BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c91417_g1_i1 len=661 path=[1:0-660]

Length=661
                                                                      Score     E

ref|XP_011070959.1|  PREDICTED: uncharacterized protein LOC105156505  94.0    2e-19   
ref|XP_010320881.1|  PREDICTED: ensconsin isoform X2                  88.2    4e-17   
ref|XP_009612846.1|  PREDICTED: uncharacterized protein At3g61260...  86.7    1e-16   
ref|XP_011075575.1|  PREDICTED: remorin                               86.3    1e-16   
ref|XP_011073051.1|  PREDICTED: remorin-like                          84.0    3e-16   
ref|XP_008374595.1|  PREDICTED: uncharacterized protein LOC103437...  83.6    5e-16   
ref|XP_008374596.1|  PREDICTED: uncharacterized protein LOC103437...  83.2    6e-16   
ref|XP_009339113.1|  PREDICTED: uncharacterized protein LOC103931...  83.2    7e-16   
ref|XP_009339112.1|  PREDICTED: uncharacterized protein LOC103931...  83.2    7e-16   
ref|XP_003598936.1|  hypothetical protein MTR_3g023650                82.4    1e-15   
ref|XP_010680748.1|  PREDICTED: uncharacterized protein LOC104895...  83.2    2e-15   
ref|XP_010936362.1|  PREDICTED: uncharacterized protein LOC105056000  81.3    6e-15   
ref|XP_002322038.2|  hypothetical protein POPTR_0015s03400g           80.1    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_004299327.1|  PREDICTED: uncharacterized protein LOC101295521  79.3    2e-14   
ref|XP_009110570.1|  PREDICTED: MAP7 domain-containing protein 1-...  80.1    2e-14   
ref|XP_004239071.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_010320880.1|  PREDICTED: eukaryotic translation initiation...  80.9    2e-14   
ref|XP_008239882.1|  PREDICTED: uncharacterized protein At3g61260     79.0    2e-14   
ref|XP_007210021.1|  hypothetical protein PRUPE_ppa016826mg           78.6    3e-14   
ref|XP_010258165.1|  PREDICTED: remorin-like                          79.0    4e-14   
gb|EYU43520.1|  hypothetical protein MIMGU_mgv1a017766mg              77.0    4e-14   
ref|XP_010319463.1|  PREDICTED: remorin-like                          78.2    5e-14   
ref|XP_011013144.1|  PREDICTED: remorin                               77.0    8e-14   
ref|XP_008805086.1|  PREDICTED: uncharacterized protein LOC103718170  77.4    9e-14   
gb|EMS55057.1|  hypothetical protein TRIUR3_09010                     77.4    1e-13   
ref|XP_009612847.1|  PREDICTED: uncharacterized protein LOC104106...  77.4    1e-13   
gb|EMT09002.1|  hypothetical protein F775_14267                       77.4    1e-13   
gb|EYU28836.1|  hypothetical protein MIMGU_mgv1a010207mg              77.4    2e-13   
ref|XP_003558517.2|  PREDICTED: uncharacterized protein At3g61260...  77.4    2e-13   
ref|XP_009612845.1|  PREDICTED: general transcription factor IIF ...  77.4    2e-13   
ref|XP_009148675.1|  PREDICTED: uncharacterized protein F44E2.3 i...  77.4    3e-13   
ref|XP_009148674.1|  PREDICTED: uncharacterized protein F44E2.3 i...  77.4    3e-13   
ref|XP_009783169.1|  PREDICTED: remorin-like isoform X2               77.0    3e-13   
emb|CDY34554.1|  BnaC03g56540D                                        76.6    4e-13   
gb|AAM08792.1|AC090486_2  Hypothetical protein                        73.2    4e-13   Oryza sativa [red rice]
ref|XP_006483062.1|  PREDICTED: hepatoma-derived growth factor-re...  76.6    4e-13   
ref|XP_009338684.1|  PREDICTED: remorin-like isoform X2               75.1    4e-13   
gb|KFK43643.1|  hypothetical protein AALP_AA1G153500                  76.3    4e-13   
ref|XP_009804636.1|  PREDICTED: uncharacterized protein LOC104249833  75.9    5e-13   
ref|XP_009338681.1|  PREDICTED: remorin-like isoform X1               74.7    5e-13   
ref|XP_006438799.1|  hypothetical protein CICLE_v10033969mg           76.3    6e-13   
ref|XP_009110569.1|  PREDICTED: MAP7 domain-containing protein 1-...  75.9    6e-13   
emb|CDX96876.1|  BnaA08g24190D                                        75.9    6e-13   
ref|XP_006483061.1|  PREDICTED: hepatoma-derived growth factor-re...  76.6    6e-13   
ref|XP_006483060.1|  PREDICTED: hepatoma-derived growth factor-re...  76.3    7e-13   
ref|XP_006348812.1|  PREDICTED: neurofilament heavy polypeptide-like  75.5    9e-13   
ref|XP_004985235.1|  PREDICTED: axoneme-associated protein mst101...  74.3    1e-12   
ref|XP_004985233.1|  PREDICTED: axoneme-associated protein mst101...  73.9    2e-12   
ref|XP_010106646.1|  hypothetical protein L484_015245                 72.8    3e-12   
ref|XP_002488883.1|  hypothetical protein SORBIDRAFT_2600s002010      72.8    4e-12   Sorghum bicolor [broomcorn]
gb|KDP41274.1|  hypothetical protein JCGZ_15681                       74.3    4e-12   
ref|XP_008646882.1|  PREDICTED: chromatin assembly factor 1 subun...  72.0    4e-12   
ref|NP_172845.1|  Remorin family protein                              73.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79398.1|AC068197_8  F16A14.13                                   73.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006440687.1|  hypothetical protein CICLE_v10024374mg           71.6    6e-12   
ref|XP_010939078.1|  PREDICTED: LOW QUALITY PROTEIN: protein spli...  72.4    6e-12   
ref|XP_010495656.1|  PREDICTED: hepatoma-derived growth factor-re...  73.2    6e-12   
ref|XP_010458857.1|  PREDICTED: ensconsin-like                        73.2    7e-12   
ref|XP_010476422.1|  PREDICTED: remorin-like                          72.8    8e-12   
ref|NP_001064352.1|  Os10g0325400                                     72.8    8e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002315011.2|  hypothetical protein POPTR_0010s16830g           72.0    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009137069.1|  PREDICTED: uncharacterized protein LOC103861116  72.0    1e-11   
gb|KGN64032.1|  hypothetical protein Csa_1G038990                     71.2    1e-11   
ref|XP_010663298.1|  PREDICTED: uncharacterized protein At3g61260...  70.9    1e-11   
ref|XP_006477614.1|  PREDICTED: uncharacterized protein LOC102610...  70.9    1e-11   
ref|XP_008671220.1|  PREDICTED: hypothetical protein isoform X3       71.2    1e-11   
gb|KFK43642.1|  hypothetical protein AALP_AA1G153500                  72.0    1e-11   
gb|KFK32017.1|  hypothetical protein AALP_AA6G189400                  69.3    2e-11   
dbj|BAJ98071.1|  predicted protein                                    71.6    2e-11   
ref|XP_008646772.1|  PREDICTED: uncharacterized protein LOC103628330  71.2    2e-11   
ref|XP_009801837.1|  PREDICTED: uncharacterized protein At3g61260...  69.3    2e-11   
ref|NP_001144423.1|  hypothetical protein                             71.2    2e-11   Zea mays [maize]
ref|XP_008671206.1|  PREDICTED: hypothetical protein isoform X1       71.2    2e-11   
ref|XP_006303005.1|  hypothetical protein CARUB_v10021160mg           68.2    3e-11   
ref|XP_009801836.1|  PREDICTED: remorin isoform X2                    69.3    3e-11   
ref|XP_010663297.1|  PREDICTED: uncharacterized protein At3g61260...  70.5    3e-11   
ref|XP_010546168.1|  PREDICTED: uncharacterized protein LOC104818328  70.1    3e-11   
ref|XP_010030400.1|  PREDICTED: remorin isoform X1                    70.1    3e-11   
ref|XP_010030405.1|  PREDICTED: remorin isoform X2                    70.1    3e-11   
ref|XP_009801834.1|  PREDICTED: remorin isoform X1                    69.3    3e-11   
ref|XP_009595348.1|  PREDICTED: remorin                               69.3    3e-11   
gb|EAY78032.1|  hypothetical protein OsI_33072                        72.0    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_004499418.1|  PREDICTED: uncharacterized protein LOC101490290  71.6    3e-11   
ref|NP_001145483.1|  uncharacterized protein LOC100278877             70.5    4e-11   Zea mays [maize]
gb|EYU22383.1|  hypothetical protein MIMGU_mgv1a025160mg              69.3    4e-11   
ref|XP_003520101.1|  PREDICTED: remorin-like                          69.7    4e-11   
ref|XP_002438860.1|  hypothetical protein SORBIDRAFT_10g027380        70.9    5e-11   Sorghum bicolor [broomcorn]
ref|XP_009380559.1|  PREDICTED: remorin-like                          68.9    5e-11   
gb|EAZ15655.1|  hypothetical protein OsJ_31068                        71.6    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661687.1|  PREDICTED: neurofilament heavy polypeptide-like  70.1    6e-11   
gb|AFW89250.1|  hypothetical protein ZEAMMB73_646734                  70.1    7e-11   
ref|XP_006394521.1|  hypothetical protein EUTSA_v10004785mg           68.9    7e-11   
ref|XP_002890028.1|  remorin family protein                           70.1    8e-11   
emb|CDP17491.1|  unnamed protein product                              68.2    8e-11   
ref|XP_004242181.1|  PREDICTED: remorin                               67.8    1e-10   
ref|XP_006417078.1|  hypothetical protein EUTSA_v10009533mg           69.3    1e-10   
ref|XP_008389429.1|  PREDICTED: remorin-like                          68.9    1e-10   
ref|XP_010680747.1|  PREDICTED: uncharacterized protein LOC104895...  69.3    2e-10   
gb|KHN03627.1|  hypothetical protein glysoja_031124                   67.8    2e-10   
ref|XP_010680749.1|  PREDICTED: MAP7 domain-containing protein 1 ...  68.9    2e-10   
ref|XP_007037476.1|  Uncharacterized protein TCM_014147               68.9    2e-10   
ref|XP_003517822.1|  PREDICTED: remorin-like                          67.8    2e-10   
gb|EMT06811.1|  hypothetical protein F775_09107                       68.6    3e-10   
ref|XP_008775959.1|  PREDICTED: uncharacterized protein LOC103696202  67.0    3e-10   
ref|XP_008447778.1|  PREDICTED: remorin-like isoform X2               67.8    3e-10   
ref|XP_008447698.1|  PREDICTED: remorin-like isoform X1               67.8    3e-10   
ref|XP_009783168.1|  PREDICTED: chromodomain-helicase-DNA-binding...  68.2    4e-10   
ref|XP_002312276.2|  hypothetical protein POPTR_0008s09290g           65.9    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_004983300.1|  PREDICTED: ensconsin-like                        67.8    5e-10   
ref|XP_007158621.1|  hypothetical protein PHAVU_002G168100g           66.6    5e-10   
ref|XP_002866424.1|  remorin family protein                           66.6    5e-10   
ref|XP_011012381.1|  PREDICTED: remorin-like isoform X2               67.4    5e-10   
ref|XP_009356369.1|  PREDICTED: uncharacterized protein At3g61260...  67.4    5e-10   
ref|XP_011012373.1|  PREDICTED: remorin-like isoform X1               67.4    5e-10   
ref|XP_006391031.1|  hypothetical protein EUTSA_v10019347mg           63.9    6e-10   
ref|XP_009356370.1|  PREDICTED: uncharacterized protein At3g61260...  67.4    6e-10   
gb|KDP31308.1|  hypothetical protein JCGZ_11684                       65.5    7e-10   
ref|XP_004157491.1|  PREDICTED: uncharacterized protein At3g61260...  63.9    8e-10   
emb|CDX98136.1|  BnaA06g08870D                                        66.6    9e-10   
ref|XP_007224212.1|  hypothetical protein PRUPE_ppa017471mg           66.2    1e-09   
ref|XP_006649616.1|  PREDICTED: DNA ligase 1-like                     66.2    1e-09   
ref|XP_010552558.1|  PREDICTED: uncharacterized protein At3g61260...  63.5    1e-09   
ref|XP_004985234.1|  PREDICTED: axoneme-associated protein mst101...  66.2    1e-09   
ref|XP_010552557.1|  PREDICTED: remorin isoform X1                    63.5    1e-09   
ref|XP_010530533.1|  PREDICTED: nucleolar and coiled-body phospho...  66.6    1e-09   
ref|XP_010044441.1|  PREDICTED: uncharacterized protein At3g61260...  66.2    1e-09   
emb|CDY02159.1|  BnaA03g40080D                                        67.0    1e-09   
ref|XP_010044442.1|  PREDICTED: uncharacterized protein At3g61260...  66.2    1e-09   
ref|XP_006583952.1|  PREDICTED: uncharacterized protein At3g61260...  66.2    2e-09   
gb|KFK27892.1|  hypothetical protein AALP_AA8G443400                  65.1    2e-09   
ref|XP_006583951.1|  PREDICTED: uncharacterized protein At3g61260...  65.9    2e-09   
ref|XP_009399845.1|  PREDICTED: uncharacterized protein LOC103984...  63.9    2e-09   
ref|XP_009399844.1|  PREDICTED: uncharacterized protein LOC103984...  63.9    3e-09   
ref|XP_010234701.1|  PREDICTED: uncharacterized protein LOC100838...  65.1    3e-09   
ref|XP_010649472.1|  PREDICTED: uncharacterized protein At3g61260...  65.5    3e-09   
ref|XP_004137595.1|  PREDICTED: uncharacterized protein LOC101222069  64.7    3e-09   
ref|NP_849866.1|  remorin-like protein                                62.0    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010234700.1|  PREDICTED: uncharacterized protein LOC100838...  65.1    4e-09   
ref|XP_006281921.1|  hypothetical protein CARUB_v10028128mg           63.9    5e-09   
ref|XP_009399843.1|  PREDICTED: uncharacterized protein LOC103984...  63.9    5e-09   
ref|XP_009399842.1|  PREDICTED: uncharacterized protein LOC103984...  63.9    6e-09   
emb|CDY36418.1|  BnaC05g10190D                                        64.3    6e-09   
emb|CDY40911.1|  BnaC06g30490D                                        62.8    7e-09   
ref|XP_011018194.1|  PREDICTED: uncharacterized protein At3g61260...  64.3    8e-09   
ref|XP_011018175.1|  PREDICTED: uncharacterized protein At3g61260...  63.9    9e-09   
ref|XP_008671249.1|  PREDICTED: hypothetical protein isoform X4       63.2    1e-08   
emb|CDP00403.1|  unnamed protein product                              63.9    1e-08   
gb|KHN20534.1|  Hypothetical protein glysoja_029547                   62.8    1e-08   
gb|AFW70326.1|  hypothetical protein ZEAMMB73_462803                  61.6    1e-08   
ref|XP_008658459.1|  PREDICTED: uncharacterized protein LOC100278...  63.5    1e-08   
ref|XP_008671213.1|  PREDICTED: hypothetical protein isoform X2       63.2    1e-08   
ref|XP_006605547.1|  PREDICTED: uncharacterized protein At3g61260...  62.8    1e-08   
ref|XP_008393196.1|  PREDICTED: remorin-like                          62.0    2e-08   
ref|XP_009590902.1|  PREDICTED: uncharacterized protein LOC104088004  63.5    2e-08   
ref|XP_006605546.1|  PREDICTED: uncharacterized protein At3g61260...  62.8    2e-08   
gb|AAG60092.1|AC073178_3  hypothetical protein                        61.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530534.1|  PREDICTED: nucleolar and coiled-body phospho...  62.8    2e-08   
emb|CDY23073.1|  BnaC07g31140D                                        63.2    3e-08   
ref|XP_010483793.1|  PREDICTED: uncharacterized protein At3g61260...  62.0    3e-08   
ref|XP_007157419.1|  hypothetical protein PHAVU_002G068600g           62.0    3e-08   
ref|NP_200936.1|  Remorin family protein                              61.6    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KDO54571.1|  hypothetical protein CISIN_1g014975mg                 62.4    3e-08   
ref|XP_009105633.1|  PREDICTED: uncharacterized protein LOC103831505  59.3    3e-08   
ref|NP_001132191.1|  hypothetical protein                             62.4    3e-08   Zea mays [maize]
ref|XP_002514700.1|  hypothetical protein RCOM_1470580                61.6    4e-08   Ricinus communis
ref|XP_008681160.1|  PREDICTED: hypothetical protein isoform X1       62.4    4e-08   
ref|XP_008681161.1|  PREDICTED: hypothetical protein isoform X2       62.4    4e-08   
ref|XP_010530532.1|  PREDICTED: serine/arginine repetitive matrix...  62.0    4e-08   
ref|XP_010457129.1|  PREDICTED: remorin-like isoform X2               61.2    4e-08   
ref|XP_010457120.1|  PREDICTED: remorin-like isoform X1               61.2    4e-08   
ref|XP_002887228.1|  hypothetical protein ARALYDRAFT_315935           60.5    4e-08   
ref|XP_010259033.1|  PREDICTED: uncharacterized protein At3g61260...  62.0    4e-08   
ref|XP_010470914.1|  PREDICTED: uncharacterized protein At3g61260...  58.2    7e-08   
ref|XP_003607785.1|  hypothetical protein MTR_4g082910                61.2    9e-08   
ref|XP_010678430.1|  PREDICTED: remorin                               60.5    9e-08   
ref|XP_008339832.1|  PREDICTED: uncharacterized protein At3g61260...  60.5    1e-07   
ref|XP_008339833.1|  PREDICTED: uncharacterized protein At3g61260...  60.5    1e-07   
ref|XP_004505377.1|  PREDICTED: uncharacterized protein LOC101493...  60.8    1e-07   
ref|XP_004505378.1|  PREDICTED: uncharacterized protein LOC101493...  60.5    1e-07   
ref|XP_002512116.1|  DNA binding protein, putative                    60.8    1e-07   Ricinus communis
ref|XP_008221537.1|  PREDICTED: remorin-like isoform X2               59.7    1e-07   
ref|XP_010673352.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.8    1e-07   
emb|CDX95945.1|  BnaA07g27860D                                        56.6    3e-07   
ref|XP_008221536.1|  PREDICTED: uncharacterized protein At3g61260...  59.3    3e-07   
gb|ABF94601.1|  expressed protein                                     58.9    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010470915.1|  PREDICTED: uncharacterized protein LOC104750764  55.5    8e-07   
emb|CAN78816.1|  hypothetical protein VITISV_041733                   56.6    9e-07   Vitis vinifera
ref|XP_006581992.1|  PREDICTED: uncharacterized protein At3g61260...  57.4    9e-07   
ref|XP_004172072.1|  PREDICTED: uncharacterized protein LOC101225810  57.8    1e-06   
ref|XP_008446417.1|  PREDICTED: uncharacterized protein LOC103489...  57.8    1e-06   
gb|EAY89011.1|  hypothetical protein OsI_10493                        57.8    1e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008446418.1|  PREDICTED: uncharacterized protein LOC103489...  57.8    1e-06   
gb|KHN06902.1|  hypothetical protein glysoja_041282                   57.4    1e-06   
ref|XP_004135153.1|  PREDICTED: uncharacterized protein LOC101213727  57.8    1e-06   
ref|XP_010511957.1|  PREDICTED: uncharacterized protein At3g61260...  55.1    1e-06   
ref|XP_003614010.1|  hypothetical protein MTR_5g043690                57.8    1e-06   
ref|XP_003614009.1|  hypothetical protein MTR_5g043690                57.8    1e-06   
gb|AES96967.2|  carboxy-terminal region remorin                       57.0    2e-06   
gb|AES96968.2|  carboxy-terminal region remorin                       57.0    2e-06   
ref|XP_010443944.1|  PREDICTED: uncharacterized protein LOC104726...  56.6    3e-06   
ref|XP_010443945.1|  PREDICTED: remorin-like isoform X2               56.2    3e-06   
gb|AAG52495.1|AC018364_13  hypothetical protein; 34983-33172          54.7    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010044437.1|  PREDICTED: uncharacterized protein At3g61260...  55.5    6e-06   
ref|XP_009387213.1|  PREDICTED: uncharacterized protein LOC103974173  55.5    7e-06   
ref|XP_002271714.1|  PREDICTED: cytokinesis protein sepA isoform X3   55.5    8e-06   Vitis vinifera
ref|XP_010649468.1|  PREDICTED: formin-like protein 2 isoform X1      55.5    8e-06   
ref|XP_004298394.1|  PREDICTED: uncharacterized protein LOC101293779  55.1    1e-05   
ref|XP_006837034.1|  hypothetical protein AMTR_s00110p00036630        54.3    2e-05   
ref|XP_010415573.1|  PREDICTED: uncharacterized protein LOC104701...  50.8    3e-05   
emb|CAN63833.1|  hypothetical protein VITISV_009131                   53.5    4e-05   Vitis vinifera
ref|XP_009127721.1|  PREDICTED: uncharacterized protein LOC103852571  50.4    5e-05   
ref|XP_010415572.1|  PREDICTED: uncharacterized protein LOC104701...  49.7    9e-05   
ref|XP_002465656.1|  hypothetical protein SORBIDRAFT_01g043200        48.9    1e-04   Sorghum bicolor [broomcorn]
ref|XP_010415574.1|  PREDICTED: uncharacterized protein LOC104701...  49.3    1e-04   
emb|CDY28544.1|  BnaC02g19130D                                        52.0    2e-04   
ref|XP_007045930.1|  Remorin family protein                           49.3    0.001   



>ref|XP_011070959.1| PREDICTED: uncharacterized protein LOC105156505 [Sesamum indicum]
Length=337

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 80/106 (75%), Gaps = 2/106 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE +++  ++ R+E+L  II +WE +KK KA ++++RIEA+ E KRA A+Q + EEI
Sbjct  233  ADAWEKEKMASIQERYERLTAIIDDWEINKKKKANRKMERIEAKPENKRAEAVQRHQEEI  292

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
             RIE I+G ARAQ E N ++EE KVKEKAN++R TG+LP  TC +C
Sbjct  293  KRIEEIAGGARAQAEKNRRKEELKVKEKANKIRSTGKLP-ATC-LC  336



>ref|XP_010320881.1| PREDICTED: ensconsin isoform X2 [Solanum lycopersicum]
Length=403

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            AD WE +E+EK+++R++KL N IV+WE  KK KAK+ L+++EAEL+ +RA+A +H+N+E+
Sbjct  299  ADIWEKEEMEKIRIRYKKLINEIVDWETKKKKKAKRNLEKVEAELDRRRAKARKHFNDEV  358

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
             RIESI+G A+ Q + + K EE KV EKAN++R TG++P   +CF
Sbjct  359  GRIESIAGGAKEQADQHRKNEELKVLEKANKIRVTGKMPSTCSCF  403



>ref|XP_009612846.1| PREDICTED: uncharacterized protein At3g61260-like isoform X2 
[Nicotiana tomentosiformis]
Length=354

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE +E+EK+  R++KL   IVEWE  KK KAK+ L+RIEAEL  +RA+A++H+N E
Sbjct  249  KADIWEKEEMEKITERYKKLIAEIVEWETKKKKKAKRDLERIEAELNRRRAKAMRHFNNE  308

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            + RIESI+G A+ Q + N + EE KVKEKAN++R TG++P  TC +C
Sbjct  309  VGRIESIAGGAKEQADQNRENEELKVKEKANKIRSTGKMP-ATC-LC  353



>ref|XP_011075575.1| PREDICTED: remorin [Sesamum indicum]
Length=349

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE +ELE ++ R+EKL   I  WE  KK KAK++L+RIEAEL+++RA+ +Q Y+ +
Sbjct  244  KADDWEKEELESIRERYEKLRATIENWETKKKKKAKRKLERIEAELDKRRAKVVQSYHSD  303

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            I RIE I+G ARAQ E N K EE KVKEK N++R TG+LP  TC +C
Sbjct  304  IKRIEGIAGGARAQAEKNRKNEELKVKEKTNKIRLTGKLP-ATC-LC  348



>ref|XP_011073051.1| PREDICTED: remorin-like [Sesamum indicum]
Length=221

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  ++ K++ R+EK+ + I+ WE +KK +AKQ+++R + ELE +++R LQHY  +I
Sbjct  117  ADAWEKAQIAKIRKRYEKMQSEILAWENEKKLRAKQKMERKKGELELRKSRNLQHYYSKI  176

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RI+ I+G ARAQ ++  ++EE  VK+KA+++R TGR+P   CF
Sbjct  177  ARIDDIAGGARAQVDEKRRQEESVVKQKASRMRLTGRVPVD-CF  219



>ref|XP_008374595.1| PREDICTED: uncharacterized protein LOC103437864 isoform X1 [Malus 
domestica]
Length=223

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            + DAWE  +++K++ R+EK+   IV WE +KK +AK +++R + E+E++RAR +QHY  +
Sbjct  115  KPDAWERAQMKKIQRRYEKVKATIVAWENEKKMQAKAKMERRKNEIEQRRARNMQHYQIK  174

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
              RI+ I+G ARAQ E+  + EE KVKEKA ++R TG+ P    CF C
Sbjct  175  QARIDQIAGGARAQAEEKRRNEESKVKEKAKRIRSTGKAPATCFCFTC  222



>ref|XP_008374596.1| PREDICTED: uncharacterized protein LOC103437864 isoform X2 [Malus 
domestica]
Length=222

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            + DAWE  +++K++ R+EK+   IV WE +KK +AK +++R + E+E++RAR +QHY  +
Sbjct  114  KPDAWERAQMKKIQRRYEKVKATIVAWENEKKMQAKAKMERRKNEIEQRRARNMQHYQIK  173

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
              RI+ I+G ARAQ E+  + EE KVKEKA ++R TG+ P    CF C
Sbjct  174  QARIDQIAGGARAQAEEKRRNEESKVKEKAKRIRSTGKAPATCFCFTC  221



>ref|XP_009339113.1| PREDICTED: uncharacterized protein LOC103931366 isoform X2 [Pyrus 
x bretschneideri]
Length=222

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            + DAWE  +++K++ R+EK+   IV WE +KK +AK +++R + E+E++RAR +QHY  +
Sbjct  114  KPDAWEGAQMKKIQKRYEKVKATIVAWENEKKMQAKAKMERRKNEIEQRRARNMQHYQIK  173

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
              RI+ I+G ARAQ E+  + EE KVKEKA ++R TG+ P    CF C
Sbjct  174  QARIDQIAGGARAQAEEKRRNEESKVKEKAKRIRSTGKAPATCFCFTC  221



>ref|XP_009339112.1| PREDICTED: uncharacterized protein LOC103931366 isoform X1 [Pyrus 
x bretschneideri]
Length=223

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            + DAWE  +++K++ R+EK+   IV WE +KK +AK +++R + E+E++RAR +QHY  +
Sbjct  115  KPDAWEGAQMKKIQKRYEKVKATIVAWENEKKMQAKAKMERRKNEIEQRRARNMQHYQIK  174

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
              RI+ I+G ARAQ E+  + EE KVKEKA ++R TG+ P    CF C
Sbjct  175  QARIDQIAGGARAQAEEKRRNEESKVKEKAKRIRSTGKAPATCFCFTC  222



>ref|XP_003598936.1| hypothetical protein MTR_3g023650 [Medicago truncatula]
 gb|AES69187.1| carboxy-terminal region remorin [Medicago truncatula]
Length=235

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A+AWE  ++E+++ R+EK+ + I+ WE +K+ +AKQQ++R + EL+  RA A++HY  +
Sbjct  127  KAEAWEKAKMERIQKRYEKMKSQILSWEGEKRVQAKQQMERKKNELDYTRANAIEHYKRK  186

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ I   A  + EDN ++EE KVKEKAN++R TG++P  TCF
Sbjct  187  IARIDMIGQRAIKELEDNRRKEELKVKEKANKIRKTGKVP-VTCF  230



>ref|XP_010680748.1| PREDICTED: uncharacterized protein LOC104895823 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=382

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE +++ K+K R+EKLN  I+EWE  K+NKA+++L+  E E E++RA+ALQ Y+ E+
Sbjct  276  ADAWEREQMAKIKERYEKLNATILEWEDKKRNKARRKLEMTENEPEKRRAKALQKYHIEM  335

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
             RI+ I+  ARAQ ++  + EE KVKEKAN+ R TG  P     +C
Sbjct  336  ERIKQIADGARAQAKEKRRNEEFKVKEKANKYRATGEPPLPPMCLC  381



>ref|XP_010936362.1| PREDICTED: uncharacterized protein LOC105056000 [Elaeis guineensis]
Length=320

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  ++ ++K+RF+K N  I+EWE +KK KA+ +L+R E E E +RARA+Q Y  E
Sbjct  215  KADAWEKAKMARIKMRFDKANATILEWETEKKAKARHRLERKERESEWRRARAVQEYRNE  274

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLP  142
            ++RIE I G A+A EE+  + +E K  EKA ++R TG++P
Sbjct  275  LSRIEKIVGTAKALEEERKRNDEYKTMEKARKIRLTGKVP  314



>ref|XP_002322038.2| hypothetical protein POPTR_0015s03400g [Populus trichocarpa]
 gb|EEF06165.2| hypothetical protein POPTR_0015s03400g [Populus trichocarpa]
Length=294

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE  +L K+  R+EK+ + I++WE  KK +AK   ++ ++ELE +RAR +QHY+ +
Sbjct  189  KADSWEKDQLRKINRRYEKMKSKILDWEKAKKMRAKLHGEKKKSELELRRARNMQHYHNK  248

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            I RI+ ISG AR Q E+  + EE +VKEKA  +R  GR P + CF C
Sbjct  249  IARIDLISGRARGQLEEKRRNEELEVKEKAKHMRSKGRSPSR-CFCC  294



>ref|XP_004299327.1| PREDICTED: uncharacterized protein LOC101295521 [Fragaria vesca 
subsp. vesca]
Length=239

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  E++K++ R+EK+   I+ WE +KK + K +++R + E+E++RA  +QHY  +
Sbjct  131  KADAWEKAEMKKIQNRYEKVKAAILAWENEKKMQVKLKMERRKREMEQRRAINMQHYQVK  190

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
              RI+ I+G ARAQ E   + EE KVKEKA ++R TG++P    CF C
Sbjct  191  QERIDQIAGGARAQVEVKRRNEESKVKEKAKRIRATGKVPVTCFCFTC  238



>ref|XP_009110570.1| PREDICTED: MAP7 domain-containing protein 1-like isoform X2 [Brassica 
rapa]
Length=341

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  EL K+K R+EKLN  I  WEA K++KA+++L + E+E E++R R LQ + E++
Sbjct  236  ADAWEKAELAKIKARYEKLNRKIDLWEAKKRDKARRKLDKSESEQEQRRKRGLQRFREDM  295

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
              IE I+  ARAQ E   + EE KVKE+A  +R TG++P + C
Sbjct  296  EYIEHIAAGARAQAEKQRQNEELKVKERAGIVRKTGKIPGKAC  338



>ref|XP_004239071.1| PREDICTED: eukaryotic translation initiation factor 5B isoform 
X3 [Solanum lycopersicum]
Length=397

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 77/117 (66%), Gaps = 13/117 (11%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQ------  277
            AD WE +E+EK+++R++KL N IV+WE  KK KAK+ L+++EAEL       LQ      
Sbjct  281  ADIWEKEEMEKIRIRYKKLINEIVDWETKKKKKAKRNLEKVEAELLSNEKMKLQAELDRR  340

Query  276  ------HYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
                  H+N+E+ RIESI+G A+ Q + + K EE KV EKAN++R TG++P   +CF
Sbjct  341  RAKARKHFNDEVGRIESIAGGAKEQADQHRKNEELKVLEKANKIRVTGKMPSTCSCF  397



>ref|XP_010320880.1| PREDICTED: eukaryotic translation initiation factor 5B isoform 
X1 [Solanum lycopersicum]
Length=415

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 77/117 (66%), Gaps = 13/117 (11%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQ------  277
            AD WE +E+EK+++R++KL N IV+WE  KK KAK+ L+++EAEL       LQ      
Sbjct  299  ADIWEKEEMEKIRIRYKKLINEIVDWETKKKKKAKRNLEKVEAELLSNEKMKLQAELDRR  358

Query  276  ------HYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
                  H+N+E+ RIESI+G A+ Q + + K EE KV EKAN++R TG++P   +CF
Sbjct  359  RAKARKHFNDEVGRIESIAGGAKEQADQHRKNEELKVLEKANKIRVTGKMPSTCSCF  415



>ref|XP_008239882.1| PREDICTED: uncharacterized protein At3g61260 [Prunus mume]
Length=238

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  +++K++ R+EK+ + I+ WE +KK +AK ++++ ++ELE++RA  +QHY  + 
Sbjct  131  ADAWEKAQIKKIQRRYEKVKSAILAWENEKKMQAKIKMEKRKSELEQRRASNMQHYQIKQ  190

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
            TRI+ I+G ARAQ E+  + EE KV+EK  ++R  G++P +  CF C
Sbjct  191  TRIDQIAGGARAQMEEKRRNEESKVREKVKRIRSKGKVPVKCFCFTC  237



>ref|XP_007210021.1| hypothetical protein PRUPE_ppa016826mg [Prunus persica]
 gb|EMJ11220.1| hypothetical protein PRUPE_ppa016826mg [Prunus persica]
Length=238

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  +++K++ R+EK+ + I+ WE +KK +AK ++++ ++ELE++RA  +QHY  + 
Sbjct  131  ADAWEKAQIKKIQKRYEKVKSAILAWENEKKMQAKIKMEKRKSELEQRRASNMQHYQIKQ  190

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
            TRI+ I+G ARAQ E+  + EE KV+EK  ++R  G++P +  CF C
Sbjct  191  TRIDQIAGGARAQMEEKRRNEESKVREKVKRIRSKGKVPVKCFCFTC  237



>ref|XP_010258165.1| PREDICTED: remorin-like [Nelumbo nucifera]
Length=329

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            R DAWE  E EK+K R EK  + I+ WE +KK KA++QL+R + ELE+K  RAL H+  +
Sbjct  224  RVDAWEKAETEKIKKRDEKTKSTILSWENEKKAKARRQLERKQRELEQKTRRALHHFENK  283

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
            + RI  I+  ARAQ E+N + +E KVK+KAN+ R +G++    C
Sbjct  284  LARINQIAEGARAQAEENRRNDESKVKDKANKFRSSGKVTGNCC  327



>gb|EYU43520.1| hypothetical protein MIMGU_mgv1a017766mg, partial [Erythranthe 
guttata]
Length=161

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE   + K++ R+EK+   I+ WE +KK + K Q++R + ELE +++R  +HY  +
Sbjct  54   KADSWERAHIAKIRKRYEKMTLEILAWENEKKLREKHQMERKKGELELRKSRNWKHYQSK  113

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRL-PEQTCF  127
            + RI+ I G ARAQ E   K+EE  VK KANQ+R TG++ P   CF
Sbjct  114  VARIDEIGGGARAQVEAKRKKEESIVKNKANQMRSTGKVAPVINCF  159



>ref|XP_010319463.1| PREDICTED: remorin-like [Solanum lycopersicum]
 ref|XP_010319464.1| PREDICTED: remorin-like [Solanum lycopersicum]
 ref|XP_010319465.1| PREDICTED: remorin-like [Solanum lycopersicum]
 ref|XP_010319466.1| PREDICTED: remorin-like [Solanum lycopersicum]
 ref|XP_010319467.1| PREDICTED: remorin-like [Solanum lycopersicum]
Length=288

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A+ WE++E++K+K R+EK + +I++WE  KK K+K+ L++IEA+L+ +RA   Q +  +
Sbjct  183  KANIWENEEMKKIKERYEKQHYVILDWETKKKKKSKRHLEQIEAKLDRRRAMTKQSFYND  242

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            I RIE I+G A+A+ E N ++EE KVKE+AN++R TG++P    CF
Sbjct  243  IERIEKIAGGAKAKAEQNQEKEEHKVKERANKIRSTGKMPATCLCF  288



>ref|XP_011013144.1| PREDICTED: remorin [Populus euphratica]
 ref|XP_011013145.1| PREDICTED: remorin [Populus euphratica]
 ref|XP_011013146.1| PREDICTED: remorin [Populus euphratica]
 ref|XP_011013148.1| PREDICTED: remorin [Populus euphratica]
 ref|XP_011013149.1| PREDICTED: remorin [Populus euphratica]
Length=224

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE  +L K+  R+EK+ + I++WE  +K +AK   ++ ++ELE +RAR +QHY  +
Sbjct  119  KADSWEKDQLRKINRRYEKMKSKILDWEKARKMRAKLHGEKKKSELELRRARNMQHYQNK  178

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            I RI+ ISG AR Q E+  + EE +VKEKA  +R  GR P + CF C
Sbjct  179  IARIDMISGGARRQLEEKRRNEEFEVKEKAKHMRSRGRSPSR-CFCC  224



>ref|XP_008805086.1| PREDICTED: uncharacterized protein LOC103718170 [Phoenix dactylifera]
Length=282

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  ++ K+K R+EK+N  I+EWE +KK KAK QL R E ELE +R R LQ +  E
Sbjct  177  KADAWEKAKMAKIKRRYEKMNATILEWENEKKMKAKCQLNRKEGELERRRNRTLQEHRNE  236

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLP  142
            + RI+ I   ARA  E+  + +E K  EKAN++R TG++P
Sbjct  237  MFRIDKIGSGARAMAEERKRNDEYKAIEKANKMRSTGKIP  276



>gb|EMS55057.1| hypothetical protein TRIUR3_09010 [Triticum urartu]
Length=298

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 70/105 (67%), Gaps = 0/105 (0%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE + L +V+  +EK+   I EWE +KK KAK+Q ++ E  L+ KRA+ L  YN+E
Sbjct  194  KADAWEKERLARVREEYEKMMETIAEWETEKKVKAKRQKEQKEVALDRKRAKQLAEYNQE  253

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            +TRI  I+G AR+   +    +E+K++EKA ++R TG+ P   CF
Sbjct  254  MTRINKIAGGARSMAGERKYEDEKKIREKAKKIRSTGKSPRGCCF  298



>ref|XP_009612847.1| PREDICTED: uncharacterized protein LOC104106069 isoform X3 [Nicotiana 
tomentosiformis]
Length=312

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 80/120 (67%), Gaps = 15/120 (13%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekr----------  292
            +AD WE +E+EK+  R++KL   IVEWE  KK KAK+ L+RIEAE+   +          
Sbjct  194  KADIWEKEEMEKITERYKKLIAEIVEWETKKKKKAKRDLERIEAEILSNKNNMKLQAELN  253

Query  291  ---araLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
               A+A++H+N E+ RIESI+G A+ Q + N + EE KVKEKAN++R TG++P  TC +C
Sbjct  254  RRRAKAMRHFNNEVGRIESIAGGAKEQADQNRENEELKVKEKANKIRSTGKMP-ATC-LC  311



>gb|EMT09002.1| hypothetical protein F775_14267 [Aegilops tauschii]
Length=313

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 70/105 (67%), Gaps = 0/105 (0%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE + L +V+  +EK+   I EWE +KK KAK+Q ++ E  L+ KRA+ L  YN+E
Sbjct  209  KADAWEKERLARVREEYEKMMETIAEWETEKKVKAKRQKEQKEVALDRKRAKQLAEYNQE  268

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            +TRI  I+G AR+   +    +E+K++EKA ++R TG+ P   CF
Sbjct  269  MTRINKIAGGARSMAGERKYEDEKKIREKAKKIRSTGKSPRGCCF  313



>gb|EYU28836.1| hypothetical protein MIMGU_mgv1a010207mg [Erythranthe guttata]
Length=319

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            RADAWE +E+  +K R+EK+   +  WE  KK KAK+++++IEAEL+++RARA+Q Y  +
Sbjct  214  RADAWEKEEMASIKERYEKMRATVDNWETKKKKKAKRKIEKIEAELDKRRARAVQSYKVK  273

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            I R+E I+G AR Q E N K EE K K+KAN++R TG LP  TC +C
Sbjct  274  IARVEGIAGGARVQAEKNRKNEESKAKDKANKIRLTGMLP-ATC-LC  318



>ref|XP_003558517.2| PREDICTED: uncharacterized protein At3g61260-like [Brachypodium 
distachyon]
Length=348

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  +L +++  +EK+ + I EWE +KK KAK+Q ++ E EL++ RAR L+ YN+E
Sbjct  244  KADAWEKAKLARIREEYEKMIDTIAEWETEKKVKAKRQKEQKEIELDKMRARVLEEYNKE  303

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            + R+  I+G AR   E+    +E+K+++KA ++R TG+LP   CF
Sbjct  304  MARVNKIAGGARTMAEERKYNDEKKIRDKAKKIRSTGKLPRGCCF  348



>ref|XP_009612845.1| PREDICTED: general transcription factor IIF subunit 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=367

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 80/120 (67%), Gaps = 15/120 (13%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekr----------  292
            +AD WE +E+EK+  R++KL   IVEWE  KK KAK+ L+RIEAE+   +          
Sbjct  249  KADIWEKEEMEKITERYKKLIAEIVEWETKKKKKAKRDLERIEAEILSNKNNMKLQAELN  308

Query  291  ---araLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
               A+A++H+N E+ RIESI+G A+ Q + N + EE KVKEKAN++R TG++P  TC +C
Sbjct  309  RRRAKAMRHFNNEVGRIESIAGGAKEQADQNRENEELKVKEKANKIRSTGKMP-ATC-LC  366



>ref|XP_009148675.1| PREDICTED: uncharacterized protein F44E2.3 isoform X2 [Brassica 
rapa]
Length=377

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            AD WE  EL K+K R+EKLN  I  WE  K++KA+++L + E+E E+KR R LQ + E++
Sbjct  272  ADDWEKTELAKIKARYEKLNRKIDLWEEKKRDKARRKLDKSESEQEQKRKRGLQRFREDM  331

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              IE I+  ARAQ     + EE KVKEKA  +R TG++P + CF
Sbjct  332  EYIEQIAAGARAQAGKQRQTEELKVKEKAGIVRSTGKIPGKACF  375



>ref|XP_009148674.1| PREDICTED: uncharacterized protein F44E2.3 isoform X1 [Brassica 
rapa]
Length=379

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            AD WE  EL K+K R+EKLN  I  WE  K++KA+++L + E+E E+KR R LQ + E++
Sbjct  274  ADDWEKTELAKIKARYEKLNRKIDLWEEKKRDKARRKLDKSESEQEQKRKRGLQRFREDM  333

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              IE I+  ARAQ     + EE KVKEKA  +R TG++P + CF
Sbjct  334  EYIEQIAAGARAQAGKQRQTEELKVKEKAGIVRSTGKIPGKACF  377



>ref|XP_009783169.1| PREDICTED: remorin-like isoform X2 [Nicotiana sylvestris]
Length=363

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE +E+EK+  R++KL   IVEWE  KK KAK+ L+RIEAEL+ +RA+A++H+N E
Sbjct  258  KADIWEKEEMEKIIERYKKLITEIVEWETKKKKKAKRNLERIEAELDRRRAKAMRHFNNE  317

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            + RIESI+G A+ Q + N + EE KVKEKAN++R TG++P  TC +C
Sbjct  318  VGRIESIAGGAKEQADQNRENEELKVKEKANKIRSTGKMP-ATC-LC  362



>emb|CDY34554.1| BnaC03g56540D [Brassica napus]
Length=342

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            ADAWE  EL K+K R+EKLN  I  WEA K++KA++ L + E   +E+R +   Q + E+
Sbjct  236  ADAWEKAELAKIKARYEKLNRKIDLWEAKKRDKARRNLDKSEQSQQEQRRKRGLQRFRED  295

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
            +  IE IS  ARAQ E   + EE KVKE+A  +R TG++P + C
Sbjct  296  MEYIEHISSGARAQAEKQRQNEELKVKERAGIVRKTGKIPGKAC  339



>gb|AAM08792.1|AC090486_2 Hypothetical protein [Oryza sativa Japonica Group]
Length=107

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQ-RIeaeleekraraLQHYNEE  262
            AD WE +++ K+K ++    + IVEWEA+KK KAK+Q++ +     E KR +AL+ YN+E
Sbjct  2    ADTWEKEKMAKIKKQYNMTMDTIVEWEAEKKAKAKRQMELKEGDNSERKREKALEEYNDE  61

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            ITRI  ++  +R   E+  +  E+KV+EKA ++R TG+LP    CF
Sbjct  62   ITRINKVAAASRLTAEEKRRSAERKVREKAERIRVTGKLPGACGCF  107



>ref|XP_006483062.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like 
isoform X3 [Citrus sinensis]
 ref|XP_006483063.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like 
isoform X4 [Citrus sinensis]
Length=347

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  E+ ++K R+EKLN  I+ WE  KK KA+++L R E ELE++R +ALQ +  ++
Sbjct  242  ADAWEKAEMARIKERYEKLNETILSWEERKKKKARRKLDRAEGELEKRRVKALQKFRSDM  301

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
              I+ I+G ARAQ ++  ++ E K KEKAN++R TG++P  TC
Sbjct  302  ESIDRIAGGARAQAQEKRRKAEFKAKEKANKIRTTGKIPATTC  344



>ref|XP_009338684.1| PREDICTED: remorin-like isoform X2 [Pyrus x bretschneideri]
Length=221

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  +++K++ R+EK+   IV WE +KK KAK +++R ++E+E++RAR +QHY  E
Sbjct  113  KADAWERAQMKKIQKRYEKVKATIVAWENEKKMKAKAKMERRKSEIEQRRARNMQHYQIE  172

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
              RI+ I+G ARAQ E+  + EE KVKEK   +R TG+ P    CF C
Sbjct  173  QARIDQIAGGARAQVEEKRRNEESKVKEKVTMIRSTGKAPTTCFCFTC  220



>gb|KFK43643.1| hypothetical protein AALP_AA1G153500 [Arabis alpina]
Length=344

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 69/106 (65%), Gaps = 1/106 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            AD WE  EL K+K R+EKLN  I  WE  K++KA+++L + E+ELE+ R R LQ + E+ 
Sbjct  239  ADDWEKAELAKIKARYEKLNRKIDIWETKKRDKARRKLDKSESELEQTRRRGLQRFREDT  298

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
              IE IS  ARAQ +   + EE K KEKA  +R TG+LP + C +C
Sbjct  299  EYIEHISAGARAQADKQRQSEEFKAKEKAGIIRSTGKLPGKAC-LC  343



>ref|XP_009804636.1| PREDICTED: uncharacterized protein LOC104249833 [Nicotiana sylvestris]
Length=306

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+W+ +E++K+K R+EKL  +I +WE  KK KAK  L++ EA+L+++R +A   +  +
Sbjct  201  KADSWQKEEMKKIKERYEKLKKVIHDWETKKKKKAKCHLEQTEAQLDKRREKARDSFYSD  260

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RIE I+G A++Q E N + EE KVKEKAN++R TG++P  TC 
Sbjct  261  IGRIEQIAGGAKSQAEQNQENEELKVKEKANKIRSTGKMPP-TCL  304



>ref|XP_009338681.1| PREDICTED: remorin-like isoform X1 [Pyrus x bretschneideri]
Length=223

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  +++K++ R+EK+   IV WE +KK KAK +++R ++E+E++RAR +QHY  E
Sbjct  115  KADAWERAQMKKIQKRYEKVKATIVAWENEKKMKAKAKMERRKSEIEQRRARNMQHYQIE  174

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
              RI+ I+G ARAQ E+  + EE KVKEK   +R TG+ P    CF C
Sbjct  175  QARIDQIAGGARAQVEEKRRNEESKVKEKVTMIRSTGKAPTTCFCFTC  222



>ref|XP_006438799.1| hypothetical protein CICLE_v10033969mg [Citrus clementina]
 gb|ESR52039.1| hypothetical protein CICLE_v10033969mg [Citrus clementina]
Length=373

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  E+ ++K R+EKLN  I+ WE  KK KA+++L R E ELE++R +ALQ +  ++
Sbjct  268  ADAWEKAEMARIKERYEKLNETILSWEERKKKKARRKLDRAEGELEKRRVKALQKFRSDM  327

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
              I+ I+G ARAQ ++  ++ E K KEKAN++R TG++P  TC
Sbjct  328  ESIDRIAGGARAQAQEKRRKAEFKAKEKANKIRTTGKIPATTC  370



>ref|XP_009110569.1| PREDICTED: MAP7 domain-containing protein 1-like isoform X1 [Brassica 
rapa]
Length=342

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            ADAWE  EL K+K R+EKLN  I  WEA K++KA+++L + E   +E+R +   Q + E+
Sbjct  236  ADAWEKAELAKIKARYEKLNRKIDLWEAKKRDKARRKLDKSEQSEQEQRRKRGLQRFRED  295

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
            +  IE I+  ARAQ E   + EE KVKE+A  +R TG++P + C
Sbjct  296  MEYIEHIAAGARAQAEKQRQNEELKVKERAGIVRKTGKIPGKAC  339



>emb|CDX96876.1| BnaA08g24190D [Brassica napus]
Length=342

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            ADAWE  EL K+K R+EKLN  I  WEA K++KA+++L + E   +E+R +   Q + E+
Sbjct  236  ADAWEKAELAKIKARYEKLNRKIDLWEAKKRDKARRKLDKSEQSEQEQRRKRGLQRFRED  295

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
            +  IE I+  ARAQ E   + EE KVKE+A  +R TG++P + C
Sbjct  296  MEYIEHIAAGARAQAEKQRQNEELKVKERAGIVRKTGKIPGKAC  339



>ref|XP_006483061.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like 
isoform X2 [Citrus sinensis]
Length=402

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  E+ ++K R+EKLN  I+ WE  KK KA+++L R E ELE++R +ALQ +  ++
Sbjct  297  ADAWEKAEMARIKERYEKLNETILSWEERKKKKARRKLDRAEGELEKRRVKALQKFRSDM  356

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
              I+ I+G ARAQ ++  ++ E K KEKAN++R TG++P  TC
Sbjct  357  ESIDRIAGGARAQAQEKRRKAEFKAKEKANKIRTTGKIPATTC  399



>ref|XP_006483060.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like 
isoform X1 [Citrus sinensis]
Length=403

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  E+ ++K R+EKLN  I+ WE  KK KA+++L R E ELE++R +ALQ +  ++
Sbjct  298  ADAWEKAEMARIKERYEKLNETILSWEERKKKKARRKLDRAEGELEKRRVKALQKFRSDM  357

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
              I+ I+G ARAQ ++  ++ E K KEKAN++R TG++P  TC
Sbjct  358  ESIDRIAGGARAQAQEKRRKAEFKAKEKANKIRTTGKIPATTC  400



>ref|XP_006348812.1| PREDICTED: neurofilament heavy polypeptide-like [Solanum tuberosum]
Length=351

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 79/124 (64%), Gaps = 20/124 (16%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeael---------------  304
            AD WE +E+EK+++R++KL N IV+WE  KK KAK+ L+++E +                
Sbjct  228  ADIWEKEEMEKIRIRYKKLINEIVDWETKKKKKAKRDLEKVEVDSIKLQAELLSNEKMKL  287

Query  303  ----eekraraLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ  136
                + +RA+A +H+N+E+ RIE I+G A+ Q + + K EE KV EKAN++R TG++P  
Sbjct  288  QAELDRRRAKARKHFNDEVGRIEGIAGGAKEQADQHRKNEELKVIEKANKIRVTGKMPST  347

Query  135  -TCF  127
             +CF
Sbjct  348  CSCF  351



>ref|XP_004985235.1| PREDICTED: axoneme-associated protein mst101(2)-like isoform 
X3 [Setaria italica]
Length=277

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L +V+  +EK+   I EWE +KK KA++Q  + E EL++KRA+AL+ YN+E
Sbjct  172  KADDWEKAKLARVREEYEKMIETIAEWETEKKVKARRQKDQKETELDKKRAKALEEYNQE  231

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +TRI  I+G AR+  E+    +E+K+KEKA+++R TG++P    CF
Sbjct  232  MTRINKIAGGARSMAEERKYNDEKKIKEKAHKIRSTGKVPRTCACF  277



>ref|XP_004985233.1| PREDICTED: axoneme-associated protein mst101(2)-like isoform 
X1 [Setaria italica]
Length=317

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L +V+  +EK+   I EWE +KK KA++Q  + E EL++KRA+AL+ YN+E
Sbjct  212  KADDWEKAKLARVREEYEKMIETIAEWETEKKVKARRQKDQKETELDKKRAKALEEYNQE  271

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +TRI  I+G AR+  E+    +E+K+KEKA+++R TG++P    CF
Sbjct  272  MTRINKIAGGARSMAEERKYNDEKKIKEKAHKIRSTGKVPRTCACF  317



>ref|XP_010106646.1| hypothetical protein L484_015245 [Morus notabilis]
 gb|EXC11025.1| hypothetical protein L484_015245 [Morus notabilis]
Length=240

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  +++KV+   EK  + I+ WE +KK +AK ++++ ++ LE++RA+ +QHY  +
Sbjct  133  KADAWEKAQMKKVQSWNEKSKSAILAWENEKKMQAKLKMEKRKSLLEQRRAQNMQHYQNK  192

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
            + RIE I+G ARAQ E+  ++EE  VK+KA + R  G +P +  CF C
Sbjct  193  VVRIEKIAGGARAQLEEKRRKEELAVKDKAKKTRSGGNVPLKCFCFTC  240



>ref|XP_002488883.1| hypothetical protein SORBIDRAFT_2600s002010 [Sorghum bicolor]
 gb|EES20438.1| hypothetical protein SORBIDRAFT_2600s002010 [Sorghum bicolor]
Length=280

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L +V+  +EK+   I EWE +KK KA++Q ++ E EL+ KRA+AL+ YN+E
Sbjct  175  KADEWEKAKLARVREEYEKMMETIAEWETEKKVKARRQKEQKETELDRKRAKALEEYNQE  234

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +TRI  I+G AR+  E+    +E K+KEKA ++R TG+ P    CF
Sbjct  235  MTRINKIAGGARSMAEERKYNDENKIKEKARKIRSTGKPPRTCACF  280



>gb|KDP41274.1| hypothetical protein JCGZ_15681 [Jatropha curcas]
Length=480

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            AD WE  EL ++K ++E+LN  I+ WE  KK K++++L +IE+ELE KR +A + ++ E+
Sbjct  376  ADIWERDELARIKKKYEELNARILSWENKKKAKSRRKLDKIESELERKRIKAFEQFHSEV  435

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLP-EQTCF  127
              I  I+G AR + ++  ++EE K KEKANQ+R TG+ P  ++CF
Sbjct  436  DDINQIAGGARVKAKERQRKEELKAKEKANQIRKTGKAPNSRSCF  480



>ref|XP_008646882.1| PREDICTED: chromatin assembly factor 1 subunit A-like [Zea mays]
Length=210

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L +V+  +EK+   I EWE +KK KA++Q ++ E EL++KR +AL+ YN E
Sbjct  105  KADEWEKAKLGRVREEYEKMMETIAEWETEKKVKARRQKEQKETELDKKREKALEEYNLE  164

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +TRI  ISG ARA  E+    + +K++EKA+++R TG+ P    CF
Sbjct  165  MTRISKISGGARAMAEERKYNDGKKIREKAHKMRSTGKPPRTCACF  210



>ref|NP_172845.1| Remorin family protein [Arabidopsis thaliana]
 gb|AAD39278.1|AC007576_1 Hypothetical protein [Arabidopsis thaliana]
 gb|AEE29083.1| Remorin family protein [Arabidopsis thaliana]
Length=345

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeael-eekraraLQHYNEE  262
            ADAWE  EL K+K R+EKLN  I  WEA K+ KA+++L   E    E++R R LQ + E+
Sbjct  240  ADAWEKAELSKIKARYEKLNRKIDLWEAKKREKARRKLDISEQSELEQRRKRGLQRFRED  299

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
               IE I+  ARAQ E + + +E KVKEKA  +R TG+LP   C
Sbjct  300  TEYIEQIAAGARAQAEKDRQSKEFKVKEKAGVIRSTGKLPGNAC  343



>gb|AAF79398.1|AC068197_8 F16A14.13 [Arabidopsis thaliana]
Length=356

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeael-eekraraLQHYNEE  262
            ADAWE  EL K+K R+EKLN  I  WEA K+ KA+++L   E    E++R R LQ + E+
Sbjct  251  ADAWEKAELSKIKARYEKLNRKIDLWEAKKREKARRKLDISEQSELEQRRKRGLQRFRED  310

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
               IE I+  ARAQ E + + +E KVKEKA  +R TG+LP   C
Sbjct  311  TEYIEQIAAGARAQAEKDRQSKEFKVKEKAGVIRSTGKLPGNAC  354



>ref|XP_006440687.1| hypothetical protein CICLE_v10024374mg [Citrus clementina]
 gb|ESR53927.1| hypothetical protein CICLE_v10024374mg [Citrus clementina]
Length=228

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A+AWE  +++K+  R+EKL   ++ WE +KK +AK ++++ +AEL++KR    QHY  +
Sbjct  122  KAEAWELAQMQKIIKRYEKLKAAVLTWEYEKKFQAKLKMEKRKAELDKKRTLNQQHYQNK  181

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            I RIE I+G ARAQ E+   ++E ++KEKA  +R   + P + C  C
Sbjct  182  IARIERIAGGARAQAEEERIKKEAEIKEKARMIRSREKAPVKYCLCC  228



>ref|XP_010939078.1| PREDICTED: LOW QUALITY PROTEIN: protein split ends-like [Elaeis 
guineensis]
Length=281

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  E+ K+K R+EK+   I  WE +KK KAK+ L++ E E E+KRA+ALQ Y+ EI
Sbjct  177  ADAWEKAEMAKMKTRYEKMKAKIFGWETEKKTKAKRLLEQKERETEQKRAKALQEYHNEI  236

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            +RI+ IS E +A  ++  + E  K++E A Q+R TGR+     CF
Sbjct  237  SRIDKISAEEKALVDERERNEGHKIREMAKQMRTTGRISHACLCF  281



>ref|XP_010495656.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like 
[Camelina sativa]
Length=346

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            ADAWE  EL K+K R+EKLN  I  WEA K++KA+++L   E   +E++ +   Q + E+
Sbjct  241  ADAWEKAELAKIKARYEKLNRKIDLWEAKKRDKARRKLDISEQSEQEQKRKRGLQRFRED  300

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
               IE I+  ARAQ E   + +E KVKEKA  +R TG LP + C
Sbjct  301  TEYIEQIAAGARAQAEKERQSKEFKVKEKAGVIRSTGELPGKAC  344



>ref|XP_010458857.1| PREDICTED: ensconsin-like [Camelina sativa]
Length=347

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            ADAWE  EL K+K R+EKLN  I  WEA K++KA+++L   E   +E++ +   Q + E+
Sbjct  242  ADAWEKAELAKIKARYEKLNRKIDLWEAKKRDKARRKLDISEQSEQEQKRKRGLQRFRED  301

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
               IE I+  ARAQ E   + +E KVKEKA  +R TG LP + C
Sbjct  302  TEYIEQIAAGARAQAEKERQSKEFKVKEKAGVIRSTGELPGKAC  345



>ref|XP_010476422.1| PREDICTED: remorin-like [Camelina sativa]
 ref|XP_010476423.1| PREDICTED: remorin-like [Camelina sativa]
Length=347

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            ADAWE  EL K+K R+EKLN  I  WEA K++KA+++L   E   +E++ +   Q + E+
Sbjct  242  ADAWEKAELAKIKARYEKLNRKIDLWEAKKRDKARRKLDISEQSEQEQKRKRGLQRFRED  301

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
               IE I+  ARAQ E   + +E KVKEKA  +R TG LP + C
Sbjct  302  TEYIEQIAAGARAQAEKERQSKEFKVKEKAGVIRSTGELPGKAC  345



>ref|NP_001064352.1| Os10g0325400 [Oryza sativa Japonica Group]
 gb|ABB47162.1| Remorin, C-terminal region family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26266.1| Os10g0325400 [Oryza sativa Japonica Group]
 dbj|BAG87431.1| unnamed protein product [Oryza sativa Japonica Group]
Length=357

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQ-RIeaeleekraraLQHYNEE  262
            AD WE +++ K+K ++    + IVEWEA+KK KAK+Q++ +     E KR +AL+ YN+E
Sbjct  252  ADTWEKEKMAKIKKQYNMTMDTIVEWEAEKKAKAKRQMELKEGDNSERKREKALEEYNDE  311

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            ITRI  ++  +R   E+  +  E+KV+EKA ++R TG+LP    CF
Sbjct  312  ITRINKVAAASRLTAEEKRRSAERKVREKAERIRVTGKLPGACGCF  357



>ref|XP_002315011.2| hypothetical protein POPTR_0010s16830g [Populus trichocarpa]
 gb|EEF01182.2| hypothetical protein POPTR_0010s16830g [Populus trichocarpa]
Length=316

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  EL K++ R+E++N  I+ WE  KK KA+++L++ E++LE  R+RAL+ ++++I
Sbjct  212  ADAWERAELSKIQKRYEQMNATILSWENKKKEKARKRLRKTESDLERIRSRALKQFHDDI  271

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              I+ I+G A+A+  +  + EE K KEKAN +R TG+LP +TCF
Sbjct  272  VDIDQIAGGAKAKAAERQRNEEFKAKEKANTIRKTGKLP-RTCF  314



>ref|XP_009137069.1| PREDICTED: uncharacterized protein LOC103861116 [Brassica rapa]
Length=306

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE  +L+K+KLR+EK+   IV WE ++K+ AK ++++ ++EL+++     QHY  +
Sbjct  197  KADSWEKSQLDKIKLRYEKMKAEIVGWENERKSAAKLRMEKRKSELQKRTEINNQHYKTK  256

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            + RI+ I+  A+ Q E+  + +E +V+EK  ++R TG++P    CF
Sbjct  257  LARIQVIADGAKKQLEEKKRSQEAQVQEKVKKMRRTGKVPANYLCF  302



>gb|KGN64032.1| hypothetical protein Csa_1G038990 [Cucumis sativus]
Length=273

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            RAD WE  ++EK+  R+ K+   I+ WE +KK  AK  +++ +AELE K+A   Q+Y E 
Sbjct  165  RADVWERNKMEKISKRYLKIKASILAWENEKKMHAKHHMEKKKAELERKKALFQQYYQEN  224

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
            I RI+ I+G ARAQ E+  KREE+K +E AN++R TGRLP    CF C
Sbjct  225  IARIDQIAGGARAQLEEKRKREEKKARETANRIRSTGRLPVTCFCFQC  272



>ref|XP_010663298.1| PREDICTED: uncharacterized protein At3g61260 isoform X2 [Vitis 
vinifera]
 ref|XP_010663299.1| PREDICTED: uncharacterized protein At3g61260 isoform X2 [Vitis 
vinifera]
 ref|XP_010663300.1| PREDICTED: uncharacterized protein At3g61260 isoform X2 [Vitis 
vinifera]
 emb|CBI15154.3| unnamed protein product [Vitis vinifera]
Length=227

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  ++ K+K R + +++ I+ WE +KK +AK  ++R ++ELE+++A  LQHY  +
Sbjct  122  KADAWEKAQITKIKKRNDNISSRILAWENEKKMRAKLIMERKKSELEQRKALNLQHYQIK  181

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ I+G ARAQ ++  + EE +VK KA  +R TG++P + CF
Sbjct  182  IERIDQIAGGARAQLQEKRRNEESEVKHKAEMIRKTGKVPVR-CF  225



>ref|XP_006477614.1| PREDICTED: uncharacterized protein LOC102610074 isoform X1 [Citrus 
sinensis]
 ref|XP_006477615.1| PREDICTED: uncharacterized protein LOC102610074 isoform X2 [Citrus 
sinensis]
 ref|XP_006477616.1| PREDICTED: uncharacterized protein LOC102610074 isoform X3 [Citrus 
sinensis]
Length=229

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A+AWE  +++K+  R+EKL   ++ WE +KK +A  ++++ +AEL+++R    QHY  +
Sbjct  123  KAEAWELAQMQKIIKRYEKLKAAVLTWEYEKKFQATLKMEKRKAELDKRRTLNQQHYQNK  182

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            I RIE I+G ARAQ E+  +++E ++KEKA  +R  G+ P + C  C
Sbjct  183  IARIERIAGGARAQAEEERRKKEAEIKEKAKMIRSRGKAPVKYCLCC  229



>ref|XP_008671220.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 ref|XP_008671225.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 ref|XP_008671232.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 ref|XP_008671239.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 ref|XP_008671244.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 tpg|DAA44033.1| TPA: hypothetical protein ZEAMMB73_289642 [Zea mays]
Length=283

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L +V+  +EK+   I EWE +KK KA++Q ++ E EL+ KR +AL+ YN E
Sbjct  178  KADEWEKAKLGRVREEYEKMMETIAEWETEKKVKARRQKEQKETELDRKREKALEEYNLE  237

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +TRI  ISG ARA  E+    + +K++EKA ++R TG+ P    CF
Sbjct  238  MTRISKISGGARAMAEERKYNDRKKIREKARKMRSTGKPPRTCACF  283



>gb|KFK43642.1| hypothetical protein AALP_AA1G153500 [Arabis alpina]
Length=345

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeael-eekraraLQHYNEE  262
            AD WE  EL K+K R+EKLN  I  WE  K++KA+++L + E    E+ R R LQ + E+
Sbjct  239  ADDWEKAELAKIKARYEKLNRKIDIWETKKRDKARRKLDKSEQSELEQTRRRGLQRFRED  298

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
               IE IS  ARAQ +   + EE K KEKA  +R TG+LP + C +C
Sbjct  299  TEYIEHISAGARAQADKQRQSEEFKAKEKAGIIRSTGKLPGKAC-LC  344



>gb|KFK32017.1| hypothetical protein AALP_AA6G189400 [Arabis alpina]
Length=142

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 64/104 (62%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
             D W+  E+ K K ++EKL+  I+ WE  K+ KAK++L R E  +E  + +ALQ + +E 
Sbjct  40   VDQWKETEIGKAKKKYEKLSEKIMSWEDYKRKKAKRKLHRTERGVERTKLKALQKFRDEN  99

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RIE I   ARA   ++  +EE KVKEKAN +R TGR P  TC 
Sbjct  100  ERIEIIVASARAHAYESRMKEELKVKEKANLMRTTGRSP-STCL  142



>dbj|BAJ98071.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE ++L +V+  +EK+   I EWE +KK KAK+Q ++ E  L+ KRA+ L  YN+E
Sbjct  209  KADVWEKEKLARVREEYEKMMETIAEWETEKKVKAKRQKEQKEVALDRKRAKQLAEYNQE  268

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            +TRI  I+G AR+   +    +E+K++EKA ++R TG+     CF
Sbjct  269  MTRINKIAGGARSMAGERKYEDEKKIREKAKKIRSTGKSARGCCF  313



>ref|XP_008646772.1| PREDICTED: uncharacterized protein LOC103628330 [Zea mays]
Length=296

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L +V+  +EK+   I EWE +KK KA++Q ++ E EL++KR +AL+ YN E
Sbjct  191  KADEWEKAKLGRVREEYEKMMETIAEWETEKKVKARRQKEQKETELDKKREKALEEYNLE  250

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
            +TRI  ISG ARA  E+    + +K++EKA+++R TG+ P +TC
Sbjct  251  MTRISKISGGARAMAEERKYNDGKKIREKAHKMRSTGK-PPRTC  293



>ref|XP_009801837.1| PREDICTED: uncharacterized protein At3g61260 isoform X3 [Nicotiana 
sylvestris]
Length=161

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  +  K++ R ++L + ++ WE +KK  AKQQ++R + +LE    R LQHY  +
Sbjct  56   KADAWEKAQTAKIRKRHDELLSALLAWENEKKMIAKQQMERRKNQLELAMKRNLQHYKNK  115

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFI  124
            + RI+ I+  AR Q E+  K EE  VKEK+N++R TG +  + CF 
Sbjct  116  LARIDHIAKGARTQAEEKRKYEESIVKEKSNKIRSTGNVSVK-CFC  160



>ref|NP_001144423.1| hypothetical protein [Zea mays]
 ref|XP_008671253.1| PREDICTED: hypothetical protein isoform X5 [Zea mays]
 gb|ACG40405.1| hypothetical protein [Zea mays]
 tpg|DAA44035.1| TPA: hypothetical protein ZEAMMB73_289642 [Zea mays]
Length=316

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L +V+  +EK+   I EWE +KK KA++Q ++ E EL+ KR +AL+ YN E
Sbjct  211  KADEWEKAKLGRVREEYEKMMETIAEWETEKKVKARRQKEQKETELDRKREKALEEYNLE  270

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +TRI  ISG ARA  E+    + +K++EKA ++R TG+ P    CF
Sbjct  271  MTRISKISGGARAMAEERKYNDRKKIREKARKMRSTGKPPRTCACF  316



>ref|XP_008671206.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=323

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L +V+  +EK+   I EWE +KK KA++Q ++ E EL+ KR +AL+ YN E
Sbjct  218  KADEWEKAKLGRVREEYEKMMETIAEWETEKKVKARRQKEQKETELDRKREKALEEYNLE  277

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +TRI  ISG ARA  E+    + +K++EKA ++R TG+ P    CF
Sbjct  278  MTRISKISGGARAMAEERKYNDRKKIREKARKMRSTGKPPRTCACF  323



>ref|XP_006303005.1| hypothetical protein CARUB_v10021160mg, partial [Capsella rubella]
 gb|EOA35903.1| hypothetical protein CARUB_v10021160mg, partial [Capsella rubella]
Length=121

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
             D W+  E+ K + ++EKL+  IV WE  ++ KAK++L R E  +E+ + +A++ + +E 
Sbjct  19   VDQWKETEMGKTRKKYEKLSEKIVSWEDKQRKKAKRKLHRTERGVEKTKLKAIERFRDEN  78

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RIE I   ARA   ++  +EE KVKEKAN +R TGR P  TC 
Sbjct  79   ERIEIIVASARAHAYESQTKEELKVKEKANLMRATGRKP-STCL  121



>ref|XP_009801836.1| PREDICTED: remorin isoform X2 [Nicotiana sylvestris]
Length=194

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  +  K++ R ++L + ++ WE +KK  AKQQ++R + +LE    R LQHY  +
Sbjct  89   KADAWEKAQTAKIRKRHDELLSALLAWENEKKMIAKQQMERRKNQLELAMKRNLQHYKNK  148

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            + RI+ I+  AR Q E+  K EE  VKEK+N++R TG +  + CF
Sbjct  149  LARIDHIAKGARTQAEEKRKYEESIVKEKSNKIRSTGNVSVK-CF  192



>ref|XP_010663297.1| PREDICTED: uncharacterized protein At3g61260 isoform X1 [Vitis 
vinifera]
Length=273

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  ++ K+K R + +++ I+ WE +KK +AK  ++R ++ELE+++A  LQHY  +
Sbjct  168  KADAWEKAQITKIKKRNDNISSRILAWENEKKMRAKLIMERKKSELEQRKALNLQHYQIK  227

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ I+G ARAQ ++  + EE +VK KA  +R TG++P + CF
Sbjct  228  IERIDQIAGGARAQLQEKRRNEESEVKHKAEMIRKTGKVPVR-CF  271



>ref|XP_010546168.1| PREDICTED: uncharacterized protein LOC104818328 [Tarenaya hassleriana]
Length=250

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE   ++K++ R+EK+ + I+ WE ++K  A+ ++++ ++ELE ++    + Y  +
Sbjct  142  KADSWECVRIKKIRKRYEKMKDTILAWENERKLAARLKMEKSKSELERRKEINNRRYRSK  201

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLP-EQTCFIC  121
            ++RIE I+  A+ Q E+  K EE +VKEKAN +R TG++P +  CF C
Sbjct  202  LSRIEMIARGAKQQLEEKRKSEEARVKEKANTMRRTGKVPMDYFCFRC  249



>ref|XP_010030400.1| PREDICTED: remorin isoform X1 [Eucalyptus grandis]
 gb|KCW83685.1| hypothetical protein EUGRSUZ_B00564 [Eucalyptus grandis]
Length=259

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 2/106 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  ++E ++ R E L + I  WE +KK +AK   +R   ELE++R+R  QHY  +
Sbjct  155  KADAWERAQIEMIRKRHENLKSSIFSWENEKKTRAKHSFERKRNELEQRRSRNQQHYQYK  214

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFI  124
            + RI+ ++ EA AQ E+  + EE +VKEKA ++R +G  P  TCF 
Sbjct  215  VARIDHMAREATAQAEEKRRTEESRVKEKAKKIR-SGEAPF-TCFC  258



>ref|XP_010030405.1| PREDICTED: remorin isoform X2 [Eucalyptus grandis]
Length=257

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 2/106 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  ++E ++ R E L + I  WE +KK +AK   +R   ELE++R+R  QHY  +
Sbjct  153  KADAWERAQIEMIRKRHENLKSSIFSWENEKKTRAKHSFERKRNELEQRRSRNQQHYQYK  212

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFI  124
            + RI+ ++ EA AQ E+  + EE +VKEKA ++R +G  P  TCF 
Sbjct  213  VARIDHMAREATAQAEEKRRTEESRVKEKAKKIR-SGEAPF-TCFC  256



>ref|XP_009801834.1| PREDICTED: remorin isoform X1 [Nicotiana sylvestris]
 ref|XP_009801835.1| PREDICTED: remorin isoform X1 [Nicotiana sylvestris]
Length=212

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  +  K++ R ++L + ++ WE +KK  AKQQ++R + +LE    R LQHY  +
Sbjct  107  KADAWEKAQTAKIRKRHDELLSALLAWENEKKMIAKQQMERRKNQLELAMKRNLQHYKNK  166

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            + RI+ I+  AR Q E+  K EE  VKEK+N++R TG +  + CF
Sbjct  167  LARIDHIAKGARTQAEEKRKYEESIVKEKSNKIRSTGNVSVK-CF  210



>ref|XP_009595348.1| PREDICTED: remorin [Nicotiana tomentosiformis]
 ref|XP_009595349.1| PREDICTED: remorin [Nicotiana tomentosiformis]
 ref|XP_009595350.1| PREDICTED: remorin [Nicotiana tomentosiformis]
 ref|XP_009595351.1| PREDICTED: remorin [Nicotiana tomentosiformis]
 ref|XP_009595352.1| PREDICTED: remorin [Nicotiana tomentosiformis]
Length=195

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  +  K++ R ++L + ++ WE +KK  AKQQ++R + +LE    R LQHY  +
Sbjct  90   KADAWEKAQTAKIRKRHDELLSALLAWENEKKMIAKQQMERRKNQLELAMKRNLQHYKNK  149

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            + RI+ I+  AR Q E+  K EE  VKEK+N++R TG +  + CF
Sbjct  150  LARIDHIAKGARTQAEEKRKYEESIVKEKSNKIRSTGNVSVK-CF  193



>gb|EAY78032.1| hypothetical protein OsI_33072 [Oryza sativa Indica Group]
Length=547

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQ-RIeaeleekraraLQHYNEE  262
            AD WE +++ K+K ++    + IVEWEA+KK KAK+Q++ +     E KR +AL+ YN+E
Sbjct  442  ADTWEKEKMAKIKKQYNMTMDTIVEWEAEKKAKAKRQMELKEGDNSERKREKALEEYNDE  501

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            ITRI  ++  +R   E+  +  E+KV+EKA ++R TG+LP    CF
Sbjct  502  ITRINKVAAASRLTAEEKRRSAERKVREKAERIRVTGKLPGACGCF  547



>ref|XP_004499418.1| PREDICTED: uncharacterized protein LOC101490290 [Cicer arietinum]
Length=447

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A+AWE  ++E+++ R+EK+ + I+ WE++K+ +AK  ++R + E + KRA  ++HY  +
Sbjct  339  KAEAWEKAKIERIQKRYEKMKSQILSWESEKRIEAKLHMERKKNENDHKRANEIEHYKRK  398

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ I   A  + E++ ++EE KV+EKAN++R TG++P  TCF
Sbjct  399  IARIDKIGERAIKELEEHRRKEELKVREKANKIRKTGKVP-VTCF  442



>ref|NP_001145483.1| uncharacterized protein LOC100278877 [Zea mays]
 gb|ACG47943.1| hypothetical protein [Zea mays]
Length=315

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 71/104 (68%), Gaps = 1/104 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L KV+  +EK+   I EWE +KK KA++  ++ E  L+ KRA+AL+ YN+E
Sbjct  210  KADEWEKAKLAKVREEYEKMMETIAEWETEKKVKARRHKEQRETVLDRKRAKALEEYNQE  269

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
            +TRI  I+G AR+  E+    +E K+KEKA+++R T R P +TC
Sbjct  270  MTRISKIAGGARSMAEERKYNDENKIKEKAHKIRST-RKPPRTC  312



>gb|EYU22383.1| hypothetical protein MIMGU_mgv1a025160mg [Erythranthe guttata]
Length=242

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE +E+  ++ R  +L  II  WE  KK KA  +L+  + +L+++RA+A+Q + E+ 
Sbjct  138  ADAWEKEEMASIQERHLRLIAIIDNWEMKKKKKADHKLENTKNKLKKRRAKAVQSHREKT  197

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
             RIE ++G ARAQ E+N + EE K KEKAN+++ TG++P    CF
Sbjct  198  KRIEEVAGGARAQAEENRRNEELKAKEKANKIKLTGKIPPTCLCF  242



>ref|XP_003520101.1| PREDICTED: remorin-like [Glycine max]
 gb|KHN02015.1| hypothetical protein glysoja_034537 [Glycine soja]
Length=266

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 69/106 (65%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  E ++++ R++KL  +I  WE  KK KA+++L + E  + ++R +AL+ +  +
Sbjct  159  KADEWERAEFQEIRQRYDKLREVIDSWENKKKMKARRKLDKEERGVAQRRMKALEDFQNK  218

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFI  124
            IT I+ I+  AR + E++ + EEQK KEKAN +R TG +P   CF 
Sbjct  219  ITAIDQIADGARTKAEESRRNEEQKTKEKANVIRTTGEMP-GICFC  263



>ref|XP_002438860.1| hypothetical protein SORBIDRAFT_10g027380 [Sorghum bicolor]
 gb|EER90227.1| hypothetical protein SORBIDRAFT_10g027380 [Sorghum bicolor]
Length=374

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 72/106 (68%), Gaps = 2/106 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQ-RIeaeleekraraLQHYNEE  262
            ADAWE ++L K+K ++ +    I EWE +KK KAK+Q + + E+E + KRA+AL+ YNEE
Sbjct  269  ADAWEKEKLAKIKKQYNETMQTIAEWETEKKAKAKRQKELKDESESDRKRAKALEEYNEE  328

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            ++RI  ++  +R   ED  +  E+KV++KA+ +R TG+LP    CF
Sbjct  329  MSRINKVAAASRLTAEDKRRSAERKVRDKAHTIRSTGKLPGTCGCF  374



>ref|XP_009380559.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=228

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            + DAWE  +++K++ R++K+ +II+EW+ +KK KAK++++R E +LE +  RAL+ +  E
Sbjct  123  KVDAWERAKIDKIRKRYDKMKSIILEWQNEKKLKAKRRMERKERDLELRHERALREHRIE  182

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            ++RI+ ++  ARA  E+  +  E    EKA ++R TG++P  TCF
Sbjct  183  VSRIDKMADGARALAEERKRNGESTTVEKAKKMRSTGKVP-HTCF  226



>gb|EAZ15655.1| hypothetical protein OsJ_31068 [Oryza sativa Japonica Group]
Length=1197

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = -2

Query  438   ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQ-RIeaeleekraraLQHYNEE  262
             AD WE +++ K+K ++    + IVEWEA+KK KAK+Q++ +     E KR +AL+ YN+E
Sbjct  1092  ADTWEKEKMAKIKKQYNMTMDTIVEWEAEKKAKAKRQMELKEGDNSERKREKALEEYNDE  1151

Query  261   ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
             ITRI  ++  +R   E+  +  E+KV+EKA ++R TG+LP    CF
Sbjct  1152  ITRINKVAAASRLTAEEKRRSAERKVREKAERIRVTGKLPGACGCF  1197



>ref|XP_006661687.1| PREDICTED: neurofilament heavy polypeptide-like [Oryza brachyantha]
Length=346

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQL-QRIeaeleekraraLQHYNEE  262
            AD WE +++ K+K ++    + I EWEA+KK KAK+Q+ Q+     E KRA+AL+ Y++E
Sbjct  241  ADKWEKEKMAKIKKQYSMTMDTIAEWEAEKKAKAKRQMEQKQGDNSERKRAKALEEYSDE  300

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +TRI  ++  +R   E+     E+KV+EKA+++R TG+LP    CF
Sbjct  301  MTRINKVAAASRLTAEEKRGSAERKVREKADRIRVTGKLPRSCGCF  346



>gb|AFW89250.1| hypothetical protein ZEAMMB73_646734 [Zea mays]
Length=358

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 71/104 (68%), Gaps = 1/104 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L KV+  +EK+   I EWE +KK KA++  ++ E  L+ KRA+AL+ YN+E
Sbjct  253  KADEWEKAKLAKVREEYEKMMETIAEWETEKKVKARRHKEQRETVLDRKRAKALEEYNQE  312

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
            +TRI  I+G AR+  E+    +E K+KEKA+++R T R P +TC
Sbjct  313  MTRISKIAGGARSMAEERKYNDENKIKEKAHKIRST-RKPPRTC  355



>ref|XP_006394521.1| hypothetical protein EUTSA_v10004785mg [Eutrema salsugineum]
 gb|ESQ31807.1| hypothetical protein EUTSA_v10004785mg [Eutrema salsugineum]
Length=263

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE+ ++ K+KLR+EK+   IV WE ++K  AK +++R ++ELE+++    QHY  +
Sbjct  155  KADSWENTQMNKIKLRYEKMKAEIVGWENERKLTAKLRMERRKSELEKRKEINNQHYKSK  214

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLP-EQTCFIC  121
            + RI+ I+  A+ Q E+  K +E +++++  ++R TG++P    CF C
Sbjct  215  LARIQLIADGAKKQLEEKRKSKEAQLRDEVKKMRRTGKVPINYFCFRC  262



>ref|XP_002890028.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66287.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
Length=345

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            A+ WE+ +L K+K R+EKLN  I  WEA K+ KA+++L   E    E+R +   Q + E+
Sbjct  240  ANTWENAQLAKIKARYEKLNRKIDLWEAKKREKARRKLDMSEQSELEQRRKRGLQRFRED  299

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
               IE I+  ARAQ E + + +E KVKEKA  +R TG+LP + C
Sbjct  300  TEYIEQIAAGARAQAEKDRQSKEFKVKEKAGVIRSTGKLPGKAC  343



>emb|CDP17491.1| unnamed protein product [Coffea canephora]
Length=203

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  ++ K+K R+E++ + I+ WE +KK + K QL++ ++ELE +R R LQ+Y  +
Sbjct  98   KADAWEKAQMAKIKKRYERMQSDILAWEHEKKMQEKLQLEKKKSELELRRERNLQYYRSK  157

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            + RI+  +G AR Q E+  K EE  VKEKA  +R TG  P + CF
Sbjct  158  LARIDHNAGGARKQIEEKRKYEESVVKEKARNIRSTGNAPLR-CF  201



>ref|XP_004242181.1| PREDICTED: remorin [Solanum lycopersicum]
Length=196

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  ++ K++ R ++L + ++ WE +KK  AK+Q++R + ++E    R LQHY  +
Sbjct  91   KADAWEKAQIAKIRKRHDELLSALLAWENEKKMMAKEQMERRKNQVELALKRNLQHYKNK  150

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            + RI+ I+  AR Q E+  + EE  VKEK+N++R T R    TC+
Sbjct  151  LARIDHIAKGARTQAEEKRRYEETTVKEKSNKIRST-RTGPVTCY  194



>ref|XP_006417078.1| hypothetical protein EUTSA_v10009533mg [Eutrema salsugineum]
 gb|ESQ35431.1| hypothetical protein EUTSA_v10009533mg [Eutrema salsugineum]
Length=354

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            ADAWE  EL K++ R++KL   I  WE  K++KA+++L + E    E+R +   Q + E+
Sbjct  248  ADAWEKAELLKIEARYDKLTRKIDLWETKKRDKARRKLDKSEQSELEQRRKRGLQRFRED  307

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
               IE I+  ARAQ E   + EE KVKEKA  +R TG++P + C +C
Sbjct  308  TEYIEQIAAGARAQAEKQRQNEELKVKEKAGIVRTTGKIPGKAC-LC  353



>ref|XP_008389429.1| PREDICTED: remorin-like [Malus domestica]
 ref|XP_008350907.1| PREDICTED: remorin-like [Malus domestica]
Length=326

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 71/104 (68%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            AD WE  E+ ++K R EK+N  I+ WE  KK K+   L +IE+E+E KRA+ALQ ++ E+
Sbjct  222  ADIWEETEIARLKERHEKINATILAWEKKKKKKSTNHLHKIESEVERKRAKALQKFSSEM  281

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              I+ I+  ARA+ E+  ++E  KVKEKAN +R TG+ P +TCF
Sbjct  282  ETIKQIAQGARAEAEERHRKEVLKVKEKANAMRTTGKAP-KTCF  324



>ref|XP_010680747.1| PREDICTED: uncharacterized protein LOC104895823 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=410

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 28/134 (21%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQ-----------------------  328
            ADAWE +++ K+K R+EKLN  I+EWE  K+NKA+++                       
Sbjct  276  ADAWEREQMAKIKERYEKLNATILEWEDKKRNKARRKLEMTEVRIIYKQDSSCYKIRKAI  335

Query  327  -----LQRIeaeleekraraLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQL  163
                 LQ+ + E E++RA+ALQ Y+ E+ RI+ I+  ARAQ ++  + EE KVKEKAN+ 
Sbjct  336  LTMFCLQKRQNEPEKRRAKALQKYHIEMERIKQIADGARAQAKEKRRNEEFKVKEKANKY  395

Query  162  RYTGRLPEQTCFIC  121
            R TG  P     +C
Sbjct  396  RATGEPPLPPMCLC  409



>gb|KHN03627.1| hypothetical protein glysoja_031124 [Glycine soja]
Length=259

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 69/106 (65%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  E ++++ R++KL  +I  WE  KK KA+++L + E  + ++R +AL+ +  +
Sbjct  152  KADEWERAEFQEIRQRYDKLREVIDSWENKKKMKARRKLDKEERGVAQRRMKALEDFQNK  211

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFI  124
            IT I+ I+  AR + E++ + EEQK KEKAN ++ TG +P   CF 
Sbjct  212  ITAIDQIADGARTKAEESRRNEEQKAKEKANAIQTTGEMP-GICFC  256



>ref|XP_010680749.1| PREDICTED: MAP7 domain-containing protein 1 isoform X3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680750.1| PREDICTED: MAP7 domain-containing protein 1 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=366

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 28/134 (21%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQ-----------------------  328
            ADAWE +++ K+K R+EKLN  I+EWE  K+NKA+++                       
Sbjct  232  ADAWEREQMAKIKERYEKLNATILEWEDKKRNKARRKLEMTEVRIIYKQDSSCYKIRKAI  291

Query  327  -----LQRIeaeleekraraLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQL  163
                 LQ+ + E E++RA+ALQ Y+ E+ RI+ I+  ARAQ ++  + EE KVKEKAN+ 
Sbjct  292  LTMFCLQKRQNEPEKRRAKALQKYHIEMERIKQIADGARAQAKEKRRNEEFKVKEKANKY  351

Query  162  RYTGRLPEQTCFIC  121
            R TG  P     +C
Sbjct  352  RATGEPPLPPMCLC  365



>ref|XP_007037476.1| Uncharacterized protein TCM_014147 [Theobroma cacao]
 gb|EOY21977.1| Uncharacterized protein TCM_014147 [Theobroma cacao]
Length=402

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAWE  ++EKV  R+E     I+ W  +KK +AK +++R + ELE+K  R  Q Y  +
Sbjct  297  KADAWEKAQMEKVNRRYEDKKASILAWANEKKLRAKIKMERRKKELEQKIKRNQQFYQAK  356

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ ++G ARAQ ++  + EE KVKEKA + R +G+ P  TCF
Sbjct  357  IARIDHVAGGARAQADEQRRNEELKVKEKARKTRASGQDP-VTCF  400



>ref|XP_003517822.1| PREDICTED: remorin-like [Glycine max]
Length=266

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 69/106 (65%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  E ++++ R++KL  +I  WE  KK KA+++L + E  + ++R +AL+ +  +
Sbjct  159  KADEWERAEFQEIRQRYDKLREVIDSWENKKKMKARRKLDKEERGVAQRRMKALEDFQNK  218

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFI  124
            IT I+ I+  AR + E++ + EEQK KEKAN ++ TG +P   CF 
Sbjct  219  ITAIDQIADGARTKAEESRRNEEQKAKEKANAIQTTGEMP-GICFC  263



>gb|EMT06811.1| hypothetical protein F775_09107 [Aegilops tauschii]
Length=351

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            A AWE +EL K+K R+ +    I EWE +KK KA++Q +  E + E KRA+AL+ YN+E+
Sbjct  247  AAAWEKEELAKIKERYNETMETIAEWETEKKAKARRQKEPKEGDSERKRAKALEEYNDEM  306

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
             RI  ++  +R   ED  +  E KV EKA ++R TG+LP    CF
Sbjct  307  KRISKVAAASRMSAEDKKRNAEGKVWEKAAKIRSTGKLPRSCGCF  351



>ref|XP_008775959.1| PREDICTED: uncharacterized protein LOC103696202 [Phoenix dactylifera]
Length=235

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  + +K+K R+EK+ + I++ E +KK KAKQ+L++ +   E +RA+AL+ Y  EI
Sbjct  131  ADAWEKAKRDKIKTRYEKMKSKILDRETEKKIKAKQRLEQKQRGPEPRRAKALEEYQNEI  190

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +RI+ IS E R   +   + +E K++E A Q+R TG +P    CF
Sbjct  191  SRIDKISAEDRLLVDKRERNDELKIREMAKQMRSTGDIPHACVCF  235



>ref|XP_008447778.1| PREDICTED: remorin-like isoform X2 [Cucumis melo]
Length=274

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            RAD WE  ++E++  R+ K+   I+ WE +KK  AK  +++ + ELE K+A   Q+Y+E 
Sbjct  166  RADVWERNKMERISKRYLKIKASILAWENEKKMHAKLHMEKKKDELERKKALFQQYYHEN  225

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ I+G ARA  E+  KREE+K +E AN++R TGRLP  TCF
Sbjct  226  IARIDQIAGGARAHLEEKRKREEKKARETANRIRSTGRLP-VTCF  269



>ref|XP_008447698.1| PREDICTED: remorin-like isoform X1 [Cucumis melo]
Length=280

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            RAD WE  ++E++  R+ K+   I+ WE +KK  AK  +++ + ELE K+A   Q+Y+E 
Sbjct  172  RADVWERNKMERISKRYLKIKASILAWENEKKMHAKLHMEKKKDELERKKALFQQYYHEN  231

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ I+G ARA  E+  KREE+K +E AN++R TGRLP  TCF
Sbjct  232  IARIDQIAGGARAHLEEKRKREEKKARETANRIRSTGRLP-VTCF  275



>ref|XP_009783168.1| PREDICTED: chromodomain-helicase-DNA-binding protein 7-like isoform 
X1 [Nicotiana sylvestris]
Length=376

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 80/120 (67%), Gaps = 15/120 (13%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekr----------  292
            +AD WE +E+EK+  R++KL   IVEWE  KK KAK+ L+RIEAE+   +          
Sbjct  258  KADIWEKEEMEKIIERYKKLITEIVEWETKKKKKAKRNLERIEAEILSNKNKMKLQAELD  317

Query  291  ---araLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
               A+A++H+N E+ RIESI+G A+ Q + N + EE KVKEKAN++R TG++P  TC +C
Sbjct  318  RRRAKAMRHFNNEVGRIESIAGGAKEQADQNRENEELKVKEKANKIRSTGKMP-ATC-LC  375



>ref|XP_002312276.2| hypothetical protein POPTR_0008s09290g [Populus trichocarpa]
 gb|EEE89643.2| hypothetical protein POPTR_0008s09290g [Populus trichocarpa]
Length=189

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 69/104 (66%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  EL K++ R+EK N  I+ WE  KK KA+ +L++ E + E  R++AL+ +  E+
Sbjct  85   ADAWERAELSKIQKRYEKTNARILSWENRKKEKARNRLKKTENDSEGIRSKALKQFRAEM  144

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              I+ I+G A+A+  +  + EE + K KAN +R TG+LP +TCF
Sbjct  145  ADIDQIAGAAKAKAAERQRNEELRAKGKANTIRKTGKLP-RTCF  187



>ref|XP_004983300.1| PREDICTED: ensconsin-like [Setaria italica]
Length=353

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQ-RIeaeleekraraLQHYNEE  262
            ADAWE ++L K+K ++ +    I EWEA+KK KA++Q + + E++ E KRA+AL+ YNEE
Sbjct  248  ADAWEKEKLAKIKKQYNETMETIAEWEAEKKAKARRQKELKDESDSERKRAKALEEYNEE  307

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            ++RI  ++  +R   E+  +  ++KV++KA  +R TG+LP +TC +C
Sbjct  308  MSRINKVAAASRLTAEEKRRSADRKVRDKAQTIRSTGKLP-RTC-VC  352



>ref|XP_007158621.1| hypothetical protein PHAVU_002G168100g [Phaseolus vulgaris]
 gb|ESW30615.1| hypothetical protein PHAVU_002G168100g [Phaseolus vulgaris]
Length=270

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNE  265
            +A+AWE +ELEK+K R+EKL   I  WE  KK K+ ++L +++    E++     + Y E
Sbjct  164  KANAWEREELEKIKERYEKLLETIGSWEKRKKAKSVRKLNKLQHGDNERKRAKALKKYEE  223

Query  264  EITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            ++  +  I G A+AQ E+  + E  K KEKAN +R TG++P   +CF
Sbjct  224  KMNYVNLIVGGAKAQAEERRRNEVLKAKEKANIIRTTGKIPGPCSCF  270



>ref|XP_002866424.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42683.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
Length=263

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE+  ++K++LR+EK+   IV WE ++K  A  ++++ ++E+E++R    QHY  +
Sbjct  155  KADSWENSHIKKIRLRYEKMKADIVGWENERKLVATLRMEKKKSEMEKRREINNQHYKSK  214

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLP-EQTCFIC  121
            + RI+ I+  A+ Q E+  + +E +V EK  ++R TG++P    CF C
Sbjct  215  LARIKLIADGAKKQLEEKRRSKEAQVHEKVKKMRRTGKIPINYFCFRC  262



>ref|XP_011012381.1| PREDICTED: remorin-like isoform X2 [Populus euphratica]
Length=311

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  EL K++ R+E++N  I+ WE  KK KA+++L++ E++LE  R RA + +++++
Sbjct  207  ADAWERAELSKIQKRYEQVNATILSWENKKKEKAQKRLRKTESDLERIRLRAFKQFHDDM  266

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              I+ I+G A+A+  +  + EE K KEKAN +R TG+LP + CF
Sbjct  267  VDIDQIAGGAKAKAAERQRNEEFKAKEKANTIRKTGKLP-RACF  309



>ref|XP_009356369.1| PREDICTED: uncharacterized protein At3g61260 isoform X1 [Pyrus 
x bretschneideri]
Length=328

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            RAD WE  E+ ++K R+EK+N  IV WE  KK K+ + L +IE+E+E KRA+A+  +  E
Sbjct  223  RADIWEETEIARLKERYEKINATIVAWEKKKKKKSTKHLHKIESEVERKRAKAVLQFGSE  282

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            +  I+ I+  ARA+ E+  ++E  KVKEKAN +R TG+ P +TCF
Sbjct  283  METIKQIAEGARAKAEERHRKEVLKVKEKANAMRTTGKAP-KTCF  326



>ref|XP_011012373.1| PREDICTED: remorin-like isoform X1 [Populus euphratica]
Length=313

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  EL K++ R+E++N  I+ WE  KK KA+++L++ E++LE  R RA + +++++
Sbjct  209  ADAWERAELSKIQKRYEQVNATILSWENKKKEKAQKRLRKTESDLERIRLRAFKQFHDDM  268

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              I+ I+G A+A+  +  + EE K KEKAN +R TG+LP + CF
Sbjct  269  VDIDQIAGGAKAKAAERQRNEEFKAKEKANTIRKTGKLP-RACF  311



>ref|XP_006391031.1| hypothetical protein EUTSA_v10019347mg [Eutrema salsugineum]
 gb|ESQ28317.1| hypothetical protein EUTSA_v10019347mg [Eutrema salsugineum]
Length=108

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = -2

Query  435  DAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEIT  256
            D W+  E+ K + ++EKL+  IV WE  +K KAK++L R E  +E+ + +A+Q + +E  
Sbjct  6    DLWKETEIGKTRKKYEKLSEKIVLWEDKRKKKAKRKLHRTERGVEKTKMKAMQRFRDENE  65

Query  255  RIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             IE I   ARA   ++  +EE KVKEKAN +R TGR P  TC 
Sbjct  66   SIEMIVASARAHAYESRVKEELKVKEKANLMRTTGRSPSTTCL  108



>ref|XP_009356370.1| PREDICTED: uncharacterized protein At3g61260 isoform X2 [Pyrus 
x bretschneideri]
Length=326

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            RAD WE  E+ ++K R+EK+N  IV WE  KK K+ + L +IE+E+E KRA+A+  +  E
Sbjct  221  RADIWEETEIARLKERYEKINATIVAWEKKKKKKSTKHLHKIESEVERKRAKAVLQFGSE  280

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            +  I+ I+  ARA+ E+  ++E  KVKEKAN +R TG+ P +TCF
Sbjct  281  METIKQIAEGARAKAEERHRKEVLKVKEKANAMRTTGKAP-KTCF  324



>gb|KDP31308.1| hypothetical protein JCGZ_11684 [Jatropha curcas]
Length=207

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            + D+WE  +  K+  R+EKL + ++ WE  KK +AK +++R + ELE +++R  QHY  +
Sbjct  102  KVDSWEKAQRRKINKRYEKLKSEVLVWENAKKREAKIRMERKKNELELRKSRNYQHYLIK  161

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            + RI++I+G A+ Q E+  + +E +VKEKA  +R  G+ P + CF C
Sbjct  162  LDRIDAIAGGAKGQLEETKRNDECEVKEKAKYMRSKGKNPVK-CFCC  207



>ref|XP_004157491.1| PREDICTED: uncharacterized protein At3g61260-like [Cucumis sativus]
Length=126

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            RAD WE  ++EK+  R+ K+   I+ WE +KK  A  +L+R       K+A   Q+Y E 
Sbjct  27   RADVWERNKMEKISKRYLKIKASILAWENEKKMHA--ELER-------KKALFQQYYQEN  77

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ I+G ARAQ E+  KREE+K +E AN++R TGRLP  TCF
Sbjct  78   IARIDQIAGGARAQLEEKRKREEKKARETANRIRSTGRLPV-TCF  121



>emb|CDX98136.1| BnaA06g08870D [Brassica napus]
Length=324

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKL-RFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            AD WE  EL K+K  R+EKLN  I  WEA K+ KA+++L + E+E E+KR R LQ + E+
Sbjct  218  ADGWEKTELAKIKASRYEKLNRKIDLWEAKKREKARKKLDKSESEQEQKRKRGLQRFRED  277

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            +  IE I+  ARAQ E   + EE KVKEKA  +R TG++P + CF
Sbjct  278  MEYIEQIAAGARAQAEKQRQTEELKVKEKAGIVRSTGKIPGKACF  322



>ref|XP_007224212.1| hypothetical protein PRUPE_ppa017471mg, partial [Prunus persica]
 gb|EMJ25411.1| hypothetical protein PRUPE_ppa017471mg, partial [Prunus persica]
Length=293

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            AD WE  +L  +K R+EK N  I+ WE+ KK K + +L   E+E+E+KR +A + +N ++
Sbjct  189  ADIWEENKLTMLKERYEKQNATILSWESKKKKKTRHRLSTKESEIEKKRVKAQRKFNRDM  248

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              I+ I+  ARAQ E+  + E  KVKEKAN +R TG+ P  +CF
Sbjct  249  EHIKQIAEGARAQAEERYRNEVLKVKEKANAIRKTGKAP-TSCF  291



>ref|XP_006649616.1| PREDICTED: DNA ligase 1-like [Oryza brachyantha]
Length=306

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            + D WE  +L  ++  ++K+ + I EWE +KK KAK+Q +  E EL+ KRA+AL+ YN+E
Sbjct  201  KTDEWEKAKLTSIREEYQKMIDTIAEWENEKKVKAKRQKELKEKELDRKRAKALEEYNQE  260

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            ITRI  I+G AR+  E+    +E+K+KEKAN+ R T + P    CF
Sbjct  261  ITRINKIAGGARSMAEERKYNDEKKIKEKANKRRSTEKAPRTCACF  306



>ref|XP_010552558.1| PREDICTED: uncharacterized protein At3g61260 isoform X2 [Tarenaya 
hassleriana]
Length=124

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            AD W   E+ K++ +++KL++ I+ WE  +K K +++L+  E  +E+++  AL  + EE+
Sbjct  22   ADHWNETEMVKLEEKYKKLSDKILSWEEKRKKKTRRKLEGTEGHVEKRKMNALYKFREEV  81

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              IE I+ +AR   ++  K EE KV+EKAN +R TGRLP  +CF
Sbjct  82   GHIEKIAADARGHAKETRKNEELKVREKANMMRATGRLP-PSCF  124



>ref|XP_004985234.1| PREDICTED: axoneme-associated protein mst101(2)-like isoform 
X2 [Setaria italica]
Length=306

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 64/106 (60%), Gaps = 12/106 (11%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L +V+  +EK+   I EWE +KK +  ++  +           AL+ YN+E
Sbjct  212  KADDWEKAKLARVREEYEKMIETIAEWETEKKTELDKKRAK-----------ALEEYNQE  260

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +TRI  I+G AR+  E+    +E+K+KEKA+++R TG++P    CF
Sbjct  261  MTRINKIAGGARSMAEERKYNDEKKIKEKAHKIRSTGKVPRTCACF  306



>ref|XP_010552557.1| PREDICTED: remorin isoform X1 [Tarenaya hassleriana]
Length=130

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            AD W   E+ K++ +++KL++ I+ WE  +K K +++L+  E  +E+++  AL  + EE+
Sbjct  28   ADHWNETEMVKLEEKYKKLSDKILSWEEKRKKKTRRKLEGTEGHVEKRKMNALYKFREEV  87

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              IE I+ +AR   ++  K EE KV+EKAN +R TGRLP  +CF
Sbjct  88   GHIEKIAADARGHAKETRKNEELKVREKANMMRATGRLP-PSCF  130



>ref|XP_010530533.1| PREDICTED: nucleolar and coiled-body phosphoprotein 1 isoform 
X2 [Tarenaya hassleriana]
Length=366

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  EL K+K R+EKL+  I  WEA K++KA+++L++ E EL++KR RAL+ + E+ 
Sbjct  261  ADAWEKAELAKIKERYEKLSRKIDSWEAKKRDKARRKLEKTERELDQKRRRALERFREDT  320

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
              I+ I+  ARAQ E   K EE+KVKEKA+ +R TG LP + C +C
Sbjct  321  EYIDQIASGARAQAEKQRKSEEKKVKEKADVIRRTGELPAKPC-LC  365



>ref|XP_010044441.1| PREDICTED: uncharacterized protein At3g61260 isoform X1 [Eucalyptus 
grandis]
Length=335

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD W  +E+ ++  R+ KLN+ I  WE  K+ KAK +L   E ELE+KR  AL+ +  E
Sbjct  230  KADVWIREEMSRINDRYAKLNSTINTWETHKRKKAKSKLIETEGELEKKRDNALKTFQTE  289

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            +  IE  +  AR Q E+  + EE K +EKAN++R TG+LP +  CF
Sbjct  290  MDSIEKFTAAARKQAEERQRNEELKAQEKANRIRTTGKLPTRCLCF  335



>emb|CDY02159.1| BnaA03g40080D [Brassica napus]
Length=728

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 88/157 (56%), Gaps = 22/157 (14%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE  +L+K+KLR+EK+   IV WE ++K+ AK ++++ ++EL+++     QHY  +
Sbjct  194  KADSWEKSQLDKIKLRYEKMKAEIVGWENERKSAAKLRMEKRKSELQKRTEINNQHYKTK  253

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGR-----------LPEQTCFIC*L  115
            + RI+ I+  A+ Q E+  + +E +V+EK  ++R TG+           LP   CF+  +
Sbjct  254  LARIQVIADGAKKQLEEKKRSQEAQVQEKVKKMRRTGKREDSRQGNSNPLP-HMCFLH-I  311

Query  114  PTLIYIYTHHCIYLYCDVYILYMHACMHVVIILYIQC  4
             T++   T   +  Y +V  + +H         Y+ C
Sbjct  312  KTIVIAGTIVSLLYYFNVDQMKIH---------YMSC  339



>ref|XP_010044442.1| PREDICTED: uncharacterized protein At3g61260 isoform X2 [Eucalyptus 
grandis]
Length=332

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD W  +E+ ++  R+ KLN+ I  WE  K+ KAK +L   E ELE+KR  AL+ +  E
Sbjct  227  KADVWIREEMSRINDRYAKLNSTINTWETHKRKKAKSKLIETEGELEKKRDNALKTFQTE  286

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            +  IE  +  AR Q E+  + EE K +EKAN++R TG+LP +  CF
Sbjct  287  MDSIEKFTAAARKQAEERQRNEELKAQEKANRIRTTGKLPTRCLCF  332



>ref|XP_006583952.1| PREDICTED: uncharacterized protein At3g61260-like isoform X2 
[Glycine max]
Length=332

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNE  265
            +ADAWE +ELEK+K R+EKL   I  WE  KK KA ++L + +    E++   + + Y +
Sbjct  226  KADAWEREELEKIKERYEKLLETIDSWEKRKKAKAIRKLNKHQHSESERKRAKVLKKYQD  285

Query  264  EITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +++ I  I+G ARAQ E+  + E  K KEKAN +R TG++P   +CF
Sbjct  286  KMSYISQIAGGARAQAEERRRSEVLKAKEKANIIRTTGKIPGPCSCF  332



>gb|KFK27892.1| hypothetical protein AALP_AA8G443400 [Arabis alpina]
Length=263

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 68/108 (63%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE  ++ K+ LR+EK+   I  WE ++K  AK ++++ + E+E +R    QHY  +
Sbjct  155  KADSWEKTQINKIGLRYEKMKAEIAAWENERKLAAKLRMEKRKIEMERRREINHQHYKLK  214

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLP-EQTCFIC  121
            + R++ I+  A+ Q E   + +E +V+EKA +LR TG++P    CF C
Sbjct  215  LARVKLIADRAKKQLEQKRRSKETQVQEKARKLRRTGKVPINYFCFRC  262



>ref|XP_006583951.1| PREDICTED: uncharacterized protein At3g61260-like isoform X1 
[Glycine max]
Length=343

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNE  265
            +ADAWE +ELEK+K R+EKL   I  WE  KK KA ++L + +    E++   + + Y +
Sbjct  237  KADAWEREELEKIKERYEKLLETIDSWEKRKKAKAIRKLNKHQHSESERKRAKVLKKYQD  296

Query  264  EITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +++ I  I+G ARAQ E+  + E  K KEKAN +R TG++P   +CF
Sbjct  297  KMSYISQIAGGARAQAEERRRSEVLKAKEKANIIRTTGKIPGPCSCF  343



>ref|XP_009399845.1| PREDICTED: uncharacterized protein LOC103984131 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=219

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A+AWE ++++++K R+E++ N I EWE  KK KAK +L R E  +E ++ +ALQ Y  +
Sbjct  114  KANAWEREKMDEIKKRYERMMNEIREWENQKKVKAKHRLDRKERYVERRKEKALQEYRYK  173

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ +S +AR   E+  K +E K +EKA  +R  G  P  TC 
Sbjct  174  IERIDRVSVDARNLAEEKRKNDETKTQEKARMMRSKGNGP-HTCL  217



>ref|XP_009399844.1| PREDICTED: uncharacterized protein LOC103984131 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=222

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A+AWE ++++++K R+E++ N I EWE  KK KAK +L R E  +E ++ +ALQ Y  +
Sbjct  117  KANAWEREKMDEIKKRYERMMNEIREWENQKKVKAKHRLDRKERYVERRKEKALQEYRYK  176

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ +S +AR   E+  K +E K +EKA  +R  G  P  TC 
Sbjct  177  IERIDRVSVDARNLAEEKRKNDETKTQEKARMMRSKGNGP-HTCL  220



>ref|XP_010234701.1| PREDICTED: uncharacterized protein LOC100838912 isoform X2 [Brachypodium 
distachyon]
Length=308

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            A AWE  +L K+K R+ +    I EWEA+KK KA++Q +  E + E KRA+AL+ YN+E+
Sbjct  204  AAAWEKDKLAKIKKRYNEAMETIAEWEAEKKAKARRQKEPREGDSERKRAKALEEYNDEM  263

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
             RI  ++  +R   E+  +  E  V EKA ++R TG+LP+  +CF
Sbjct  264  KRISKVAAASRLTAEEKKRSAEANVWEKAAKIRSTGKLPQSCSCF  308



>ref|XP_010649472.1| PREDICTED: uncharacterized protein At3g61260 isoform X2 [Vitis 
vinifera]
Length=353

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 72/105 (69%), Gaps = 2/105 (2%)
 Frame = -2

Query  435  DAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEIT  256
            DAWE  E+ K+K +F+K+N  I  W   KK KAK +L +IEA L++KRA+AL+HY  +I 
Sbjct  250  DAWEKAEMAKIKEKFDKVNGEIASWADKKKKKAKLKLDKIEAALDQKRAKALRHYRTDIQ  309

Query  255  RIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
             I+ ++G A+AQ E+  + EE KVKEK+  +R TG+ P  TC +C
Sbjct  310  NIDYVAGGAKAQAEEKRRNEELKVKEKSKIIRETGQFP-PTC-LC  352



>ref|XP_004137595.1| PREDICTED: uncharacterized protein LOC101222069 [Cucumis sativus]
Length=264

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%), Gaps = 10/108 (9%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            RAD WE  ++EK+  R+ K+   I+ WE +KK  A  +L+R       K+A   Q+Y E 
Sbjct  165  RADVWERNKMEKISKRYLKIKASILAWENEKKMHA--ELER-------KKALFQQYYQEN  215

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
            I RI+ I+G ARAQ E+  KREE+K +E AN++R TGRLP    CF C
Sbjct  216  IARIDQIAGGARAQLEEKRKREEKKARETANRIRSTGRLPVTCFCFQC  263



>ref|NP_849866.1| remorin-like protein [Arabidopsis thaliana]
 gb|AEE34911.1| remorin-like protein [Arabidopsis thaliana]
Length=120

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (62%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
             D W+  E+ K + ++EKL+  IV WE  K+ KAK++L R E  +E+ + +A Q + +E 
Sbjct  18   VDQWKETEISKSRKKYEKLSEKIVSWEDKKRKKAKRKLHRTERSVEKTKLKATQRFRDEN  77

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RIE I   ARA   ++  +EE KVKEKAN +R TGR P  TC 
Sbjct  78   ERIEIIVASARAHAYESRIKEELKVKEKANLMRTTGRKP-STCL  120



>ref|XP_010234700.1| PREDICTED: uncharacterized protein LOC100838912 isoform X1 [Brachypodium 
distachyon]
Length=348

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            A AWE  +L K+K R+ +    I EWEA+KK KA++Q +  E + E KRA+AL+ YN+E+
Sbjct  244  AAAWEKDKLAKIKKRYNEAMETIAEWEAEKKAKARRQKEPREGDSERKRAKALEEYNDEM  303

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
             RI  ++  +R   E+  +  E  V EKA ++R TG+LP+  +CF
Sbjct  304  KRISKVAAASRLTAEEKKRSAEANVWEKAAKIRSTGKLPQSCSCF  348



>ref|XP_006281921.1| hypothetical protein CARUB_v10028128mg [Capsella rubella]
 gb|EOA14819.1| hypothetical protein CARUB_v10028128mg [Capsella rubella]
Length=261

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 69/108 (64%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE+ +++K++LR+EK+   IV WE  +K     ++++ ++ELE+++    QHY  +
Sbjct  153  KADSWENSQIKKIRLRYEKMKAEIVGWENKRKLAVNLRMEKRKSELEKRKQIYNQHYKSQ  212

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
            + RI  I+  A+ Q E+  + +E +V EKA ++R T ++P    CF C
Sbjct  213  LARIYLIADGAKKQLEEKSRSKEARVHEKAKKMRPTNKVPTNYFCFRC  260



>ref|XP_009399843.1| PREDICTED: uncharacterized protein LOC103984131 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=265

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A+AWE ++++++K R+E++ N I EWE  KK KAK +L R E  +E ++ +ALQ Y  +
Sbjct  160  KANAWEREKMDEIKKRYERMMNEIREWENQKKVKAKHRLDRKERYVERRKEKALQEYRYK  219

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ +S +AR   E+  K +E K +EKA  +R  G  P  TC 
Sbjct  220  IERIDRVSVDARNLAEEKRKNDETKTQEKARMMRSKGNGP-HTCL  263



>ref|XP_009399842.1| PREDICTED: uncharacterized protein LOC103984131 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A+AWE ++++++K R+E++ N I EWE  KK KAK +L R E  +E ++ +ALQ Y  +
Sbjct  164  KANAWEREKMDEIKKRYERMMNEIREWENQKKVKAKHRLDRKERYVERRKEKALQEYRYK  223

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ +S +AR   E+  K +E K +EKA  +R  G  P  TC 
Sbjct  224  IERIDRVSVDARNLAEEKRKNDETKTQEKARMMRSKGNGP-HTCL  267



>emb|CDY36418.1| BnaC05g10190D [Brassica napus]
Length=323

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVK-LRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            AD WE  EL K+K  R+EKLN  I  WEA K++KA+++L + E+E E++R R LQ + ++
Sbjct  217  ADGWEKAELGKIKESRYEKLNRKIDLWEAKKRDKARKKLDKSESEQEQRRKRGLQRFRDD  276

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            +  IE I+  ARAQ E   +  E KVKEKA  +R TG++P + CF
Sbjct  277  MEYIEQIAAGARAQAEKERQTGELKVKEKAGIVRSTGKIPGKACF  321



>emb|CDY40911.1| BnaC06g30490D [Brassica napus]
Length=208

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
             + W+  E+ K + ++EKL   I+ WE  K  KAK+ L R E  +E+ + +ALQ Y E+ 
Sbjct  106  VELWKETEMAKTRTKYEKLREKIMLWEDKKTKKAKRNLHRTERGVEKTKLKALQRYTEDN  165

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RIE I   AR    +   +EE KVKEKAN +R +GR P  TC 
Sbjct  166  ERIEIIVASAREHAYERQMKEELKVKEKANLMRTSGRSP-STCL  208



>ref|XP_011018194.1| PREDICTED: uncharacterized protein At3g61260-like isoform X2 
[Populus euphratica]
Length=351

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 65/105 (62%), Gaps = 2/105 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            ADAWE  EL K++ R+EK N  I+ WE  KK KA+ +L++ +    +       + ++ E
Sbjct  246  ADAWERAELSKIQKRYEKTNARILSWENKKKEKARNRLKKTDQNDSKGIRSKAFKKFHAE  305

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            +  I+ I+G A+A+  +  + EE +VK KAN +R TG+LP +TCF
Sbjct  306  MADIDQIAGAAKAKAAERQRNEELRVKGKANTIRKTGKLP-RTCF  349



>ref|XP_011018175.1| PREDICTED: uncharacterized protein At3g61260-like isoform X1 
[Populus euphratica]
 ref|XP_011018185.1| PREDICTED: uncharacterized protein At3g61260-like isoform X1 
[Populus euphratica]
Length=355

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 65/105 (62%), Gaps = 2/105 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            ADAWE  EL K++ R+EK N  I+ WE  KK KA+ +L++ +    +       + ++ E
Sbjct  250  ADAWERAELSKIQKRYEKTNARILSWENKKKEKARNRLKKTDQNDSKGIRSKAFKKFHAE  309

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            +  I+ I+G A+A+  +  + EE +VK KAN +R TG+LP +TCF
Sbjct  310  MADIDQIAGAAKAKAAERQRNEELRVKGKANTIRKTGKLP-RTCF  353



>ref|XP_008671249.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
 tpg|DAA44034.1| TPA: hypothetical protein ZEAMMB73_289642 [Zea mays]
Length=272

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 12/106 (11%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L +V+  +EK+   I EWE +KK +  ++ ++             + YN E
Sbjct  178  KADEWEKAKLGRVREEYEKMMETIAEWETEKKTELDRKREKAL-----------EEYNLE  226

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +TRI  ISG ARA  E+    + +K++EKA ++R TG+ P    CF
Sbjct  227  MTRISKISGGARAMAEERKYNDRKKIREKARKMRSTGKPPRTCACF  272



>emb|CDP00403.1| unnamed protein product [Coffea canephora]
Length=404

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            RAD WE  E+ ++  ++EK    I+E E ++K  AK++L+R EAEL+++RARA  HY  E
Sbjct  299  RADVWEEDEMARINEKYEKKRVKILELEEEEKKAAKRRLERTEAELDKRRARATHHYRSE  358

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            + RIESI+  AR+   +N + EE KVKEKA++ R TG+LP    CF
Sbjct  359  LERIESIARGARSHATENQRYEESKVKEKASKFRMTGKLPAAFWCF  404



>gb|KHN20534.1| Hypothetical protein glysoja_029547 [Glycine soja]
Length=274

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNE  265
            +ADAWE +ELEK+K  +EKL   I  WE  KK KA ++L + +    E++   + ++Y +
Sbjct  168  KADAWEREELEKIKESYEKLLETIDSWEKRKKAKAIRKLNKHQHSESERKRAKVLKNYQD  227

Query  264  EITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            ++  I  I+G ARAQ E+  + E  K KEKAN +R TG++P   +CF
Sbjct  228  KMNYISQIAGGARAQAEERRRNEVLKAKEKANIIRTTGKIPGPCSCF  274



>gb|AFW70326.1| hypothetical protein ZEAMMB73_462803 [Zea mays]
Length=197

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 73/129 (57%), Gaps = 26/129 (20%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQ----------------------  328
            +AD WE  +L +V+  +EK+   I EWE +KK KA++Q                      
Sbjct  67   KADEWEKAKLGRVREEYEKMMETIAEWETEKKVKARRQKEQKEEFVMTTYLIKSHCLRRL  126

Query  327  ---LQRIeaeleekraraLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRY  157
               L  ++ EL++KR +AL+ YN E+TRI  ISG ARA  E+    + +K++EKA+++R 
Sbjct  127  RAELLNLQTELDKKREKALEEYNLEMTRISKISGGARAMAEERKYNDGKKIREKAHKMRS  186

Query  156  TGRLPEQTC  130
            TG+ P +TC
Sbjct  187  TGK-PPRTC  194



>ref|XP_008658459.1| PREDICTED: uncharacterized protein LOC100278877 isoform X1 [Zea 
mays]
Length=347

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (62%), Gaps = 12/104 (12%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L KV+  +EK+   I EWE +KK      L R       KRA+AL+ YN+E
Sbjct  253  KADEWEKAKLAKVREEYEKMMETIAEWETEKKT----VLDR-------KRAKALEEYNQE  301

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
            +TRI  I+G AR+  E+    +E K+KEKA+++R T R P +TC
Sbjct  302  MTRISKIAGGARSMAEERKYNDENKIKEKAHKIRST-RKPPRTC  344



>ref|XP_008671213.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=312

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 12/106 (11%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  +L +V+  +EK+   I EWE +KK +  ++ ++             + YN E
Sbjct  218  KADEWEKAKLGRVREEYEKMMETIAEWETEKKTELDRKREKAL-----------EEYNLE  266

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            +TRI  ISG ARA  E+    + +K++EKA ++R TG+ P    CF
Sbjct  267  MTRISKISGGARAMAEERKYNDRKKIREKARKMRSTGKPPRTCACF  312



>ref|XP_006605547.1| PREDICTED: uncharacterized protein At3g61260-like isoform X2 
[Glycine max]
Length=284

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNE  265
            +ADAWE +ELEK+K  +EKL   I  WE  KK KA ++L + +    E++   + ++Y +
Sbjct  178  KADAWEREELEKIKESYEKLLETIDSWEKRKKAKAIRKLNKHQHSESERKRAKVLKNYQD  237

Query  264  EITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            ++  I  I+G ARAQ E+  + E  K KEKAN +R TG++P   +CF
Sbjct  238  KMNYISQIAGGARAQAEERRRNEVLKAKEKANIIRTTGKIPGPCSCF  284



>ref|XP_008393196.1| PREDICTED: remorin-like [Malus domestica]
Length=223

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = -2

Query  429  WEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRI  250
            WE  +++K++ R+EK+   I  WE +KK KAK +++R + E+E++RAR +QHY  +  RI
Sbjct  119  WERAQMKKIQRRYEKVKATIDAWENEKKMKAKAKMERRKREIEQRRARNMQHYQIKQARI  178

Query  249  ESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
            + I+G ARAQ E+  + EE KVK+KA ++  TG+ P    CF C
Sbjct  179  DQIAGGARAQVEEKRRNEESKVKQKAKRISSTGKAPTTCFCFTC  222



>ref|XP_009590902.1| PREDICTED: uncharacterized protein LOC104088004 [Nicotiana tomentosiformis]
Length=576

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE +E++K+K R+EKL  +I +WE  KK KAK+ L++ EA+L+ +RA+A   +  +
Sbjct  471  KADIWEKEEMKKIKERYEKLKKVIHDWETKKKKKAKRHLEQTEAQLDRRRAKARDSFYSD  530

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTC  130
            I RIE I+G A++Q E N + EE KVKEKAN++R  G++P  TC
Sbjct  531  IGRIEHIAGGAKSQAEQNQENEELKVKEKANKIRSAGKIPA-TC  573



>ref|XP_006605546.1| PREDICTED: uncharacterized protein At3g61260-like isoform X1 
[Glycine max]
Length=340

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNE  265
            +ADAWE +ELEK+K  +EKL   I  WE  KK KA ++L + +    E++   + ++Y +
Sbjct  234  KADAWEREELEKIKESYEKLLETIDSWEKRKKAKAIRKLNKHQHSESERKRAKVLKNYQD  293

Query  264  EITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
            ++  I  I+G ARAQ E+  + E  K KEKAN +R TG++P   +CF
Sbjct  294  KMNYISQIAGGARAQAEERRRNEVLKAKEKANIIRTTGKIPGPCSCF  340



>gb|AAG60092.1|AC073178_3 hypothetical protein [Arabidopsis thaliana]
Length=211

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (62%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
             D W+  E+ K + ++EKL+  IV WE  K+ KAK++L R E  +E+ + +A Q + +E 
Sbjct  109  VDQWKETEISKSRKKYEKLSEKIVSWEDKKRKKAKRKLHRTERSVEKTKLKATQRFRDEN  168

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RIE I   ARA   ++  +EE KVKEKAN +R TGR P  TC 
Sbjct  169  ERIEIIVASARAHAYESRIKEELKVKEKANLMRTTGRKP-STCL  211



>ref|XP_010530534.1| PREDICTED: nucleolar and coiled-body phosphoprotein 1 isoform 
X3 [Tarenaya hassleriana]
Length=340

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeael-eekraraLQHYNEE  262
            ADAWE  EL K+K R+EKL+  I  WEA K++KA+++L++ E    ++KR RAL+ + E+
Sbjct  234  ADAWEKAELAKIKERYEKLSRKIDSWEAKKRDKARRKLEKTEQRELDQKRRRALERFRED  293

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
               I+ I+  ARAQ E   K EE+KVKEKA+ +R TG LP + C +C
Sbjct  294  TEYIDQIASGARAQAEKQRKSEEKKVKEKADVIRRTGELPAKPC-LC  339



>emb|CDY23073.1| BnaC07g31140D [Brassica napus]
Length=652

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE  +L+K++LR+EK+   IV WE ++K+ AK ++++ ++EL+++     QHY  +
Sbjct  155  KADSWEKSQLDKIRLRYEKMKAEIVGWENERKSAAKLRMEKRKSELQKRTEINNQHYKAK  214

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGR  148
            + RI+ I+  A+ Q E+  + +E +V+EK  ++R TG+
Sbjct  215  LARIQVIADGAKKQLEEKKRSQEAQVQEKVKKMRRTGK  252



>ref|XP_010483793.1| PREDICTED: uncharacterized protein At3g61260-like [Camelina sativa]
Length=262

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 70/107 (65%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            + D+WE+ +++K++LR+EK+   IV WE ++K  A +++++ + ELE+++    QHY  +
Sbjct  154  KVDSWENTQIKKIRLRYEKMKAEIVGWENERKLAANRRMEKRKIELEKRKYINNQHYKSK  213

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            + RI+ I+  A+ Q E+  + +E +V EK  ++  TG++P  T + C
Sbjct  214  LARIQLIADGAKKQLEEKRRSKEAQVHEKVKKMHRTGKVP--TNYFC  258



>ref|XP_007157419.1| hypothetical protein PHAVU_002G068600g [Phaseolus vulgaris]
 gb|ESW29413.1| hypothetical protein PHAVU_002G068600g [Phaseolus vulgaris]
Length=281

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  EL++++ R++KL  +I  WE  KK KA+++L + E  L ++R RAL+ + ++
Sbjct  176  KADEWERTELQEIRQRYDKLREMIDSWENKKKTKARRKLDKEERGLAQRRMRALEDFQDK  235

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFI  124
            IT I+ I+  A+ + E++ K E +K    AN +R TG++P   CF 
Sbjct  236  ITSIDHIAERAKTRAEESRKNEVKKANANANVIRATGKMP-GICFC  280



>ref|NP_200936.1| Remorin family protein [Arabidopsis thaliana]
 dbj|BAB08483.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97447.1| Remorin family protein [Arabidopsis thaliana]
Length=263

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 68/108 (63%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE  +++K++LR+EK+   IV WE ++K  A   +++ ++ELE+++    QHY  +
Sbjct  155  KADSWEKSQIKKIRLRYEKMKADIVGWENERKLAATLLMEKRKSELEKRKGINNQHYKSK  214

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
            + RI+ I+  A+ Q E+  + +E +V  K  ++  TG++P    CF C
Sbjct  215  LARIQLIADGAKKQLEEKRRSKEAQVHGKVKKMSRTGKVPNNYFCFRC  262



>gb|KDO54571.1| hypothetical protein CISIN_1g014975mg [Citrus sinensis]
Length=415

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A+AWE  +++K+  R+EKL   ++ WE +KK +A  ++++ +AEL++KR    QHY  +
Sbjct  169  KAEAWELAQMQKIIKRYEKLKAAVLTWEYEKKFQATLKMEKRKAELDKKRTLNQQHYQNK  228

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLP  142
            I RIE I+G ARAQ E+   ++E ++KEKA  +R   + P
Sbjct  229  IARIERIAGGARAQAEEERIKKEAEIKEKARMIRSREKAP  268



>ref|XP_009105633.1| PREDICTED: uncharacterized protein LOC103831505 [Brassica rapa]
Length=126

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
             + W+  E+ K K ++EKL   IV WE  K  KAK++L R E  +E+ + +ALQ Y E+ 
Sbjct  24   VELWKETEMAKTKTKYEKLCEKIVLWEDKKTKKAKRKLHRTERGVEKTKLKALQRYTEDN  83

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RI  I   ARA   ++  +EE KVK+KAN +R TGR P  TC 
Sbjct  84   ERIGIIVASARAHAYESQMKEELKVKQKANLMRTTGRSP-STCL  126



>ref|NP_001132191.1| hypothetical protein [Zea mays]
 gb|ACF80941.1| unknown [Zea mays]
 gb|AFW69066.1| hypothetical protein ZEAMMB73_227203 [Zea mays]
Length=347

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 69/106 (65%), Gaps = 2/106 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQ-RIeaeleekraraLQHYNEE  262
            ADAWE ++L ++K ++ +    I  WEA+KK  A++Q Q + E+E E KRA+AL+ Y EE
Sbjct  242  ADAWEKEKLARIKRKYNETMQTIAAWEAEKKANARRQKQLKDESESERKRAKALEEYTEE  301

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            ++RI  ++  +R   E+  +  E+K ++KA+ +R TG+LP    CF
Sbjct  302  MSRINKVAAASRLTAEEKKRSAERKARDKAHTIRSTGKLPGACGCF  347



>ref|XP_002514700.1| hypothetical protein RCOM_1470580 [Ricinus communis]
 gb|EEF47806.1| hypothetical protein RCOM_1470580 [Ricinus communis]
Length=253

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = -2

Query  435  DAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEIT  256
            D+WE  +L K+  R+EK+   ++ WE  KK +AK  ++R + ELE +++R LQ+Y  ++ 
Sbjct  150  DSWEKAQLRKINKRYEKMKAEVLAWENAKKIEAKMHMERKKNELELRKSRNLQYYQIKVE  209

Query  255  RIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            RIE+++G A+ Q E+  + EE +VKEKA  +R  G+ P + CF C
Sbjct  210  RIEAVAGGAKGQLEEKRRSEESEVKEKARNMRLKGKNPVR-CFCC  253



>ref|XP_008681160.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW69067.1| hypothetical protein ZEAMMB73_227203 [Zea mays]
Length=354

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 69/106 (65%), Gaps = 2/106 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQ-RIeaeleekraraLQHYNEE  262
            ADAWE ++L ++K ++ +    I  WEA+KK  A++Q Q + E+E E KRA+AL+ Y EE
Sbjct  249  ADAWEKEKLARIKRKYNETMQTIAAWEAEKKANARRQKQLKDESESERKRAKALEEYTEE  308

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            ++RI  ++  +R   E+  +  E+K ++KA+ +R TG+LP    CF
Sbjct  309  MSRINKVAAASRLTAEEKKRSAERKARDKAHTIRSTGKLPGACGCF  354



>ref|XP_008681161.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=350

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 69/106 (65%), Gaps = 2/106 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQ-RIeaeleekraraLQHYNEE  262
            ADAWE ++L ++K ++ +    I  WEA+KK  A++Q Q + E+E E KRA+AL+ Y EE
Sbjct  245  ADAWEKEKLARIKRKYNETMQTIAAWEAEKKANARRQKQLKDESESERKRAKALEEYTEE  304

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
            ++RI  ++  +R   E+  +  E+K ++KA+ +R TG+LP    CF
Sbjct  305  MSRINKVAAASRLTAEEKKRSAERKARDKAHTIRSTGKLPGACGCF  350



>ref|XP_010530532.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Tarenaya hassleriana]
Length=367

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeael-eekraraLQHYNEE  262
            ADAWE  EL K+K R+EKL+  I  WEA K++KA+++L++ E    ++KR RAL+ + E+
Sbjct  261  ADAWEKAELAKIKERYEKLSRKIDSWEAKKRDKARRKLEKTEQRELDQKRRRALERFRED  320

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
               I+ I+  ARAQ E   K EE+KVKEKA+ +R TG LP + C +C
Sbjct  321  TEYIDQIASGARAQAEKQRKSEEKKVKEKADVIRRTGELPAKPC-LC  366



>ref|XP_010457129.1| PREDICTED: remorin-like isoform X2 [Camelina sativa]
Length=262

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE+ +++K++LR+EK+   IV WE ++K  A  ++++ ++ELE+++    QHY  +
Sbjct  154  KADSWENTQIKKIRLRYEKMKAEIVGWENERKLAANLRMEKRKSELEKRKDINNQHYKSK  213

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
            + RI+ I+  A+ Q E+  + +E +V EK  ++  TG+ P+   C  C
Sbjct  214  LARIQLIADGAKKQLEEKRRSKEAQVHEKVKKMHRTGKAPKNYFCLRC  261



>ref|XP_010457120.1| PREDICTED: remorin-like isoform X1 [Camelina sativa]
Length=263

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD+WE+ +++K++LR+EK+   IV WE ++K  A  ++++ ++ELE+++    QHY  +
Sbjct  155  KADSWENTQIKKIRLRYEKMKAEIVGWENERKLAANLRMEKRKSELEKRKDINNQHYKSK  214

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CFIC  121
            + RI+ I+  A+ Q E+  + +E +V EK  ++  TG+ P+   C  C
Sbjct  215  LARIQLIADGAKKQLEEKRRSKEAQVHEKVKKMHRTGKAPKNYFCLRC  262



>ref|XP_002887228.1| hypothetical protein ARALYDRAFT_315935 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63487.1| hypothetical protein ARALYDRAFT_315935 [Arabidopsis lyrata subsp. 
lyrata]
Length=210

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (62%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
             D W+  EL K + ++EKL+  IV WE  K+ KAK++L R E  +E+ + +A+Q + +E 
Sbjct  108  VDQWKETELSKSRNKYEKLSEKIVSWEDKKRKKAKRKLHRTERAVEKTKLKAVQRFTDEN  167

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RIE I   ARA   ++  +EE KVKEKAN +R TGR P   C 
Sbjct  168  ERIEIIVASARAHAYESRMKEELKVKEKANLMRTTGRKP-SACL  210



>ref|XP_010259033.1| PREDICTED: uncharacterized protein At3g61260-like [Nelumbo nucifera]
Length=327

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 72/104 (69%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            A AWE  E+ K++ R+E++ N I+ WE +KK KAK++L R E +LE +R RALQH++ E 
Sbjct  223  AIAWEKAEMAKIRKRYEQMKNQILLWEDEKKRKAKRRLDRKEGKLERRRQRALQHFSNET  282

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             +I  I+  AR   E   K+EE +VKEKAN++R TG++P  TCF
Sbjct  283  AKINQIAQAARENMERQRKKEESEVKEKANKIRSTGKVP-VTCF  325



>ref|XP_010470914.1| PREDICTED: uncharacterized protein At3g61260-like [Camelina sativa]
Length=120

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
             D W+  E+ K ++++EKL+  IV WE  K+ KAK++L R E  +E+ + +A++ + ++ 
Sbjct  18   VDQWKETEIVKTRMKYEKLSEKIVSWEDKKRKKAKRKLHRTERGVEKTKLKAIERFRDDN  77

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RIE I   ARA   ++  +EE KV+EKAN +R TG+ P  TC 
Sbjct  78   ERIEMIVASARAHAYESRVKEELKVREKANLMRATGKNP-STCL  120



>ref|XP_003607785.1| hypothetical protein MTR_4g082910 [Medicago truncatula]
 gb|AES89982.1| carboxy-terminal region remorin [Medicago truncatula]
Length=356

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 76/130 (58%), Gaps = 6/130 (5%)
 Frame = -2

Query  510  MRQYSASRRTApdpsmppvmvdPRADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQ  331
            +RQ S    TA  PS  P   + +ADAWE +EL+K+K R+EKL   I  WE  KK KA++
Sbjct  231  IRQTS----TAARPSTRPSETEAKADAWEREELKKIKERYEKLLETIDSWEKRKKMKARR  286

Query  330  QLQRIeaeleekraraL-QHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYT  154
            +L + E     ++     + Y ++I  I+ I+  ARAQ ++  K E  K K+KAN +R T
Sbjct  287  KLNKHEQSENTRKREKAWKKYQDKIKYIDEIAEGARAQSDERRKNETLKAKDKANIIRTT  346

Query  153  GRLPEQ-TCF  127
            G+LP   +CF
Sbjct  347  GKLPGACSCF  356



>ref|XP_010678430.1| PREDICTED: remorin [Beta vulgaris subsp. vulgaris]
Length=261

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            RA+AWE   L K+   +EK    I+EWE +KK KA   ++R +AELE  +   L HY  +
Sbjct  154  RAEAWEQARLAKINKWYEKTREKIIEWENEKKMKAATNMERRKAELERLKRLNLHHYQNK  213

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I +IE +   AR Q ++  +REE   K++  ++  TGR P Q CF
Sbjct  214  IDKIEDVGVGARKQLDEKKRREEAYAKQQGRKISSTGRPPVQ-CF  257



>ref|XP_008339832.1| PREDICTED: uncharacterized protein At3g61260 isoform X1 [Malus 
domestica]
Length=291

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 62/105 (59%), Gaps = 2/105 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            AD WE  ++ ++K R+EK    I+ WE +KK K +++L +I+     ++     + ++ E
Sbjct  186  ADIWEETKIARLKARYEKQKATILAWENNKKTKCRKRLDKIKQGEVAEKREKALRKFSAE  245

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            +  I+ I+  ARAQ  +  +    KVK+KAN++R TG+ P  TCF
Sbjct  246  MEYIKEIADGARAQAAERHRNGVLKVKQKANEMRRTGKAP-TTCF  289



>ref|XP_008339833.1| PREDICTED: uncharacterized protein At3g61260 isoform X2 [Malus 
domestica]
Length=289

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 62/105 (59%), Gaps = 2/105 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraL-QHYNEE  262
            AD WE  ++ ++K R+EK    I+ WE +KK K +++L +I+     ++     + ++ E
Sbjct  184  ADIWEETKIARLKARYEKQKATILAWENNKKTKCRKRLDKIKQGEVAEKREKALRKFSAE  243

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            +  I+ I+  ARAQ  +  +    KVK+KAN++R TG+ P  TCF
Sbjct  244  MEYIKEIADGARAQAAERHRNGVLKVKQKANEMRRTGKAP-TTCF  287



>ref|XP_004505377.1| PREDICTED: uncharacterized protein LOC101493550 isoform X1 [Cicer 
arietinum]
Length=351

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 77/130 (59%), Gaps = 6/130 (5%)
 Frame = -2

Query  510  MRQYSASRRTApdpsmppvmvdPRADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQ  331
            +RQ S S R +  P         +ADAWE +EL+K+K R+EKL   I  WE  KK KA++
Sbjct  226  IRQTSTSTRPSTKPGTAET----KADAWEREELKKIKERYEKLLETIDSWEKRKKMKARR  281

Query  330  QLQRI-eaeleekraraLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYT  154
            +L +  ++E E KR +A + Y ++I  +E I+  ARAQ  +    E  K K+KAN +R T
Sbjct  282  KLNKHEQSENERKREKARKKYEDKIKYLEEIAAGARAQSNERRNNETLKAKDKANIIRTT  341

Query  153  GRLPEQ-TCF  127
            G+LP   +CF
Sbjct  342  GKLPGACSCF  351



>ref|XP_004505378.1| PREDICTED: uncharacterized protein LOC101493550 isoform X2 [Cicer 
arietinum]
Length=300

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 75/130 (58%), Gaps = 6/130 (5%)
 Frame = -2

Query  510  MRQYSASRRTApdpsmppvmvdPRADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQ  331
            +RQ S S R +  P         +ADAWE +EL+K+K R+EKL   I  WE  KK KA++
Sbjct  175  IRQTSTSTRPSTKPGTAET----KADAWEREELKKIKERYEKLLETIDSWEKRKKMKARR  230

Query  330  QLQRIeaelee-kraraLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYT  154
            +L + E    E KR +A + Y ++I  +E I+  ARAQ  +    E  K K+KAN +R T
Sbjct  231  KLNKHEQSENERKREKARKKYEDKIKYLEEIAAGARAQSNERRNNETLKAKDKANIIRTT  290

Query  153  GRLPEQ-TCF  127
            G+LP   +CF
Sbjct  291  GKLPGACSCF  300



>ref|XP_002512116.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF50785.1| DNA binding protein, putative [Ricinus communis]
Length=340

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 64/104 (62%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            ADAWE  EL K+K +++ L   I+ WE  KK K++ +L + E ELE KR +AL+ +  E+
Sbjct  236  ADAWERSELAKIKKKYDALEARILSWENKKKKKSRHRLDKSEGELERKRLKALERFRSEV  295

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              +  I+  AR++     + EE K KEKAN+ R  G++P  TCF
Sbjct  296  EDVNQIAEGARSKARKEQQNEELKAKEKANKCRKAGKVP-TTCF  338



>ref|XP_008221537.1| PREDICTED: remorin-like isoform X2 [Prunus mume]
Length=247

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            AD WE  +L  +K R+EK N  I+ WE+ KK K +++L   E+E+E+KR +A + +N ++
Sbjct  143  ADIWEENKLAMLKERYEKQNATILSWESKKKKKTRRRLSTKESEIEKKRVKAQRKFNRDM  202

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              I+ I+  ARAQ E+  + E  K KEKAN +R TG+ P  +CF
Sbjct  203  EHIKQIAEGARAQAEERYRNEVLKAKEKANAIRKTGKAP-TSCF  245



>ref|XP_010673352.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104889753 
[Beta vulgaris subsp. vulgaris]
Length=127

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 63/100 (63%), Gaps = 4/100 (4%)
 Frame = -2

Query  420  QELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRIESI  241
            +++ K +  +EKLN  I+EWE  K+NKA+++L+      E++RA+ALQ Y+ E+ RI+ I
Sbjct  31   KKISKSRKXYEKLNATILEWEDKKRNKARRKLE----MTEKRRAKALQKYHIEMERIKQI  86

Query  240  SGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
               ARA  ++  + EE KVKEK N+ R TG  P     +C
Sbjct  87   VDGARAHAKEKRRNEEFKVKEKTNKYRATGEPPLPPMCLC  126



>emb|CDX95945.1| BnaA07g27860D [Brassica napus]
Length=107

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
             + W+  E+ K K ++EKL   IV W   K  KAK++L R E  +E+ + +ALQ Y E+ 
Sbjct  5    VELWKETEMAKTKTKYEKLCEKIVLWADKKTKKAKRKLHRTERGVEKTKLKALQRYTEDN  64

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RI  I   ARA   +   +EE KVKEK N +R TGR P  TC 
Sbjct  65   ERIGIIVASARAHAYERQMKEELKVKEKVNLMRTTGRSP-STCL  107



>ref|XP_008221536.1| PREDICTED: uncharacterized protein At3g61260-like isoform X1 
[Prunus mume]
Length=329

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            AD WE  +L  +K R+EK N  I+ WE+ KK K +++L   E+E+E+KR +A + +N ++
Sbjct  225  ADIWEENKLAMLKERYEKQNATILSWESKKKKKTRRRLSTKESEIEKKRVKAQRKFNRDM  284

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
              I+ I+  ARAQ E+  + E  K KEKAN +R TG+ P  +CF
Sbjct  285  EHIKQIAEGARAQAEERYRNEVLKAKEKANAIRKTGKAP-TSCF  327



>gb|ABF94601.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ26030.1| hypothetical protein OsJ_09883 [Oryza sativa Japonica Group]
Length=323

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = -2

Query  429  WEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRI  250
            WE  +L  +   ++ + + I EWE +KK KAK+Q ++ E  L++KRA+AL+ Y++EITRI
Sbjct  222  WEKAKLASITEEYKNMMDTIAEWENEKKVKAKRQKEQKEKVLDQKRAKALEEYSQEITRI  281

Query  249  ESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
              I+G AR   E+    +E+K+KEKAN+ R + + P    CF
Sbjct  282  NKIAGGARTMAEERKYNDEKKIKEKANKRRLSEKAPRACACF  323



>ref|XP_010470915.1| PREDICTED: uncharacterized protein LOC104750764 [Camelina sativa]
Length=117

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
            A A +  E+ K ++++EKL+  IV WE  K+ K K++L R E  +E+ + +A++ + ++ 
Sbjct  15   AAAVDQTEIVKTRMKYEKLSEKIVSWEDKKRKKGKRKLHRTERGVEKTKLKAIERFRDDN  74

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RIE I   ARA   ++  +EE KV+EKAN +R TG+ P  TC 
Sbjct  75   ERIEMIVASARAHAYESRVKEELKVREKANLMRATGKNP-STCL  117



>emb|CAN78816.1| hypothetical protein VITISV_041733 [Vitis vinifera]
Length=202

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -2

Query  414  LEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRIESISG  235
            ++ +  R + +++ I+ WE +KK +AK  ++R ++ELE+++A  LQHY  +I RI+ I+G
Sbjct  106  IQTMNFRNDNISSRILAWENEKKMRAKLIMERKKSELEQRKALNLQHYQIKIERIDQIAG  165

Query  234  EARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             ARAQ ++  + EE +VK KA  +R TG++P + CF
Sbjct  166  GARAQLQEKRRNEESEVKHKAEMIRKTGKVPVR-CF  200



>ref|XP_006581992.1| PREDICTED: uncharacterized protein At3g61260-like [Glycine max]
Length=234

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A  WE  ++E+++ R+EK  + I+ WE+ +K +AK Q+ R ++E E KRA  +QHY  +
Sbjct  126  KATLWEKAKIERIQKRYEKTKSKILAWESYRKIQAKMQMDRKKSEWEHKRAIEMQHYKNK  185

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ I+  A +Q ED+ +++E K KEKA ++R TGR+P + CF
Sbjct  186  IARIDMIAQGAISQLEDHKRKQESKAKEKAKKIRKTGRVPVK-CF  229



>ref|XP_004172072.1| PREDICTED: uncharacterized protein LOC101225810 [Cucumis sativus]
Length=319

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 63/109 (58%), Gaps = 3/109 (3%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKA--KQQLQRIeaeleekraraLQHYN  268
            +AD WE  EL K++ R++K+N  I  WE  K+ KA  K +  +++     +R +  + + 
Sbjct  212  KADMWEKAELAKIQERYQKVNETISYWETKKREKAICKFEASQVDGTKRSQREKGRKKFE  271

Query  267  EEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            E++  I+ I+GEAR++ +   K E  K   KA+ +R TG +P  +C+ C
Sbjct  272  EDMEFIKQIAGEARSKADHKKKNEILKANRKADIIRQTGDIP-VSCYCC  319



>ref|XP_008446417.1| PREDICTED: uncharacterized protein LOC103489168 isoform X1 [Cucumis 
melo]
Length=320

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKA--KQQLQRIeaeleekraraLQHYN  268
            +AD WE  EL K++ R++K+N  I  WE  K+ KA  K +  ++      +R +  + + 
Sbjct  213  KADLWEKAELAKIQERYQKVNETISYWETKKREKAIRKFEASQVLGTKRSEREKGRKKFE  272

Query  267  EEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            E++  I+ I+GEAR++ +   K E  K   KA+ +R TG LP  +C+ C
Sbjct  273  EDMEFIKQIAGEARSKADRKKKNEILKANRKADIIRQTGDLP-VSCYCC  320



>gb|EAY89011.1| hypothetical protein OsI_10493 [Oryza sativa Indica Group]
Length=323

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = -2

Query  429  WEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRI  250
            WE  +L  +   ++ + + I EWE +KK KAK+Q ++ E  L++KRA+AL+ Y++EITRI
Sbjct  222  WEKAKLASITEEYKNMMDTIAEWENEKKVKAKRQKEQKEKVLDQKRAKALEEYSQEITRI  281

Query  249  ESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ-TCF  127
              I+G AR   E+    +E+++KEKAN+ R + + P    CF
Sbjct  282  NKIAGGARTMAEERKYNDEKRIKEKANKRRLSEKAPRACACF  323



>ref|XP_008446418.1| PREDICTED: uncharacterized protein LOC103489168 isoform X2 [Cucumis 
melo]
Length=319

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKA--KQQLQRIeaeleekraraLQHYN  268
            +AD WE  EL K++ R++K+N  I  WE  K+ KA  K +  ++      +R +  + + 
Sbjct  212  KADLWEKAELAKIQERYQKVNETISYWETKKREKAIRKFEASQVLGTKRSEREKGRKKFE  271

Query  267  EEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            E++  I+ I+GEAR++ +   K E  K   KA+ +R TG LP  +C+ C
Sbjct  272  EDMEFIKQIAGEARSKADRKKKNEILKANRKADIIRQTGDLP-VSCYCC  319



>gb|KHN06902.1| hypothetical protein glysoja_041282 [Glycine soja]
Length=260

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A  WE  ++E+++ R+EK  + I+ WE+ +K +AK Q+ R ++E E KRA  +QHY  +
Sbjct  152  KATLWEKAKIERIQKRYEKTKSKILAWESYRKIQAKMQMDRKKSEWEHKRAIEMQHYKNK  211

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            I RI+ I+  A +Q ED+ +++E K KEKA ++R TGR+P + CF
Sbjct  212  IARIDMIAQGAISQLEDHKRKQESKAKEKAKKIRKTGRVPVK-CF  255



>ref|XP_004135153.1| PREDICTED: uncharacterized protein LOC101213727 [Cucumis sativus]
 gb|KGN51964.1| hypothetical protein Csa_5G606540 [Cucumis sativus]
Length=319

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 63/109 (58%), Gaps = 3/109 (3%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKA--KQQLQRIeaeleekraraLQHYN  268
            +AD WE  EL K++ R++K+N  I  WE  K+ KA  K +  ++E     +R +  + + 
Sbjct  212  KADMWEKAELAKIQERYQKVNETISYWETKKREKAICKFEASQVEGTKRSQREKGRKKFE  271

Query  267  EEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            E++  I+ I+GEAR++ +   K E  K   KA+ +R TG +P  +C+ C
Sbjct  272  EDMEFIKQIAGEARSKADHKKKNEILKANRKADIIRQTGDIP-VSCYCC  319



>ref|XP_010511957.1| PREDICTED: uncharacterized protein At3g61260-like [Camelina sativa]
Length=120

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 64/104 (62%), Gaps = 1/104 (1%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
             D W+  E+ K ++++EKL+  IV WE  K+ KAK++L R E  +E+ + +A++ + ++ 
Sbjct  18   VDQWKETEIVKTRMKYEKLSEKIVSWEDKKRKKAKRKLHRTERGVEKTKLKAIERFRDDN  77

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             RIE I   AR    ++  +EE KV+E AN +R TG+ P  TC 
Sbjct  78   ERIEMIVASARVHAYESRVKEELKVRENANLMRTTGKNP-STCL  120



>ref|XP_003614010.1| hypothetical protein MTR_5g043690 [Medicago truncatula]
Length=677

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 9/137 (7%)
 Frame = -2

Query  435  DAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEIT  256
            D WE  ELEK+K R+EKL  +I  WE  K+ KAK++L + E+E+E +R +AL+ +  ++ 
Sbjct  209  DEWERTELEKIKQRYEKLKVLIDSWEDKKRMKAKRKLMKQESEIERRRLKALEKFQNKMK  268

Query  255  RIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC*LPTLIYIYTHHCIY  76
             +  ++  ARA+ E++ K EE + K K + +R T +LP    + C        +   C +
Sbjct  269  YVNLVADGARAKAEESRKNEELQAKGKGSTIRTTCKLPRM--YFC------LKFVKACGF  320

Query  75   LYCDVYILYMHACMHVV  25
             Y     +   A +HV 
Sbjct  321  -YSIELCVDSKAVIHVT  336



>ref|XP_003614009.1| hypothetical protein MTR_5g043690 [Medicago truncatula]
Length=678

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 9/137 (7%)
 Frame = -2

Query  435  DAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEIT  256
            D WE  ELEK+K R+EKL  +I  WE  K+ KAK++L + E+E+E +R +AL+ +  ++ 
Sbjct  210  DEWERTELEKIKQRYEKLKVLIDSWEDKKRMKAKRKLMKQESEIERRRLKALEKFQNKMK  269

Query  255  RIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC*LPTLIYIYTHHCIY  76
             +  ++  ARA+ E++ K EE + K K + +R T +LP    + C        +   C +
Sbjct  270  YVNLVADGARAKAEESRKNEELQAKGKGSTIRTTCKLPRM--YFC------LKFVKACGF  321

Query  75   LYCDVYILYMHACMHVV  25
             Y     +   A +HV 
Sbjct  322  -YSIELCVDSKAVIHVT  337



>gb|AES96967.2| carboxy-terminal region remorin [Medicago truncatula]
Length=312

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  435  DAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEIT  256
            D WE  ELEK+K R+EKL  +I  WE  K+ KAK++L + E+E+E +R +AL+ +  ++ 
Sbjct  209  DEWERTELEKIKQRYEKLKVLIDSWEDKKRMKAKRKLMKQESEIERRRLKALEKFQNKMK  268

Query  255  RIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
             +  ++  ARA+ E++ K EE + K K + +R T +LP    CF
Sbjct  269  YVNLVADGARAKAEESRKNEELQAKGKGSTIRTTCKLPRMYFCF  312



>gb|AES96968.2| carboxy-terminal region remorin [Medicago truncatula]
Length=313

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  435  DAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEIT  256
            D WE  ELEK+K R+EKL  +I  WE  K+ KAK++L + E+E+E +R +AL+ +  ++ 
Sbjct  210  DEWERTELEKIKQRYEKLKVLIDSWEDKKRMKAKRKLMKQESEIERRRLKALEKFQNKMK  269

Query  255  RIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
             +  ++  ARA+ E++ K EE + K K + +R T +LP    CF
Sbjct  270  YVNLVADGARAKAEESRKNEELQAKGKGSTIRTTCKLPRMYFCF  313



>ref|XP_010443944.1| PREDICTED: uncharacterized protein LOC104726715 isoform X1 [Camelina 
sativa]
Length=267

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            + D+WE+ +++K++LR+EK+   IV WE ++K  A  ++++ ++ELE+++    QHY  +
Sbjct  159  KVDSWENTQIKKIRLRYEKMKAEIVGWENERKLAANLRMEKRKSELEKRKDINNQHYKSK  218

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            + RI+ I+  A+ Q E+  + +E +V EK  ++  TG++   T + C
Sbjct  219  LARIQLIADGAKKQLEEKRRSKEAQVHEKVKKMHRTGKIT--TNYFC  263



>ref|XP_010443945.1| PREDICTED: remorin-like isoform X2 [Camelina sativa]
Length=262

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            + D+WE+ +++K++LR+EK+   IV WE ++K  A  ++++ ++ELE+++    QHY  +
Sbjct  154  KVDSWENTQIKKIRLRYEKMKAEIVGWENERKLAANLRMEKRKSELEKRKDINNQHYKSK  213

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            + RI+ I+  A+ Q E+  + +E +V EK  ++  TG++   T + C
Sbjct  214  LARIQLIADGAKKQLEEKRRSKEAQVHEKVKKMHRTGKIT--TNYFC  258



>gb|AAG52495.1|AC018364_13 hypothetical protein; 34983-33172 [Arabidopsis thaliana]
Length=178

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = -2

Query  396  RFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRIESISGEARAQE  217
            R+EKL+  IV WE  K+ KAK++L R E  +E+ + +A Q + +E  RIE I   ARA  
Sbjct  90   RYEKLSEKIVSWEDKKRKKAKRKLHRTERSVEKTKLKATQRFRDENERIEIIVASARAHA  149

Query  216  EDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             ++  +EE KVKEKAN +R TGR P  TC 
Sbjct  150  YESRIKEELKVKEKANLMRTTGRKP-STCL  178



>ref|XP_010044437.1| PREDICTED: uncharacterized protein At3g61260-like [Eucalyptus 
grandis]
 ref|XP_010044438.1| PREDICTED: uncharacterized protein At3g61260-like [Eucalyptus 
grandis]
 ref|XP_010044439.1| PREDICTED: uncharacterized protein At3g61260-like [Eucalyptus 
grandis]
 gb|KCW86531.1| hypothetical protein EUGRSUZ_B03177 [Eucalyptus grandis]
Length=273

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +ADAW  QEL ++K   + LN +I  WE  KK KA+++L   E+EL+ KR +A + Y   
Sbjct  168  KADAWLRQELSRIKNSHDNLNAVIASWETQKKKKARRKLDATESELQRKREQASKTYQTG  227

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            + RIE I   ARAQ ++  +RE    ++KA++L  TG+LP  TCF
Sbjct  228  MQRIELIVAAARAQAQERQRREGLMAQDKADRLGTTGKLP-TTCF  271



>ref|XP_009387213.1| PREDICTED: uncharacterized protein LOC103974173 [Musa acuminata 
subsp. malaccensis]
Length=335

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = -2

Query  438  ADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEI  259
             D WE ++++K++ R+EK  +  +EWE  KK KAK+QL+  E +L+ K +RAL+ Y+ EI
Sbjct  231  VDVWEREKMDKIRERYEKEISKTLEWENAKKLKAKRQLEHKEMDLKLKHSRALREYHNEI  290

Query  258  TRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            +RI   +G  RA  E+  K  E K KEKA++  Y        C  C
Sbjct  291  SRINKTAGGKRALAEERKKNNELKTKEKAHKRHYNRE--SSLCMFC  334



>ref|XP_002271714.1| PREDICTED: cytokinesis protein sepA isoform X3 [Vitis vinifera]
Length=322

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 69/127 (54%), Gaps = 25/127 (20%)
 Frame = -2

Query  435  DAWEHQELEKVKLRFEKLNNIIVEW------------------------EADKKNKAKQQ  328
            DAWE  E+ K+K +F+K+N  I  W                        +A + ++    
Sbjct  195  DAWEKAEMAKIKEKFDKVNGEIASWADKKKKKAKLKLDKIEGALDQKRAKALRHDRTDIN  254

Query  327  LQRIeaeleekraraLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGR  148
            + +++A L++KRA+AL+HY  +I  I+ ++G A+AQ E+  + EE KVKEK+  +R TG+
Sbjct  255  ISKLQAALDQKRAKALRHYRTDIQNIDYVAGGAKAQAEEKRRNEELKVKEKSKIIRETGQ  314

Query  147  LPEQTCF  127
             P  TC 
Sbjct  315  FP-PTCL  320



>ref|XP_010649468.1| PREDICTED: formin-like protein 2 isoform X1 [Vitis vinifera]
 emb|CBI27257.3| unnamed protein product [Vitis vinifera]
Length=377

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 26/129 (20%)
 Frame = -2

Query  435  DAWEHQELEKVKLRFEKLNNIIVEW------------------------EADKKNKAKQQ  328
            DAWE  E+ K+K +F+K+N  I  W                        +A + ++    
Sbjct  250  DAWEKAEMAKIKEKFDKVNGEIASWADKKKKKAKLKLDKIEGALDQKRAKALRHDRTDIN  309

Query  327  LQRIeaeleekraraLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGR  148
            + +++A L++KRA+AL+HY  +I  I+ ++G A+AQ E+  + EE KVKEK+  +R TG+
Sbjct  310  ISKLQAALDQKRAKALRHYRTDIQNIDYVAGGAKAQAEEKRRNEELKVKEKSKIIRETGQ  369

Query  147  LPEQTCFIC  121
             P  TC +C
Sbjct  370  FPP-TC-LC  376



>ref|XP_004298394.1| PREDICTED: uncharacterized protein LOC101293779 [Fragaria vesca 
subsp. vesca]
Length=338

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 87/165 (53%), Gaps = 10/165 (6%)
 Frame = -2

Query  621  PSITNSlllllLFIKPQSN*GV*FNLLLTTIANCL*NMRQYSASRRTApdpsmppvmvdP  442
            P+  +  L     IKP ++     +L  TT A    N  ++ ++ R     +        
Sbjct  181  PTFADKPLNSTSSIKPGTS-APQLDLPFTTKAATPSNETKWQSAARPGVVKT--------  231

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +AD WE  E+ K+  R+E+    I+ WE  KK K+K QL + E+E+E +R+++L+ YN +
Sbjct  232  KADEWEEAEMAKLNKRYEQQTTTILSWENKKKKKSKLQLGKRESEIERRRSKSLEKYNNQ  291

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTG-RLPEQTC  130
            +  I+ I+  ARAQ E+  K +  KVKEKAN LR TG   P   C
Sbjct  292  MESIKQIAEGARAQAEEKRKNKVLKVKEKANTLRRTGEEAPTGCC  336



>ref|XP_006837034.1| hypothetical protein AMTR_s00110p00036630 [Amborella trichopoda]
 gb|ERM99887.1| hypothetical protein AMTR_s00110p00036630 [Amborella trichopoda]
Length=318

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 11/116 (9%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQL----------QRIeaeleekr  292
            +ADAWE   +EK+K R++   ++I +WE  KK KA  +L          + ++ +LE K 
Sbjct  203  KADAWEKARMEKIKKRYDMDVSVIKDWEKRKKEKAYDRLHENQQALIGFRELQRQLEAKS  262

Query  291  araLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQT-CF  127
             +A   YN ++ RIE  + E R   E  M  EE K K+KAN++R TGR      CF
Sbjct  263  NKATGEYNRDMERIEKNAKEVRIYVEAKMLSEETKTKDKANKIRSTGRSRSACRCF  318



>ref|XP_010415573.1| PREDICTED: uncharacterized protein LOC104701561 isoform X2 [Camelina 
sativa]
Length=103

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = -2

Query  396  RFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRIESISGEARAQE  217
            R+EKL+  IV WE  K+ KAK++L R E  +E+ + +A++ + ++  RIE I   ARA  
Sbjct  15   RYEKLSEKIVSWEDKKRKKAKRKLHRTERGVEKTKLKAIERFRDDNERIEMIVASARAHA  74

Query  216  EDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             ++  +EE KVK KAN +R TGR P  TC 
Sbjct  75   YESRMKEELKVKAKANLMRTTGRNP-STCL  103



>emb|CAN63833.1| hypothetical protein VITISV_009131 [Vitis vinifera]
Length=851

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 28/131 (21%)
 Frame = -2

Query  435  DAWEHQELEKVK---LRFEKLNNIIVEW------------------------EADKKNKA  337
            DAWE  E+ K+K    RF+K+N  I  W                        +A + ++ 
Sbjct  721  DAWEKAEMAKIKEKNFRFDKVNGEIASWADKKKKKAKLKLDKIEGALDQKRAKALRHDRT  780

Query  336  KQQLQRIeaeleekraraLQHYNEEITRIESISGEARAQEEDNMKREEQKVKEKANQLRY  157
               + +++A L++KRA+AL+HY  +I  I+ ++G A+AQ E+  + EE KVKEK+  +R 
Sbjct  781  DINISKLQAALDQKRAKALRHYRTDIQNIDYVAGGAKAQAEEKRRNEELKVKEKSKIIRE  840

Query  156  TGRLPEQT-CF  127
            TG+ P    CF
Sbjct  841  TGQFPPTCLCF  851



>ref|XP_009127721.1| PREDICTED: uncharacterized protein LOC103852571 [Brassica rapa]
 emb|CDY44060.1| BnaA02g14240D [Brassica napus]
Length=107

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -2

Query  429  WEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRI  250
            W+ +E++K + ++E+L+  I+ WE  KK KAK++L R E  +E+ + +A Q + ++  RI
Sbjct  8    WKEREMDKTRKKYERLSEKIMLWEDKKKKKAKRKLHRTERGVEKAKLKAKQRFIDDNERI  67

Query  249  ESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLP  142
            E I   AR    ++  +E  KVKEKAN +R TGR P
Sbjct  68   EIIVASARTHAYESQMKEVLKVKEKANLMRTTGRSP  103



>ref|XP_010415572.1| PREDICTED: uncharacterized protein LOC104701561 isoform X1 [Camelina 
sativa]
Length=115

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = -2

Query  396  RFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRIESISGEARAQE  217
            R+EKL+  IV WE  K+ KAK++L R E  +E+ + +A++ + ++  RIE I   ARA  
Sbjct  27   RYEKLSEKIVSWEDKKRKKAKRKLHRTERGVEKTKLKAIERFRDDNERIEMIVASARAHA  86

Query  216  EDNMKREEQKVKEKANQLRYTGRLPEQTCF  127
             ++  +EE KVK KAN +R TGR P  TC 
Sbjct  87   YESRMKEELKVKAKANLMRTTGRNP-STCL  115



>ref|XP_002465656.1| hypothetical protein SORBIDRAFT_01g043200 [Sorghum bicolor]
 gb|EER92654.1| hypothetical protein SORBIDRAFT_01g043200 [Sorghum bicolor]
Length=76

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 12/83 (14%)
 Frame = -2

Query  372  IVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRIESISGEARAQEEDNMKREE  193
            I EWE +KK     +L R       KRA+AL+ YN+E+TRI  I+G AR+  E+    +E
Sbjct  5    IAEWETEKKT----ELDR-------KRAKALEEYNQEMTRINKIAGGARSMAEERKYNDE  53

Query  192  QKVKEKANQLRYTGRLPEQT-CF  127
             K+KEKA ++R TG+ P    CF
Sbjct  54   NKIKEKARKIRSTGKPPRTCACF  76



>ref|XP_010415574.1| PREDICTED: uncharacterized protein LOC104701561 isoform X3 [Camelina 
sativa]
Length=101

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 1/89 (1%)
 Frame = -2

Query  393  FEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRIESISGEARAQEE  214
            +EKL+  IV WE  K+ KAK++L R E  +E+ + +A++ + ++  RIE I   ARA   
Sbjct  14   YEKLSEKIVSWEDKKRKKAKRKLHRTERGVEKTKLKAIERFRDDNERIEMIVASARAHAY  73

Query  213  DNMKREEQKVKEKANQLRYTGRLPEQTCF  127
            ++  +EE KVK KAN +R TGR P  TC 
Sbjct  74   ESRMKEELKVKAKANLMRTTGRNP-STCL  101



>emb|CDY28544.1| BnaC02g19130D [Brassica napus]
Length=729

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 63/98 (64%), Gaps = 0/98 (0%)
 Frame = -2

Query  429  WEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEEITRI  250
            W+ +E++K + ++EKL+  I+ WE  KK KAK++L R E  +E+++ +A Q + ++  RI
Sbjct  46   WKEREMDKTRKKYEKLSEKIMLWEDKKKKKAKRKLHRTERGVEKEKLKAKQRFIDDNERI  105

Query  249  ESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQ  136
            E I   AR    ++  +EE KVKEKAN +R TGR P  
Sbjct  106  EIIVASARTHAYESQLKEELKVKEKANLMRTTGRSPSS  143



>ref|XP_007045930.1| Remorin family protein [Theobroma cacao]
 gb|EOY01762.1| Remorin family protein [Theobroma cacao]
Length=291

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -2

Query  441  RADAWEHQELEKVKLRFEKLNNIIVEWEADKKNKAKQQLQRIeaeleekraraLQHYNEE  262
            +A+ WE  E+ K+K R+ KLN+ I+ WE  KK KA  +L + ++ELEEKRARAL  +  E
Sbjct  186  KAEEWEKAEMAKIKERYVKLNSTILAWEEKKKKKATNKLNKAKSELEEKRARALTKFRNE  245

Query  261  ITRIESISGEARAQEEDNMKREEQKVKEKANQLRYTGRLPEQTCFIC  121
            +  I+ ++  AR Q E   + +  K KEKAN +R TG++P +TCF C
Sbjct  246  MEYIKQVAEGARVQAEARQRSDVLKAKEKANIIRTTGKVP-RTCFCC  291



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 959982664718