BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c913_g2_i1 len=317 path=[2822:0-290 1409:291-316]

Length=317
                                                                      Score     E

emb|CDP10543.1|  unnamed protein product                              50.4    6e-05   
ref|XP_009618586.1|  PREDICTED: probable glycosyltransferase At5g...  48.1    4e-04   



>emb|CDP10543.1| unnamed protein product [Coffea canephora]
Length=531

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +3

Query  126  LMVPAALAFSTAIFITLYIASTSKVLLMIHPNQTHLRVKPPVEF  257
              VP  LAF+T +FI  YI+STS +L  IH N+THL V+PP++ 
Sbjct  26   FFVPTCLAFTTCVFIFFYISSTSNIL-SIHLNETHLHVRPPIQL  68



>ref|XP_009618586.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
tomentosiformis]
Length=488

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +3

Query  117  RGSLMVPAALAFSTAIFITLYIASTSKVLLMIHPNQTHLRVKPPVEFSIINT  272
            +GS + P  LAF T+  I  YI STS+ LL IHP+QT L +K P++ S I++
Sbjct  21   KGSFIKPTILAFITSTLIVFYIFSTSR-LLNIHPHQTRLHIKTPLDSSRISS  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522854037308