslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAF  443
             + S+SISN+STSDE+EE Q  IIDERKQRRM+SNRESARRSRMRK++HLDELWSQV+  
Sbjct  56   TAQSSSISNHSTSDEAEEHQLSIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVIRL  115

Query  442  RTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFS-DLRDLED  266
            R EN +L+D+LN +SE HD VL ENARLKEEAS LR+++ +L+ G    P+S  LR+LED
Sbjct  116  RNENHSLMDKLNHVSECHDLVLQENARLKEEASDLRQMLTDLKIGS---PYSLALRELED  172

Query  265  IKC  257
            I C
Sbjct  173  IPC  175



>ref|NP_001236950.1| bZIP transcription factor bZIP35 [Glycine max]
 gb|ABI34640.1| bZIP transcription factor bZIP35 [Glycine max]
 gb|KHN31086.1| Ocs element-binding factor 1 [Glycine soja]
Length=198

 Score =   138 bits (348),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 120/185 (65%), Gaps = 11/185 (6%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHH--QNALPIITPP  626
            M+PS E  G++Y + E+ F +PP      S  P +     L+   N H   +    + PP
Sbjct  1    MVPS-EIRGVHYLAPENPFLVPPNFSLLQSDIPNLHLNTLLSNFPNCHFPPSGHEFVVPP  59

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
               LS++ +++   +     Q  IIDERK RRM+SNRESARRSRMRK++HLDELWSQV+ 
Sbjct  60   SSCLSSNSTSDEADEI----QFNIIDERKHRRMISNRESARRSRMRKQKHLDELWSQVVR  115

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFS-DLRDLE  269
             RTEN NL+D+LN +SE HD+VL ENARLKEEAS LR+++ +++ G A   F+  + DLE
Sbjct  116  LRTENHNLIDKLNHVSESHDRVLQENARLKEEASALRQMLADMQIGTA---FACTMEDLE  172

Query  268  DIKCS  254
            D+ C+
Sbjct  173  DLPCN  177



>ref|XP_009612533.1| PREDICTED: basic leucine zipper 43-like [Nicotiana tomentosiformis]
Length=179

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 118/177 (67%), Gaps = 17/177 (10%)
 Frame = -1

Query  790  SVENTGINYFSAESLFTLPPLDFTF-NSSSPAIDFTRFLNINN--NHHQNALPIITPPDF  620
            S E   I+YF+ E+  +  P+DF+F + + PA  +  FL  NN  N++Q + P+    D 
Sbjct  3    SSEAAAIHYFAPENNPSSLPIDFSFMHKNLPAFQYNTFLTNNNIQNYNQASFPV---QDL  59

Query  619  slsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFR  440
            S   S  +++++ +  E+Q +    RKQRRMVSNRESARRSRMRK+RHLDELWSQVL  R
Sbjct  60   STQPSCISSNSTSDESEEQQK----RKQRRMVSNRESARRSRMRKQRHLDELWSQVLRLR  115

Query  439  TENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLE  269
            TEN NL+++LNQ++E HD+V+ EN +LKEEAS LRR+++       D PF    DL+
Sbjct  116  TENQNLMNKLNQVTESHDRVIQENMQLKEEASDLRRMII-------DSPFHAFSDLD  165



>ref|XP_004155288.1| PREDICTED: uncharacterized protein LOC101224302 [Cucumis sativus]
Length=200

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 125/183 (68%), Gaps = 9/183 (5%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPP-LDFTFNSSSPAIDFTRFL-NINNNHHQNALPIITPP  626
            M+P  E +GI +F +E+ F  P  +D   NS      F  FL N+  +H    +P  +  
Sbjct  1    MLPG-EISGIQFFPSENSFQFPSNIDMMQNSFQTLHHFNGFLGNLPMSH----VPHPSHE  55

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
                S+S S NSTSD++EEQQ  IIDERKQRRM+SNRESARRSRMRK++ LDELWSQVL 
Sbjct  56   FLKQSSSFSYNSTSDDAEEQQKSIIDERKQRRMISNRESARRSRMRKQKRLDELWSQVLR  115

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            FRTEN  L+D+LN +S++H+KVLLENARLKEEAS LR+++ +L+ G    P   L  LED
Sbjct  116  FRTENHKLIDKLNHVSDNHEKVLLENARLKEEASDLRQMLTDLQIGSPYTPC--LSILED  173

Query  265  IKC  257
            + C
Sbjct  174  VPC  176



>emb|CAN76820.1| hypothetical protein VITISV_032595 [Vitis vinifera]
Length=195

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 126/184 (68%), Gaps = 14/184 (8%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHHQNALPII---TP  629
            M+P  E TGI+Y + E+    P        ++P + F  +L+   N   + +P I   TP
Sbjct  1    MLPG-EFTGIHYMAPENPTPFPANFGMTYGNTPTLHFGGYLS---NLTXSQIPPIHEFTP  56

Query  628  PDFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVL  449
                 S+S+SNNSTSDE+EE Q  IIDERKQRRM+SNRESARRSRMRK++HLDELWSQV+
Sbjct  57   ----QSSSLSNNSTSDEAEEHQLSIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVV  112

Query  448  AFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLE  269
              R EN +L+D+LN +SE HD+VL EN RLKEEAS LR+++ +LR G    P++ LR+LE
Sbjct  113  RLRNENHSLIDKLNHVSECHDRVLQENVRLKEEASDLRQMLTDLRIGS---PYTTLRELE  169

Query  268  DIKC  257
             + C
Sbjct  170  GVSC  173



>ref|XP_002269495.1| PREDICTED: basic leucine zipper 43 [Vitis vinifera]
 emb|CBI27427.3| unnamed protein product [Vitis vinifera]
Length=195

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 129/185 (70%), Gaps = 16/185 (9%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPP-LDFTFNSSSPAIDFTRFLNINNNHHQNALPII---T  632
            M+P  E TGI+Y + E+    P     T++++ P + F  +L+   N   + +P I   T
Sbjct  1    MLPG-EFTGIHYMAPENPTPFPANFGMTYDNT-PTLHFGGYLS---NLTTSQIPPIHEFT  55

Query  631  PPDFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQV  452
            P     S+S+SNNSTSDE+EE Q  IIDERKQRRM+SNRESARRSRMRK++HLDELWSQV
Sbjct  56   P----QSSSLSNNSTSDEAEEHQLSIIDERKQRRMISNRESARRSRMRKQKHLDELWSQV  111

Query  451  LAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDL  272
            +  R EN +L+D+LN +SE HD+VL EN RLKEEAS LR+++ +LR G    P++ LR+L
Sbjct  112  VRLRNENHSLIDKLNHVSECHDRVLQENVRLKEEASDLRQMLTDLRIGS---PYTTLREL  168

Query  271  EDIKC  257
            E + C
Sbjct  169  EGVSC  173



>ref|XP_006437815.1| hypothetical protein CICLE_v10032777mg [Citrus clementina]
 ref|XP_006484292.1| PREDICTED: ocs element-binding factor 1-like [Citrus sinensis]
 gb|ESR51055.1| hypothetical protein CICLE_v10032777mg [Citrus clementina]
Length=201

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 88/107 (82%), Gaps = 5/107 (5%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ RIIDERKQRRM+SNRESARRSRMRK+RHLDELWS V+  RTEN NL+D+LN +SE H
Sbjct  77   QQLRIIDERKQRRMISNRESARRSRMRKQRHLDELWSHVVRLRTENHNLIDKLNHVSESH  136

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSD--LRDLEDIKCS  254
            D+VL ENARL+EEAS LR+++ EL+      P+++  LRDLE++ C+
Sbjct  137  DRVLQENARLREEASDLRQMLTELQ---LSSPYTNASLRDLEEVPCN  180



>ref|XP_011009140.1| PREDICTED: basic leucine zipper 43-like [Populus euphratica]
Length=200

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 127/185 (69%), Gaps = 11/185 (6%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTF--NSSSPAIDFTRFLNINNNHHQNALPIITPP  626
            M+P  E TGI+Y +A+      P +F     ++ P+  F R L+   N   ++LP     
Sbjct  1    MLPG-ELTGIHYLTADQNLVPFPANFGMMQQNNIPSFHFNRLLS---NLQNSSLPQPVYE  56

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
                S+S+SNNSTSDESEE Q  IIDERKQRRM+SNRESARRSRMRK++HLDELWSQV+ 
Sbjct  57   FAPQSSSLSNNSTSDESEEHQLSIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVVR  116

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSD--LRDL  272
             RTEN NL+D+L+ MSE HD+VL ENARLK+EAS  R+++ + + G    P++   LRDL
Sbjct  117  LRTENDNLIDKLSHMSECHDRVLQENARLKQEASDFRQMLTDFQIGS---PYTTTALRDL  173

Query  271  EDIKC  257
            E+I C
Sbjct  174  EEIPC  178



>ref|XP_002315989.1| bZIP family protein [Populus trichocarpa]
 gb|EEF02160.1| bZIP family protein [Populus trichocarpa]
Length=200

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 126/185 (68%), Gaps = 11/185 (6%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTF--NSSSPAIDFTRFLNINNNHHQNALPIITPP  626
            M+P  E TGI Y +A+      P +F     S+ P+  F R L+   N   ++LP     
Sbjct  1    MLPG-ELTGIRYLTADQNLVPFPANFGMMQQSNIPSFHFNRLLS---NLQNSSLPQPVYE  56

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
                S+S+SNNSTSDESEE Q  IIDERKQRRM+SNRESARRSRMRK++HLDELWSQV+ 
Sbjct  57   FAPQSSSLSNNSTSDESEEHQLSIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVVR  116

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSD--LRDL  272
             RTEN NL+D+L+ +SE HD+VL ENARLK+EAS  R+++ + + G    P++   LRDL
Sbjct  117  LRTENHNLIDKLSHVSECHDRVLQENARLKQEASDFRQMLTDFQIGS---PYTTTALRDL  173

Query  271  EDIKC  257
            E++ C
Sbjct  174  EEVPC  178



>ref|XP_003518809.1| PREDICTED: ocs element-binding factor 1-like [Glycine max]
 gb|KHN29912.1| Ocs element-binding factor 1 [Glycine soja]
Length=199

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 119/184 (65%), Gaps = 11/184 (6%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFL-NINNNHHQ-NALPIITPP  626
            M+PS E  G++Y + E+ F +PP      +  P +     L N  N H+  +    + PP
Sbjct  1    MVPS-EIRGVHYLAPENPFLVPPNFSLLQNDIPNLHLNTLLRNFPNCHYPPSGHEFVVPP  59

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
               LS + +++   +     Q  IIDERK RRM+SNRESARRSRMRK++HLDELWSQV+ 
Sbjct  60   SSCLSNNSTSDEADEI----QFNIIDERKHRRMISNRESARRSRMRKQKHLDELWSQVVR  115

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFS-DLRDLE  269
             RTEN +L+D+LN +SE HD+VL ENARLKEEAS LR+++ +++ G +   F+  + DLE
Sbjct  116  LRTENHSLIDKLNHVSESHDRVLQENARLKEEASDLRQMLADMQIGTS---FACTMEDLE  172

Query  268  DIKC  257
            D+ C
Sbjct  173  DLPC  176



>ref|XP_010681295.1| PREDICTED: basic leucine zipper 43-like [Beta vulgaris subsp. 
vulgaris]
Length=200

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 7/108 (6%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ +IIDER+QRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN +L+D+LN +SE H
Sbjct  75   QQIQIIDERRQRRMISNRESARRSRMRKQRHLDELWSQVIRLRNENNSLIDKLNHLSESH  134

Query  388  DKVLLENARLKEEASGLRRLV---VELRDGGADDPFSDLRDLEDIKCS  254
            DK+L EN RLKEEAS LR+++   V+L    A   ++  RDLEDI C+
Sbjct  135  DKILQENVRLKEEASDLRQMISNNVQL----ASTTYNAFRDLEDIPCT  178



>gb|KDO70208.1| hypothetical protein CISIN_1g043159mg [Citrus sinensis]
Length=201

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 87/107 (81%), Gaps = 5/107 (5%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ RIIDERKQRRM+SNRESARRSRMRK+RHLDELWS V+  RTEN NL+D+LN +SE H
Sbjct  77   QQLRIIDERKQRRMISNRESARRSRMRKQRHLDELWSHVVRLRTENHNLIDKLNHVSESH  136

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSD--LRDLEDIKCS  254
            D+VL ENARL+EEAS LR+++ EL+      P+++  LRDL ++ C+
Sbjct  137  DRVLQENARLREEASDLRQMLTELQ---LSSPYTNASLRDLGEVPCN  180



>ref|XP_007157937.1| hypothetical protein PHAVU_002G110600g [Phaseolus vulgaris]
 gb|AAK25822.1|AF350505_1 bZip transcription factor [Phaseolus vulgaris]
 gb|ESW29931.1| hypothetical protein PHAVU_002G110600g [Phaseolus vulgaris]
Length=193

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 124/185 (67%), Gaps = 12/185 (6%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHH--QNALPIITPP  626
            M+PS E  G+NY + E+ F +PP      +  P +     L+   N H   + L  + P 
Sbjct  1    MVPS-EIRGVNYLAPENPFLVPPNFGLLQNDIPNLHLNTLLSNFPNCHFPPSGLEFVAP-  58

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
                 + +S+NSTSDE++E Q  IIDERK RRM+SNRESARRSRMRK++HLDELWSQV+ 
Sbjct  59   ----HSCLSSNSTSDEADEIQFNIIDERKHRRMISNRESARRSRMRKQKHLDELWSQVVR  114

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFS-DLRDLE  269
             RTEN NL+D+LN MS+ HD+VL EN RLKEEAS LR+++ +++ G +   F+  + +LE
Sbjct  115  LRTENHNLIDKLNHMSDSHDRVLQENTRLKEEASDLRQMLADMQIGTS---FACTMEELE  171

Query  268  DIKCS  254
            D+ C+
Sbjct  172  DLPCN  176



>ref|XP_010257863.1| PREDICTED: basic leucine zipper 43-like [Nelumbo nucifera]
Length=198

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 87/104 (84%), Gaps = 3/104 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ RIIDERKQRRM+SNRESARRSRMRK++HLDELWSQV+  RTEN  L+D+LN +SE H
Sbjct  76   QQLRIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVIRLRTENRQLIDKLNHVSECH  135

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            D+VL ENA+L+EEAS LR+++ +L+    D+P++ LRD E+I C
Sbjct  136  DQVLQENAQLREEASELRQMLGDLQ---LDNPYTALRDPEEIPC  176



>ref|XP_006373522.1| hypothetical protein POPTR_0017s14490g [Populus trichocarpa]
 gb|ERP51319.1| hypothetical protein POPTR_0017s14490g [Populus trichocarpa]
Length=193

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (82%), Gaps = 3/104 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRMVSNRESARRSRMRK++HLDELWSQV+ FR EN  LLD+LN +SE H
Sbjct  71   QQLSLINERKQRRMVSNRESARRSRMRKQKHLDELWSQVVWFRNENHQLLDKLNHVSECH  130

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            D+V+ ENA+LKEE SGLR+++ +++    + P+  L+DLEDI C
Sbjct  131  DRVVHENAQLKEETSGLRQILTDMQ---LNSPYPLLKDLEDITC  171



>ref|XP_011070884.1| PREDICTED: basic leucine zipper 43-like [Sesamum indicum]
Length=195

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 125/186 (67%), Gaps = 16/186 (9%)
 Frame = -1

Query  799  MIPSVENTGIN---YFSAE--SLFTLPPLDFTF-NSSSPAIDFTRFLNINNNHHQNALPI  638
            MIPS E   +N   YFS +  S+F   P +F F +++ P   F+ F     N+ Q +L I
Sbjct  1    MIPS-ETQAMNMNNYFSQDNPSIF---PANFRFIHTNLPPFHFSTFFTNLPNNLQTSLSI  56

Query  637  ITPPDFslsasisnnstsdeseEQ-QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELW  461
               PD + ++S  +N+++ +  E+ Q  IIDERKQRRM+SNRESARRSRMRK+RHLDELW
Sbjct  57   ---PDLAPNSSCISNNSTSDEAEEHQVSIIDERKQRRMISNRESARRSRMRKQRHLDELW  113

Query  460  SQVLAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDL  281
            SQ+L  RTEN NL+DRLN + E HDKV+ EN RLKEEAS LRR++ +L+   +    S L
Sbjct  114  SQLLRLRTENHNLIDRLNHVLESHDKVVQENVRLKEEASDLRRMLTDLQVNSSYT--SIL  171

Query  280  RDLEDI  263
            RDLE +
Sbjct  172  RDLEQL  177



>ref|XP_008379475.1| PREDICTED: basic leucine zipper 63-like [Malus domestica]
Length=202

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 84/104 (81%), Gaps = 2/104 (2%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE H
Sbjct  79   QQLSLINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSESH  138

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            DKVL ENA+LKEEAS LR++V +L+     +PF  LRDLED+ C
Sbjct  139  DKVLEENAQLKEEASELRQMVNDLQLHSPYNPF--LRDLEDVPC  180



>ref|XP_011021132.1| PREDICTED: basic leucine zipper 43-like [Populus euphratica]
Length=193

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRMVSNRESARRSRMRK++HLDELWSQV+ FR EN  LLD+LN +SE H
Sbjct  71   QQLSLINERKQRRMVSNRESARRSRMRKQKHLDELWSQVVWFRNENHQLLDKLNHVSECH  130

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            D+V+ ENA+LKEE S LR+++ +++    + P+  L+DLEDI C
Sbjct  131  DRVVHENAQLKEETSDLRQMLTDMK---LNSPYPSLKDLEDITC  171



>ref|XP_007032940.1| Basic leucine-zipper 42 [Theobroma cacao]
 gb|EOY03866.1| Basic leucine-zipper 42 [Theobroma cacao]
Length=181

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 81/102 (79%), Gaps = 3/102 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN +SE H
Sbjct  74   QQLSLINERKQRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLIDKLNHVSESH  133

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
            DKVL ENA+LKEEAS LR++   L D     P+S LRDLEDI
Sbjct  134  DKVLQENAQLKEEASELRQM---LSDMQLSSPYSTLRDLEDI  172



>ref|XP_009356481.1| PREDICTED: basic leucine zipper 10-like [Pyrus x bretschneideri]
Length=204

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 123/195 (63%), Gaps = 25/195 (13%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLP-PLDFTFNSSS-PAIDFTRFLNINNNHHQNALPIITPP  626
            M+P    +G+NYF  E    LP P DF F  +  P++ F    N  N  HQ     I PP
Sbjct  1    MLPVEIISGLNYFEPE--IPLPNPSDFAFTQNQIPSLHFNTLFN--NLSHQ-----IPPP  51

Query  625  ---DFslsasisnnstsdeseEQQH---RIIDERKQRRMVSNRESARRSRMRKKRHLDEL  464
               DF+  +S  +N++S   + ++H   R+IDERK RRM+SNRESARRSRMRK++HLDEL
Sbjct  52   IGHDFTQQSSSLSNNSSTSDDAEEHHHLRVIDERKHRRMISNRESARRSRMRKQKHLDEL  111

Query  463  WSQVLAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPF--  290
            W QV+  R EN +L+DRLN +SE HD+V+ ENARLKEEA  LR+++  L+ G    P+  
Sbjct  112  WLQVVRLRNENHSLIDRLNNLSESHDRVVEENARLKEEACDLRQMLTNLQIGS---PYNI  168

Query  289  --SDLRDLE-DIKCS  254
              S  R+LE ++ C+
Sbjct  169  NASTFRELEGEVPCN  183



>ref|XP_010029442.1| PREDICTED: basic leucine zipper 43 [Eucalyptus grandis]
Length=184

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 3/106 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN  SE  
Sbjct  76   QQLMLINERKQRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLMDKLNHASEIK  135

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCSF  251
            DKVL ENA+LKEE  GLR+ + E++    ++ +S LRDLED+ C+ 
Sbjct  136  DKVLQENAQLKEETCGLRQTITEMQ---LNNTYSTLRDLEDVPCNL  178



>gb|KCW56356.1| hypothetical protein EUGRSUZ_I02090 [Eucalyptus grandis]
Length=166

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 3/106 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN  SE  
Sbjct  58   QQLMLINERKQRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLMDKLNHASEIK  117

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCSF  251
            DKVL ENA+LKEE  GLR+ + E++    ++ +S LRDLED+ C+ 
Sbjct  118  DKVLQENAQLKEETCGLRQTITEMQ---LNNTYSTLRDLEDVPCNL  160



>gb|AAK01953.1| bZIP [Phaseolus acutifolius]
Length=193

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 124/185 (67%), Gaps = 12/185 (6%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHH--QNALPIITPP  626
            M+PS E  G++Y + E+ F +PP      +  P +     L+   N H   + L  + P 
Sbjct  1    MVPS-EIRGVHYLAPENPFLVPPNFGLLQNDIPNLHLNTLLSNFPNCHFPPSGLEFVAP-  58

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
                 + +S+NSTSDE++E Q  IIDERK RRM+SNRESARRSRMRK++HLDELWSQV+ 
Sbjct  59   ----HSCLSSNSTSDEADEIQFNIIDERKHRRMISNRESARRSRMRKQKHLDELWSQVVR  114

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFS-DLRDLE  269
             RTEN NL+D+LN MS+ HD+VL +N RLKEEAS LR+++ +++ G +   F+  + +LE
Sbjct  115  LRTENHNLIDKLNHMSDSHDRVLQKNTRLKEEASDLRQMLADMQIGIS---FACTMEELE  171

Query  268  DIKCS  254
            D+ C+
Sbjct  172  DLPCN  176



>ref|XP_002278738.1| PREDICTED: basic leucine zipper 43 [Vitis vinifera]
 emb|CAN66938.1| hypothetical protein VITISV_030756 [Vitis vinifera]
Length=198

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 125/180 (69%), Gaps = 14/180 (8%)
 Frame = -1

Query  790  SVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLN--INNNHHQNALPIITPP--D  623
            S E TG++YF   +    P       +++P+I F+ F +  ++N H      +++P   +
Sbjct  3    SSEVTGLHYFVPSNPTPYPAHFSMAGNNAPSIHFSGFSSSPLSNFH------VVSPQVHE  56

Query  622  Fslsasi-snnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
            F+   S  S+NSTSDE++EQQ  +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+ 
Sbjct  57   FNPQISCFSSNSTSDEADEQQLSLINERKQRRMISNRESARRSRMRKQKHLDELWSQVVW  116

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
             R EN  L+D+LN +SE HD+VL EN +LKEEAS LR++V +L+    + P+ +LRDLED
Sbjct  117  LRNENHQLIDKLNHVSECHDRVLQENVQLKEEASELRQMVTDLQ---LNSPYPNLRDLED  173



>emb|CDP02366.1| unnamed protein product [Coffea canephora]
Length=180

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 82/104 (79%), Gaps = 3/104 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  II+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN  SE H
Sbjct  74   QQLSIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLIDKLNHASECH  133

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            D+VL EN +LKEEAS LR+++ E++    + P+ +LRDLED  C
Sbjct  134  DRVLQENTQLKEEASELRQMLTEMQ---LNSPYYNLRDLEDDPC  174



>ref|XP_009378305.1| PREDICTED: basic leucine zipper 63-like [Pyrus x bretschneideri]
Length=202

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 105/161 (65%), Gaps = 21/161 (13%)
 Frame = -1

Query  724  FTFNS-SSPAIDF----TRFLNINNNHHQNALPIITPPDFslsasisnnstsdeseEQQH  560
            F FN  SSP  +F    ++ L INNN  Q +    +  D              E++EQQ 
Sbjct  36   FQFNRFSSPLYNFQFPNSQLLEINNNPQQPSSFSSSTSD--------------EADEQQL  81

Query  559  RIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKV  380
             +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE HDKV
Sbjct  82   SLINERKQRRMLSNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSESHDKV  141

Query  379  LLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            L ENA+LKEEAS LR++V +L+       F  LRDLED+ C
Sbjct  142  LEENAQLKEEASELRQMVNDLQLHSPYHSF--LRDLEDVPC  180



>gb|EYU28915.1| hypothetical protein MIMGU_mgv1a014639mg [Erythranthe guttata]
Length=183

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 114/175 (65%), Gaps = 10/175 (6%)
 Frame = -1

Query  772  INYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHHQNALPIITPPDFslsasisnn  593
            ++YF+ ++     P      ++SP++ + RF+  N       LP   P         ++N
Sbjct  9    MHYFAPQNPSPYQPNFNLIQNTSPSMQYNRFVPAN-------LPNYPPISLLNELCPNSN  61

Query  592  stsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDR  413
            STSDE+E+ Q  ++DERKQRRM+SNRESARRSRMRK+RHLDELW QVL  R EN NL+++
Sbjct  62   STSDEAEDNQVGLVDERKQRRMISNRESARRSRMRKQRHLDELWGQVLRLRNENQNLVEK  121

Query  412  LNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCSFQ  248
            L+ +SE H +V+ ENARLKEEAS LR++   L D    + ++ LRD ED++ S Q
Sbjct  122  LSHVSESHGRVVEENARLKEEASDLRQM---LMDAQISNSYAVLRDFEDLESSEQ  173



>ref|XP_011099071.1| PREDICTED: basic leucine zipper 43 [Sesamum indicum]
Length=178

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 82/104 (79%), Gaps = 3/104 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  II+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE H
Sbjct  74   QQLSIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLIDKLNHVSERH  133

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            D+VL ENA+LKEEAS LR+++ E++    + P+  LR L+D  C
Sbjct  134  DQVLQENAQLKEEASELRQMLTEMQ---LNSPYPSLRGLDDDPC  174



>ref|XP_010694542.1| PREDICTED: basic leucine zipper 43 [Beta vulgaris subsp. vulgaris]
Length=184

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 81/102 (79%), Gaps = 3/102 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN ++E H
Sbjct  74   QQLTIINERKQRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLIDKLNHVTESH  133

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
            D+VL EN +LKEE S LR++V +++      P+S LRDLE++
Sbjct  134  DRVLQENVQLKEETSELRQMVTDMQ---LSSPYSTLRDLEEV  172



>gb|KDP24311.1| hypothetical protein JCGZ_25607 [Jatropha curcas]
Length=195

 Score =   127 bits (320),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 119/177 (67%), Gaps = 13/177 (7%)
 Frame = -1

Query  778  TGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHHQNALPIITPP--DFslsas  605
            TG++Y  + +            S++    F RF N++N         I+PP  +FSL +S
Sbjct  7    TGLHYLVSSNPSPYSAYFSMTQSNTSTFPFNRFNNLHNIQ-------ISPPVQEFSLQSS  59

Query  604  i-snnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENC  428
              SNNSTSDE++EQQ  +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN 
Sbjct  60   CPSNNSTSDEADEQQLSLINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENH  119

Query  427  NLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
             L+D+LN +SE HD+V+ EN +LKEEAS LR++   L D   + P+  LR+LEDI C
Sbjct  120  QLIDKLNHVSECHDRVVQENTQLKEEASELRQM---LSDMQLNSPYDTLRELEDIPC  173



>gb|ADL36621.1| BZIP domain class transcription factor [Malus domestica]
Length=204

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 123/195 (63%), Gaps = 27/195 (14%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLP-PLDFTF-NSSSPAIDF-TRFLNINNNHHQNALPIITP  629
            M+P    +G++YF  E    LP P DF F  +  P++ F T F N++          I P
Sbjct  1    MLPGEIISGLHYFEPE--IPLPNPSDFAFMQNQIPSLHFNTSFNNLSRQ--------IAP  50

Query  628  P---DFslsasisnnstsdeseEQQH---RIIDERKQRRMVSNRESARRSRMRKKRHLDE  467
            P   DF+  +S  +N++S   + ++H   R+IDERK RRM+SNRESARRSRMRK++HLDE
Sbjct  51   PIGHDFTQQSSSLSNNSSTSDDAEEHHHLRVIDERKHRRMISNRESARRSRMRKQKHLDE  110

Query  466  LWSQVLAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPF-  290
            LWSQV+  R EN +L+DRLN +SE HD V+ ENARLKEEA  LR+++  L+ G    P+ 
Sbjct  111  LWSQVVRLRNENHSLIDRLNNLSESHDMVVEENARLKEEACDLRQMLTNLQIGS---PYN  167

Query  289  ---SDLRDLE-DIKC  257
               S  R+LE ++ C
Sbjct  168  INASTFRELEGEVPC  182



>ref|XP_006482346.1| PREDICTED: ocs element-binding factor 1-like [Citrus sinensis]
Length=189

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 116/184 (63%), Gaps = 6/184 (3%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNS-SSPAIDFTRFLNINNNHHQ--NALPIITP  629
            M P  E +G++Y  A SL        + +  ++    F RFLN   N HQ    +P I  
Sbjct  1    MQPFSEVSGLHYLLAPSLSQYSSHYISSSDHNTSTCQFDRFLNPILNFHQIPPQVPEIIN  60

Query  628  PDFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVL  449
               S  +S ++ S   E ++QQ  II+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+
Sbjct  61   SQTSSFSSNNSTSDEAEEQQQQSMIINERKQRRMISNRESARRSRMRKQKHLDELWSQVV  120

Query  448  AFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLE  269
              R EN  L+D+LN +S  HDKV+ ENA LK EA+ LR+++ +L+    +  +S L+DL+
Sbjct  121  WLRNENHQLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQ---LNSHYSSLKDLD  177

Query  268  DIKC  257
            D+ C
Sbjct  178  DVPC  181



>ref|XP_004297182.1| PREDICTED: G-box-binding factor 3-like [Fragaria vesca subsp. 
vesca]
Length=197

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (78%), Gaps = 9/104 (9%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            IID+RKQRRM+SNRESARRSRMRK++HLDELWSQVL  RTEN +L+DRLN +SE HDKVL
Sbjct  91   IIDQRKQRRMISNRESARRSRMRKQKHLDELWSQVLRLRTENHSLIDRLNHVSESHDKVL  150

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRDLE---DIKCS  254
             ENA+LKEEAS LR+++ E++   A      LR  E   D+ CS
Sbjct  151  EENAKLKEEASDLRQMLTEIQISTA------LRSTELEVDVPCS  188



>ref|XP_006363571.1| PREDICTED: light-inducible protein CPRF2-like [Solanum tuberosum]
Length=194

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQHR+IDERKQRRM+SNRESARRSRMRK+RHLDEL SQV+  RTEN NL+++LNQ+SE H
Sbjct  78   QQHRMIDERKQRRMISNRESARRSRMRKQRHLDELGSQVVRLRTENHNLINKLNQVSESH  137

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCSFQR*IIHLSAVEDQL  209
            +KV+ EN +LK+EA  LRRL+  ++      PFS++ D + + CS +    + S  E +L
Sbjct  138  EKVVQENMQLKDEAYDLRRLLTNIQVAS---PFSNMDD-DHLPCSLKTESSNQSTTERKL  193



>ref|XP_010032584.1| PREDICTED: basic leucine zipper 43-like [Eucalyptus grandis]
 gb|KCW51992.1| hypothetical protein EUGRSUZ_J01431 [Eucalyptus grandis]
Length=202

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 82/104 (79%), Gaps = 3/104 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  II+ER+QRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LNQ+SE H
Sbjct  80   QQMSIINERRQRRMISNRESARRSRMRKQKHLDELWSQVVWLRHENHQLVDKLNQVSEDH  139

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            D+ + EN +LKEEAS LR+++ ++R      P S L DL+D++C
Sbjct  140  DRAVQENVQLKEEASELRQMLTDMR---LSSPISVLGDLDDVQC  180



>ref|XP_002530800.1| Ocs element-binding factor, putative [Ricinus communis]
 gb|EEF31568.1| Ocs element-binding factor, putative [Ricinus communis]
Length=195

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE H
Sbjct  73   QQLSLINERKQRRMISNRESARRSRMRKQKHLDELWSQVIWLRNENHQLIDKLNHVSECH  132

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            D+V+ ENA+LKEE S LR+++ +L+    + P++ LRDL++I C
Sbjct  133  DQVVQENAQLKEETSELRQMLSDLQ---LNSPYATLRDLQEIPC  173



>ref|XP_008230330.1| PREDICTED: ocs element-binding factor 1-like [Prunus mume]
Length=202

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 2/100 (2%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE HDKVL
Sbjct  83   LINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSESHDKVL  142

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
             ENA+LKE+AS LR+++ +L+      P   LRDLED+ C
Sbjct  143  QENAQLKEQASELRQMLTDLQLHSPYHP--SLRDLEDVPC  180



>ref|XP_007215978.1| hypothetical protein PRUPE_ppa011644mg [Prunus persica]
 gb|EMJ17177.1| hypothetical protein PRUPE_ppa011644mg [Prunus persica]
Length=202

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 2/100 (2%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE HDKVL
Sbjct  83   LINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSESHDKVL  142

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
             ENA+LKE+AS LR+++ +L+      P   LRDLED+ C
Sbjct  143  QENAQLKEQASELRQMLTDLQLHSPYHP--SLRDLEDVPC  180



>ref|XP_006417112.1| hypothetical protein EUTSA_v10008825mg [Eutrema salsugineum]
 gb|ESQ35465.1| hypothetical protein EUTSA_v10008825mg [Eutrema salsugineum]
Length=197

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +IDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  RT+N  L+D+LN++SE H
Sbjct  79   QQSMVIDERKQRRMISNRESARRSRMRKQRHLDELWSQVMRLRTDNHCLIDKLNRVSESH  138

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            +  L ENA+LKEE S LR+L+ E++    DD  S LR+LED
Sbjct  139  ELALKENAKLKEETSDLRQLISEIKSNNEDDG-SFLRELED  178



>ref|XP_006430890.1| hypothetical protein CICLE_v10013334mg, partial [Citrus clementina]
 gb|ESR44130.1| hypothetical protein CICLE_v10013334mg, partial [Citrus clementina]
Length=184

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 115/179 (64%), Gaps = 6/179 (3%)
 Frame = -1

Query  784  ENTGINYFSAESLFTLPPLDFTFNS-SSPAIDFTRFLNINNNHHQ--NALPIITPPDFsl  614
            E +G++Y  A SL        + +  ++    F RFLN   N HQ    +P I     S 
Sbjct  1    EVSGLHYLLAPSLSQYSSHYISSSDHNTSTCQFDRFLNPILNFHQIPPQVPEIINSQTSS  60

Query  613  sasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTE  434
             +S ++ S   E ++QQ  II+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R E
Sbjct  61   FSSNNSTSDEAEEQQQQSMIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNE  120

Query  433  NCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            N  L+D+LN +S  HDKV+ ENA+LK EA+ LR+++ +L+    +  +S L+DL+D+ C
Sbjct  121  NHQLVDKLNHVSGCHDKVMQENAQLKVEATELRQMLTDLQ---LNSHYSSLKDLDDVPC  176



>ref|XP_008389357.1| PREDICTED: basic leucine zipper 63-like [Malus domestica]
Length=204

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 122/194 (63%), Gaps = 25/194 (13%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTF-NSSSPAIDF-TRFLNINNNHHQNALPIITPP  626
            M+P    +G++YF  E +    P DF F  +  P++ F T F N++          I PP
Sbjct  1    MLPGEIISGLHYFEPE-IPLXNPSDFAFMQNQIPSLHFNTSFNNLSRQ--------IAPP  51

Query  625  ---DFslsasisnnstsdeseEQQH---RIIDERKQRRMVSNRESARRSRMRKKRHLDEL  464
               DF+  +S  +N++S   + ++H   R+IDERK RRM+SNRESARRSRMRK++HLDEL
Sbjct  52   IGHDFTQQSSSLSNNSSTSDDAEEHHHLRVIDERKHRRMISNRESARRSRMRKQKHLDEL  111

Query  463  WSQVLAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPF--  290
            WSQV+  R EN +L+DRLN +SE HD V+ ENARLKEEA  LR+++  L+ G    P+  
Sbjct  112  WSQVVRLRNENHSLIDRLNNLSESHDMVVEENARLKEEACDLRQMLTNLQIGS---PYNI  168

Query  289  --SDLRDLE-DIKC  257
              S  R+LE ++ C
Sbjct  169  NASTFRELEGEVPC  182



>ref|XP_002892761.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69020.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=196

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +IDERKQRRM+SNRESARRSRMRK+RHLDELWSQV   RT+N  L+D+LN++SE H
Sbjct  78   QQSMVIDERKQRRMISNRESARRSRMRKQRHLDELWSQVKRLRTDNYCLIDKLNRVSESH  137

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            +  L ENA+LKEE S LR+L+ E++    DD  S LR+LED
Sbjct  138  ELALKENAKLKEETSDLRQLISEIKSNNEDDN-SFLRELED  177



>ref|NP_172817.2| basic leucine-zipper 58 [Arabidopsis thaliana]
 gb|AAF81286.1|AC027656_3 Contains similarity to bZIP DNA-binding protein HBF-1 - soybean 
from Glycine max gb|Y10685. It contains a bZIP transcription 
factor PF|00170. EST gb|N37717 comes from this gene [Arabidopsis 
thaliana]
 gb|AAF99826.1|AC027134_8 Hypothetical protein [Arabidopsis thaliana]
 gb|AAG48793.1|AF332430_1 putative bZIP transcription factor [Arabidopsis thaliana]
 dbj|BAH30293.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29040.1| basic leucine-zipper 58 [Arabidopsis thaliana]
Length=196

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +IDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  RT+N  L+D+LN++SE H
Sbjct  78   QQSMVIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLMDKLNRVSESH  137

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            +  L ENA+LKEE S LR+L+ E++    DD  S LR+LED
Sbjct  138  ELALKENAKLKEETSDLRQLISEIKSHNEDDN-SFLRELED  177



>ref|XP_010100890.1| Ocs element-binding factor 1 [Morus notabilis]
 gb|EXB85814.1| Ocs element-binding factor 1 [Morus notabilis]
Length=219

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 80/101 (79%), Gaps = 4/101 (4%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE H+KV+
Sbjct  100  LINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLIDKLNHVSESHEKVV  159

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED-IKC  257
             ENA+LKEEAS LR++   L D   + PF  LRDLED + C
Sbjct  160  QENAQLKEEASELRQM---LSDIQLNSPFPSLRDLEDHVPC  197



>ref|XP_004141481.1| PREDICTED: transcription factor HBP-1a-like [Cucumis sativus]
 ref|XP_004156175.1| PREDICTED: transcription factor HBP-1a-like [Cucumis sativus]
 gb|KGN52540.1| hypothetical protein Csa_5G642710 [Cucumis sativus]
Length=178

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQVL  R EN  L+D+LNQ+S+ H
Sbjct  72   QQQSLINERKQRRMISNRESARRSRMRKQKHLDELWSQVLWLRNENHQLIDKLNQVSDCH  131

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
            DKV+ EN +LKE+ S LRR++ EL+    +D +   R+LE I
Sbjct  132  DKVVQENVQLKEQTSELRRMLTELQ---VNDHYPSFRELEKI  170



>ref|XP_009117984.1| PREDICTED: ocs element-binding factor 1-like [Brassica rapa]
 ref|XP_009117985.1| PREDICTED: ocs element-binding factor 1-like [Brassica rapa]
Length=195

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ   IDERKQRRMVSNRESARRSRMRK+RHLDELWSQV+  RT+N  L+D+LN +SE H
Sbjct  77   QQSMAIDERKQRRMVSNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLIDKLNNVSESH  136

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            +  L ENA+LKEE S LR+L+ E++    DD  + LRDLED
Sbjct  137  ELALKENAKLKEETSDLRQLLSEIKSNNEDDN-NFLRDLED  176



>emb|CDY45336.1| BnaC01g30400D [Brassica napus]
Length=198

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +IDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  RT+N  L+D+LN++SE H
Sbjct  80   QQSMVIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLIDKLNRVSESH  139

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
               L ENA+LKEE S L++L+ E++    DD  + LR+LED
Sbjct  140  QLALKENAKLKEETSNLKQLISEIKSNNEDDN-NFLRELED  179



>gb|KEH22053.1| BZIP transcription factor [Medicago truncatula]
Length=192

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 82/105 (78%), Gaps = 4/105 (4%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  IIDERK RRM+SNRESARRSRMRK++HLDELWSQV+  RTEN NL+D+LN +SE HD
Sbjct  77   QFNIIDERKHRRMISNRESARRSRMRKQKHLDELWSQVVRLRTENHNLVDKLNHVSESHD  136

Query  385  KVLLENARLKEEASGLRRLVVELRDGGADDPF-SDLRDLEDIKCS  254
            KV+ ENARLKEE   LR++V +++ G +   F  ++ DL +I C+
Sbjct  137  KVVQENARLKEETFDLRQMVADMQIGNS---FPCNMEDLCEIPCN  178



>emb|CDY16099.1| BnaC08g40240D [Brassica napus]
Length=163

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ   IDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  RT+N  L+D+LN +SE H
Sbjct  45   QQSMAIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLIDKLNNVSESH  104

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            +  L ENA+LKEE S LR+L+ E++    DD  + LRDLED
Sbjct  105  ELALKENAKLKEETSDLRQLLSEIKSNNEDDN-NFLRDLED  144



>gb|AFO63290.1| bZIP11 [Tamarix hispida]
Length=224

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN +L+D+LN ++E  
Sbjct  74   QQLSVINERKQRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHHLIDKLNHVTESR  133

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
            D+ L EN +LKEEAS LR+++  L+  G   P S LRDLED+
Sbjct  134  DRALQENVQLKEEASELRQMLTGLQLTG---PLSPLRDLEDV  172



>ref|XP_008377571.1| PREDICTED: light-inducible protein CPRF2-like [Malus domestica]
Length=192

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 124/196 (63%), Gaps = 29/196 (15%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLP---PLDFTF-NSSSPAIDFTRFLNINNNHHQNALPIIT  632
            M+P    +G++YF +E    +P   P D+ F ++  P+  F    N  N  HQ     I 
Sbjct  1    MLPGEIISGLHYFESE----IPLRNPSDYAFMHNQIPSHHFNTLFN--NLSHQ-----IP  49

Query  631  PP---DFslsasisnnstsdeseEQQH---RIIDERKQRRMVSNRESARRSRMRKKRHLD  470
            PP   DF+  +S  + ++S   + ++H   R+I+ERKQRRM+SNRESARRSRMRK++HLD
Sbjct  50   PPPGHDFTQQSSSLSYNSSTSDDAEEHHHLRVIEERKQRRMISNRESARRSRMRKQKHLD  109

Query  469  ELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPF  290
            ELWSQV+  R EN +L+DRLN +SE  D+V+ ENARLKEE+S LR+++  L+ G    P+
Sbjct  110  ELWSQVVRLRNENHSLIDRLNNVSESRDRVVEENARLKEESSDLRQMLTNLQIGS---PY  166

Query  289  ----SDLRDLE-DIKC  257
                S  R+L+ D+ C
Sbjct  167  NINASTFRELDSDVPC  182



>ref|XP_010554251.1| PREDICTED: basic leucine zipper 43-like [Tarenaya hassleriana]
Length=181

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  IIDERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R +N  L+D+L ++S+ H
Sbjct  71   QQSIIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVIGLRDQNRCLIDKLIRVSDSH  130

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDP-FSDLRDLEDIKCSFQ  248
            D+VL EN+RLKEEAS LR+L+ E+R    D    S  R+LED   S +
Sbjct  131  DRVLKENSRLKEEASDLRQLITEMRTDNNDSTCLSFFRELEDFDPSIK  178



>ref|XP_006303717.1| hypothetical protein CARUB_v10011839mg [Capsella rubella]
 gb|EOA36615.1| hypothetical protein CARUB_v10011839mg [Capsella rubella]
Length=197

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  IIDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  RT+N  L+D+LN++SE H
Sbjct  79   QQSMIIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLIDKLNRVSESH  138

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            +  L ENA+LKEE S LR+L+ E++    +D  S LR+LED
Sbjct  139  ELALKENAKLKEETSDLRQLISEIKSNNEEDN-SFLRELED  178



>gb|KEH18256.1| BZIP transcription factor [Medicago truncatula]
Length=181

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 81/105 (77%), Gaps = 4/105 (4%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  IIDERK RRM+SNRESARRSRMRK++HLDELWSQV+  RTEN NL+D+LN +SE HD
Sbjct  67   QFNIIDERKHRRMISNRESARRSRMRKQKHLDELWSQVMKLRTENHNLVDKLNHVSESHD  126

Query  385  KVLLENARLKEEASGLRRLVVELRDGGADDPF-SDLRDLEDIKCS  254
             V+ ENARLKEE   LR++V +++ G +   F  ++ DL +I C+
Sbjct  127  TVVQENARLKEETFDLRQMVADMQIGNS---FPCNMEDLCEIPCN  168



>ref|XP_010495411.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=196

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  IIDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R++N  L+D+LN++SE H
Sbjct  78   QQSMIIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRSDNHCLIDKLNRVSESH  137

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            +  L ENA+LKEE S LR+L+ +++    DD  S LR+LED
Sbjct  138  ELALKENAKLKEETSDLRQLISDIKSNNEDDN-SFLRELED  177



>ref|XP_010458808.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=196

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  IIDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R++N  L+D+LN++SE H
Sbjct  78   QQSMIIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRSDNHCLIDKLNRVSESH  137

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            +  L ENA+LKEE S LR+L+ +++    DD  S LR+LED
Sbjct  138  ELALKENAKLKEETSDLRQLISDIKSNNEDDN-SFLRELED  177



>ref|XP_010476364.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=198

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  IIDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R++N  L+D+LN++SE H
Sbjct  80   QQSMIIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRSDNHCLIDKLNRVSESH  139

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            +  L ENA+LKEE S LR+L+ +++    DD  S LR+LED
Sbjct  140  ELALKENAKLKEETSDLRQLISDIKSNNEDDN-SFLRELED  179



>ref|XP_009373742.1| PREDICTED: ocs element-binding factor 1-like [Pyrus x bretschneideri]
Length=202

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 80/105 (76%), Gaps = 4/105 (4%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERK RRM+SNRESARRSRMRK++HLDELWSQV+  R EN  +LD+LN +SE H
Sbjct  79   QQLSLINERKHRRMISNRESARRSRMRKQKHLDELWSQVVWLRKENHQILDKLNHVSESH  138

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFS-DLRDLEDIKC  257
            +KVL ENA+LKEEAS LR+   +L D     P+   LRDLED+ C
Sbjct  139  EKVLQENAQLKEEASELRQ---QLNDLQLHSPYHPSLRDLEDVPC  180



>ref|XP_010528016.1| PREDICTED: basic leucine zipper 43 [Tarenaya hassleriana]
Length=185

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 82/109 (75%), Gaps = 3/109 (3%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  IIDERKQRRM+SNRESARRSRMRK++HLDELWSQVL  R EN  L+D+LN+ SE HD
Sbjct  76   QQNIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVLRLRNENHCLIDKLNRASESHD  135

Query  385  KVLLENARLKEEASGLRRLVVELRDGGADDP---FSDLRDLEDIKCSFQ  248
             +L ENA+LKEEAS LR+L+ E+R    ++     S LR+L+D   S +
Sbjct  136  LILKENAKLKEEASDLRQLITEMRADNNNNDNICISFLRELQDFDPSIK  184



>ref|XP_008459417.1| PREDICTED: basic leucine zipper 63-like [Cucumis melo]
 gb|ADN34279.1| bZIP transcription factor [Cucumis melo subsp. melo]
Length=179

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQVL  R EN  L+D+LNQ+S+ H
Sbjct  73   QQQSLINERKQRRMISNRESARRSRMRKQKHLDELWSQVLWLRNENHQLIDKLNQVSDCH  132

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
            DKV+ EN +LKE+ S LRR++ EL+    ++ +   R+LE I
Sbjct  133  DKVVQENVQLKEQTSELRRMLTELQ---VNNHYPKFRELEKI  171



>ref|XP_010523524.1| PREDICTED: basic leucine zipper 43-like [Tarenaya hassleriana]
Length=184

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            +Q  IIDER+QRRM+SNRESARRSRMRK+RHLDELWSQV   R EN  L+D+LN +SE H
Sbjct  78   RQQSIIDERRQRRMISNRESARRSRMRKQRHLDELWSQVTRLRKENHCLIDKLNCLSESH  137

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            D VL ENARLKEE S LR+L+ E+R    +     LR+ +D
Sbjct  138  DCVLKENARLKEETSDLRQLISEMRANSDNMCIGFLREFDD  178



>ref|XP_010528445.1| PREDICTED: basic leucine zipper 43-like [Tarenaya hassleriana]
Length=169

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 78/98 (80%), Gaps = 3/98 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            +Q  II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  LLD+LN +SE H
Sbjct  66   KQTDIINERKQRRMISNRESARRSRMRKQRHLDELWSQVMYLRNENHQLLDKLNHVSESH  125

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
            +KVL EN++LKEEA+ LR+++ +++      PFS  RD
Sbjct  126  EKVLQENSQLKEEATELRQMISDMQ---IQSPFSCFRD  160



>ref|XP_008341823.1| PREDICTED: ocs element-binding factor 1-like [Malus domestica]
Length=202

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 81/104 (78%), Gaps = 2/104 (2%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  +L++LN +SE H
Sbjct  79   QQLSLINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRKENHQILEKLNHVSESH  138

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            +KVL ENA+LKEE S LR+++ +L+      P   LRDLED+ C
Sbjct  139  EKVLQENAQLKEEXSELRQMLNDLQLHSPYHP--SLRDLEDVPC  180



>ref|XP_009355720.1| PREDICTED: basic leucine zipper 63 [Pyrus x bretschneideri]
Length=204

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 120/194 (62%), Gaps = 25/194 (13%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLP-PLDFTF-NSSSPAIDFTRFLNINNNHHQNALPIITPP  626
            M+P    +G++YF  E    LP P D+ F ++  P+  F    N       N    I PP
Sbjct  1    MLPGEIISGLHYFEPE--IPLPNPSDYGFMHNQIPSHHFNTLFN-------NLSRQIPPP  51

Query  625  ---DFslsasisnnstsdeseEQQH---RIIDERKQRRMVSNRESARRSRMRKKRHLDEL  464
               DF+  +S  + ++S   + ++H   R+I+ERKQRRM+SNRESARRSRMRK++HLDEL
Sbjct  52   PGHDFTQQSSSLSYNSSTSDDAEEHHHLRVIEERKQRRMISNRESARRSRMRKQKHLDEL  111

Query  463  WSQVLAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPF--  290
            WSQV+  R EN +L+ RLN +SE  D+V+ ENARLKEEAS LR+++  L+ G    P+  
Sbjct  112  WSQVVRLRNENHSLIGRLNNVSESRDRVVEENARLKEEASDLRQMLTNLQIGS---PYNI  168

Query  289  --SDLRDLE-DIKC  257
              S  R+L+ D+ C
Sbjct  169  NASTFRELDSDVPC  182



>ref|XP_010091673.1| Ocs element-binding factor 1 [Morus notabilis]
 gb|EXB44939.1| Ocs element-binding factor 1 [Morus notabilis]
Length=220

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -1

Query  559  RIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKV  380
            RIIDER+QRRM+SNRESARRSRMRK++HLDELWSQV+  R+EN +L+D+LN +SE HD+V
Sbjct  80   RIIDERRQRRMISNRESARRSRMRKQKHLDELWSQVVRLRSENHSLIDKLNHVSECHDRV  139

Query  379  LLENARLKEEASGLRRLVVELR  314
            L ENARLKEEAS LR+++ +L+
Sbjct  140  LEENARLKEEASNLRQMLTDLK  161



>emb|CDY37559.1| BnaA02g20110D [Brassica napus]
 emb|CDX98108.1| BnaA06g08590D [Brassica napus]
Length=198

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            +Q  +IDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  RT+N  L+D+LN++SE H
Sbjct  80   RQSMVIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLIDKLNRVSESH  139

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
               L ENA+LKEE S L++L+ E++    DD  + LR+LED
Sbjct  140  QLALKENAKLKEETSNLKQLISEIKSNNEDDN-NFLRELED  179



>gb|KFK43613.1| hypothetical protein AALP_AA1G149300 [Arabis alpina]
Length=194

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  IIDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  RT+N  L+D+LN++SE H
Sbjct  76   QQSMIIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLVDKLNRVSESH  135

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLE  269
            +  L ENA+LKEE S LR+L+ E++    DD  + LR+LE
Sbjct  136  ELALKENAKLKEETSDLRQLISEIKSNNEDDN-NFLRELE  174



>gb|KDO72256.1| hypothetical protein CISIN_1g042014mg [Citrus sinensis]
Length=169

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 112/183 (61%), Gaps = 24/183 (13%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHHQ--NALPIITPP  626
            M P  E +G++Y  A SL                   ++FLN   N HQ    +P I   
Sbjct  1    MQPFSEVSGLHYLLAPSL-------------------SQFLNPILNFHQIPPQVPEIINS  41

Query  625  DFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLA  446
              S  +S ++ S   E ++QQ  II+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+ 
Sbjct  42   QTSSFSSNNSTSDEAEEQQQQSMIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVW  101

Query  445  FRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
             R EN  L+D+LN +S  HDKV+ ENA LK EA+ LR+++ +L+    +  +S L+DL+D
Sbjct  102  LRNENHQLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQ---LNSHYSSLKDLDD  158

Query  265  IKC  257
            + C
Sbjct  159  VPC  161



>ref|XP_006395249.1| hypothetical protein EUTSA_v10005423mg [Eutrema salsugineum]
 gb|ESQ32535.1| hypothetical protein EUTSA_v10005423mg [Eutrema salsugineum]
Length=171

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  LLD+LN +SE H+KVL
Sbjct  75   IINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHEKVL  134

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE S L++++ +++      PFS  RD
Sbjct  135  QENAQLKEETSELKQVISDMQ---IQSPFSCFRD  165



>emb|CDY66911.1| BnaA06g39730D [Brassica napus]
Length=172

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  LLD+LN +SE H+KVL
Sbjct  76   IINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHEKVL  135

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE S L++++ +++      PFS  RD
Sbjct  136  QENAQLKEETSELKQVISDMQ---IQSPFSCFRD  166



>emb|CDX85297.1| BnaC07g26080D [Brassica napus]
Length=172

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  LLD+LN +SE H+KVL
Sbjct  76   IINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHEKVL  135

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE S L++++ +++      PFS  RD
Sbjct  136  QENAQLKEETSDLKQVISDMQ---IQSPFSCFRD  166



>ref|XP_009129054.1| PREDICTED: ocs element-binding factor 1 [Brassica rapa]
 emb|CDY46496.1| BnaA02g27460D [Brassica napus]
Length=179

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 112/183 (61%), Gaps = 9/183 (5%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTR--FLN--INNNHHQNALPIIT  632
            MIP+       Y S E+L TLP      N  S     +   +LN  INNN+  +++    
Sbjct  1    MIPAEITGYYQYLSPENLGTLPTEFNIINMPSSPTSSSSLTYLNDLINNNYSSSSIR---  57

Query  631  PPDFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQV  452
              D  +  + +++        Q   I+DERKQRRM+SNRESARRSRMRK+RHLDELWSQV
Sbjct  58   -QDLMMGNNSTSDEDHQHHHHQSIIIVDERKQRRMLSNRESARRSRMRKQRHLDELWSQV  116

Query  451  LAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELR-DGGADDPFSDLRD  275
            +  R EN  L+D+LN++SE  D VL EN++LKEEAS LR+LV EL+ +  +DD  + +R 
Sbjct  117  IRLRNENNCLIDKLNRVSETQDSVLKENSKLKEEASELRQLVCELKSNKNSDDDNNFVRK  176

Query  274  LED  266
            L +
Sbjct  177  LSE  179



>ref|XP_010514686.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=172

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  LLD+LN +SE HDKVL
Sbjct  76   IINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHDKVL  135

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE S L+ ++  ++      PFS  RD
Sbjct  136  QENAQLKEETSELKEVISNMQ---IQSPFSCFRD  166



>ref|XP_010425193.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=162

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I+DERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN++SE  D VL
Sbjct  70   ILDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSETQDSVL  129

Query  376  LENARLKEEASGLRRLVVELRDGGADD  296
             EN++LKEEAS LR+LV EL+    +D
Sbjct  130  KENSKLKEEASDLRKLVCELKSNKNND  156



>ref|XP_010503013.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=172

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  LLD+LN +SE HDKVL
Sbjct  76   IINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHDKVL  135

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE S L+ ++  ++      PFS  RD
Sbjct  136  QENAQLKEETSELKEVISNMQ---IQSPFSCFRD  166



>emb|CDX99780.1| BnaC02g35400D [Brassica napus]
Length=179

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 107/179 (60%), Gaps = 1/179 (1%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHHQNALPIITPPDF  620
            MIP+       Y S E+L TLP      N  S     +    +N+  + N        D 
Sbjct  1    MIPAEITGYYQYLSPENLATLPAEFNIINMPSSPTSSSSLTYLNDLINNNYSSSFIRQDL  60

Query  619  slsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFR  440
             +S + +++        Q   I+DERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R
Sbjct  61   MMSNNSTSDEDPQHHHHQSIIIVDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLR  120

Query  439  TENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELR-DGGADDPFSDLRDLED  266
             EN  L+D+LN++SE  D VL EN++LKEEAS LR+LV EL+ +  +DD  + +R L +
Sbjct  121  NENNCLIDKLNRVSETQDSVLKENSKLKEEASELRQLVCELKSNKNSDDDNNFVRKLSE  179



>ref|XP_009603686.1| PREDICTED: basic leucine zipper 43-like [Nicotiana tomentosiformis]
Length=180

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 77/105 (73%), Gaps = 3/105 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK+RHLDELW+QV+  R EN  LLD+LN  SE  
Sbjct  73   QQLNLINERKQRRMISNRESARRSRMRKQRHLDELWAQVVWLRNENHQLLDKLNHSSERQ  132

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCS  254
            D+VL ENA+LK+EAS LR+++    D     P   LR LED  CS
Sbjct  133  DQVLEENAQLKKEASELRQMIT---DMQLSSPCPSLRALEDEPCS  174



>ref|XP_011012258.1| PREDICTED: basic leucine zipper 43-like [Populus euphratica]
Length=196

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D++N +SE H
Sbjct  74   QQLSLINERKQRRMLSNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKVNHVSECH  133

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            D+V+ EN +LKEE S LR+++ +++      P+  L+ LEDI C
Sbjct  134  DQVVQENNKLKEEISELRQVLTDMQ---LSSPYPSLKGLEDITC  174



>ref|XP_009792002.1| PREDICTED: basic leucine zipper 43-like [Nicotiana sylvestris]
Length=180

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 78/105 (74%), Gaps = 3/105 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK+RHLDELW+QV+  R EN  LLD+LN  SE  
Sbjct  73   QQLNLINERKQRRMISNRESARRSRMRKQRHLDELWAQVVWLRNENHQLLDKLNHASERQ  132

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCS  254
            D VL ENA+LK+EAS LR+++ +++      P   LR LED  CS
Sbjct  133  DHVLEENAQLKKEASELRQMITDMQLSS---PCPSLRALEDEPCS  174



>ref|XP_010502422.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=166

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I+DERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN++SE  D VL
Sbjct  70   ILDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSETQDSVL  129

Query  376  LENARLKEEASGLRRLVVELRDGGADD  296
             EN++LKEEAS LR+LV EL+    +D
Sbjct  130  KENSKLKEEASDLRKLVCELKSNKNND  156



>ref|XP_008243767.1| PREDICTED: basic leucine zipper 63 [Prunus mume]
Length=204

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 83/109 (76%), Gaps = 8/109 (7%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            Q  RIIDERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN +L+DRLN +SE H
Sbjct  77   QHLRIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVVRLRNENQSLIDRLNYVSESH  136

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPF----SDLRDLE-DIKC  257
            D+++ EN +LKEEAS LR+++  L+ G    P+    +  R+LE ++ C
Sbjct  137  DRIVQENTKLKEEASDLRQMLTNLQIGS---PYNINATTFRELEAEVPC  182



>ref|NP_189674.1| basic leucine-zipper 42 [Arabidopsis thaliana]
 dbj|BAB01020.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAH30475.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77649.1| basic leucine-zipper 42 [Arabidopsis thaliana]
Length=173

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  LLD+LN +SE HDKVL
Sbjct  77   IINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHDKVL  136

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE   L++++ +++      PFS  RD
Sbjct  137  QENAQLKEETFELKQVISDMQ---IQSPFSCFRD  167



>ref|XP_006384243.1| bZIP transcription factor family protein [Populus trichocarpa]
 gb|ERP62040.1| bZIP transcription factor family protein [Populus trichocarpa]
Length=196

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D++N +SE H
Sbjct  74   QQLSLINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKVNHVSECH  133

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            D+V+ EN +LKEE S LR++   L D     P+  L+ LEDI C
Sbjct  134  DQVVQENNQLKEEISELRQV---LTDMQLSSPYPSLKGLEDITC  174



>ref|XP_010316197.1| PREDICTED: basic leucine zipper 43 [Solanum lycopersicum]
Length=180

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK+RHLDELW+QVL  R EN  LLD+LN  SE H
Sbjct  73   QQWTLINERKQRRMISNRESARRSRMRKQRHLDELWAQVLWLRNENHQLLDKLNHASERH  132

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCS  254
            D+VL ENA+LK E S LR+++  ++      P    R LE+  CS
Sbjct  133  DQVLQENAQLKNETSELRKMITGMQ---LSSPCPSSRALENEPCS  174



>ref|XP_007223457.1| hypothetical protein PRUPE_ppa011589mg [Prunus persica]
 gb|EMJ24656.1| hypothetical protein PRUPE_ppa011589mg [Prunus persica]
Length=204

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 82/109 (75%), Gaps = 8/109 (7%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            Q  RIIDERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN +L+DRLN +SE H
Sbjct  77   QHLRIIDERKQRRMISNRESARRSRMRKQKHLDELWSQVVRLRNENQSLIDRLNYVSESH  136

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPF----SDLRDLE-DIKC  257
            D+V+ EN +LKEEAS LR+ +  L+ G    P+    +  R+LE ++ C
Sbjct  137  DRVVQENTKLKEEASDLRQTLTNLQIGS---PYNINATTFRELEPEVPC  182



>ref|XP_006291935.1| hypothetical protein CARUB_v10018121mg [Capsella rubella]
 gb|EOA24833.1| hypothetical protein CARUB_v10018121mg [Capsella rubella]
Length=172

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  LLD+LN +SE HDKVL
Sbjct  76   IINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHDKVL  135

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE S L+ ++  ++      PFS  RD
Sbjct  136  QENAQLKEETSELKEVISNMQ---IQSPFSCFRD  166



>ref|XP_004137148.1| PREDICTED: ocs element-binding factor 1-like [Cucumis sativus]
 ref|XP_004154731.1| PREDICTED: ocs element-binding factor 1-like [Cucumis sativus]
 gb|KGN53757.1| hypothetical protein Csa_4G122810 [Cucumis sativus]
Length=161

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQVL  R EN  L+DRLNQ+SE H
Sbjct  70   QQLSLINERKQRRMISNRESARRSRMRKQKHLDELWSQVLWLRNENHQLIDRLNQVSECH  129

Query  388  DKVLLENARLKEEASGLRRLVVELR  314
            D+ L ENA+LKEEAS LR+++ + +
Sbjct  130  DRALQENAQLKEEASELRQMLTDFQ  154



>ref|XP_002875554.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51813.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=172

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  LLD+L  +SE H+KVL
Sbjct  76   IINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLKNLSESHEKVL  135

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE S L++++ +++      PFS  RD
Sbjct  136  QENAQLKEETSELKQVISDMQ---IQSPFSCFRD  166



>emb|CDY35775.1| BnaC02g38190D [Brassica napus]
Length=171

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+ FR EN  LLD+LN +SE H+KVL
Sbjct  75   IINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWFRVENHQLLDKLNNLSESHEKVL  134

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             EN +LK E S L++++ +++      PFS  RD
Sbjct  135  QENVQLKGETSELKQVISDMK---IQSPFSCFRD  165



>gb|KFK39850.1| hypothetical protein AALP_AA3G296300 [Arabis alpina]
Length=171

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I+DERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN++SE+ D VL
Sbjct  83   ILDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSENQDSVL  142

Query  376  LENARLKEEASGLRRLVVELR  314
             EN++LKEEAS LR+LV EL+
Sbjct  143  KENSKLKEEASDLRQLVCELK  163



>ref|XP_006338314.1| PREDICTED: light-inducible protein CPRF2-like [Solanum tuberosum]
Length=180

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 3/105 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK+RHLDELW+QV+  R EN  LLD+LN  SE H
Sbjct  73   QQWTLINERKQRRMISNRESARRSRMRKQRHLDELWAQVVWLRNENHQLLDKLNHDSERH  132

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCS  254
            D+VL ENA+LK EAS LR+++  ++      P    R LE+  CS
Sbjct  133  DQVLQENAQLKNEASELRQMIAGMQFSS---PCPSSRALENEPCS  174



>ref|XP_009148651.1| PREDICTED: ocs element-binding factor 1-like [Brassica rapa]
Length=193

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%), Gaps = 6/101 (6%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            +Q  +IDERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  RT+N  L+D+LN++SE H
Sbjct  80   RQSMVIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLIDKLNRVSESH  139

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
               L ENA+LKEE S L++L+ E++          LR+LED
Sbjct  140  QLALKENAKLKEETSNLKQLISEIKSNNF------LRELED  174



>gb|EYU44259.1| hypothetical protein MIMGU_mgv1a018568mg, partial [Erythranthe 
guttata]
Length=157

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 102/145 (70%), Gaps = 15/145 (10%)
 Frame = -1

Query  733  PLDFTFNSS-SPAIDFTRFLNINNNHHQNALPIITP---PDFsl-sasisnnstsdeseE  569
            P  F+ N++ +P   F+RF N          P+  P   P F   +  +S+NSTSDE++E
Sbjct  21   PTHFSLNTNIAPPYQFSRFPN----------PLYQPHTTPQFQEFNPQLSSNSTSDEADE  70

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  II+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN  SE H
Sbjct  71   QQLSIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHFSERH  130

Query  388  DKVLLENARLKEEASGLRRLVVELR  314
            D+V+ ENA+LKEEAS LR+++  ++
Sbjct  131  DRVVQENAQLKEEASELRQMLTGMQ  155



>gb|AFK43945.1| unknown [Lotus japonicus]
Length=185

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 102/174 (59%), Gaps = 14/174 (8%)
 Frame = -1

Query  784  ENTGINYFSAESLFTLPPLDFTFNSSSPAIDFTRFLNINNNHHQNALPIITPPDFslsas  605
            E  G+NY    +    P       ++ P   F RF N           +   PDFS  +S
Sbjct  5    EAPGLNYMLPSNPPPYPANYTMIQNNIPTFQFQRFSNQ----------LFQVPDFSPQSS  54

Query  604  isnnstsdese-EQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENC  428
              +++++ +   EQQ  +I+ERK RRM+SNRESARRSRMRK+RHLDELWSQV+  R EN 
Sbjct  55   CISSNSTSDEADEQQQGLINERKHRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENH  114

Query  427  NLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
             LLD+L+  SE HD+V+ ENA+LKEEA GLR++   LRD     P      LED
Sbjct  115  QLLDKLSHASESHDQVVQENAQLKEEALGLRQM---LRDMQIHSPCPSFAPLED  165



>ref|XP_010496052.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=172

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  LLD+LN +SE ++KVL
Sbjct  76   IINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESYEKVL  135

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE S L+ ++  ++      PFS  RD
Sbjct  136  QENAQLKEETSELKEVISNMQ---IQSPFSCFRD  166



>ref|XP_009129683.1| PREDICTED: ocs element-binding factor 1-like [Brassica rapa]
Length=171

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+ FR EN  LLD+LN +SE H+K+L
Sbjct  75   IINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWFRVENYQLLDKLNNLSESHEKIL  134

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             EN +LK E S L++++ +++      PFS   D
Sbjct  135  QENVQLKGETSELKQVISDMK---IQSPFSCFGD  165



>gb|EPS60120.1| hypothetical protein M569_14683, partial [Genlisea aurea]
Length=123

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 85/112 (76%), Gaps = 7/112 (6%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++DERK+RRM SNRESARRSRMRK+RHLDELWSQVL  RTEN +LLD+LN +++ HD+++
Sbjct  17   VVDERKRRRMKSNRESARRSRMRKQRHLDELWSQVLRLRTENNHLLDKLNHVTQSHDRIV  76

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCSFQR*IIHLSAV  221
             EN +LK+EAS L +++++++       F+ + D ED+ C+    + HL+A 
Sbjct  77   QENEKLKDEASDLHQMLMDIQFCNI---FTCISDFEDMSCN----LTHLAAA  121



>ref|XP_010514166.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=166

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I+DERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN++SE    +L
Sbjct  70   ILDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSETQASIL  129

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
             EN++LKEEAS LR+LV EL+    ++  S  R+ ED
Sbjct  130  KENSKLKEEASDLRKLVCELK-SNKNNENSIQREFED  165



>ref|XP_006292701.1| hypothetical protein CARUB_v10018947mg [Capsella rubella]
 gb|EOA25599.1| hypothetical protein CARUB_v10018947mg [Capsella rubella]
Length=169

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I+DERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN++SE  D VL
Sbjct  73   ILDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSETQDCVL  132

Query  376  LENARLKEEASGLRRLVVEL  317
             EN++LKEEAS LR+LV EL
Sbjct  133  KENSKLKEEASDLRQLVCEL  152



>ref|XP_004304176.1| PREDICTED: basic leucine zipper 63-like [Fragaria vesca subsp. 
vesca]
Length=219

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN MSE H
Sbjct  90   QQLSLINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHMSESH  149

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPF-SDLRD-LE-DIKC  257
            D+ L ENA+LKEE S LR L+ +L+    +  +   LRD LE D+ C
Sbjct  150  DRALQENAQLKEEVSELRELLSDLQLHSPNSNYHPSLRDQLEVDVPC  196



>ref|XP_004490322.1| PREDICTED: light-inducible protein CPRF2-like [Cicer arietinum]
Length=186

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 109/169 (64%), Gaps = 8/169 (5%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNSSSPAIDF---TRFLNINNNHHQNALPIITP  629
            M+P+ E  G++  + E+ F + P ++     S   +F   +   N+ N H  +A    TP
Sbjct  1    MVPN-EMRGVHNLTPENSFQIQP-NYLLPQQSDIPNFHLNSLLTNLPNFHFPSAGLEFTP  58

Query  628  PDFslsasisnnstsdeseEQQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVL  449
            P      S ++ ++ +  E Q + ++DER+ RRM+SNRESARRSRMRK++HLDELWSQV+
Sbjct  59   P---SCLSSNSTTSDEADELQFNVVLDERRHRRMISNRESARRSRMRKQKHLDELWSQVV  115

Query  448  AFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGA  302
              RTEN NL+D+LN +SE HD+V+ ENA+LKEE   LR++V  ++ G +
Sbjct  116  RLRTENHNLIDKLNHVSESHDRVVQENAKLKEETFDLRQMVSHMQIGNS  164



>ref|XP_007151433.1| hypothetical protein PHAVU_004G045800g [Phaseolus vulgaris]
 gb|ESW23427.1| hypothetical protein PHAVU_004G045800g [Phaseolus vulgaris]
Length=196

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERK RRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+++LN +SE H
Sbjct  72   QQLSLINERKHRRMISNRESARRSRMRKQKHLDELWSQVMWLRNENHQLIEKLNHVSESH  131

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCS  254
            D+VL ENA+LKEEAS LR+++ +++       F+  +D  D+ C+
Sbjct  132  DQVLQENAQLKEEASELRQMMRDMQIHSPCPSFTPFQD--DVPCT  174



>gb|EPS71175.1| hypothetical protein M569_03582 [Genlisea aurea]
Length=198

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I+ ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN +SE HD+VL
Sbjct  85   ILHERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRNENHQLIDKLNHVSERHDRVL  144

Query  376  LENARLKEEASGLRRLVVELR-DGGADDPFSDL  281
             ENA+LKEE + L++++ ++R +   DD F  L
Sbjct  145  QENAQLKEETTELKQIITDMRFNTPYDDTFPHL  177



>emb|CDY71548.1| BnaCnng73390D [Brassica napus]
Length=170

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I+DERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN + E  D VL
Sbjct  83   ILDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNSVLETQDNVL  142

Query  376  LENARLKEEASGLRRLVVELR  314
             EN++LKEEAS LRRLV +L+
Sbjct  143  KENSKLKEEASDLRRLVCDLK  163



>ref|XP_006395651.1| hypothetical protein EUTSA_v10005000mg [Eutrema salsugineum]
 gb|ESQ32937.1| hypothetical protein EUTSA_v10005000mg [Eutrema salsugineum]
Length=179

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I+DERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN++SE  D VL
Sbjct  79   ILDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSETQDSVL  138

Query  376  LENARLKEEASGLRRLVVEL  317
             EN++LKEEA  LRRLV EL
Sbjct  139  KENSKLKEEAFDLRRLVCEL  158



>ref|XP_009588233.1| PREDICTED: basic leucine zipper 43-like [Nicotiana tomentosiformis]
Length=179

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERK+RRM+SNRESARRSRMRK++HLDELW+QV+  R EN  LL++LN  SE HD+ L
Sbjct  74   LINERKERRMISNRESARRSRMRKQKHLDELWAQVICLRNENHQLLNKLNHASEIHDQAL  133

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCS  254
             ENA+LKEE S LR++V  ++   + + +  LRD++   CS
Sbjct  134  QENAQLKEETSALRQMVTNMQLMNSPN-YPCLRDVDGEPCS  173



>ref|XP_002875253.1| hypothetical protein ARALYDRAFT_484308 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51512.1| hypothetical protein ARALYDRAFT_484308 [Arabidopsis lyrata subsp. 
lyrata]
Length=144

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I+DERKQRRM+SNRESARRSRMRK+RHLDEL +QV+  R EN  L+D+LNQ+SE  D VL
Sbjct  48   ILDERKQRRMLSNRESARRSRMRKQRHLDELQAQVIRLRNENNCLIDKLNQVSETQDSVL  107

Query  376  LENARLKEEASGLRRLVVEL  317
             EN++LKEEAS LR+LV EL
Sbjct  108  KENSKLKEEASDLRQLVCEL  127



>ref|XP_009152133.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 [Brassica 
rapa]
 emb|CDY48072.1| BnaA06g33560D [Brassica napus]
Length=170

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I+DERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R +N  L+D+LN + E  D VL
Sbjct  83   ILDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNDNNCLIDKLNSVLETQDNVL  142

Query  376  LENARLKEEASGLRRLVVELR  314
             EN++LKEEAS LRRLV +L+
Sbjct  143  KENSKLKEEASDLRRLVCDLK  163



>ref|NP_001235209.1| uncharacterized protein LOC100500497 [Glycine max]
 gb|ACU15597.1| unknown [Glycine max]
 gb|KHN14454.1| Ocs element-binding factor 1 [Glycine soja]
Length=193

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERK RRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE H
Sbjct  74   QQQSLINERKHRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLMDKLNHVSESH  133

Query  388  DKVLLENARLKEEASGLRRLVVELR  314
            DKV  EN +L+EEAS LR+++ +++
Sbjct  134  DKVAQENVQLREEASELRQMICDMQ  158



>ref|XP_010044346.1| PREDICTED: basic leucine zipper 43 [Eucalyptus grandis]
Length=182

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 85/108 (79%), Gaps = 7/108 (6%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            +Q R+IDER++RRM+SNRESARRSRMRK+RHLDELWSQVL  R EN +L++RLN+ +E H
Sbjct  74   RQFRLIDERRRRRMISNRESARRSRMRKQRHLDELWSQVLRLRGENQSLVERLNEATERH  133

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSD----LRDLEDIKC  257
            ++ + EN+RL+EE + LR+L   LRD   D P++D    +RDLE++ C
Sbjct  134  ERAVRENSRLQEEVADLRQL---LRDVRFDSPYNDASGGIRDLEEVVC  178



>gb|KEH21784.1| BZIP transcription factor [Medicago truncatula]
Length=191

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERK RRMVSNRESARRSRMRK++ LDELWSQV+  R EN  LLD+LN   E HDKV+
Sbjct  83   LINERKHRRMVSNRESARRSRMRKQKQLDELWSQVVWLRNENHQLLDKLNNFCETHDKVV  142

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
             EN +LKE+AS LR++V +++   +  P S L D+  I
Sbjct  143  QENVQLKEQASELRQMVCDMQLHSSCLPLSPLEDVPSI  180



>gb|KHN02655.1| Ocs element-binding factor 1 [Glycine soja]
Length=214

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 113/179 (63%), Gaps = 11/179 (6%)
 Frame = -1

Query  778  TGINYFSAESLFTLPPLD-FT--FNSSSPAIDFTRFLNI---NNNHHQNALPIITPPDFs  617
            + ++Y    +  + PP + +T    +S P   F RF N     NN H     +   PDFS
Sbjct  8    SSLSYLLPSNPCSYPPSNNYTSMIQNSIPTFQFQRFSNQIYGYNNSHNTTYQV---PDFS  64

Query  616  lsasisnnstsdeseEQQH-RIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFR  440
              +S  +++++ +  + Q+  +I+ERK RRM+SNRESARRSRMRK++HLDELWSQV+  R
Sbjct  65   PQSSCISSNSTSDEADDQNLSLINERKHRRMLSNRESARRSRMRKQKHLDELWSQVVWLR  124

Query  439  TENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELR-DGGADDPFSDLRDLED  266
             EN  L+D+LN +SE HD+VL EN++LKEEAS LR+++ +++       P S +  LED
Sbjct  125  NENHQLIDKLNHVSETHDQVLQENSQLKEEASELRQMIRDMQIHSPCGGPNSFITPLED  183



>ref|NP_178489.1| basic leucine-zipper 48 [Arabidopsis thaliana]
 gb|AAM15441.1| bZIP protein (AtbZIP48) [Arabidopsis thaliana]
 dbj|BAH30383.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC05787.1| basic leucine-zipper 48 [Arabidopsis thaliana]
Length=166

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++DERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+D+LN++SE  + VL
Sbjct  70   VLDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSETQNCVL  129

Query  376  LENARLKEEASGLRRLVVEL  317
             EN++LKEEAS LR+LV EL
Sbjct  130  KENSKLKEEASDLRQLVCEL  149



>ref|XP_010549959.1| PREDICTED: basic leucine zipper 43 [Tarenaya hassleriana]
 gb|ABD96858.1| hypothetical protein [Cleome spinosa]
Length=183

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 75/106 (71%), Gaps = 6/106 (6%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  II+ERKQRRM+SNRESARRSRMRK+RHLDEL SQV   R EN  L+++LNQ+SE H
Sbjct  75   QQLSIINERKQRRMISNRESARRSRMRKQRHLDELLSQVAWLRNENHQLINKLNQVSESH  134

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKCSF  251
            D VL ENA+LKEE S LR+LV  ++        S    LED  C+ 
Sbjct  135  DCVLQENAQLKEETSELRQLVTTMKLR------SQYSCLEDFPCNM  174



>ref|XP_009778656.1| PREDICTED: basic leucine zipper 43-like [Nicotiana sylvestris]
Length=164

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRM+SNRESARRSRMRK++HLDELW+QV+  R EN  LL++LN  SE HD+ L
Sbjct  75   LINERKQRRMISNRESARRSRMRKQKHLDELWAQVICLRNENHQLLNKLNDASESHDQAL  134

Query  376  LENARLKEEASGLRRLVVELR  314
             ENA+LKEE S LR++V  ++
Sbjct  135  QENAQLKEETSALRQMVTNMQ  155



>emb|CDY33124.1| BnaC09g22200D [Brassica napus]
 emb|CDY04169.1| BnaA09g19470D [Brassica napus]
Length=176

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 111/189 (59%), Gaps = 23/189 (12%)
 Frame = -1

Query  799  MIPSVENTGINYFSAESLFTLPPLDFTFNS-----SSPAIDFTRFLNINNNHH--QNALP  641
            M P+       Y S E L T+P      N      SS ++++   L INNN+    N   
Sbjct  1    MTPAEITGYYQYLSPEKLSTIPAEFNMLNMPTSPISSSSLNYLNDLIINNNYSLSSNGQD  60

Query  640  IITPPDFslsasisnnstsdeseEQQHRII---DERKQRRMVSNRESARRSRMRKKRHLD  470
            ++   +          STSDE   Q H+ I   DERKQRRM+SNRESARRSRMRK+RHLD
Sbjct  61   LMMSNN----------STSDEDYHQHHQSITALDERKQRRMLSNRESARRSRMRKQRHLD  110

Query  469  ELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEASGLRRLVVELRDGGADDPF  290
            ELWSQV++ R EN  L+D+L ++S+  D VL EN++LKEE S LR+LV EL+    +   
Sbjct  111  ELWSQVISLRNENNCLIDKLIRVSDTQDNVLKENSKLKEEVSDLRQLVSELKPNKNN---  167

Query  289  SDLRDLEDI  263
            S LR+ E++
Sbjct  168  SFLREFEEV  176



>gb|ABI34652.1| bZIP transcription factor bZIP73B [Glycine max]
Length=193

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERK RRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN + E H
Sbjct  74   QQQSLINERKHRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLMDKLNHVXESH  133

Query  388  DKVLLENARLKEEASGLRRLVVELR  314
            DKV  EN +L+EEAS LR+++ +++
Sbjct  134  DKVAQENVQLREEASELRQMICDMQ  158



>ref|NP_001235322.1| uncharacterized protein LOC100527640 [Glycine max]
 gb|ACU16771.1| unknown [Glycine max]
Length=185

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 102/154 (66%), Gaps = 11/154 (7%)
 Frame = -1

Query  712  SSSPAIDFTRFLNI---NNNHHQNALPIITPPDFslsasisnnstsdeseEQQH-RIIDE  545
            +S P   F RF N     NN H     +   PDFS  +S  +++++ +  + Q+  +I+E
Sbjct  4    NSIPTFQFQRFSNQIYGCNNSHNTTYQV---PDFSPQSSCISSNSTSDEADDQNLSLINE  60

Query  544  RKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLENA  365
            RK RRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE HD+VL EN+
Sbjct  61   RKHRRMLSNRESARRSRMRKQKHLDELWSQVVWLRNENHQLIDKLNHVSETHDQVLQENS  120

Query  364  RLKEEASGLRRLVVELR----DGGADDPFSDLRD  275
            +LKEEAS LR+++ +++     GG +   + L D
Sbjct  121  QLKEEASELRQMIRDMQIHSPCGGPNSFITPLED  154



>gb|KGN49810.1| hypothetical protein Csa_5G137430 [Cucumis sativus]
Length=162

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +IDERKQRRM+SN ESARRSRMRK++HLDELWS VL  RTEN +L+++LNQ+++   ++L
Sbjct  50   VIDERKQRRMISNWESARRSRMRKQKHLDELWSVVLHLRTENHSLMEKLNQLTDSEQQLL  109

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSD-LRDLEDIKC  257
             EN +LKEEA  L R++ +++ G    P++  LR+LE+  C
Sbjct  110  QENVKLKEEALNLHRMITDIQMGS---PYTTHLRELEEAPC  147



>ref|XP_010558536.1| PREDICTED: basic leucine zipper 43-like [Tarenaya hassleriana]
 gb|ABD96902.1| hypothetical protein [Cleome spinosa]
Length=172

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+RHLDEL SQV   R EN  L+D+LNQ+SE HD+VL
Sbjct  78   IINERKQRRMISNRESARRSRMRKQRHLDELLSQVAWLRKENHQLIDKLNQVSESHDRVL  137

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDL  281
             EN +LKEE S LR+LV  ++       F D 
Sbjct  138  QENTQLKEETSELRQLVSTMKLRSQYSYFEDF  169



>ref|XP_008466040.1| PREDICTED: light-inducible protein CPRF2 [Cucumis melo]
Length=185

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++DERKQRRM+SNRESARRSRMRK++HLDELWS V+  RTEN +L+++LNQ+++   ++L
Sbjct  73   VVDERKQRRMISNRESARRSRMRKQKHLDELWSVVVRLRTENHSLMEKLNQLTDSEQQLL  132

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSD-LRDLEDIKC  257
             EN +LKEEAS  RR++ +++      P++  LR+L++  C
Sbjct  133  EENVKLKEEASDFRRIITDVQ---MSSPYTTHLRELKEAPC  170



>ref|XP_010525137.1| PREDICTED: basic leucine zipper 43-like [Tarenaya hassleriana]
 gb|ABD96938.1| hypothetical protein [Cleome spinosa]
Length=174

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  II ERKQRRM+SNRESARRSRMRK+RHLDEL SQ+   R EN  LL +LNQ+SE H
Sbjct  69   QQLSIIKERKQRRMISNRESARRSRMRKQRHLDELMSQMARLRNENQQLLRKLNQLSESH  128

Query  388  DKVLLENARLKEEASGLRRLVVELR  314
            D VL EN +LKEE S LR+LVV ++
Sbjct  129  DHVLQENVKLKEETSELRQLVVTMK  153



>gb|EYU39353.1| hypothetical protein MIMGU_mgv1a024017mg, partial [Erythranthe 
guttata]
Length=151

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE HD+V+
Sbjct  70   IINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLIDKLNHVSESHDRVV  129

Query  376  LENARLKEEASGLRRLV  326
             ENA+LKEE   LR+++
Sbjct  130  QENAQLKEETLELRQMI  146



>ref|XP_007139371.1| hypothetical protein PHAVU_008G023800g [Phaseolus vulgaris]
 gb|ESW11365.1| hypothetical protein PHAVU_008G023800g [Phaseolus vulgaris]
Length=195

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERK RRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE H
Sbjct  76   QQLSLINERKHRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLMDKLNHVSESH  135

Query  388  DKVLLENARLKEEASGLRRLVVELR  314
            D+V  EN +L+EEAS LR+++ +++
Sbjct  136  DRVAQENVQLREEASELRQMICDMQ  160



>ref|XP_010552351.1| PREDICTED: basic leucine zipper 43-like [Tarenaya hassleriana]
Length=170

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%), Gaps = 3/98 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  II+ERKQRR +SNRESARRSRMRK+RHLDEL SQV+    +N  LL++LN  SE H
Sbjct  69   QQINIINERKQRRKISNRESARRSRMRKQRHLDELLSQVMYLMNQNHQLLEKLNHASESH  128

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
            +KVL ENARLKEEA+ LR+++ +++      PFS   D
Sbjct  129  EKVLQENARLKEEATELRQMITDMQ---IRSPFSCFGD  163



>ref|XP_004507268.1| PREDICTED: basic leucine zipper 63-like [Cicer arietinum]
Length=204

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 76/103 (74%), Gaps = 5/103 (5%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERK RRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+++LN +SE+HD+V+
Sbjct  83   LINERKHRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENQQLIEKLNHVSENHDQVV  142

Query  376  LENARLKEEASGLRRLVVELRDGGADDPF-SDLRDLED-IKCS  254
             ENA+LKEE   LR++   LRD     PF      LED I C+
Sbjct  143  QENAKLKEETLELRQM---LRDMQIQSPFIPSFSPLEDHINCN  182



>ref|XP_004149503.1| PREDICTED: uncharacterized protein LOC101222428 [Cucumis sativus]
Length=225

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +IDERKQRRM+SN ESARRSRMRK++HLDELWS VL  RTEN +L+++LNQ+++   ++L
Sbjct  113  VIDERKQRRMISNWESARRSRMRKQKHLDELWSVVLHLRTENHSLMEKLNQLTDSEQQLL  172

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSD-LRDLEDIKC  257
             EN +LKEEA  L R++ +++ G    P++  LR+LE+  C
Sbjct  173  QENVKLKEEALNLHRMITDIQMGS---PYTTHLRELEEAPC  210



>ref|NP_001235016.1| bZIP transcription factor bZIP73A [Glycine max]
 gb|ABI34651.1| bZIP transcription factor bZIP73A [Glycine max]
Length=195

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERK RRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +S   
Sbjct  76   QQQSLINERKHRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLMDKLNHVSASQ  135

Query  388  DKVLLENARLKEEASGLRRLVVELR  314
            DKV+ EN +L+EEAS LR+++ +++
Sbjct  136  DKVVQENVQLREEASELRQMICDMQ  160



>gb|KHN13783.1| Ocs element-binding factor 1 [Glycine soja]
Length=195

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERK RRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +S   
Sbjct  76   QQQSLINERKHRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLMDKLNHVSASQ  135

Query  388  DKVLLENARLKEEASGLRRLVVELR  314
            DKV+ EN +L+EEAS LR+++ +++
Sbjct  136  DKVVQENVQLREEASELRQMICDMQ  160



>ref|XP_006346868.1| PREDICTED: light-inducible protein CPRF2-like [Solanum tuberosum]
Length=174

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 77/103 (75%), Gaps = 2/103 (2%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERK+RRM+SNRESARRSRMRK++HL+ELW+QV   R EN  LL++LN +S+ HD+ L
Sbjct  66   LINERKKRRMISNRESARRSRMRKQKHLNELWAQVNCLRNENHLLLNKLNHVSKGHDQAL  125

Query  376  LENARLKEEASGLRRLV--VELRDGGADDPFSDLRDLEDIKCS  254
             ENA+LKEE +GLR++V  ++L +G       DL+   D  CS
Sbjct  126  EENAQLKEETAGLRQMVTNMQLMNGPNYPSLKDLQLDNDEPCS  168



>ref|XP_003635906.1| BZIP transcription factor bZIP73A [Medicago truncatula]
 gb|AFK45822.1| unknown [Medicago truncatula]
 gb|KEH25210.1| BZIP transcription factor [Medicago truncatula]
Length=200

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERK RRM+SNRESARRSRMRK++HLDELWSQVL  R EN  L+++LN +SE+HD+V+
Sbjct  86   LINERKHRRMISNRESARRSRMRKQKHLDELWSQVLWLRNENHQLIEKLNHVSENHDQVV  145

Query  376  LENARLKEEASGLRRLVVELR  314
             ENA+LKEEA  LR+++ +++
Sbjct  146  QENAQLKEEALELRQMIKDMQ  166



>ref|NP_197087.1| basic leucine-zipper 3 [Arabidopsis thaliana]
 emb|CAC01782.1| bZIP DNA-binding protein-like [Arabidopsis thaliana]
 dbj|BAC42470.1| putative bZIP transcription factor AtbZip3 [Arabidopsis thaliana]
 gb|AAO39911.1| At5g15830 [Arabidopsis thaliana]
 gb|AED92212.1| basic leucine-zipper 3 [Arabidopsis thaliana]
Length=186

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 77/104 (74%), Gaps = 2/104 (2%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  LLD+LNQ+S+++D V+
Sbjct  70   VINERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQVSDNNDLVI  129

Query  376  LENARLKEEASGLRRLVVELR--DGGADDPFSDLRDLEDIKCSF  251
             EN+ LKEE   LR+++  ++   GG  D +S    ++++   F
Sbjct  130  QENSSLKEENLELRQVITSMKKLGGGIHDKYSSPSSMDELDQDF  173



>ref|NP_001237100.1| uncharacterized protein LOC100527256 [Glycine max]
 gb|ACU16313.1| unknown [Glycine max]
Length=195

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQ  +I+ERK RRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +S   
Sbjct  76   QQQSLINERKHRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLMDKLNHVSASQ  135

Query  388  DKVLLENARLKEEASGLRRLVVELR  314
            D+V+ EN +L+EEAS LR+++ +++
Sbjct  136  DEVVQENVQLREEASELRQMICDMQ  160



>ref|XP_010681298.1| PREDICTED: basic leucine zipper 43-like [Beta vulgaris subsp. 
vulgaris]
Length=169

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -1

Query  553  IDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLL  374
            +DERK RRM+SNRESARRSRMRKKR ++ELWS VL  RTEN  L+D+L  +SE H++VL 
Sbjct  73   VDERKHRRMLSNRESARRSRMRKKRQINELWSHVLRLRTENHALIDKLEHVSESHNQVLQ  132

Query  373  ENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            EN +LKEE S LR+++  ++    D  ++ LR +ED
Sbjct  133  ENIQLKEETSNLRQMLTYMKLDTNDVLYNALRYVED  168



>ref|XP_010492432.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=185

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  LL++LNQ+S+ +D V+
Sbjct  70   VINERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLEKLNQVSDSNDHVI  129

Query  376  LENARLKEEASGLRRLVVELRDGGADD  296
             EN  LKEE S LR+++  ++  G D+
Sbjct  130  QENLNLKEENSELRQVITSMKKLGGDN  156



>ref|XP_003555028.1| PREDICTED: basic leucine zipper 63-like [Glycine max]
 gb|KHN30759.1| Ocs element-binding factor 1 [Glycine soja]
Length=220

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERK RRM+SNRESARRSRMRK++HLDELWSQV+  R EN  L+D+LN +SE HD+V+
Sbjct  90   LINERKHRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLMDKLNHVSESHDQVM  149

Query  376  LENARLKEEASGLRRLVVELR  314
             ENA+LKE+A  LR+++ +++
Sbjct  150  QENAQLKEQALELRQMIRDMQ  170



>ref|XP_002871687.1| hypothetical protein ARALYDRAFT_488428 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47946.1| hypothetical protein ARALYDRAFT_488428 [Arabidopsis lyrata subsp. 
lyrata]
Length=184

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  LLD+LNQ+S+++D+V+
Sbjct  69   VINERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQVSDNNDRVI  128

Query  376  LENARLKEEASGLRRLVVELR--DGGADDPFS  287
             EN  LKEE   LR+++  ++   GG  D +S
Sbjct  129  QENLSLKEENLELRQVITSVKKLGGGIHDKYS  160



>ref|XP_011085668.1| PREDICTED: basic leucine zipper 43-like [Sesamum indicum]
Length=174

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSR+RK+RHLDELWSQV+  R EN  L++RL ++ E H++ L
Sbjct  69   IINERKQRRMISNRESARRSRIRKQRHLDELWSQVVWLRNENHQLMERLKRVMERHERAL  128

Query  376  LENARLKEEASGLRRLVVELR  314
             ENA+LKEEAS LR +V  ++
Sbjct  129  EENAQLKEEASELREMVTGMQ  149



>ref|XP_009114126.1| PREDICTED: ocs element-binding factor 1-like [Brassica rapa]
Length=174

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 78/102 (76%), Gaps = 3/102 (3%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            Q+ + ++ERKQRRM+SNRESARRSRMRK+RHLDELWSQV+  R EN  L+++L ++S+  
Sbjct  76   QRIKALNERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIEKLVRVSDTQ  135

Query  388  DKVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
            D VL EN++LKEE S LR+LV EL+    +   S LR+ E++
Sbjct  136  DNVLKENSKLKEEVSDLRQLVSELKPNKNN---SFLREFEEV  174



>ref|XP_004164850.1| PREDICTED: uncharacterized protein LOC101227590 [Cucumis sativus]
Length=417

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +IDERKQRRM+SN ESARRSRMRK++HLDELWS VL  RTEN +L+++LNQ+++   ++L
Sbjct  305  VIDERKQRRMISNWESARRSRMRKQKHLDELWSVVLHLRTENHSLMEKLNQLTDSEQQLL  364

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSD-LRDLEDIKC  257
             EN +LKEEA  L R++ +++ G    P++  LR+LE+  C
Sbjct  365  QENVKLKEEALNLHRMITDIQMGS---PYTTHLRELEEAPC  402



>ref|XP_006284650.1| hypothetical protein CARUB_v10005907mg [Capsella rubella]
 gb|EOA17548.1| hypothetical protein CARUB_v10005907mg [Capsella rubella]
Length=165

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRR +SNRESARRSRMRK+R +DELWSQV+  R EN  LL +LN++ E H+K +
Sbjct  68   MINERKQRRKLSNRESARRSRMRKQRQVDELWSQVMWLRNENHQLLHKLNRVLESHEKAI  127

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
             ENA+LKEE S L+ ++ ++       PFS  RD EDI
Sbjct  128  EENAQLKEETSELKHMISDMTQLQNQSPFSCFRD-EDI  164



>ref|XP_010453732.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=184

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  LL++LN++S+ +D V+
Sbjct  70   VINERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLEKLNKVSDSNDHVI  129

Query  376  LENARLKEEASGLRRLVVELRDGGAD  299
             EN  LKEE S LR+++  ++  G D
Sbjct  130  QENLNLKEENSELRQVITSMKKLGGD  155



>ref|XP_010496567.1| PREDICTED: basic leucine zipper 43 [Camelina sativa]
Length=162

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I++ERKQRR VSNRESARRSRMRK+R +D+LWSQVL  R EN  LL +LN++ E H+KV+
Sbjct  67   IVNERKQRRKVSNRESARRSRMRKQRQVDDLWSQVLWLRNENHQLLHKLNRVLESHEKVI  126

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE S L+ ++ +++      PFS  RD
Sbjct  127  EENAQLKEETSELKHVISDMQ-LQIQSPFSCFRD  159



>ref|XP_006288751.1| hypothetical protein CARUB_v10002068mg [Capsella rubella]
 gb|EOA21649.1| hypothetical protein CARUB_v10002068mg [Capsella rubella]
Length=183

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  LLD+LNQ+S+ +D V+
Sbjct  70   VINERKQRRMVSNRESARRSRMRKQRHLDELMSQVAWLRSENHQLLDKLNQVSDSNDHVM  129

Query  376  LENARLKEEASGLRRLVVELRDGGA  302
             EN  LKEE   LR+++  ++  G 
Sbjct  130  QENLNLKEENLELRQVITSMKKLGG  154



>ref|XP_009126070.1| PREDICTED: G-box-binding factor 3-like [Brassica rapa]
 emb|CDX85530.1| BnaA02g02830D [Brassica napus]
Length=188

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I++RKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  LLD+LNQ S+ +D VL
Sbjct  70   VINDRKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENQQLLDKLNQASDSNDLVL  129

Query  376  LENARLKEEASGLRRLVVELRDGGA  302
             EN RLKEE   LR+++  ++  G 
Sbjct  130  QENLRLKEENVELRQVITSMKKLGG  154



>ref|XP_010420260.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=182

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R++N  LL++LNQ+S+ +D V+
Sbjct  69   VINERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSKNHQLLEKLNQVSDSNDHVI  128

Query  376  LENARLKEEASGLRRLVVELRDGGAD  299
             EN  LKEE S LR+ +  ++  G D
Sbjct  129  QENLNLKEENSELRQGITSMKKLGGD  154



>emb|CDX90970.1| BnaC02g06270D [Brassica napus]
Length=194

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I++RKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  LLD+LNQ S+ +D V+
Sbjct  70   VINDRKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENQQLLDKLNQASDSNDLVI  129

Query  376  LENARLKEEASGLRRLVVELRDGGA  302
             EN RLKEE   LR+++  ++  G 
Sbjct  130  QENLRLKEENVELRQVITSMKKLGG  154



>gb|KFK36518.1| hypothetical protein AALP_AA4G134500 [Arabis alpina]
Length=163

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  I+++RKQR+ +SNRESARRSRMRK+R LDELWSQV+  R EN  LL +LN++ E  +
Sbjct  65   QEDIVNDRKQRKKISNRESARRSRMRKQRQLDELWSQVMWLRNENHQLLHKLNRVLESQE  124

Query  385  KVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
            KV+ ENA+LKEEA  L++++ +++      PFS  RD
Sbjct  125  KVVEENAQLKEEAVELKQMISDMQLQN-QSPFSCFRD  160



>ref|XP_006844140.1| hypothetical protein AMTR_s00006p00259200 [Amborella trichopoda]
 gb|ERN05815.1| hypothetical protein AMTR_s00006p00259200 [Amborella trichopoda]
Length=197

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 70/105 (67%), Gaps = 14/105 (13%)
 Frame = -1

Query  529  MVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLENARLKEE  350
            M+SNRESARRSRMRK+RHLDELW+ VL  R+EN  L+++LN  SEHH+KV++EN  L+ E
Sbjct  69   MLSNRESARRSRMRKQRHLDELWTTVLRLRSENRQLIEKLNVTSEHHEKVMIENESLRAE  128

Query  349  ASGLRRLVVELRDGGAD--------------DPFSDLRDLEDIKC  257
             + LRR++  +R+ G +                FS LRD E++ C
Sbjct  129  VTDLRRMLENMREKGGECVQQPGVGVVPLPLSAFSLLRDFEEVSC  173



>gb|AAO22653.1| putative bZIP family transcription factor [Arabidopsis thaliana]
Length=152

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQ+R +SNRESARRSRMRK+R +DELWSQV+  R EN  LL +LN + E  +KV+
Sbjct  55   IINERKQKRKISNRESARRSRMRKQRQVDELWSQVMWLRDENHQLLRKLNCVLESQEKVI  114

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
             EN +LKEE + L++++ +++      PFS +RD +D+
Sbjct  115  EENVQLKEETTELKQMISDMQLQNQ-SPFSCIRDDDDV  151



>ref|NP_198696.1| basic leucine-zipper 43 [Arabidopsis thaliana]
 sp|Q9FMC2.1|BZP43_ARATH RecName: Full=Basic leucine zipper 43; Short=AtbZIP43; Short=bZIP 
protein 43 [Arabidopsis thaliana]
 dbj|BAB08636.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94361.1| basic leucine-zipper 43 [Arabidopsis thaliana]
Length=165

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQ+R +SNRESARRSRMRK+R +DELWSQV+  R EN  LL +LN + E  +KV+
Sbjct  68   IINERKQKRKISNRESARRSRMRKQRQVDELWSQVMWLRDENHQLLRKLNCVLESQEKVI  127

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
             EN +LKEE + L++++ +++      PFS +RD +D+
Sbjct  128  EENVQLKEETTELKQMISDMQLQNQ-SPFSCIRDDDDV  164



>ref|XP_002868752.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45011.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=162

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I +ERKQ+R +SNRESARRSRMRK+R  DELWSQV+  R EN  LL +LN + E  +KV+
Sbjct  67   IFNERKQKRKISNRESARRSRMRKQRQADELWSQVMWLRNENHQLLRKLNCVLESQEKVI  126

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE S L+ L+ +++      PFS +RD
Sbjct  127  EENAQLKEETSELKHLISDMQLQN-QSPFSGIRD  159



>ref|XP_006400109.1| hypothetical protein EUTSA_v10015835mg [Eutrema salsugineum]
 dbj|BAJ33807.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41562.1| hypothetical protein EUTSA_v10015835mg [Eutrema salsugineum]
Length=190

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  LLD+LNQ S+ +D VL
Sbjct  67   IINERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQASDSNDLVL  126

Query  376  LENARLKEEASGLRRLVV---ELRDGGA  302
             EN  LKEE   LR+++    +LR  G 
Sbjct  127  RENLILKEENLELRQVITSMKKLRGAGG  154



>ref|XP_006405699.1| hypothetical protein EUTSA_v10028235mg [Eutrema salsugineum]
 gb|ESQ47152.1| hypothetical protein EUTSA_v10028235mg [Eutrema salsugineum]
Length=162

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  II+E+KQR+ +SNRESARRSRMRK+R LDELWSQV+  R EN  LL + N++ E  +
Sbjct  64   QRDIINEKKQRKKLSNRESARRSRMRKQRQLDELWSQVMWLRNENHQLLHKFNRLLESRE  123

Query  385  KVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
            KV+ ENA+LKEE   L++++ +++      PFS LRD
Sbjct  124  KVIEENAQLKEETFTLKQMISDMQLQN-QSPFSCLRD  159



>ref|XP_009151747.1| PREDICTED: ocs element-binding factor 1-like [Brassica rapa]
Length=172

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 3/94 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            II+ERKQRRM+SNRESARRSRMRK+R LDELWSQV+  R EN  LLD+LN +SE H+KVL
Sbjct  76   IINERKQRRMISNRESARRSRMRKQRRLDELWSQVMWLRIENHQLLDKLNNLSESHEKVL  135

Query  376  LENARLKEEASGLRRLVVELRDGGADDPFSDLRD  275
             ENA+LKEE S L++++ +++      PFS  RD
Sbjct  136  QENAQLKEETSELKQVISDMQ---IQSPFSCFRD  166



>ref|XP_010435789.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=163

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I++ERKQRR +SNRESARRSRMRK+R +DELWSQV+  R EN  LL +LN++ E H+KV+
Sbjct  67   IVNERKQRRKLSNRESARRSRMRKQRQVDELWSQVMWLRNENHQLLHKLNRVLESHEKVI  126

Query  376  LENARLKEEASGLRRLVVELR  314
             ENA+LKEE S L+ ++ +++
Sbjct  127  EENAQLKEETSELKHVISDMQ  147



>emb|CDX70656.1| BnaC03g07400D [Brassica napus]
Length=190

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  +L++LNQ S+ +D VL
Sbjct  71   VISERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQILEKLNQASDSNDLVL  130

Query  376  LENARLKEEASGLRRLVVELR--DGGA  302
             EN  LKEE   L++++  ++  +GG+
Sbjct  131  QENLSLKEENLELQQVITSMKKLEGGS  157



>emb|CDY26467.1| BnaC09g42010D [Brassica napus]
Length=183

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 4/89 (4%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  LL++LNQ S  +D VL
Sbjct  68   VINERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENQQLLEKLNQASNSNDLVL  127

Query  376  LENARLKEEASGLRRLVVELRD----GGA  302
             EN+ LKE+   L +++  ++     GG+
Sbjct  128  QENSSLKEKNLALHQVITSMKKVIGAGGS  156



>ref|XP_009131503.1| PREDICTED: ocs element-binding factor 1-like [Brassica rapa]
 emb|CDX78655.1| BnaA03g05670D [Brassica napus]
Length=193

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  +L +LN+ ++ +D VL
Sbjct  71   VISERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQILGKLNKATDSNDLVL  130

Query  376  LENARLKEEASGLRRLVVELRD-GGAD  299
             EN  LKEE   LR+++  ++  GGA+
Sbjct  131  QENLILKEENLELRQVITSMKKLGGAE  157



>ref|XP_008804405.1| PREDICTED: basic leucine zipper 63-like [Phoenix dactylifera]
Length=197

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 70/98 (71%), Gaps = 3/98 (3%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  + +ER++RRM+SNRESARRSRMRK++HL ELWSQV+  R  N +LLD LN++   HD
Sbjct  77   QQSLAEERRKRRMISNRESARRSRMRKQKHLSELWSQVIHLRAANRHLLDELNRVMTDHD  136

Query  385  KVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDL  272
            ++L +NA+L++E S L + + ELR    DD    LR L
Sbjct  137  QILHKNAQLRDEESELTKKLEELR---VDDTNGALRGL  171



>emb|CDX70639.1| BnaC03g07230D [Brassica napus]
Length=192

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  +L +LN+ ++ +D VL
Sbjct  70   VISERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQILGKLNKATDSNDLVL  129

Query  376  LENARLKEEASGLRRLVVELRD-GGAD  299
             EN  LKEE   LR+++  ++  GGA+
Sbjct  130  QENLILKEENLELRQVITSMKKLGGAE  156



>ref|XP_009121541.1| PREDICTED: ocs element-binding factor 1 [Brassica rapa]
Length=183

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  LL++LNQ S  +D VL
Sbjct  68   VINERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLEKLNQASNSNDLVL  127

Query  376  LENARLKEEASGLRRLVVELR  314
             EN  LKE+   L +++  ++
Sbjct  128  QENLSLKEKNLALHQVITSMK  148



>emb|CDX69495.1| BnaA10g18440D [Brassica napus]
Length=183

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +I+ERKQRRMVSNRESARRSRMRK+RHLDEL SQV   R+EN  LL++LNQ S  +D VL
Sbjct  68   VINERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLEKLNQASNSNDLVL  127

Query  376  LENARLKEEASGLRRLVVELR  314
             EN  LKE+   L +++  ++
Sbjct  128  QENLSLKEKNLALHQVITSMK  148



>ref|XP_008807020.1| PREDICTED: ocs element-binding factor 1-like [Phoenix dactylifera]
Length=170

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  + +ER++RRM+SNRESARRSR+RK++HL ELWSQV+  RT N  LLD+LN +    D
Sbjct  77   QPSLAEERRKRRMLSNRESARRSRIRKQKHLSELWSQVVRLRTANRQLLDQLNHVMRGRD  136

Query  385  KVLLENARLKEEASGLRRLVVEL  317
            ++L ENA+L++E S LR+ + +L
Sbjct  137  QILYENAQLRDEESELRKKLEDL  159



>ref|XP_010942236.1| PREDICTED: basic leucine zipper 43-like [Elaeis guineensis]
Length=155

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  ++ ER++RRM+SNRESARRSRMRK+RHLDEL SQV+  R  N  L+D +NQ+ E  D
Sbjct  57   QASLVHERRKRRMISNRESARRSRMRKQRHLDELRSQVVYLRATNRRLIDEINQVMEERD  116

Query  385  KVLLENARLKEEASGLRR  332
            ++L EN+ L+EEAS L++
Sbjct  117  RILQENSWLREEASDLQK  134



>ref|XP_010943359.1| PREDICTED: basic leucine zipper 43 [Elaeis guineensis]
Length=197

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q R+ +ER++RRM+SNRESARRSRMRK++HL EL SQV+  R  N  LLD LN++   +D
Sbjct  77   QLRLAEERRKRRMISNRESARRSRMRKQKHLRELLSQVMHLRAANRQLLDELNRVMRDYD  136

Query  385  KVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLED  266
            ++L ENA+L++E S LR+   +L+D   DD    L+ LE+
Sbjct  137  QILHENAQLRDEESELRK---KLQDLLVDDTNGALQGLEE  173



>ref|XP_008783104.1| PREDICTED: ocs element-binding factor 1-like [Phoenix dactylifera]
Length=122

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = -1

Query  565  QHRIIDE-RKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            Q  ++DE R++RRMVSN+ESARRSRMRK+RHL ELWSQV+  R  N  L D LN + E  
Sbjct  27   QPSLVDEMRRRRRMVSNKESARRSRMRKQRHLHELWSQVVYLRATNRRLADELNHVMEER  86

Query  388  DKVLLENARLKEEASGLRR  332
            D++L EN+ L +EAS LR+
Sbjct  87   DRILYENSWLGQEASDLRK  105



>ref|XP_010929454.1| PREDICTED: basic leucine zipper 43-like [Elaeis guineensis]
Length=123

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++DER  RR +SNRESARRSRMRK+RHL ELWSQV+  R  N  L+D LN + E  D++L
Sbjct  30   LVDER--RRRISNRESARRSRMRKQRHLGELWSQVVHLRATNRRLVDELNHVVEERDRIL  87

Query  376  LENARLKEEASGLR  335
             ENA L++EAS LR
Sbjct  88   YENAWLRQEASDLR  101



>gb|AFW73238.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|AIB04757.1| bZIP transcription factor, partial [Zea mays]
Length=176

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 67/97 (69%), Gaps = 4/97 (4%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  + +ER++RRMVSNRESARRSRMRK++ L ELW+QV+  R+ N  LLD+LN      D
Sbjct  80   QRSVAEERRKRRMVSNRESARRSRMRKQKQLSELWAQVVHLRSTNRQLLDQLNHAIRDCD  139

Query  385  KVLLENARLKEEASGLRR----LVVELRDGGADDPFS  287
            +VL EN++L++E + L++    L V+  + GA  P S
Sbjct  140  RVLRENSQLRDEQTKLQQQLEMLPVDTTESGAMSPGS  176



>ref|XP_004953778.1| PREDICTED: ocs element-binding factor 1-like [Setaria italica]
Length=169

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 68/97 (70%), Gaps = 4/97 (4%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  + +ER++RRM+SNRESARRSRMRK++ L ELWSQV+  R+ N  LLD+LN +    D
Sbjct  73   QRSLAEERRKRRMISNRESARRSRMRKQKQLSELWSQVVHLRSTNRQLLDQLNHVIRDCD  132

Query  385  KVLLENARLKEEASGLR----RLVVELRDGGADDPFS  287
            +VL EN++L++E + L+    +L VE  + G  +P S
Sbjct  133  RVLHENSQLRDEQTKLQKQLEKLPVETPESGVMNPDS  169



>ref|XP_009391277.1| PREDICTED: basic leucine zipper 63 [Musa acuminata subsp. malaccensis]
Length=157

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            + +ER+QRRM+SNRESARRSRMRK++HL ELWSQV+  ++ N  LLD LN++    D++ 
Sbjct  73   LAEERRQRRMISNRESARRSRMRKQKHLSELWSQVIHLQSANRQLLDELNRVMRERDQIA  132

Query  376  LENARLKEEASGLRR  332
            LEN RL+ E S L++
Sbjct  133  LENDRLRHEESELQK  147



>ref|XP_008646194.1| PREDICTED: uncharacterized protein LOC103627679 [Zea mays]
Length=260

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 67/97 (69%), Gaps = 4/97 (4%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  + +ER++RRMVSNRESARRSRMRK++ L ELW+QV+  R+ N  LLD+LN      D
Sbjct  164  QRSVAEERRKRRMVSNRESARRSRMRKQKQLSELWAQVVHLRSTNRQLLDQLNHAIRDCD  223

Query  385  KVLLENARLKEEASGLRR----LVVELRDGGADDPFS  287
            +VL EN++L++E + L++    L V+  + GA  P S
Sbjct  224  RVLRENSQLRDEQTKLQQQLEMLPVDTTESGAMSPGS  260



>ref|NP_177054.1| basic leucine-zipper 8 [Arabidopsis thaliana]
 gb|AAG52032.1|AC011914_2 putative bZIP transcription factor; 2580-2996 [Arabidopsis thaliana]
 gb|AAK94025.1|AF400621_1 transcription factor-like protein bZIP8 [Arabidopsis thaliana]
 gb|ABD60700.1| At1g68880 [Arabidopsis thaliana]
 dbj|BAH30366.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34854.1| basic leucine-zipper 8 [Arabidopsis thaliana]
Length=138

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -1

Query  550  DERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLE  371
            +ERK+RR VSNRESARRSRMRK+RH++ELWS ++    +N +L+D L+Q  E ++KV+ E
Sbjct  45   NERKRRRKVSNRESARRSRMRKQRHMEELWSMLVQLINKNKSLVDELSQARECYEKVIEE  104

Query  370  NARLKEEASGLRRLVVEL  317
            N +L+EE S  R+++ E+
Sbjct  105  NMKLREENSKSRKMIGEI  122



>ref|XP_003570460.1| PREDICTED: basic leucine zipper 43-like [Brachypodium distachyon]
Length=170

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            QH + +ER++RRM+SNRESARRSRMRK++ L ELW+QV+  R+ N  LLD+LN +    D
Sbjct  73   QHSLAEERRKRRMLSNRESARRSRMRKQKQLSELWAQVVHLRSTNRQLLDQLNHVIRDCD  132

Query  385  KVLLENARLKEEASGLRRLVVEL  317
            ++L +N++L+ E + L++ + +L
Sbjct  133  RILHDNSKLRAEQAELKQQLEKL  155



>ref|XP_002888689.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH64948.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=130

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -1

Query  550  DERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLE  371
            DERK+RR VSNRESARRSRMRK+RH+DELWS ++    +N  L+D L++  E ++KV+ E
Sbjct  45   DERKRRRKVSNRESARRSRMRKQRHMDELWSMLVQLINKNKCLVDELSRAREGYEKVIEE  104

Query  370  NARLKEEASGLRRLVVEL  317
            N +L+EE S  R  + E+
Sbjct  105  NMKLREENSKSRETIGEI  122



>ref|XP_002454348.1| hypothetical protein SORBIDRAFT_04g029210 [Sorghum bicolor]
 gb|EES07324.1| hypothetical protein SORBIDRAFT_04g029210 [Sorghum bicolor]
Length=169

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  + +ER++RRM+SNRESARRSRMRK++ L ELW+QV+  R+ N  LLD+LN +    D
Sbjct  73   QRSLAEERRKRRMISNRESARRSRMRKQKQLSELWAQVVHLRSTNRQLLDQLNHVIRDCD  132

Query  385  KVLLENARLKEEASGLR----RLVVELRDGGADDPFS  287
            +V  EN++L++E + L+    +L +E  + G   P S
Sbjct  133  RVQHENSQLRDEQTKLQQQLEKLPLETTESGVMSPDS  169



>ref|NP_001150379.1| G-box-binding factor 1 [Zea mays]
 gb|ACG38857.1| G-box-binding factor 1 [Zea mays]
Length=176

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  + +ER++RRMVSNRESARRSR+RK++ L ELW+QV+  R  N   LD+LN++    D
Sbjct  78   QRSLAEERRKRRMVSNRESARRSRVRKQKQLSELWAQVVHLRGTNRQHLDQLNRVIRDCD  137

Query  385  KVLLENARLKEEASGLRRLVVEL  317
            +VLLEN+RL++E + L++ + EL
Sbjct  138  RVLLENSRLRDERTRLQQQLEEL  160



>ref|XP_009417568.1| PREDICTED: ocs element-binding factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=162

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            + +ER++RRM+SNRESARRSRMRK++H  ELW+QV+  R+ N  LLD LN++    D+++
Sbjct  69   VAEERRKRRMISNRESARRSRMRKQKHFSELWTQVVHLRSANRQLLDELNRVMRERDRIM  128

Query  376  LENARLKEEASGLRR  332
             EN +L+ E + LR+
Sbjct  129  HENDQLRHEETELRK  143



>ref|XP_006840454.1| hypothetical protein AMTR_s00045p00175090 [Amborella trichopoda]
 gb|ERN02129.1| hypothetical protein AMTR_s00045p00175090 [Amborella trichopoda]
Length=152

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            + H+I+D+RKQ+RM+SNRESARRSRMRK++HLD+L +Q+   R EN  +L R++  ++H+
Sbjct  23   EDHQIVDKRKQKRMLSNRESARRSRMRKQKHLDDLINQMAHIRNENSQILTRVDLTTQHY  82

Query  388  DKVLLENARLKEEASGL  338
             K+  EN  L++E   L
Sbjct  83   IKIETENHALRDEVLAL  99



>ref|XP_010927984.1| PREDICTED: basic leucine zipper 43-like [Elaeis guineensis]
Length=170

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  + +ER++RRM+SNRESARRSR+RK++HL+EL  QV   RT N  LLD+LN +    D
Sbjct  77   QPSLAEERRKRRMLSNRESARRSRIRKQKHLNELSLQVFHLRTANRQLLDQLNHVMRDRD  136

Query  385  KVLLENARLKEEASGLRR  332
            ++L ENA+L++E S LR+
Sbjct  137  QILHENAQLRDEESELRK  154



>ref|XP_009407232.1| PREDICTED: G-box-binding factor 3-like [Musa acuminata subsp. 
malaccensis]
Length=175

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 64/89 (72%), Gaps = 3/89 (3%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            + +ER++RRM+SNRESARRSRMRK+  L ELWS V+  R+ N  LLD LN++   HD++L
Sbjct  79   LAEERRKRRMISNRESARRSRMRKQNQLSELWSLVVHLRSTNQKLLDDLNRVIREHDQLL  138

Query  376  LENARLKEEASGLRRLVVELRDGGADDPF  290
             ENA+L++E + L+    +L++  A+D  
Sbjct  139  HENAQLRDEETKLQN---KLKNIQAEDKL  164



>ref|XP_007042116.1| Basic leucine-zipper 44 [Theobroma cacao]
 gb|EOX97947.1| Basic leucine-zipper 44 [Theobroma cacao]
Length=161

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++DERK++RM+SNRESARRSRMRK++HLD+L +QV   R EN  ++ R+N +++H+  V 
Sbjct  27   LMDERKRKRMISNRESARRSRMRKQKHLDDLMAQVTQLRKENHQIITRINIITQHYLNVE  86

Query  376  LENARLKEEASGL  338
             EN+ LK +A+ L
Sbjct  87   AENSVLKAQANEL  99



>ref|XP_010106904.1| Ocs element-binding factor 1 [Morus notabilis]
 gb|EXC12620.1| Ocs element-binding factor 1 [Morus notabilis]
Length=202

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++DERK+RRM+SNRESARRSRMRK++HL+ L +QV   R EN  L +RL  +S H  +V 
Sbjct  99   VVDERKRRRMLSNRESARRSRMRKQKHLENLRNQVNRLRVENRELTNRLRYVSYHVHRVS  158

Query  376  LENARLKEEASGLRRLVVELR  314
             +NARL+ E + LR+ + ++R
Sbjct  159  TDNARLRAEQTVLRQKLYDIR  179



>gb|AEW08358.1| hypothetical protein 2_6996_01, partial [Pinus radiata]
 gb|AFG61314.1| hypothetical protein 2_6996_01, partial [Pinus taeda]
 gb|AFG61315.1| hypothetical protein 2_6996_01, partial [Pinus taeda]
 gb|AFG61316.1| hypothetical protein 2_6996_01, partial [Pinus taeda]
 gb|AFG61317.1| hypothetical protein 2_6996_01, partial [Pinus taeda]
 gb|AFG61318.1| hypothetical protein 2_6996_01, partial [Pinus taeda]
 gb|AFG61319.1| hypothetical protein 2_6996_01, partial [Pinus taeda]
Length=133

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -1

Query  568  QQHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHH  389
            QQH IIDER++RRM+SNRESARRSRMRK++HL+EL +QV   R EN  +L   + +S+ +
Sbjct  57   QQHTIIDERRERRMLSNRESARRSRMRKQKHLEELRAQVAHMRAENRQILSSFDILSQRY  116

Query  388  DKVLLENARLK  356
             ++L EN  LK
Sbjct  117  SQILEENRVLK  127



>ref|XP_009400114.1| PREDICTED: uncharacterized protein LOC103984352 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  550  DERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLE  371
            +ER++RRM+SNRESARRSRMRK++ L ELWSQV+  R+ NC+LLD LN++     ++  E
Sbjct  204  EERRKRRMISNRESARRSRMRKQKRLSELWSQVIQLRSANCHLLDELNRVRRERVQITHE  263

Query  370  NARLKEEASGLRR  332
            N RL+ E + L +
Sbjct  264  NDRLRVEETELHK  276



>ref|XP_008445746.1| PREDICTED: ocs element-binding factor 1-like [Cucumis melo]
Length=179

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 3/80 (4%)
 Frame = -1

Query  550  DERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLE  371
            DERKQRRM+SNRESARRSRMRK++H+ EL SQ+L   T+   L ++L  + E   ++L E
Sbjct  92   DERKQRRMISNRESARRSRMRKQKHVKELCSQLLRLCTQKHELEEKLRVLMESQQRLLQE  151

Query  370  NARLKEEASGLRRLVVELRD  311
            NA LK++AS  R++   LRD
Sbjct  152  NANLKQQASAFRQI---LRD  168



>ref|XP_001766270.1| predicted protein [Physcomitrella patens]
 gb|EDQ68902.1| predicted protein [Physcomitrella patens]
Length=81

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++DER+Q+RM+SNRESARRSR+RK++HLDEL SQ+   R EN ++L+R +  S+ + ++ 
Sbjct  1    VVDERRQKRMISNRESARRSRLRKQQHLDELRSQIAQLRAENTHMLNRFSLASQQYAQLT  60

Query  376  LENARLKEEASGLR  335
             EN  L+  A+ +R
Sbjct  61   EENCVLRSNATDMR  74



>ref|XP_010441010.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=162

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I++ERKQRR VSNRES RRSRMRK+R +DELWSQV+  R EN  LL +LN++ E H+ V+
Sbjct  67   IVNERKQRRKVSNRESERRSRMRKQRQVDELWSQVMWLRNENHQLLHKLNRVLESHEMVI  126

Query  376  LENARLKEEASGLRRLVVELR  314
             ENA+LKEE S L+ ++ +++
Sbjct  127  EENAQLKEETSELKHVISDMQ  147



>ref|XP_001773106.1| predicted protein [Physcomitrella patens]
 gb|EDQ62146.1| predicted protein [Physcomitrella patens]
Length=92

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 7/81 (9%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +IDER+Q+RM+SNRESARRSR+RK++HLDEL SQ+   R EN +LL+R +  S+ +    
Sbjct  12   VIDERRQKRMISNRESARRSRLRKQQHLDELRSQISHLRAENVHLLNRYSLASQQY----  67

Query  376  LENARLKEEASGLRRLVVELR  314
               A+L EE S LR   V+LR
Sbjct  68   ---AQLNEENSVLRSNAVDLR  85



>ref|XP_008679087.1| PREDICTED: LOW QUALITY PROTEIN: basic leucine zipper 63-like 
[Zea mays]
Length=180

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 66/98 (67%), Gaps = 7/98 (7%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDR--LNQMSEH  392
            Q  + +ER++RRMVSNRESARRSR+RK++ L ELW+QV+  R  N  LLD+  LN++   
Sbjct  80   QRSLAEERRKRRMVSNRESARRSRVRKQKQLSELWAQVVHLRGTNRQLLDQQVLNRVIRD  139

Query  391  HDKVLLENARLKEEASGLRRLVVEL-----RDGGADDP  293
             D++L EN+RL++E + L++ + EL       GG   P
Sbjct  140  CDRILRENSRLRDERTRLQQQLEELPAEAAESGGMSPP  177



>gb|ADL36616.1| BZIP domain class transcription factor [Malus domestica]
 gb|ADL36617.1| BZIP domain class transcription factor [Malus domestica]
Length=156

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -1

Query  562  HRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDK  383
            H ++D+RK++RM SNRESARRSRMRK++HLD+L +QV   R EN  +L  +N  ++HH  
Sbjct  24   HHLVDQRKRKRMQSNRESARRSRMRKQQHLDDLTAQVAQLRKENNQILTSINITTQHHMN  83

Query  382  VLLENARLKEEASGL  338
            V  EN+ LK + + L
Sbjct  84   VESENSVLKAQMAEL  98



>ref|NP_001233865.1| bZIP transcription factor [Solanum lycopersicum]
 gb|ACN43325.1| bZIP transcription factor [Solanum lycopersicum]
Length=163

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -1

Query  562  HRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDK  383
             +++D+RK++RM+SNRESARRSRMRK++HLD+L SQV   R EN  +L  +N  ++H+  
Sbjct  24   QQLMDQRKRKRMISNRESARRSRMRKQKHLDDLMSQVTNLRKENNQILTSMNVTTQHYLN  83

Query  382  VLLENARLKEEASGLRR  332
            V  EN+ L+ + S L R
Sbjct  84   VEAENSILRAQLSELSR  100



>ref|XP_010039111.1| PREDICTED: basic leucine zipper 43-like [Eucalyptus grandis]
Length=216

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 64/99 (65%), Gaps = 8/99 (8%)
 Frame = -1

Query  553  IDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLL  374
            I ER+ RRM+SNRESARRSR+RKK+ ++EL  QV   R  N NL ++L  + E + ++L 
Sbjct  114  IHERRLRRMISNRESARRSRLRKKKQIEELQMQVNQLRGANNNLSEKLIGLLESNQQILQ  173

Query  373  ENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            EN +LKE+ S L+ +V +L         +  R++E++ C
Sbjct  174  ENVQLKEKVSSLQVIVSDL--------LAPFRNVEEVAC  204



>ref|XP_010546230.1| PREDICTED: basic leucine zipper 43-like [Tarenaya hassleriana]
Length=184

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 64/103 (62%), Gaps = 8/103 (8%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  I+DE++ RRMVSNRESARRSRMRKK+ ++EL  QV      N +L +++  + E + 
Sbjct  68   QQSIVDEKRARRMVSNRESARRSRMRKKKQIEELQLQVEQLVMWNHHLSEKVISLLESNH  127

Query  385  KVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            ++L ENA+LKE+ S    L  ++           +R+LEDI C
Sbjct  128  QILQENAQLKEKVSSFHILTADM--------LPPVRNLEDINC  162



>ref|XP_008650521.1| PREDICTED: uncharacterized protein LOC103631376 [Zea mays]
 gb|AFW76975.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|AIB05754.1| bZIP transcription factor, partial [Zea mays]
Length=198

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 59/81 (73%), Gaps = 2/81 (2%)
 Frame = -1

Query  526  VSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLENARLKEEA  347
             SNRESARRSR+RK++ L +LW QV+  R ++ +LLDRLN+     D+V+ +NARL+ E 
Sbjct  118  ASNRESARRSRVRKQKQLGQLWDQVVHLRGDSRDLLDRLNRAIRDCDRVMRDNARLRNER  177

Query  346  SGLRRLVVEL-RDGGADD-PF  290
            +GL+R +++L  DG  DD PF
Sbjct  178  AGLQRRLLDLITDGDGDDRPF  198



>gb|KCW49021.1| hypothetical protein EUGRSUZ_K02632 [Eucalyptus grandis]
Length=146

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (64%), Gaps = 8/99 (8%)
 Frame = -1

Query  553  IDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLL  374
            I ER+ RRM+SNRESARRSR+RKK+ ++EL  QV   R  N NL ++L  + E + ++L 
Sbjct  44   IHERRLRRMISNRESARRSRLRKKKQIEELQMQVNQLRGANNNLSEKLIGLLESNQQILQ  103

Query  373  ENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDIKC  257
            EN +LKE+ S L+ +V         D  +  R++E++ C
Sbjct  104  ENVQLKEKVSSLQVIV--------SDLLAPFRNVEEVAC  134



>ref|XP_006362037.1| PREDICTED: ocs element-binding factor 1-like [Solanum tuberosum]
Length=166

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -1

Query  562  HRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDK  383
             +++D+RK++RM+SNRESARRSRMRK++HLD+L  QV   R EN  +L  +N  ++H+  
Sbjct  24   QQLMDQRKRKRMISNRESARRSRMRKQKHLDDLMGQVTNLRKENNQILTSMNVTTQHYLN  83

Query  382  VLLENARLKEEASGLRR  332
            V  EN+ L+ + S L R
Sbjct  84   VEAENSILRAQLSELSR  100



>ref|XP_010671337.1| PREDICTED: ocs element-binding factor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=173

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q +I+DERK++RM+SNRESARRSRMRK++HLD+L  QV   R  N  LL+ +N  S+ + 
Sbjct  26   QMQIMDERKRKRMLSNRESARRSRMRKQKHLDDLMVQVSNVRKTNHQLLNSINITSQQYV  85

Query  385  KVLLENARLKEEASGL  338
            K+  EN+ L+ + S L
Sbjct  86   KIEAENSVLRAQMSEL  101



>ref|XP_004291844.1| PREDICTED: ocs element-binding factor 1-like [Fragaria vesca 
subsp. vesca]
Length=171

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            QH  ID+RK++RM SNRESARRSRMRK++HLDEL +QV   R EN  +L  +N  ++H+ 
Sbjct  23   QH-AIDQRKRKRMQSNRESARRSRMRKQQHLDELTAQVAQLRKENGQILTSINITTQHYM  81

Query  385  KVLLENARLKEEASGL  338
             V  EN+ LK + + L
Sbjct  82   NVEAENSVLKAQMAEL  97



>ref|XP_010914566.1| PREDICTED: LOW QUALITY PROTEIN: ocs element-binding factor 1-like 
[Elaeis guineensis]
Length=144

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 7/82 (9%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            I+DERK++RM+SNRESARRSRMRK++HLD+L SQV   + EN  +L ++N  +E +    
Sbjct  19   IVDERKRKRMLSNRESARRSRMRKQQHLDDLLSQVAQLKEENGQILMQVNLFTEQY----  74

Query  376  LENARLKEEASGLRRLVVELRD  311
                RL+ E + LR  V+EL D
Sbjct  75   ---VRLESENTVLRTQVMELTD  93



>ref|XP_006466428.1| PREDICTED: ocs element-binding factor 1-like [Citrus sinensis]
 gb|KDO78870.1| hypothetical protein CISIN_1g029952mg [Citrus sinensis]
Length=185

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +IDERK+RRM+SNRESARRSRMRK++HL+ L +Q+   R EN  L +RL     H  +V 
Sbjct  74   VIDERKRRRMISNRESARRSRMRKQKHLENLRNQLNRLRMENRELSNRLRFALHHCQRVR  133

Query  376  LENARLKEEASGLRRLVVELR  314
             +N RL+ E + LRR + E+R
Sbjct  134  TDNDRLRSEHTILRRRLSEIR  154



>ref|XP_006426133.1| hypothetical protein CICLE_v10027584mg [Citrus clementina]
 gb|ESR39373.1| hypothetical protein CICLE_v10027584mg [Citrus clementina]
Length=185

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +IDERK+RRM+SNRESARRSRMRK++HL+ L +Q+   R EN  L +RL     H  +V 
Sbjct  74   VIDERKRRRMISNRESARRSRMRKQKHLENLRNQLNRLRMENRELSNRLRFALHHCQRVR  133

Query  376  LENARLKEEASGLRRLVVELR  314
             +N RL+ E + LRR + E+R
Sbjct  134  TDNDRLRSEHTILRRRLSEIR  154



>ref|XP_010254730.1| PREDICTED: ocs element-binding factor 1-like [Nelumbo nucifera]
Length=153

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -1

Query  562  HRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDK  383
             ++ID+RKQ+RM+SNRESARRSRMRK++HLD+L +QV   R EN  +L  +N  ++H+  
Sbjct  24   QQVIDQRKQKRMLSNRESARRSRMRKQKHLDDLMAQVAHLRKENNQILTSINITTQHYLT  83

Query  382  VLLENARLKEEASGL  338
            +  EN+ L+ +   L
Sbjct  84   IEAENSVLRAQMEEL  98



>ref|XP_006341974.1| PREDICTED: ocs element-binding factor 1-like [Solanum tuberosum]
Length=150

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++DERK++RM SNRESARRSRMRK++HLD+L  QV   + EN N+L  +N  ++ +  V 
Sbjct  23   VVDERKRKRMQSNRESARRSRMRKQKHLDDLMCQVTQLKKENSNILSSINMTTQQYGNVE  82

Query  376  LENARLKEE  350
             EN+ L+ +
Sbjct  83   AENSVLRAQ  91



>ref|XP_008797570.1| PREDICTED: ocs element-binding factor 1-like [Phoenix dactylifera]
Length=124

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 62/91 (68%), Gaps = 4/91 (4%)
 Frame = -1

Query  550  DERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLE  371
            DER++RRM+SNRESARRSRMRK+  LDEL SQV+  R  N  L+D +N + E  D++L E
Sbjct  32   DERRRRRMISNRESARRSRMRKQSLLDELRSQVVYLRAMNRRLIDEVNHVLEEQDRILQE  91

Query  370  NARLKEEASGLRR----LVVELRDGGADDPF  290
            NA L+EEAS L++    + VE+       P+
Sbjct  92   NAWLREEASDLQKKLHDMQVEITSAAPRAPY  122



>ref|XP_009802821.1| PREDICTED: ocs element-binding factor 1-like [Nicotiana sylvestris]
 gb|AAK92213.1| bZIP transcription factor BZI-2 [Nicotiana tabacum]
Length=170

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -1

Query  562  HRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDK  383
             +++D+RK++RM+SNRESARRSRMRK++HLD+L +QV   R EN  +L  +N  ++H+  
Sbjct  25   QQLVDQRKRKRMISNRESARRSRMRKQKHLDDLMAQVATLRKENNQILTSMNVTTQHYLN  84

Query  382  VLLENARLKEEASGL  338
            V  EN+ L+ + + L
Sbjct  85   VEAENSILRAQLAEL  99



>ref|XP_006301639.1| hypothetical protein CARUB_v10022082mg [Capsella rubella]
 gb|EOA34537.1| hypothetical protein CARUB_v10022082mg [Capsella rubella]
Length=130

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -1

Query  550  DERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLE  371
            DERK+RR VSNRESARRSRMRK+RH+DELWS ++    EN  L+D LN + E ++KV+ E
Sbjct  46   DERKRRRKVSNRESARRSRMRKRRHMDELWSMLVQLINENKTLVDELNGVREGYEKVIEE  105

Query  370  NARLKEEASGLRRLVVEL  317
            N +L+EE S  R+++ E+
Sbjct  106  NTKLREENSKFRKMIGEI  123



>ref|XP_009623220.1| PREDICTED: ocs element-binding factor 1-like [Nicotiana tomentosiformis]
Length=154

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 7/81 (9%)
 Frame = -1

Query  559  RIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKV  380
            R++D+RK++RM+SNRESARRSRMRK++HLD+L SQ+   R EN  +L  +N  ++H+  V
Sbjct  27   RLMDQRKRKRMISNRESARRSRMRKQKHLDDLMSQLAHHRKENNQILTTMNVTTQHYLNV  86

Query  379  LLENARLKEEASGLRRLVVEL  317
              EN       S LR  VVEL
Sbjct  87   EAEN-------SILRAQVVEL  100



>gb|ABR16645.1| unknown [Picea sitchensis]
Length=173

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 66/112 (59%), Gaps = 9/112 (8%)
 Frame = -1

Query  559  RIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKV  380
            + IDERKQ+RM+SNRESARRSRMRK++HLDEL ++    R EN ++L + N  S  + ++
Sbjct  47   QTIDERKQKRMLSNRESARRSRMRKQQHLDELRAEAAHLRAENNHMLTKFNIASHKYMQL  106

Query  379  LLENARLKEEASG----LRRLVVELRDGGA-----DDPFSDLRDLEDIKCSF  251
              EN+ L+  A+     L+ L + ++  G       D  +   D  DIK  +
Sbjct  107  EEENSLLRSYATDLSLKLQSLTIAMQWAGVLNDMDLDSSTGFMDTTDIKSCY  158



>ref|XP_004289640.1| PREDICTED: ocs element-binding factor 1-like [Fragaria vesca 
subsp. vesca]
Length=159

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++D+RK++RM+SNRESARRSRMRK++HLD+L +Q+   R EN  ++  LN  S+H+  + 
Sbjct  26   LMDQRKRKRMLSNRESARRSRMRKQKHLDDLTAQMAQLRKENHQIVSSLNITSQHYMNIE  85

Query  376  LENARLKEEASGL  338
             EN+ L+ +A+ L
Sbjct  86   AENSVLRAQAAEL  98



>gb|AAN61914.1|AF430372_1 bZIP transcription factor [Capsicum chinense]
Length=170

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++D+RK++RM+SNRESARRSRMRK++HLD+L +QV   R EN  +L  +N  ++H+  V 
Sbjct  26   LMDQRKRKRMISNRESARRSRMRKQKHLDDLMAQVSTLRKENDQILTSMNVTTQHYLNVE  85

Query  376  LENARLKEEASGL  338
             EN+ L+ + S L
Sbjct  86   AENSILRAQLSEL  98



>gb|AAD21199.1| putative bZIP DNA-binding protein [Capsicum chinense]
Length=167

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++D+RK++RM+SNRESARRSRMRK++HLD+L +QV   R EN  +L  +N  ++H+  V 
Sbjct  26   LMDQRKRKRMISNRESARRSRMRKQKHLDDLMAQVSTLRKENDQILTSMNVTTQHYLNVE  85

Query  376  LENARLKEEASGL  338
             EN+ L+ + S L
Sbjct  86   AENSILRAQLSEL  98



>gb|AEO12092.1| putative bZIP-like DNA-binding protein [Capsicum annuum]
Length=170

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++D+RK++RM+SNRESARRSRMRK++HLD+L +QV   R EN  +L  +N  ++H+  V 
Sbjct  26   LMDQRKRKRMISNRESARRSRMRKQKHLDDLMAQVSTLRKENDQILTSMNVTTQHYLNVE  85

Query  376  LENARLKEEASGL  338
             EN+ L+ + S L
Sbjct  86   AENSILRAQLSEL  98



>ref|XP_009339530.1| PREDICTED: transcriptional activator TAF-1, partial [Pyrus x 
bretschneideri]
Length=154

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = -1

Query  547  ERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLEN  368
            ERK +RM+SNRESARRSRMRKK+ ++EL  QV    + N  L D+L Q+ E +  +L EN
Sbjct  70   ERKLKRMISNRESARRSRMRKKKQIEELQYQVDQLHSTNRGLSDKLIQLLEGNQLILQEN  129

Query  367  ARLKEEASGLR----RLVVELRDGG  305
            A+LKE  S L+     L+  LR+ G
Sbjct  130  AQLKERVSSLQIVLADLITPLRNAG  154



>ref|XP_008812527.1| PREDICTED: ocs element-binding factor 1-like [Phoenix dactylifera]
Length=141

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 58/83 (70%), Gaps = 7/83 (8%)
 Frame = -1

Query  559  RIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKV  380
            ++IDERK++RM+SNRESARRSRMRK++HLD+L SQV   + EN  +  ++N ++E +   
Sbjct  17   QLIDERKRKRMLSNRESARRSRMRKQQHLDDLLSQVARLKEENSQISMQVNLLAEQY---  73

Query  379  LLENARLKEEASGLRRLVVELRD  311
                ARL  E + LR  V+EL D
Sbjct  74   ----ARLDSENTVLRTQVMELTD  92



>ref|XP_009335873.1| PREDICTED: ocs element-binding factor 1 [Pyrus x bretschneideri]
Length=157

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -1

Query  562  HRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDK  383
            HR +D+RK++RM SNRESARRSRMRK++HLD+L +QV   R EN  +L  +N  ++H   
Sbjct  24   HRPVDQRKRKRMQSNRESARRSRMRKQQHLDDLMAQVAQLRKENNQILTSINITTQHFMN  83

Query  382  VLLENARLKEEASGL  338
            V  EN+ LK +   L
Sbjct  84   VESENSVLKAQMGEL  98



>ref|XP_009619503.1| PREDICTED: ocs element-binding factor 1-like [Nicotiana tomentosiformis]
Length=171

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++D+RK++RM+SNRESARRSRMRK++HLDEL +QV   R +N  +L  +N  ++H+  V 
Sbjct  27   LMDQRKRKRMISNRESARRSRMRKQKHLDELMAQVTTLRKQNNQILTSMNVTTQHYLNVE  86

Query  376  LENARLKEEASGL  338
             EN+ L+ + + L
Sbjct  87   AENSILRAQLAEL  99



>ref|XP_007047594.1| Basic leucine-zipper 5, putative [Theobroma cacao]
 gb|EOX91751.1| Basic leucine-zipper 5, putative [Theobroma cacao]
Length=186

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            IIDERK+RRM+SNRESARRSRMRK++HL+ L +QV   R EN  L +RL  +  H  +V 
Sbjct  74   IIDERKRRRMISNRESARRSRMRKQKHLENLRNQVNRLRIENRELTNRLRFVLYHCHRVR  133

Query  376  LENARLKEEASGLRRLVVELR  314
             +N RL+ E S L++   ++R
Sbjct  134  TDNDRLRSEYSMLQQKFWDIR  154



>ref|XP_009410287.1| PREDICTED: DNA-binding protein EMBP-1-like [Musa acuminata subsp. 
malaccensis]
Length=206

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -1

Query  550  DERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLE  371
            +ER++RRM+SNRESARRSRMRK + L EL SQV   R+ N  LLD LN+     D+VL E
Sbjct  110  EERRKRRMISNRESARRSRMRKLKQLSELRSQVAHLRSANGRLLDDLNRAMRERDQVLRE  169

Query  370  NARLKEEASGLRRLVVEL  317
            NA+L+++ + L++ + +L
Sbjct  170  NAQLRDKETELQKKLEKL  187



>ref|NP_001281289.1| ocs element-binding factor 1 [Malus domestica]
 gb|ADL36618.1| BZIP domain class transcription factor [Malus domestica]
Length=157

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -1

Query  562  HRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDK  383
            HR +D+RK++RM SNRESARRSRMRK++HLD+L +QV   R EN  +L  +N  ++H   
Sbjct  24   HRPVDQRKRKRMQSNRESARRSRMRKQQHLDDLMAQVAQLRKENNQILTSINITTQHFMN  83

Query  382  VLLENARLKEEASGL  338
            V  EN+ LK +   L
Sbjct  84   VESENSVLKAQMGEL  98



>ref|XP_007037689.1| Basic leucine-zipper 70, putative [Theobroma cacao]
 gb|EOY22190.1| Basic leucine-zipper 70, putative [Theobroma cacao]
Length=199

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 63/101 (62%), Gaps = 8/101 (8%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  I+D+++ RRM+SNRESARRSRMRKK+ ++EL SQV   +T N  L  +L  + E + 
Sbjct  99   QPSIVDDKRLRRMISNRESARRSRMRKKQQIEELQSQVDQLQTINRQLSQKLINLLESNH  158

Query  385  KVLLENARLKEEASGLRRLVVELRDGGADDPFSDLRDLEDI  263
            + L ENA+LKE  S L  ++         D F+  R+LED 
Sbjct  159  ETLQENAQLKERVSTLHMVLA--------DVFTPPRNLEDT  191



>ref|XP_004238299.1| PREDICTED: ocs element-binding factor 1 [Solanum lycopersicum]
Length=147

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++DERK++RM SNRESARRSRMRK++HLD+L  QV   + EN N+L+ +   ++ +  V 
Sbjct  23   VVDERKRKRMQSNRESARRSRMRKQKHLDDLMCQVTQLKKENSNILNSITMTTQQYGNVE  82

Query  376  LENARLKEE  350
             EN+ L+ +
Sbjct  83   AENSVLRAQ  91



>ref|NP_001238344.1| bZIP transcription factor bZIP124 [Glycine max]
 gb|ABI34666.1| bZIP transcription factor bZIP124 [Glycine max]
 gb|ACU20693.1| unknown [Glycine max]
Length=160

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++D+RK++RM+SNRESARRSRMRK++HLD+L SQV   R EN  +L  +N  ++ +  V 
Sbjct  26   VMDQRKRKRMISNRESARRSRMRKQKHLDDLVSQVAQLRKENQQILTSVNITTQQYLSVE  85

Query  376  LENARLKEEASGL  338
             EN+ L+ +   L
Sbjct  86   AENSVLRAQVGEL  98



>ref|XP_008393381.1| PREDICTED: ocs element-binding factor 1-like [Malus domestica]
 ref|XP_008360914.1| PREDICTED: ocs element-binding factor 1-like [Malus domestica]
Length=173

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = -1

Query  547  ERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLEN  368
            ERK +RM+SNRESARRSRMRKK+ ++EL  QV    + N  L ++L Q+ E + ++L EN
Sbjct  70   ERKLKRMISNRESARRSRMRKKKQIEELQYQVDQLHSTNRQLSEKLIQLLEGNQQILQEN  129

Query  367  ARLKEEASGLR----RLVVELRDGG  305
            A+LKE  S L+     L+  LR+ G
Sbjct  130  AQLKERVSSLQIFLADLITPLRNAG  154



>ref|XP_008377201.1| PREDICTED: ocs element-binding factor 1-like [Malus domestica]
Length=156

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -1

Query  562  HRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDK  383
            H ++D+RK++RM SNRESARRSRMRK++HLD+L +QV   R EN  +L  +N  ++H   
Sbjct  24   HHLVDQRKRKRMQSNRESARRSRMRKQQHLDDLTAQVAQLRKENNQILTSINITTQHXMN  83

Query  382  VLLENARLKEEASGL  338
            V  EN+ LK + + L
Sbjct  84   VESENSVLKAQMAEL  98



>gb|EAY87376.1| hypothetical protein OsI_08779 [Oryza sativa Indica Group]
 gb|EAZ24479.1| hypothetical protein OsJ_08237 [Oryza sativa Japonica Group]
Length=169

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -1

Query  565  QHRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHD  386
            Q  + +ER++RRM+SNRESARRSRMRK++ L ELW+QV+  R+ N  LLD+LN +    D
Sbjct  73   QRSLAEERRRRRMISNRESARRSRMRKQKQLSELWAQVVHLRSTNRQLLDQLNHVIRDCD  132

Query  385  KVLLENARLKEEASGLRR  332
            +V  EN +L++E + L++
Sbjct  133  RVTHENCQLRDEQAKLQK  150



>gb|ADL36602.1| BZIP domain class transcription factor [Malus domestica]
Length=175

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -1

Query  562  HRIIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDK  383
            HR +D+RK++RM SNRESARRSRMRK++HLD+L +QV   R EN  +L  +N  ++H   
Sbjct  42   HRPVDQRKRKRMQSNRESARRSRMRKQQHLDDLMAQVAQLRKENNQILTSINITTQHFMN  101

Query  382  VLLENARLKEEASGL  338
            V  EN+ LK +   L
Sbjct  102  VESENSVLKAQMGEL  116



>ref|XP_010511910.1| PREDICTED: basic leucine zipper 43-like [Camelina sativa]
Length=138

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -1

Query  550  DERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLLE  371
            DERK+RR VSNRESARRSRMRK+RH+DELWS ++    EN  L+D L++  E +DKV+ E
Sbjct  45   DERKRRRKVSNRESARRSRMRKRRHMDELWSMLVQLINENKCLVDELSRAKEGYDKVIEE  104

Query  370  NARLKEEASGLRRLVVELR  314
            N +L+EE S  R+++ E+R
Sbjct  105  NMKLREENSKSRKMIGEIR  123



>ref|XP_010105351.1| Ocs element-binding factor 1 [Morus notabilis]
 gb|EXC04411.1| Ocs element-binding factor 1 [Morus notabilis]
Length=152

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++D+RK++RM+SNRESARRSRMRK++HLD+L +QV   R EN  ++ R++  ++H+  + 
Sbjct  25   LMDQRKRKRMISNRESARRSRMRKQKHLDDLTAQVAQLRKENHQIITRVSITTQHYMSIE  84

Query  376  LENARLKEEASGL  338
             EN+ L+ +   L
Sbjct  85   AENSVLRAQVGEL  97



>gb|KDP32105.1| hypothetical protein JCGZ_12566 [Jatropha curcas]
Length=195

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            +IDERK+RRM+SNRESARRSRMRK++HL+ L +QV   R EN  L +RL  +  H   V 
Sbjct  83   VIDERKRRRMISNRESARRSRMRKQKHLENLRNQVNRLRIENRELTNRLRFVLYHCQSVR  142

Query  376  LENARLKEEASGLRRLVVELR  314
             +N RL+ E S LR+ +  +R
Sbjct  143  RDNDRLRSEHSMLRQKLSNIR  163



>gb|KHN25400.1| Ocs element-binding factor 1 [Glycine soja]
Length=164

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++D+RK++RM+SNRESARRSRMRK++HLD+L SQV   R EN  +L  +N  ++ +  V 
Sbjct  26   VMDQRKRKRMISNRESARRSRMRKQKHLDDLVSQVAQLRKENQQILTSVNITTQQYLSVE  85

Query  376  LENARLKEEASGL  338
             EN+ L+ +   L
Sbjct  86   AENSVLRAQVGEL  98



>ref|XP_008237492.1| PREDICTED: light-inducible protein CPRF2-like [Prunus mume]
Length=214

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++DERK+RRM+SNRESARRSRMRK++HL+ L +QV   R EN  L +RL+ +  H  +V 
Sbjct  104  VVDERKRRRMISNRESARRSRMRKQKHLENLRNQVNRLRVENRELKNRLSYVLYHFQRVR  163

Query  376  LENARLKEEASGLRRLVVELR  314
             +N RL+ E   LR+ + ++R
Sbjct  164  TDNDRLQSEHVLLRQKLSDIR  184



>ref|XP_002283667.1| PREDICTED: ocs element-binding factor 1 [Vitis vinifera]
Length=157

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++D+RK++RM+SNRESARRSRMRK++HLD+L +Q    R EN  ++  +N  ++H+  + 
Sbjct  26   LMDQRKRKRMISNRESARRSRMRKQKHLDDLMAQAAQLRKENSQIITSMNVTTQHYFNIE  85

Query  376  LENARLKEEASGL  338
             EN+ L+ + S L
Sbjct  86   AENSVLRAQFSEL  98



>ref|XP_010936666.1| PREDICTED: ocs element-binding factor 1-like [Elaeis guineensis]
Length=160

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 60/94 (64%), Gaps = 7/94 (7%)
 Frame = -1

Query  556  IIDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVL  377
            ++ +RKQ+RM+SNRESARRSRMRK++HLD+L +QV   R EN  +L  LN  ++H+  V 
Sbjct  26   LMHQRKQKRMLSNRESARRSRMRKQKHLDDLMAQVGHLRKENSQILTALNITTQHYLGVE  85

Query  376  LENARLKEEA-------SGLRRLVVELRDGGADD  296
             EN+ L+ +          L  ++  +  GG++D
Sbjct  86   AENSVLRTQMMELNTRLQSLDEILCYMNGGGSND  119



>ref|XP_010275577.1| PREDICTED: ocs element-binding factor 1-like [Nelumbo nucifera]
Length=156

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  553  IDERKQRRMVSNRESARRSRMRKKRHLDELWSQVLAFRTENCNLLDRLNQMSEHHDKVLL  374
            +D+RKQ+RM+SNRESARRSRMRK++HLD+L +QV   R EN  +L  +N  ++H+  +  
Sbjct  30   MDQRKQKRMLSNRESARRSRMRKQKHLDDLMAQVAQLRKENNQILTSINITTQHYLAIEA  89

Query  373  ENARLKEEASGL  338
            EN+ L+ +   L
Sbjct  90   ENSILRAQMGEL  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1882279424754