BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9136_g1_i1 len=1135 path=[1:0-387 389:388-1134]

Length=1135
                                                                      Score     E

ref|XP_009770275.1|  PREDICTED: agamous-like MADS-box protein AGL11     384   7e-130   
ref|XP_009599024.1|  PREDICTED: agamous-like MADS-box protein AGL11     384   1e-129   
emb|CAA57445.1|  fbp11                                                  384   1e-129   Petunia x hybrida [garden petunia]
gb|AIS71918.1|  TAGL11 transcription factor                             381   1e-128   
emb|CAA57311.1|  floral binding protein number 7                        380   2e-128   Petunia x hybrida [garden petunia]
ref|XP_010322781.1|  PREDICTED: agamous-like MADS-box protein AGL...    375   2e-126   
ref|XP_004241906.1|  PREDICTED: agamous-like MADS-box protein AGL...    375   2e-126   
ref|XP_006356513.1|  PREDICTED: agamous-like MADS-box protein AGL...    375   3e-126   
ref|XP_011095997.1|  PREDICTED: agamous-like MADS-box protein AGL11     374   5e-126   
ref|XP_009615311.1|  PREDICTED: agamous-like MADS-box protein AGL...    369   7e-124   
ref|XP_009774915.1|  PREDICTED: agamous-like MADS-box protein AGL...    369   8e-124   
emb|CDP10741.1|  unnamed protein product                                366   6e-123   
ref|NP_001234194.1|  TAGL11 transcription factor                        364   5e-122   
ref|XP_006339358.1|  PREDICTED: agamous-like MADS-box protein AGL...    359   4e-120   
gb|EYU22764.1|  hypothetical protein MIMGU_mgv1a013047mg                358   1e-119   
gb|EYU22762.1|  hypothetical protein MIMGU_mgv1a013047mg                358   1e-119   
ref|XP_006339359.1|  PREDICTED: agamous-like MADS-box protein AGL...    357   4e-119   
gb|EYU22761.1|  hypothetical protein MIMGU_mgv1a013047mg                352   2e-117   
gb|AAS01765.1|  MADS-box protein 1                                      341   4e-113   Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAK09621.1|  MADS-box transcription factor                          338   3e-112   
ref|XP_009615313.1|  PREDICTED: agamous-like MADS-box protein AGL...    335   8e-111   
ref|XP_009774929.1|  PREDICTED: agamous-like MADS-box protein AGL...    335   1e-110   
ref|XP_010665297.1|  PREDICTED: MADS-box protein 5 isoform X1           330   1e-108   
gb|EYU22763.1|  hypothetical protein MIMGU_mgv1a013047mg                329   2e-108   
ref|XP_010665296.1|  PREDICTED: MADS-box protein 5 isoform X2           329   3e-108   
emb|CBI39246.3|  unnamed protein product                                328   5e-108   
ref|NP_001268118.1|  MADS-box protein 5                                 323   3e-106   
ref|XP_007020163.1|  K-box region and MADS-box transcription fact...    310   4e-101   
ref|XP_006478208.1|  PREDICTED: agamous-like MADS-box protein AGL...    310   5e-101   
gb|AGV15453.1|  MADS protein                                            309   2e-100   
gb|KDP36700.1|  hypothetical protein JCGZ_07991                         308   2e-100   
ref|XP_008378733.1|  PREDICTED: agamous-like MADS-box protein AGL...    308   4e-100   
gb|AAN15183.1|  MADS box protein GHMADS-2                               308   5e-100   Gossypium hirsutum [American cotton]
gb|ADN22973.1|  mads-box transcription factor                           306   1e-99    
ref|XP_006478206.1|  PREDICTED: agamous-like MADS-box protein AGL...    306   2e-99    
ref|XP_008219059.1|  PREDICTED: agamous-like MADS-box protein AGL...    306   3e-99    
ref|NP_001236130.1|  MADS domain transporter AGL11                      305   6e-99    
gb|ADB93926.1|  SEEDSTICK-like protein                                  305   6e-99    
gb|AAY30856.1|  MADS-box transcription factor                           305   7e-99    Prunus dulcis [sweet almond]
ref|XP_009379167.1|  PREDICTED: agamous-like MADS-box protein AGL11     304   1e-98    
gb|AAO20104.1|  mads-box transcription factor                           304   2e-98    Momordica charantia [balsam pear]
ref|XP_007223946.1|  hypothetical protein PRUPE_ppa011140mg             303   3e-98    
ref|XP_008378732.1|  PREDICTED: agamous-like MADS-box protein AGL...    303   3e-98    
ref|NP_001280931.1|  agamous-like MADS-box protein AGL11                302   6e-98    
ref|XP_003598035.1|  MADS box protein                                   302   6e-98    
ref|NP_001289639.1|  glycogen debranching enzyme                        302   6e-98    
ref|XP_004499566.1|  PREDICTED: agamous-like MADS-box protein AGL...    302   7e-98    
ref|XP_008219057.1|  PREDICTED: agamous-like MADS-box protein AGL...    301   2e-97    
ref|XP_007148609.1|  hypothetical protein PHAVU_005G000900g             301   3e-97    
ref|NP_001267506.1|  agamous-like MADS-box protein AGL11-like           301   3e-97    
gb|ABM69043.1|  MADS-box protein MADS5                                  301   3e-97    Gossypium hirsutum [American cotton]
gb|KCW69546.1|  hypothetical protein EUGRSUZ_F02981                     300   4e-97    
ref|XP_003523484.1|  PREDICTED: agamous-like MADS-box protein AGL...    300   4e-97    
gb|ABQ85556.1|  SEEDSTICK-like protein                                  300   5e-97    Prunus persica
gb|AAT46096.1|  AGAMOUS-like protein                                    300   5e-97    Akebia trifoliata
gb|AEH41428.1|  seedstick-like protein                                  299   1e-96    
ref|XP_008459658.1|  PREDICTED: agamous-like MADS-box protein AGL...    298   2e-96    
gb|AAX13306.1|  MADS box protein AGL11                                  296   1e-95    Lotus japonicus
ref|XP_006376118.1|  CUM10 family protein                               296   1e-95    
ref|XP_010312975.1|  PREDICTED: TAGL11 transcription factor isofo...    295   1e-95    
gb|AAS45686.1|  AGAMOUS-like protein                                    296   2e-95    Meliosma dilleniifolia
gb|ABV60385.1|  floral organ identity protein                           295   4e-95    Carica papaya [mamon]
gb|AAC08529.1|  CUM10                                                   295   6e-95    Cucumis sativus [cucumbers]
ref|XP_009362389.1|  PREDICTED: agamous-like MADS-box protein AGL...    294   9e-95    
ref|XP_008781978.1|  PREDICTED: MADS-box transcription factor 3-like    295   1e-94    
ref|XP_008459656.1|  PREDICTED: agamous-like MADS-box protein AGL...    293   4e-94    
emb|CAA56655.1|  SLM1                                                   293   5e-94    Silene latifolia
ref|XP_002325531.1|  CUM10 family protein                               292   6e-94    Populus trichocarpa [western balsam poplar]
gb|ABD62864.1|  AG.1                                                    292   7e-94    Persea americana
gb|ACD76823.1|  SEEDSTICK-like protein                                  291   3e-93    Capsella bursa-pastoris
gb|AFH74368.1|  AGAMOUS-like protein                                    290   4e-93    
ref|XP_009421148.1|  PREDICTED: agamous-like MADS-box protein AGL11     290   4e-93    
gb|AHX58668.1|  AGAMOUS-like MADS-box transcription factor              290   4e-93    
ref|XP_006286826.1|  hypothetical protein CARUB_v10003771mg             290   5e-93    
ref|XP_010272685.1|  PREDICTED: floral homeotic protein AGAMOUS-like    290   5e-93    
gb|ADD25206.1|  AG3                                                     289   6e-93    Nymphaea odorata [American white water-lily]
gb|AAZ53205.1|  AG1                                                     290   9e-93    Eschscholzia californica
ref|NP_001268097.1|  agamous                                            289   1e-92    
gb|AEO52692.1|  AGAMOUS-like protein                                    289   1e-92    
ref|XP_010421900.1|  PREDICTED: agamous-like MADS-box protein AGL...    289   1e-92    
ref|XP_010421899.1|  PREDICTED: agamous-like MADS-box protein AGL...    289   2e-92    
ref|XP_004294526.1|  PREDICTED: agamous-like MADS-box protein AGL...    289   2e-92    
gb|AID22158.1|  AGAMOUS-like protein                                    289   2e-92    
gb|AFH74375.1|  AGAMOUS-like protein                                    288   2e-92    
gb|AFH74386.1|  AGAMOUS-like protein                                    288   3e-92    
gb|AFH74385.1|  AGAMOUS-like protein                                    288   3e-92    
emb|CBI30760.3|  unnamed protein product                                288   3e-92    
gb|AEG19542.1|  AGAMOUS-like protein                                    288   3e-92    
ref|XP_006371450.1|  hypothetical protein POPTR_0019s10580g             288   3e-92    
ref|XP_002874596.1|  hypothetical protein ARALYDRAFT_489841             288   3e-92    
ref|XP_010908080.1|  PREDICTED: MADS-box transcription factor 21-...    288   3e-92    
ref|XP_010542871.1|  PREDICTED: agamous-like MADS-box protein AGL...    288   4e-92    
dbj|BAG48168.1|  MADS-box transcription factor                          287   5e-92    Malus domestica [apple tree]
ref|XP_010421898.1|  PREDICTED: agamous-like MADS-box protein AGL...    288   5e-92    
ref|XP_010542875.1|  PREDICTED: agamous-like MADS-box protein AGL...    287   5e-92    
ref|NP_192734.1|  agamous-like MADS-box protein AGL11                   287   5e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273432.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    287   6e-92    
gb|AFH74369.1|  AGAMOUS-like protein                                    286   8e-92    
ref|XP_010437827.1|  PREDICTED: agamous-like MADS-box protein AGL...    287   9e-92    
ref|XP_010437821.1|  PREDICTED: agamous-like MADS-box protein AGL...    287   1e-91    
gb|AFX82108.1|  MADS-box transcription factor AG1                       287   1e-91    
gb|AFH74389.1|  AGAMOUS-like protein                                    286   1e-91    
gb|ADC79699.1|  AGAMOUS-like protein                                    286   2e-91    Euptelea pleiosperma
gb|AFY98824.1|  AGAMOUS-like protein                                    286   2e-91    
dbj|BAD18011.1|  MADS-box transcription factor                          286   2e-91    Asparagus virgatus
ref|XP_008791901.1|  PREDICTED: MADS-box transcription factor 3 i...    286   2e-91    
gb|AIK66813.1|  AGAMOUS-like MADS-box protein                           286   2e-91    
gb|AFH74399.1|  AGAMOUS-like protein                                    286   2e-91    
gb|AFH74382.1|  AGAMOUS-like protein                                    286   2e-91    
ref|NP_001078364.1|  agamous-like MADS-box protein AGL11                287   2e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AFH74371.1|  AGAMOUS-like protein                                    285   3e-91    
ref|XP_009401103.1|  PREDICTED: MADS-box transcription factor 3-like    286   3e-91    
ref|XP_010437812.1|  PREDICTED: agamous-like MADS-box protein AGL...    287   3e-91    
gb|AIJ29174.1|  AG-like MADS box protein                                285   3e-91    
gb|ACJ64682.1|  MADS-box protein MADS5                                  286   3e-91    Musa acuminata AAA Group [Cavendish banana]
gb|AFH74390.1|  AGAMOUS-like protein                                    285   3e-91    
gb|ADC79702.1|  AGAMOUS-like protein                                    285   3e-91    Pachysandra terminalis
gb|AAT46102.1|  AGAMOUS-like protein                                    285   5e-91    Akebia trifoliata
ref|XP_009134170.1|  PREDICTED: agamous-like MADS-box protein AGL11     285   5e-91    
emb|CAN83827.1|  hypothetical protein VITISV_030947                     286   5e-91    Vitis vinifera
ref|XP_008791911.1|  PREDICTED: MADS-box transcription factor 3 i...    285   6e-91    
ref|XP_011102155.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    285   6e-91    
ref|XP_010683283.1|  PREDICTED: agamous-like MADS-box protein AGL11     283   2e-90    
gb|ACB70410.1|  agamous MADS-box transcription factor                   283   2e-90    Hosta plantaginea [August lily]
gb|AFH74367.1|  AGAMOUS-like protein                                    283   2e-90    
gb|ADK35760.1|  agamous-like protein 2                                  283   3e-90    
gb|AAY53908.1|  MADS-box protein MADS1                                  283   3e-90    Musa acuminata [banana]
gb|ABQ28694.1|  MADS box transcription factor                           283   3e-90    Narcissus tazetta var. chinensis
gb|AAS45689.1|  AGAMOUS-like protein                                    282   5e-90    Saruma henryi
gb|AAZ95250.1|  AGAMOUS-like transcription factor                       283   5e-90    Dendrobium crumenatum
gb|AAY86365.1|  SEEDSTICK-like protein                                  283   5e-90    Dendrobium thyrsiflorum
ref|XP_008786400.1|  PREDICTED: MADS-box transcription factor 3 i...    283   6e-90    
ref|XP_010915446.1|  PREDICTED: MADS-box transcription factor 3 i...    282   6e-90    
gb|AFH74370.1|  AGAMOUS-like protein                                    282   6e-90    
gb|ADP00516.1|  MADS-box factor MADS2                                   282   8e-90    
ref|XP_009410729.1|  PREDICTED: MADS-box transcription factor 21-...    282   9e-90    
gb|AFI61557.1|  MADS-box protein 7                                      282   9e-90    
gb|ACU15109.1|  unknown                                                 280   1e-89    Glycine max [soybeans]
ref|NP_001190696.1|  agamous-like MADS-box protein AGL11                281   1e-89    
gb|AAW66881.1|  MADS box transcription factor                           281   1e-89    Elaeis guineensis
ref|XP_010915443.1|  PREDICTED: MADS-box transcription factor 3 i...    281   1e-89    
ref|XP_008786399.1|  PREDICTED: MADS-box transcription factor 3 i...    283   1e-89    
gb|ADP00515.1|  MADS-box factor MADS1                                   281   2e-89    
dbj|BAI59709.1|  MADS-box transcription factor                          281   3e-89    Lobelia erinus
ref|XP_009113582.1|  PREDICTED: agamous-like MADS-box protein AGL...    280   3e-89    
ref|XP_010912706.1|  PREDICTED: MADS-box transcription factor 21-...    280   3e-89    
ref|XP_009113581.1|  PREDICTED: agamous-like MADS-box protein AGL...    280   3e-89    
ref|XP_011102153.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    281   3e-89    
gb|AAY25577.1|  AG                                                      280   3e-89    Amborella trichopoda
ref|XP_008794140.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    280   4e-89    
ref|XP_009399817.1|  PREDICTED: MADS-box transcription factor 3-like    280   4e-89    
ref|XP_006358067.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    280   5e-89    
ref|XP_010915441.1|  PREDICTED: MADS-box transcription factor 3 i...    281   5e-89    
ref|XP_006852690.1|  hypothetical protein AMTR_s00021p00254030          280   6e-89    
gb|AHM92097.1|  MADS-box protein 21                                     280   7e-89    
ref|NP_001268105.1|  MAD-box transcripion factor                        279   7e-89    
ref|XP_010915440.1|  PREDICTED: MADS-box transcription factor 3 i...    281   8e-89    
gb|ABQ08574.1|  MADS-box protein 2                                      279   1e-88    Dendrobium nobile
gb|AHM92098.1|  MADS-box protein 22                                     279   1e-88    
ref|XP_006858589.1|  hypothetical protein AMTR_s00071p00193200          278   1e-88    
ref|XP_010925573.1|  PREDICTED: floral homeotic protein AGAMOUS-like    278   1e-88    
gb|AEZ51868.1|  AG MADS-box protein                                     279   1e-88    
emb|CAK55150.1|  agamous-like MADS-box protein AGL11 homologue          278   2e-88    Betula pendula [white birch]
gb|AIP87050.1|  AG                                                      279   2e-88    
ref|XP_006397127.1|  hypothetical protein EUTSA_v10028938mg             278   2e-88    
gb|AEX92974.1|  MADS box protein 4                                      278   2e-88    
gb|AAY86364.1|  AGAMOUS-like protein                                    278   3e-88    Dendrobium thyrsiflorum
emb|CAJ44134.1|  plena protein                                          278   3e-88    Misopates orontium
ref|XP_009380480.1|  PREDICTED: MADS-box transcription factor 3-l...    278   3e-88    
gb|AAD19360.2|  AGAMOUS homolog transcription factor                    277   4e-88    Hyacinthus orientalis [common hyacinth]
gb|AFU81322.1|  C-class MADS-box-like protein                           278   4e-88    
dbj|BAK20023.1|  PgMADS protein8                                        278   4e-88    
ref|XP_010687173.1|  PREDICTED: floral homeotic protein AGAMOUS i...    278   4e-88    
ref|XP_009380477.1|  PREDICTED: MADS-box transcription factor 3-l...    277   5e-88    
ref|XP_006449577.1|  hypothetical protein CICLE_v10016427mg             278   6e-88    
ref|XP_010656928.1|  PREDICTED: MAD-box transcripion factor isofo...    280   7e-88    
dbj|BAG69622.1|  MADS-box transcription factor                          276   9e-88    Lilium formosanum x Lilium longiflorum
gb|AAF08830.2|  transcription factor MADS1                              276   1e-87    Hyacinthus orientalis [common hyacinth]
gb|ADW08393.1|  AGAMOUS MADS box factor transcription factor            277   1e-87    
ref|XP_011085309.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    277   1e-87    
gb|AAS01766.1|  MADS-box protein 2                                      276   1e-87    Lilium longiflorum [Easter lily]
dbj|BAD83772.1|  MADS-box transcription factor                          276   1e-87    Asparagus virgatus
gb|AAL76415.1|AF234617_1  MADS-box transcription factor                 276   1e-87    Phalaenopsis equestris
gb|ADC79698.1|  AGAMOUS-like protein                                    276   1e-87    Euptelea pleiosperma
gb|AGV31153.1|  C-class MADS-box protein                                276   2e-87    
gb|AAS67611.1|  agamous MADS-box transcription factor 1b                276   2e-87    Crocus sativus [saffron crocus]
gb|AAS67610.1|  agamous MADS-box transcription factor 1a                276   2e-87    Crocus sativus [saffron crocus]
gb|AHH41528.1|  MADS-box transcription factor 1a                        276   2e-87    
emb|CBI31767.3|  unnamed protein product                                280   2e-87    
gb|KDO77975.1|  hypothetical protein CISIN_1g036452mg                   276   2e-87    
dbj|BAG74745.1|  HmAGAMOUS protein                                      276   2e-87    Hydrangea macrophylla
ref|XP_006467576.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    276   2e-87    
ref|XP_006467577.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    276   3e-87    
sp|Q40885.1|AG_PETHY  RecName: Full=Floral homeotic protein AGAMO...    276   3e-87    Petunia x hybrida [garden petunia]
ref|XP_006358066.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    276   3e-87    
ref|XP_006467575.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    276   3e-87    
gb|ADP02394.1|  AGAMOUS-like protein                                    276   3e-87    
sp|Q40872.1|AG_PANGI  RecName: Full=Floral homeotic protein AGAMO...    275   4e-87    Panax ginseng [Chinese ginseng]
gb|AAZ53206.1|  AG2                                                     275   4e-87    Eschscholzia californica
ref|XP_003565181.1|  PREDICTED: MADS-box transcription factor 3 i...    276   6e-87    
dbj|BAI59708.1|  MADS-box transcription factor                          275   7e-87    Lobelia erinus
gb|AGC31682.1|  MADS-box transcription factor                           274   8e-87    
gb|ACI23561.1|  agamous-like protein 2                                  275   8e-87    Gossypium barbadense [Egyptian cotton]
ref|XP_010230593.1|  PREDICTED: MADS-box transcription factor 3 i...    275   9e-87    
gb|AAD38119.1|  AGAMOUS homolog                                         275   9e-87    Liquidambar styraciflua [American sweet gum]
ref|XP_008794138.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    274   1e-86    
dbj|BAC66963.1|  MADS-box transcription factor AG                       274   1e-86    Agapanthus praecox
gb|ADU15476.1|  AG                                                      274   1e-86    
gb|ACY26070.1|  MADS-box transcription factor 3                         274   1e-86    Oryza sativa [red rice]
gb|AHM92099.1|  MADS-box protein 23                                     273   1e-86    
dbj|BAM71400.1|  transcription factor                                   274   2e-86    
gb|AHH28261.1|  MADS-box transcription factor                           273   2e-86    
gb|AIJ29176.1|  AG-like MADS box protein                                273   2e-86    
ref|NP_001280918.1|  agamous-like MADS-box protein AGL1                 274   2e-86    
gb|ADP06386.1|  AGAMOUS-LIKE2                                           274   2e-86    
gb|AAB25101.1|  promotes sex organ development                          273   2e-86    Antirrhinum majus [garden snapdragon]
gb|AEU08497.1|  MADS1                                                   273   2e-86    
dbj|BAB79434.1|  PMADS3                                                 273   2e-86    Petunia x hybrida [garden petunia]
gb|EYU28136.1|  hypothetical protein MIMGU_mgv1a012605mg                273   3e-86    
gb|ABR68012.1|  C-class floral identity                                 273   3e-86    Carica papaya [mamon]
gb|KHG12869.1|  Floral homeotic AGAMOUS -like protein                   273   3e-86    
ref|XP_007025251.1|  K-box region and MADS-box transcription fact...    273   4e-86    
emb|CAJ44130.1|  farinelli protein                                      273   4e-86    Misopates orontium
dbj|BAH56656.1|  MADS-box transcription factor                          274   5e-86    Triticum aestivum [Canadian hard winter wheat]
gb|AEA11211.1|  AGAMOUS-like protein                                    273   5e-86    
gb|AHY82572.1|  MADS-box protein 5                                      272   5e-86    
ref|XP_010930411.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    272   6e-86    
ref|XP_010687172.1|  PREDICTED: floral homeotic protein AGAMOUS i...    273   6e-86    
ref|XP_011085307.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    272   6e-86    
gb|AEZ51869.1|  MADS-box protein 3                                      272   7e-86    
gb|ACF93432.1|  MADS10                                                  272   7e-86    Gossypium hirsutum [American cotton]
gb|AAL92522.1|  AG-like protein                                         272   8e-86    Gossypium hirsutum [American cotton]
ref|XP_011085308.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    272   8e-86    
ref|NP_001266181.1|  floral homeotic protein AGAMOUS                    272   9e-86    
ref|XP_007025250.1|  K-box region and MADS-box transcription fact...    274   9e-86    
ref|XP_010687170.1|  PREDICTED: floral homeotic protein AGAMOUS i...    272   1e-85    
gb|AAY25575.1|  AG                                                      271   1e-85    Illicium floridanum [Florida anisetree]
emb|CAC81071.1|  MADS box transcription factor                          272   1e-85    Daucus carota subsp. sativus
ref|XP_002305048.1|  hypothetical protein POPTR_0004s06300g             271   1e-85    Populus trichocarpa [western balsam poplar]
ref|XP_010101273.1|  Agamous-like MADS-box protein AGL11                270   2e-85    
gb|AHH28311.1|  MADS-box transcription factor                           270   2e-85    
gb|AIJ29175.1|  STK-like MADS box protein                               271   2e-85    
gb|AGV40795.1|  MADS-box transcription factor 12                        271   2e-85    
dbj|BAC97837.1|  duplicated                                             271   3e-85    Ipomoea nil [qian niu]
emb|CAM59076.1|  MIKC-type MADS-box transcription factor WM29A          271   3e-85    Triticum aestivum [Canadian hard winter wheat]
ref|XP_011009675.1|  PREDICTED: floral homeotic protein AGAMOUS-like    270   3e-85    
emb|CDP18724.1|  unnamed protein product                                270   3e-85    
ref|NP_001288321.1|  MADS-box transcription factor 58-like              271   5e-85    
ref|XP_010230318.1|  PREDICTED: MADS-box transcription factor 58-...    271   6e-85    
ref|NP_001289811.1|  MADS-box transcription factor 3                    271   6e-85    
gb|AFX61408.1|  AGAMOUS-like MADS-box transcription factor              269   7e-85    
sp|Q40704.1|MADS3_ORYSJ  RecName: Full=MADS-box transcription fac...    270   7e-85    Oryza sativa Japonica Group [Japonica rice]
gb|ABM69042.1|  MADS-box protein MADS4                                  270   7e-85    Gossypium hirsutum [American cotton]
gb|AAS60204.1|  MADS-like protein RMADS222                              270   8e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006643880.1|  PREDICTED: MADS-box transcription factor 3-like    270   8e-85    
ref|XP_008342376.1|  PREDICTED: agamous-like MADS-box protein AGL...    270   8e-85    
emb|CAB42988.1|  MADS-box transcription factor                          270   9e-85    Antirrhinum majus [garden snapdragon]
ref|XP_011082936.1|  PREDICTED: floral homeotic protein AGAMOUS-like    270   1e-84    
gb|AHM92076.1|  MADS-box protein 58                                     269   1e-84    
gb|KCW47400.1|  hypothetical protein EUGRSUZ_K01195                     269   1e-84    
gb|AAT91060.1|  C class floral identity transcription factor AGAMOUS    268   1e-84    Spinacia oleracea
gb|AHM92063.1|  MADS-box protein 3                                      269   1e-84    
gb|AAL93196.1|AF486648_1  AGAMOUS-like protein 1 HvAG1                  268   1e-84    Hordeum vulgare subsp. vulgare [barley]
gb|ABF57939.1|  MADS-box transcription factor TaAGL39                   270   1e-84    Triticum aestivum [Canadian hard winter wheat]
gb|AIS82595.1|  AGAMOUS                                                 269   1e-84    
emb|CAE46181.1|  AGAMOUS-like MADS box transcription factor             268   1e-84    Elaeis guineensis
gb|AAY85372.1|  Me341                                                   268   2e-84    Beta vulgaris [beet]
dbj|BAE80121.1|  MADS-box transcription factor                          268   2e-84    Phalaenopsis hybrid cultivar
gb|EYU28135.1|  hypothetical protein MIMGU_mgv1a012605mg                269   2e-84    
ref|XP_006402748.1|  hypothetical protein EUTSA_v10006196mg             269   2e-84    
gb|ACB45306.1|  MIKC-type MADS-box transcription factor WM29B           269   3e-84    Hordeum vulgare [barley]
ref|NP_001289649.1|  glycogen debranching enzyme                        268   3e-84    
gb|AAZ77747.1|  agamous-like MADS box 2                                 268   3e-84    Castanea mollissima
gb|AHH28339.1|  MADS-box transcription factor                           266   4e-84    
ref|XP_010230317.1|  PREDICTED: MADS-box transcription factor 58-...    270   4e-84    
ref|XP_010930410.1|  PREDICTED: MADS-box transcription factor 21-...    267   4e-84    
ref|XP_011085305.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    268   4e-84    
gb|ABD62867.1|  AGAMOUS-like transcription factor                       266   5e-84    Persea borbonia [red bay]
ref|XP_010504839.1|  PREDICTED: agamous-like MADS-box protein AGL...    268   5e-84    
ref|XP_010427791.1|  PREDICTED: agamous-like MADS-box protein AGL...    267   6e-84    
ref|XP_010315871.1|  PREDICTED: floral homeotic protein AGAMOUS i...    267   6e-84    
gb|AAD03486.1|  MADS1                                                   267   6e-84    
ref|XP_010504841.1|  PREDICTED: agamous-like MADS-box protein AGL...    267   7e-84    
ref|XP_010427788.1|  PREDICTED: agamous-like MADS-box protein AGL...    267   7e-84    
gb|ACD76827.1|  SHATTERPROOF1-like protein                              267   8e-84    
ref|XP_002870009.1|  hypothetical protein ARALYDRAFT_914774             269   8e-84    
gb|AGS44979.1|  PFAG                                                    267   8e-84    
emb|CAI61983.1|  AGAMOUS protein                                        267   9e-84    
gb|AAS45687.1|  AGAMOUS-like protein                                    265   1e-83    
gb|AER34989.1|  AGAMOUS-like protein                                    266   1e-83    
ref|XP_010687169.1|  PREDICTED: floral homeotic protein AGAMOUS i...    267   1e-83    
dbj|BAN15734.1|  AGAMOUS like protein                                   267   1e-83    
ref|XP_010687174.1|  PREDICTED: floral homeotic protein AGAMOUS i...    267   1e-83    
gb|AAL93197.1|AF486649_1  AGAMOUS-like protein 2 HvAG2                  266   1e-83    
gb|AFD36428.1|  AG-like MADS box transcription factor                   266   1e-83    
emb|CDO96907.1|  unnamed protein product                                267   1e-83    
gb|AAS45685.1|  AGAMOUS-like protein                                    265   2e-83    
ref|XP_007048826.1|  K-box region and MADS-box transcription fact...    265   2e-83    
gb|ADU56831.1|  MADS-box protein AG subfamily                           266   2e-83    
sp|P17839.2|AG_ARATH  RecName: Full=Floral homeotic protein AGAMOUS     266   2e-83    
ref|NP_567569.3|  MADS domain transcription factor AGAMOUS              266   2e-83    
dbj|BAL41415.1|  Agamous like protein                                   266   2e-83    
gb|ADC53557.1|  STK MADS-box transcription factor                       265   3e-83    
ref|XP_008383546.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    265   3e-83    
gb|AAQ54700.1|  AGAMOUS-like protein EsAG2                              265   3e-83    
dbj|BAK20022.1|  PgMADS protein7                                        265   3e-83    
dbj|BAL41416.1|  Agamous like protein                                   266   3e-83    
emb|CAA04324.1|  MADS-box protein                                       264   4e-83    
gb|AEK33831.1|  agamous                                                 265   4e-83    
emb|CDY09267.1|  BnaC03g62970D                                          265   4e-83    
ref|NP_191437.1|  agamous-like MADS-box protein AGL1                    265   4e-83    
gb|ABO46006.1|  AGAMOUS-like protein                                    265   4e-83    
emb|CAA16753.1|  floral homeotic protein agamous                        266   4e-83    
dbj|BAK06517.1|  predicted protein                                      266   4e-83    
gb|ABK28609.1|  unknown                                                 265   5e-83    
gb|AIC33050.1|  flower development transporter AG2                      265   5e-83    
gb|ABC25564.1|  MADS box 2                                              264   5e-83    
emb|CAA37642.1|  unnamed protein product                                266   5e-83    
ref|XP_010504840.1|  PREDICTED: agamous-like MADS-box protein AGL...    267   6e-83    
gb|ABM69045.1|  MADS-box protein MADS7                                  265   6e-83    
ref|XP_009404530.1|  PREDICTED: floral homeotic protein AGAMOUS-like    264   6e-83    
ref|XP_009356654.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    265   7e-83    
gb|AER30448.1|  AGAMOUS4                                                265   7e-83    
gb|EMS57386.1|  MADS-box transcription factor 3                         265   7e-83    
gb|AEI01160.1|  SHATTERPPOOF-like protein                               265   7e-83    
dbj|BAA90743.1|  MADS-box protein                                       265   8e-83    
gb|ACD76828.1|  AGAMOUS-like protein                                    265   8e-83    
dbj|BAG24494.1|  FARINELLI-like MADS-box protein                        265   9e-83    
ref|XP_002876479.1|  hypothetical protein ARALYDRAFT_486333             265   9e-83    
ref|XP_004309724.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    265   9e-83    
ref|XP_006575666.1|  PREDICTED: agamous-like MADS-box protein AGL...    264   1e-82    
emb|CAA08801.1|  MADS-box protein, GAGA2                                264   1e-82    
emb|CAB95649.1|  MADS box protein                                       264   1e-82    
ref|XP_004513719.1|  PREDICTED: agamous-like MADS-box protein AGL...    264   1e-82    
gb|AAD01744.1|  agamous-like putative transcription factor              263   1e-82    
dbj|BAK20021.1|  PgMADS protein6                                        263   1e-82    
gb|ACN97631.1|  AGAMOUS-like protein                                    263   1e-82    
ref|XP_009360794.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    264   1e-82    
ref|XP_007217264.1|  hypothetical protein PRUPE_ppa010578mg             264   1e-82    
ref|XP_009132380.1|  PREDICTED: floral homeotic protein AGAMOUS i...    264   1e-82    
gb|ACD76829.1|  AGAMOUS-like protein                                    264   2e-82    
gb|ACD76826.1|  SHATTERPROOF1a-like protein                             264   2e-82    
gb|AHM92096.1|  MADS-box protein 20                                     263   2e-82    
ref|XP_010451378.1|  PREDICTED: floral homeotic protein AGAMOUS         265   2e-82    
ref|XP_002454985.1|  hypothetical protein SORBIDRAFT_03g002525          264   2e-82    
dbj|BAF34914.1|  MADS-box protein                                       264   2e-82    
gb|AFM30905.1|  transcription factor MADS5                              263   2e-82    
gb|AAQ54699.1|  AGAMOUS-like protein LpAG                               263   2e-82    
ref|XP_006284388.1|  hypothetical protein CARUB_v10005558mg             264   2e-82    
gb|AAO18229.1|  MADS-box transcriptional factor HAM59                   263   2e-82    
gb|AFI23876.1|  AGAMOUS1                                                263   2e-82    
ref|XP_010436489.1|  PREDICTED: floral homeotic protein AGAMOUS-like    265   2e-82    
gb|AAQ54702.1|  AGAMOUS-like protein GfAG1                              263   2e-82    
emb|CAC80858.1|  C-type MADS box protein                                263   3e-82    
gb|AAQ54696.1|  AGAMOUS-like protein CsaAG                              262   3e-82    
ref|XP_010516535.1|  PREDICTED: agamous-like MADS-box protein AGL...    263   3e-82    
sp|Q2V0P1.1|MAD58_ORYSJ  RecName: Full=MADS-box transcription fac...    264   3e-82    
ref|XP_009802761.1|  PREDICTED: floral homeotic protein AGAMOUS i...    263   3e-82    
gb|ADG45820.1|  mutant SHATTERPROOF-like protein                        263   3e-82    
gb|ADG45819.1|  SHATTERPROOF-like protein                               263   3e-82    
gb|KCW47399.1|  hypothetical protein EUGRSUZ_K01195                     263   3e-82    
gb|ABB92624.1|  AGAMOUS-like protein                                    261   4e-82    
gb|AAC08528.1|  CUM1                                                    263   4e-82    
gb|AAM76208.1|  AGAMOUS-like MADS-box transcription factor              262   4e-82    
gb|ADD25188.1|  AG                                                      261   4e-82    
gb|AAQ54697.1|  AGAMOUS-like protein CsAG1                              262   4e-82    
ref|XP_010516534.1|  PREDICTED: agamous-like MADS-box protein AGL...    263   4e-82    
ref|XP_008371525.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    263   4e-82    
gb|AAZ95251.1|  AGAMOUS-like transcription factor                       262   4e-82    
gb|AAQ54698.1|  AGAMOUS-like protein CsAG2                              262   5e-82    
ref|XP_008439701.1|  PREDICTED: floral homeotic protein AGAMOUS i...    262   5e-82    
gb|AAQ54695.1|  AGAMOUS-like protein CbpAG3                             262   5e-82    
gb|AHH28276.1|  MADS-box transcription factor                           261   5e-82    
gb|AFU81323.1|  D-class MADS-box-like protein                           261   5e-82    
gb|AIU94283.1|  floral homeotic protein AGAMOUS                         262   6e-82    
ref|NP_849351.1|  agamous-like MADS-box protein AGL11                   261   6e-82    
gb|AFO83615.1|  AGAMOUS-like protein                                    262   6e-82    
emb|CDY60297.1|  BnaC03g72890D                                          264   6e-82    
gb|AAS45697.1|  AGAMOUS-like protein                                    261   7e-82    
gb|AAQ54703.1|  AGAMOUS-like protein TaAG1                              261   7e-82    
emb|CDX99406.1|  BnaC01g11460D                                          264   7e-82    
ref|XP_010915442.1|  PREDICTED: MADS-box transcription factor 3 i...    262   8e-82    
ref|XP_011002033.1|  PREDICTED: floral homeotic protein AGAMOUS-like    262   8e-82    
dbj|BAB70737.1|  putative MADS-domain transcription factor MpMADS2      261   8e-82    
gb|AFK13159.1|  agamous                                                 262   8e-82    
dbj|BAD93166.1|  MADS-box transcription factor GbMADS2                  261   9e-82    
ref|XP_009113584.1|  PREDICTED: agamous-like MADS-box protein AGL...    261   9e-82    
ref|XP_002317315.1|  MADS-box family protein                            261   9e-82    
ref|XP_009421278.1|  PREDICTED: MADS-box transcription factor 3-like    261   9e-82    
ref|XP_007211925.1|  hypothetical protein PRUPE_ppa010595mg             261   9e-82    
emb|CBY05404.1|  SHATTERPROOF1-like protein                             262   1e-81    
gb|AAQ54707.1|  AGAMOUS-like protein GfAG3                              261   1e-81    
gb|AER34988.1|  AGAMOUS-like protein                                    261   1e-81    
ref|XP_008439700.1|  PREDICTED: floral homeotic protein AGAMOUS i...    262   1e-81    
dbj|BAN15735.1|  AGAMOUS like-protein                                   262   1e-81    
gb|AGU92563.1|  SHATTERPROOF-like protein                               261   1e-81    
ref|XP_009351902.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    261   1e-81    
gb|AAX69070.1|  MADS box protein M8                                     261   1e-81    
gb|AFU81372.1|  SHATTERPROOF                                            261   1e-81    
ref|NP_001280758.1|  agamous-like MADS-box protein AGL1                 261   1e-81    
emb|CBY05398.1|  SHATTERPROOF1-like protein                             261   1e-81    
gb|AAQ54692.1|  AGAMOUS-like protein CrAG                               261   1e-81    
ref|XP_004968556.1|  PREDICTED: MADS-box transcription factor 3-l...    261   1e-81    
ref|XP_008225406.1|  PREDICTED: floral homeotic protein AGAMOUS i...    263   2e-81    
emb|CDX98597.1|  BnaA03g43820D                                          261   2e-81    
gb|AAQ54693.1|  AGAMOUS-like protein CbpAG1                             260   2e-81    
dbj|BAK18552.1|  MADS-box transcription factor                          261   2e-81    
gb|AAA68001.1|  agamous protein                                         261   2e-81    
gb|AAQ54694.1|  AGAMOUS-like protein CbpAG2                             260   2e-81    
gb|AAT99428.1|  AG-like MADS-box protein                                261   2e-81    
gb|AAU82055.1|  SHATTERPROOF1                                           260   3e-81    
ref|XP_006654143.1|  PREDICTED: MADS-box transcription factor 58-...    261   3e-81    
gb|ACA42767.1|  shatterproof 2                                          260   3e-81    
gb|AGB51137.1|  Shatterproof                                            260   3e-81    
ref|XP_004485955.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    260   3e-81    
ref|XP_010506126.1|  PREDICTED: agamous-like MADS-box protein AGL...    260   3e-81    
gb|AAY63868.1|  AGAMOUS                                                 260   4e-81    
gb|AAF75773.2|AF265554_1  transcription factor CMB                      259   4e-81    
gb|ADP09005.1|  AGAMOUS-like protein                                    260   4e-81    
ref|XP_010445284.1|  PREDICTED: floral homeotic protein AGAMOUS-like    262   4e-81    
gb|AAU82079.1|  SHATTERPROOF2                                           260   4e-81    
gb|AAU29513.1|  MADS4                                                   259   5e-81    
emb|CAM59077.1|  MIKC-type MADS-box transcription factor WM29B          261   5e-81    
dbj|BAC22939.1|  MADS box transcription factor                          260   6e-81    
gb|ACD76824.1|  SHATTERPROOF2-like protein                              259   6e-81    
ref|XP_006411552.1|  hypothetical protein EUTSA_v10017047mg             259   6e-81    
ref|XP_009586722.1|  PREDICTED: floral homeotic protein AGAMOUS i...    259   6e-81    
gb|AAU82070.1|  SHATTERPROOF2                                           259   6e-81    
gb|AGV55405.1|  MADS-box transcription factor AGAMOUSa                  260   7e-81    
ref|NP_565986.1|  agamous-like MADS-box protein AGL5                    259   7e-81    
emb|CAC80857.1|  C-type MADS box protein                                259   7e-81    
gb|AAQ54704.1|  AGAMOUS-like protein TaAG2                              259   7e-81    
dbj|BAG69623.1|  MADS-box transcription factor                          259   7e-81    
gb|AAW78030.1|  AGAMOUS-like protein                                    259   8e-81    
gb|AEK94071.1|  AGAMOUS                                                 260   8e-81    
ref|XP_009142866.1|  PREDICTED: agamous-like MADS-box protein AGL5      259   9e-81    
ref|XP_009132356.1|  PREDICTED: floral homeotic protein AGAMOUS i...    259   1e-80    
gb|AGB51138.1|  Shatterproof                                            259   1e-80    
ref|XP_006595747.1|  PREDICTED: agamous-like MADS-box protein AGL...    258   1e-80    
emb|CAA08800.1|  MADS-box protein, GAGA1                                259   1e-80    
ref|XP_004968557.1|  PREDICTED: MADS-box transcription factor 3-l...    259   1e-80    
gb|AAQ54701.1|  AGAMOUS-like protein EsAG1                              258   2e-80    
ref|XP_009802759.1|  PREDICTED: floral homeotic protein AGAMOUS i...    258   2e-80    
ref|XP_009116562.1|  PREDICTED: agamous-like MADS-box protein AGL1      258   2e-80    
gb|AGK25050.1|  shatterproof                                            258   2e-80    
gb|AIU94766.1|  class D MADS-domain transcription factor                257   2e-80    
gb|ACD76825.1|  SCHATTERPROOF2-like protein                             258   2e-80    
gb|AAM74074.1|AF492455_1  MADS-box transcription factor                 258   2e-80    
ref|XP_009104172.1|  PREDICTED: agamous-like MADS-box protein AGL1      258   2e-80    
dbj|BAG69621.1|  MADS-box transcription factor                          258   3e-80    
ref|XP_003545122.1|  PREDICTED: agamous-like MADS-box protein AGL...    258   3e-80    
gb|AGK25046.1|  shatterproof                                            258   3e-80    
gb|AGK25043.1|  shatterproof                                            257   3e-80    
ref|XP_009136976.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    259   3e-80    
dbj|BAG06959.1|  MADS-box transcription factor                          258   4e-80    
emb|CBY05410.1|  SHATTERPROOF2-like protein                             257   4e-80    
emb|CBY05405.1|  SHATTERPROOF2-like protein                             257   4e-80    
ref|XP_006358069.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    257   5e-80    
gb|ACH72974.1|  AGAMOUS                                                 257   5e-80    
dbj|BAK18553.1|  MADS-box transcription factor                          257   5e-80    
gb|AGK25037.1|  shatterproof                                            256   6e-80    
gb|ADO23651.1|  agamous-like 1                                          257   6e-80    
gb|AAS45683.1|  AGAMOUS-like protein                                    256   6e-80    
ref|XP_004968558.1|  PREDICTED: MADS-box transcription factor 3-l...    257   6e-80    
emb|CAM59041.1|  MIKC-type MADS-box transcription factor WM2            258   7e-80    
ref|XP_008225407.1|  PREDICTED: floral homeotic protein AGAMOUS i...    257   7e-80    
ref|XP_011098072.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    256   7e-80    
ref|XP_007147970.1|  hypothetical protein PHAVU_006G169600g             257   7e-80    
gb|ADG63468.1|  agamous-like protein                                    257   7e-80    
gb|AAQ54705.1|  AGAMOUS-like protein EsAG3                              256   9e-80    
gb|AEV53931.1|  MADS-box transcription factor                           257   1e-79    
gb|AFP99884.1|  AGAMOUS                                                 256   1e-79    
gb|AGK25038.1|  shatterproof                                            255   1e-79    
dbj|BAH37040.1|  MADS-box transcription factor AG-like                  255   1e-79    
gb|ACG32928.1|  MADS-box transcription factor 3                         257   1e-79    
gb|AGK25044.1|  shatterproof                                            255   1e-79    
gb|AGK25042.1|  shatterproof                                            255   1e-79    
gb|ABF50233.1|  AGAMOUS                                                 254   1e-79    
gb|ABF50231.1|  AGAMOUS                                                 255   2e-79    
gb|AHM92074.1|  MADS-box protein 21                                     256   2e-79    
gb|ACR47977.1|  MADS box protein                                        256   2e-79    
gb|AFV13863.1|  shatterproof1-like protein SHP1                         253   3e-79    
gb|AGK25045.1|  shatterproof                                            255   3e-79    
gb|AGB51135.1|  Shatterproof                                            255   3e-79    
gb|AGB51134.1|  Shatterproof                                            255   3e-79    
emb|CDX98330.1|  BnaC06g16910D                                          255   3e-79    
gb|AEA76418.1|  putative AG                                             254   3e-79    
dbj|BAC97838.1|  peony                                                  255   3e-79    
emb|CAD23413.1|  m23                                                    257   3e-79    
gb|AAS45702.1|  AGAMOUS-like protein                                    254   4e-79    
gb|AAS45688.1|  AGAMOUS-like protein                                    254   4e-79    
ref|XP_010506124.1|  PREDICTED: agamous-like MADS-box protein AGL...    255   4e-79    
ref|XP_009586720.1|  PREDICTED: floral homeotic protein AGAMOUS i...    255   4e-79    
gb|ACN26807.1|  unknown                                                 256   4e-79    
gb|AAS45706.1|  AGAMOUS-like protein                                    253   4e-79    
emb|CAD23407.1|  putative MADS-domain transcription factor              256   4e-79    
gb|ABR68545.1|  AGAMOUS-like                                            253   6e-79    
ref|XP_009138935.1|  PREDICTED: agamous-like MADS-box protein AGL1      254   6e-79    
ref|NP_850377.1|  agamous-like MADS-box protein AGL5                    254   7e-79    
ref|XP_004485952.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    254   8e-79    



>ref|XP_009770275.1| PREDICTED: agamous-like MADS-box protein AGL11 [Nicotiana sylvestris]
Length=228

 Score =   384 bits (986),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 191/226 (85%), Positives = 207/226 (92%), Gaps = 2/226 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLC+AEIALIVFSSRGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSSRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TIDRYKKATS+ SN CT QELNAQFYQQESKKLRQQI M+QNSNRHLVGEGL S N
Sbjct  61   NIKATIDRYKKATSETSNACTTQELNAQFYQQESKKLRQQIQMIQNSNRHLVGEGLSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERGI++IRSKKH++I+AETENLQKRE+ LEQENAFLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGITRIRSKKHEMILAETENLQKREIQLEQENAFLRSKIAENERLQEL  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASY-PVP-DKKTLHL  227
            SMMP  GQ+Y AIQ YLARNMLQLN+MEG   SY  +P DKK+L L
Sbjct  181  SMMPTGGQDYSAIQQYLARNMLQLNMMEGGIPSYHQLPTDKKSLEL  226



>ref|XP_009599024.1| PREDICTED: agamous-like MADS-box protein AGL11 [Nicotiana tomentosiformis]
 ref|XP_009599025.1| PREDICTED: agamous-like MADS-box protein AGL11 [Nicotiana tomentosiformis]
Length=229

 Score =   384 bits (985),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 208/228 (91%), Gaps = 4/228 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLC+AEIALIVFSSRGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSSRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TIDRYKKATS+ SN CT QELNAQFYQQESKKLRQQI M+QNSNRHLVGEGL S N
Sbjct  61   NIKATIDRYKKATSETSNACTTQELNAQFYQQESKKLRQQIQMIQNSNRHLVGEGLSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERGI++IRSKKH++I+AETENLQKRE+ LEQENAFLR+K+AENERLQ+L
Sbjct  121  VRELKQLENRLERGITRIRSKKHEMILAETENLQKREIQLEQENAFLRSKVAENERLQEL  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVME-GVQASY--PVP-DKKTLHL  227
            SMMP  GQEY AIQ YLARNMLQLN+ME GV  SY   +P DKK+L L
Sbjct  181  SMMPAGGQEYSAIQQYLARNMLQLNMMEGGVPNSYHHQLPTDKKSLEL  228



>emb|CAA57445.1| fbp11 [Petunia x hybrida]
Length=228

 Score =   384 bits (985),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 208/228 (91%), Gaps = 3/228 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGRVYEY+NN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRVYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIKGTI+RYKKAT++ SN CT QELNAQFYQQESKKLRQQI +LQN+NRHLVGEGL + N
Sbjct  61   NIKGTIERYKKATAETSNACTTQELNAQFYQQESKKLRQQIQLLQNTNRHLVGEGLSALN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERGI++IRSKKH++I+AETENLQKRE+ LEQEN FLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGITRIRSKKHEMILAETENLQKREIQLEQENTFLRSKIAENERLQEL  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASY-PVP--DKKTLHLD  224
            SMMP  GQEY+A Q Y ARNMLQLN+MEG   SY P+P  DKK+L L+
Sbjct  181  SMMPATGQEYNAFQQYFARNMLQLNMMEGGVPSYDPLPAHDKKSLQLE  228



>gb|AIS71918.1| TAGL11 transcription factor [Nicotiana tabacum]
Length=229

 Score =   381 bits (978),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 207/228 (91%), Gaps = 4/228 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLC+AEIALIVFSSRGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSSRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TIDRYKKATS+ SN CT QELNAQFYQQESKKLRQQI M+QNSNRHLVGEGL S N
Sbjct  61   NIKATIDRYKKATSETSNACTTQELNAQFYQQESKKLRQQIQMIQNSNRHLVGEGLSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRE KQLE+RLERGI++IRSKKH++I+AETENLQKRE+ LEQENAFLR+K+AENERLQ+L
Sbjct  121  VREPKQLENRLERGITRIRSKKHEMILAETENLQKREIQLEQENAFLRSKVAENERLQEL  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVME-GVQASY--PVP-DKKTLHL  227
            SMMP  GQEY AIQ YLARNMLQLN+ME GV  SY   +P DKK+L L
Sbjct  181  SMMPAGGQEYSAIQQYLARNMLQLNMMEGGVPNSYHHQLPTDKKSLEL  228



>emb|CAA57311.1| floral binding protein number 7 [Petunia x hybrida]
Length=225

 Score =   380 bits (976),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/226 (82%), Positives = 208/226 (92%), Gaps = 2/226 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLC+AEIALIVFS+RGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+  IDRYKKAT + SN  T QELNAQFYQQESKKLRQQI ++QNSNRHLVGEGL S N
Sbjct  61   NIRAIIDRYKKATVETSNAFTTQELNAQFYQQESKKLRQQIQLIQNSNRHLVGEGLSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERGI++IRSKKH++I+AE+E+LQKRE+ LEQENAFLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGIARIRSKKHEMILAESEDLQKREIQLEQENAFLRSKIAENERLQEL  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVP-DKKTLHLD  224
            SMMP  GQEY+AIQ YLARNMLQLN+MEGV  SYP+P DKK+L L+
Sbjct  181  SMMPAGGQEYNAIQQYLARNMLQLNMMEGV-PSYPLPSDKKSLDLE  225



>ref|XP_010322781.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Solanum 
lycopersicum]
Length=232

 Score =   375 bits (964),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 208/231 (90%), Gaps = 7/231 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLC+AEIALIVFS+RGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TI+RYKKAT++ SN CT QELNAQFYQQESKKLRQQI M+QNSNRHLVGEGL   N
Sbjct  61   NIKATIERYKKATAETSNACTTQELNAQFYQQESKKLRQQIQMMQNSNRHLVGEGLSCLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERGIS+IRSKKH++I+AETENLQKRE+ LEQENAFLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGISRIRSKKHEMILAETENLQKREILLEQENAFLRSKIAENERLQEL  180

Query  358  SMMPGA-GQEYHAIQHYLARNMLQLNVME--GVQASYPVP----DKKTLHL  227
            SMMP A GQ+Y AIQ YLARNMLQLN+ME  GV +  P+P    DKK+L L
Sbjct  181  SMMPAAGGQDYSAIQQYLARNMLQLNMMEGQGVSSYDPLPPPHHDKKSLEL  231



>ref|XP_004241906.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322780.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Solanum 
lycopersicum]
Length=237

 Score =   375 bits (964),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 208/231 (90%), Gaps = 7/231 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLC+AEIALIVFS+RGRVYEYSNN
Sbjct  6    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSNN  65

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TI+RYKKAT++ SN CT QELNAQFYQQESKKLRQQI M+QNSNRHLVGEGL   N
Sbjct  66   NIKATIERYKKATAETSNACTTQELNAQFYQQESKKLRQQIQMMQNSNRHLVGEGLSCLN  125

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERGIS+IRSKKH++I+AETENLQKRE+ LEQENAFLR+KIAENERLQ+L
Sbjct  126  VRELKQLENRLERGISRIRSKKHEMILAETENLQKREILLEQENAFLRSKIAENERLQEL  185

Query  358  SMMPGA-GQEYHAIQHYLARNMLQLNVME--GVQASYPVP----DKKTLHL  227
            SMMP A GQ+Y AIQ YLARNMLQLN+ME  GV +  P+P    DKK+L L
Sbjct  186  SMMPAAGGQDYSAIQQYLARNMLQLNMMEGQGVSSYDPLPPPHHDKKSLEL  236



>ref|XP_006356513.1| PREDICTED: agamous-like MADS-box protein AGL11-like [Solanum 
tuberosum]
Length=232

 Score =   375 bits (962),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 207/231 (90%), Gaps = 7/231 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLC+AEIALIVFS+RGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TI+RYKKAT++ SN CT QELNAQFYQQESKKLRQQI M+QNSNRHLVGEGL   N
Sbjct  61   NIKATIERYKKATAETSNACTTQELNAQFYQQESKKLRQQIQMMQNSNRHLVGEGLSCLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERGIS+IRSKKH++I+AETENLQKRE+ LEQENAFLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGISRIRSKKHEMILAETENLQKREILLEQENAFLRSKIAENERLQEL  180

Query  358  SMMPG-AGQEYHAIQHYLARNMLQLNVME--GVQASYPVP----DKKTLHL  227
            SMMP   GQEY AIQ YLARNMLQLN+ME  GV +  P+P    DKK+L L
Sbjct  181  SMMPAPGGQEYSAIQQYLARNMLQLNMMEGQGVSSYDPLPPPHHDKKSLEL  231



>ref|XP_011095997.1| PREDICTED: agamous-like MADS-box protein AGL11 [Sesamum indicum]
 ref|XP_011096010.1| PREDICTED: agamous-like MADS-box protein AGL11 [Sesamum indicum]
 ref|XP_011096018.1| PREDICTED: agamous-like MADS-box protein AGL11 [Sesamum indicum]
 ref|XP_011096026.1| PREDICTED: agamous-like MADS-box protein AGL11 [Sesamum indicum]
Length=222

 Score =   374 bits (960),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 186/224 (83%), Positives = 206/224 (92%), Gaps = 3/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEY+NN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKKAT+D+SN  T QE+NAQFYQQESKKLRQQI MLQ+SNRHL+GE LGS N
Sbjct  61   NIRSTIDRYKKATADSSNAYTTQEINAQFYQQESKKLRQQIQMLQSSNRHLMGESLGSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLESRLERGI++IR KKH+LI+AETENLQKRE+ LEQENA LRAKI ENE+LQQL
Sbjct  121  VKELKQLESRLERGITRIRGKKHELILAETENLQKREIQLEQENACLRAKIQENEKLQQL  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            SMMP +GQ++ A Q YLARN+LQLN+ME V A YPVPDKKTLHL
Sbjct  181  SMMP-SGQDF-AFQAYLARNVLQLNMMENVTA-YPVPDKKTLHL  221



>ref|XP_009615311.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009615312.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Nicotiana 
tomentosiformis]
Length=231

 Score =   369 bits (947),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 205/231 (89%), Gaps = 6/231 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGRVYEYSN 
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRVYEYSNT  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TI+RYKKAT++ S+  T QELNAQFYQQESKKLRQQI ++QN+NRHLVGEG+ S N
Sbjct  61   NIKATIERYKKATAETSSAYTTQELNAQFYQQESKKLRQQIQLMQNTNRHLVGEGVSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERG+++IRSKKH++I+AETENLQKRE+ LEQENAFLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGLTRIRSKKHEMILAETENLQKREIQLEQENAFLRSKIAENERLQEL  180

Query  358  SMMPGAGQE--YHAIQHYLARNMLQLNVMEGVQA----SYPVPDKKTLHLD  224
            SMMP AGQE  Y+A Q Y ARNMLQLN+MEG+Q     S    DKK+ HLD
Sbjct  181  SMMPAAGQEQDYNAFQQYYARNMLQLNMMEGMQPSNYDSLLSSDKKSPHLD  231



>ref|XP_009774915.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009774922.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Nicotiana 
sylvestris]
Length=232

 Score =   369 bits (946),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 207/231 (90%), Gaps = 7/231 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGRVYEYSN 
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRVYEYSNT  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TI+RYKKAT++ S+  T QELNAQFYQQESKKLRQQI ++QN+NRHLVGEG+ S N
Sbjct  61   NIKATIERYKKATAETSSAYTTQELNAQFYQQESKKLRQQIQLMQNTNRHLVGEGVSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERG+++IRSKKH++I+AETENLQKRE+ LEQENAFLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGLTRIRSKKHEMILAETENLQKREIQLEQENAFLRSKIAENERLQEL  180

Query  358  SMMPGAGQE--YHAIQHYLARNMLQLNVMEGVQASY---PV--PDKKTLHL  227
            SMMP AGQE  Y+A Q Y ARNMLQLN+MEG+Q S    P+   DKK+LHL
Sbjct  181  SMMPAAGQEQDYNAFQQYYARNMLQLNMMEGMQPSNNYDPLLSADKKSLHL  231



>emb|CDP10741.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   366 bits (940),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 206/225 (92%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEY+NN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYANN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N IK TIDRY+KAT+DASN C+ QE+NAQFYQQESKKLRQQI M+QNSNRHL+GEGL S 
Sbjct  61   NSIKSTIDRYRKATTDASNSCSTQEINAQFYQQESKKLRQQIQMIQNSNRHLMGEGLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            NV+ELKQLE+RLERGIS+IRSKKH++I+AET+ LQKRE+ LEQENA LRAKIAENERLQQ
Sbjct  121  NVKELKQLENRLERGISRIRSKKHEMILAETDTLQKREIQLEQENACLRAKIAENERLQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            LS++P  GQEY+ +Q YLARN+LQLN+MEG+   + VPDKK+L L
Sbjct  181  LSIVP-PGQEYNEMQAYLARNLLQLNMMEGLPV-FQVPDKKSLQL  223



>ref|NP_001234194.1| TAGL11 transcription factor [Solanum lycopersicum]
 gb|AAM33102.2| TAGL11 transcription factor [Solanum lycopersicum]
Length=223

 Score =   364 bits (934),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 178/222 (80%), Positives = 200/222 (90%), Gaps = 2/222 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            N+K TI+RYKKAT++ S+  T QELNAQFYQQESKKLRQQI M+QN+NRHLVGEGL S N
Sbjct  61   NVKATIERYKKATAETSSAYTTQELNAQFYQQESKKLRQQIQMMQNTNRHLVGEGLSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERGI++IRSKKH+ I+AETE+L KRE+ LEQENAFLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGITRIRSKKHEAILAETEDLHKREIQLEQENAFLRSKIAENERLQEL  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASY-PV-PDKK  239
            SMMP  G+EY+A Q YLARNMLQLN+ME    SY P+ PD K
Sbjct  181  SMMPSGGEEYNAFQQYLARNMLQLNMMETALPSYDPLSPDHK  222



>ref|XP_006339358.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X1 
[Solanum tuberosum]
Length=232

 Score =   359 bits (922),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 202/229 (88%), Gaps = 5/229 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            N+K TI+RYKKAT++ S+  T QELNAQFYQQESKKLRQQI ++QN+NRHLVGEGL S N
Sbjct  61   NVKATIERYKKATAETSSAYTTQELNAQFYQQESKKLRQQIQLMQNTNRHLVGEGLCSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERGI++IRSKKH+ I+AETENL KRE+ LEQENAFLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGITRIRSKKHEAILAETENLHKREIQLEQENAFLRSKIAENERLQEL  180

Query  358  SMMPG---AGQEYHAIQHYLARNMLQLNVMEGVQASY-PV-PDKKTLHL  227
            SMMP     G+EY+A Q YLARNMLQLN+ME    SY P+ PD K  HL
Sbjct  181  SMMPSGEQGGEEYNAFQQYLARNMLQLNMMETAVPSYDPLSPDHKRSHL  229



>gb|EYU22764.1| hypothetical protein MIMGU_mgv1a013047mg [Erythranthe guttata]
Length=232

 Score =   358 bits (919),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 199/221 (90%), Gaps = 3/221 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEY+NN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKK+++D+S   T QE+NAQFYQ ESKKLRQQI MLQNSNRHL+GEGLGS N
Sbjct  61   NIRSTIDRYKKSSADSSTGFTTQEINAQFYQAESKKLRQQIQMLQNSNRHLMGEGLGSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+E+KQLESRLERGI++IR KKH++I+AETENLQKRE+ LEQENA LRAKI ENE+LQQL
Sbjct  121  VKEMKQLESRLERGIARIRVKKHEMILAETENLQKREIQLEQENALLRAKIQENEKLQQL  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKT  236
            SMMP AGQ+Y   Q Y ARN+ QLN+MEGV A YP+ DKKT
Sbjct  181  SMMP-AGQDYQ-FQAYYARNVFQLNMMEGVSA-YPICDKKT  218



>gb|EYU22762.1| hypothetical protein MIMGU_mgv1a013047mg [Erythranthe guttata]
Length=223

 Score =   358 bits (918),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 199/221 (90%), Gaps = 3/221 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEY+NN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKK+++D+S   T QE+NAQFYQ ESKKLRQQI MLQNSNRHL+GEGLGS N
Sbjct  61   NIRSTIDRYKKSSADSSTGFTTQEINAQFYQAESKKLRQQIQMLQNSNRHLMGEGLGSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+E+KQLESRLERGI++IR KKH++I+AETENLQKRE+ LEQENA LRAKI ENE+LQQL
Sbjct  121  VKEMKQLESRLERGIARIRVKKHEMILAETENLQKREIQLEQENALLRAKIQENEKLQQL  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKT  236
            SMMP AGQ+Y   Q Y ARN+ QLN+MEGV A YP+ DKKT
Sbjct  181  SMMP-AGQDYQ-FQAYYARNVFQLNMMEGVSA-YPICDKKT  218



>ref|XP_006339359.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X2 
[Solanum tuberosum]
Length=226

 Score =   357 bits (915),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 200/225 (89%), Gaps = 5/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            N+K TI+RYKKAT++ S+  T QELNAQFYQQESKKLRQQI ++QN+NRHLVGEGL S N
Sbjct  61   NVKATIERYKKATAETSSAYTTQELNAQFYQQESKKLRQQIQLMQNTNRHLVGEGLCSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERGI++IRSKKH+ I+AETENL KRE+ LEQENAFLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGITRIRSKKHEAILAETENLHKREIQLEQENAFLRSKIAENERLQEL  180

Query  358  SMMPG---AGQEYHAIQHYLARNMLQLNVMEGVQASY-PV-PDKK  239
            SMMP     G+EY+A Q YLARNMLQLN+ME    SY P+ PD K
Sbjct  181  SMMPSGEQGGEEYNAFQQYLARNMLQLNMMETAVPSYDPLSPDHK  225



>gb|EYU22761.1| hypothetical protein MIMGU_mgv1a013047mg [Erythranthe guttata]
Length=227

 Score =   352 bits (903),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 199/225 (88%), Gaps = 7/225 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEY+NN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSN----RHLVGEGL  551
            NI+ TIDRYKK+++D+S   T QE+NAQFYQ ESKKLRQQI MLQNSN    RHL+GEGL
Sbjct  61   NIRSTIDRYKKSSADSSTGFTTQEINAQFYQAESKKLRQQIQMLQNSNSLIHRHLMGEGL  120

Query  550  GSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER  371
            GS NV+E+KQLESRLERGI++IR KKH++I+AETENLQKRE+ LEQENA LRAKI ENE+
Sbjct  121  GSLNVKEMKQLESRLERGIARIRVKKHEMILAETENLQKREIQLEQENALLRAKIQENEK  180

Query  370  LQQLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKT  236
            LQQLSMMP AGQ+Y   Q Y ARN+ QLN+MEGV A YP+ DKKT
Sbjct  181  LQQLSMMP-AGQDYQ-FQAYYARNVFQLNMMEGVSA-YPICDKKT  222



>gb|AAS01765.1| MADS-box protein 1 [Eustoma exaltatum subsp. russellianum]
Length=218

 Score =   341 bits (875),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 192/210 (91%), Gaps = 2/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKI+IKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAE+ALI+FSSRGRVYEY+NN
Sbjct  1    MGRGKIDIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSSRGRVYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TIDRY+KATSDAS + T QE+NAQFYQQESKKLRQQI +LQNSNRHL+GEGL S N
Sbjct  61   NIKSTIDRYRKATSDASTVFTTQEINAQFYQQESKKLRQQIQVLQNSNRHLMGEGLSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLESRLERGIS+ RSKKH++I+AE E LQKRE+ LEQENA +R+KIAE ERLQ+L
Sbjct  121  VKELKQLESRLERGISRTRSKKHEMILAEVEYLQKREIQLEQENACIRSKIAEQERLQEL  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLN-VMEG  272
            SMMP  GQ+Y+A+Q YLA+N +Q+N +MEG
Sbjct  181  SMMP-PGQDYNAMQAYLAQNFMQVNGLMEG  209



>dbj|BAK09621.1| MADS-box transcription factor [Cyclamen persicum]
Length=222

 Score =   338 bits (868),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 199/225 (88%), Gaps = 5/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR YEY+NN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRCYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
             +K TI+RYKK ++D++N+C   E+NAQFYQQESKKLRQQI ML+N+NR+L+GEGLGS N
Sbjct  61   TVKSTIERYKKTSTDSANVCPTPEINAQFYQQESKKLRQQIQMLENTNRNLLGEGLGSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            ++E+KQLE+RL+RGIS+IRSKKH++I+AETENLQKRE+ LE EN FLRAKIAE ERLQ+L
Sbjct  121  LKEMKQLETRLDRGISRIRSKKHEMILAETENLQKRELELEHENTFLRAKIAEAERLQEL  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYP-VPDKKTLHL  227
            +M PG   EY A Q YLARN+LQLN+ME    SYP +P+KK LHL
Sbjct  181  NMGPGP--EY-AFQAYLARNVLQLNLMEE-GPSYPRLPEKKNLHL  221



>ref|XP_009615313.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Nicotiana 
tomentosiformis]
Length=217

 Score =   335 bits (859),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 191/231 (83%), Gaps = 20/231 (9%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGRVYEYSN 
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRVYEYSNT  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TI+RYKKAT++ S+  T QELNAQFYQQESKKLRQQI ++QN+NRHLVGEG+ S N
Sbjct  61   NIKATIERYKKATAETSSAYTTQELNAQFYQQESKKLRQQIQLMQNTNRHLVGEGVSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERG+++IRSKK              E+ LEQENAFLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGLTRIRSKK--------------EIQLEQENAFLRSKIAENERLQEL  166

Query  358  SMMPGAGQE--YHAIQHYLARNMLQLNVMEGVQA----SYPVPDKKTLHLD  224
            SMMP AGQE  Y+A Q Y ARNMLQLN+MEG+Q     S    DKK+ HLD
Sbjct  167  SMMPAAGQEQDYNAFQQYYARNMLQLNMMEGMQPSNYDSLLSSDKKSPHLD  217



>ref|XP_009774929.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Nicotiana 
sylvestris]
Length=218

 Score =   335 bits (858),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 193/231 (84%), Gaps = 21/231 (9%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGRVYEYSN 
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRVYEYSNT  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TI+RYKKAT++ S+  T QELNAQFYQQESKKLRQQI ++QN+NRHLVGEG+ S N
Sbjct  61   NIKATIERYKKATAETSSAYTTQELNAQFYQQESKKLRQQIQLMQNTNRHLVGEGVSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            VRELKQLE+RLERG+++IRSKK              E+ LEQENAFLR+KIAENERLQ+L
Sbjct  121  VRELKQLENRLERGLTRIRSKK--------------EIQLEQENAFLRSKIAENERLQEL  166

Query  358  SMMPGAGQE--YHAIQHYLARNMLQLNVMEGVQASY---PV--PDKKTLHL  227
            SMMP AGQE  Y+A Q Y ARNMLQLN+MEG+Q S    P+   DKK+LHL
Sbjct  167  SMMPAAGQEQDYNAFQQYYARNMLQLNMMEGMQPSNNYDPLLSADKKSLHL  217



>ref|XP_010665297.1| PREDICTED: MADS-box protein 5 isoform X1 [Vitis vinifera]
Length=223

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TIDRYKKA+SD++N  +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S  
Sbjct  61   NIKSTIDRYKKASSDSTNGGSTMEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLASLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH+L++AE E LQKRE+ LE E+ +LR KIAE ERLQQ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHELLLAEIEYLQKREIELENESVYLRTKIAEVERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+  +  E++AIQ  ++RN  Q N++EG    YP+PDKK LHL
Sbjct  181  NMV--STHEFNAIQALVSRNFFQPNMIEGGSTGYPLPDKKVLHL  222



>gb|EYU22763.1| hypothetical protein MIMGU_mgv1a013047mg [Erythranthe guttata]
Length=211

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 187/221 (85%), Gaps = 15/221 (7%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEY+NN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKK+++D+S   T QE+NAQFYQ ESKKLRQQI MLQNSNRHL+GEGLGS N
Sbjct  61   NIRSTIDRYKKSSADSSTGFTTQEINAQFYQAESKKLRQQIQMLQNSNRHLMGEGLGSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+E+KQLESRLERGI++IR KK            KRE+ LEQENA LRAKI ENE+LQQL
Sbjct  121  VKEMKQLESRLERGIARIRVKK------------KREIQLEQENALLRAKIQENEKLQQL  168

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKT  236
            SMMP AGQ+Y   Q Y ARN+ QLN+MEGV A YP+ DKKT
Sbjct  169  SMMP-AGQDYQ-FQAYYARNVFQLNMMEGVSA-YPICDKKT  206



>ref|XP_010665296.1| PREDICTED: MADS-box protein 5 isoform X2 [Vitis vinifera]
Length=229

 Score =   329 bits (843),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEYSNN
Sbjct  7    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYSNN  66

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TIDRYKKA+SD++N  +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S  
Sbjct  67   NIKSTIDRYKKASSDSTNGGSTMEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLASLT  126

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH+L++AE E LQKRE+ LE E+ +LR KIAE ERLQQ 
Sbjct  127  VKELKQLENRLERGITRIRSKKHELLLAEIEYLQKREIELENESVYLRTKIAEVERLQQA  186

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+  +  E++AIQ  ++RN  Q N++EG    YP+PDKK LHL
Sbjct  187  NMV--STHEFNAIQALVSRNFFQPNMIEGGSTGYPLPDKKVLHL  228



>emb|CBI39246.3| unnamed protein product [Vitis vinifera]
Length=233

 Score =   328 bits (842),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TIDRYKKA+SD++N  +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S  
Sbjct  61   NIKSTIDRYKKASSDSTNGGSTMEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLASLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH+L++AE E LQKRE+ LE E+ +LR KIAE ERLQQ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHELLLAEIEYLQKREIELENESVYLRTKIAEVERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+  +  E++AIQ  ++RN  Q N++EG    YP+PDKK LHL
Sbjct  181  NMV--STHEFNAIQALVSRNFFQPNMIEGGSTGYPLPDKKVLHL  222



>ref|NP_001268118.1| MADS-box protein 5 [Vitis vinifera]
 gb|AAM21345.1|AF373604_1 MADS-box protein 5 [Vitis vinifera]
Length=223

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 188/224 (84%), Gaps = 2/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TIDRYKKA+SD++N     E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S  
Sbjct  61   NIKSTIDRYKKASSDSTNGGFTMEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLASLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH+L++AE E LQKRE+ LE E+ +LR KIAE ERLQQ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHELLLAEIEYLQKREIELENESVYLRTKIAEVERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+  +  E++AIQ  ++RN  Q N++EG    YP+ DKK LHL
Sbjct  181  NMV--STHEFNAIQALVSRNFFQPNMIEGGSTGYPLHDKKVLHL  222



>ref|XP_007020163.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
 ref|XP_007020164.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
 gb|EOY17388.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
 gb|EOY17389.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
Length=222

 Score =   310 bits (795),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 184/224 (82%), Gaps = 3/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD+SN  +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S  
Sbjct  61   NIRSTIERYKKACSDSSNTNSVIEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLSSLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E LQKRE+ LE E+  LR KIAE ERLQQ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYLQKREIELENESVCLRTKIAEIERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+ G   E +AIQ   +RN    NV+EG  A Y  PDKK LHL
Sbjct  181  NMVTGP--ELNAIQALASRNFFSPNVIEGGTA-YSHPDKKILHL  221



>ref|XP_006478208.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X3 
[Citrus sinensis]
 ref|XP_006478209.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X4 
[Citrus sinensis]
Length=223

 Score =   310 bits (795),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 182/224 (81%), Gaps = 2/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSN+
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNS  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKKA SD SN  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S  
Sbjct  61   NIRSTIDRYKKACSDNSNSGTVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLSSLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E LQKRE+ LE E+  LR+KIAE ER QQ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEFLQKREIELENESVCLRSKIAEMERFQQA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+   GQE +AI    +RN     ++EG   +Y  PDKK LHL
Sbjct  181  NMV--TGQELNAIHALASRNFFSPAIIEGGGTAYSHPDKKILHL  222



>gb|AGV15453.1| MADS protein [Gossypium hirsutum]
Length=223

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 181/224 (81%), Gaps = 2/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKKA SD SN  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S  
Sbjct  61   NIRSTIDRYKKACSDTSNTNTVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLSSLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLERGI++IRSKKH++++AE E LQKRE+ LE E+  LR KIAE ERLQQ 
Sbjct  121  VKELKQVENRLERGITRIRSKKHEMLLAEIEFLQKREIELENESVCLRTKIAEIERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+ G   E +AIQ   +RN    NV+E   A   + DKK LHL
Sbjct  181  NMVTGP--ELNAIQALASRNFFSPNVIEHPSAYSHLSDKKILHL  222



>gb|KDP36700.1| hypothetical protein JCGZ_07991 [Jatropha curcas]
Length=222

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 184/224 (82%), Gaps = 3/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TI+RYKKA SD++N  +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S  
Sbjct  61   NIKSTIERYKKACSDSTNASSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLSSLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH+L++AE E LQKRE+ LE E+  LR KIAE ERLQQ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHELLLAEIEYLQKREIELENESVCLRTKIAEIERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+ GA  E +AIQ   +RN    +++E   A Y  PDKK LHL
Sbjct  181  NMVTGA--ELNAIQALTSRNFFGPHMIEDGTA-YSHPDKKILHL  221



>ref|XP_008378733.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Malus 
domestica]
 ref|XP_008378734.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Malus 
domestica]
 ref|XP_008378735.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 [Malus 
domestica]
Length=223

 Score =   308 bits (788),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 185/224 (83%), Gaps = 2/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFS+RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSTRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L +  
Sbjct  61   NIRNTIERYKKACSDSTGSSSVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLERGI++IRSKKH+L++AE E  QK+E+ LE EN +LR K++E ERLQQ 
Sbjct  121  VKELKQVENRLERGITRIRSKKHELLLAEIEYFQKKEIELENENVYLRTKVSEVERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+ G+  E +AIQ   +R+    N++EG  A++P  DKK LHL
Sbjct  181  NMVSGS--EMNAIQALASRHFFSQNMIEGGXATFPQQDKKNLHL  222



>gb|AAN15183.1| MADS box protein GHMADS-2 [Gossypium hirsutum]
 gb|ABM69044.1| MADS-box protein MADS6 [Gossypium hirsutum]
 gb|ACI23560.1| agamous-like protein 1 [Gossypium barbadense]
 gb|KHG27117.1| hypothetical protein F383_10728 [Gossypium arboreum]
Length=223

 Score =   308 bits (788),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 180/224 (80%), Gaps = 2/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKKA SD SN  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S  
Sbjct  61   NIRSTIDRYKKACSDTSNTNTVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLSSLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLERGI++IRSKKH++++AE E LQKRE+ LE E+  LR KIAE ERLQQ 
Sbjct  121  VKELKQVENRLERGITRIRSKKHEMLLAEIEFLQKREIELENESVCLRTKIAEIERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+ G   E +AIQ   +RN    NV+E   A     DKK LHL
Sbjct  181  NMVTGP--ELNAIQALASRNFFSPNVIEHPSAYSHPSDKKILHL  222



>gb|ADN22973.1| mads-box transcription factor [Siraitia grosvenorii]
Length=227

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 183/228 (80%), Gaps = 6/228 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSN----RHLVGEGL  551
            +IK TIDRYKKA SD+S   +  ELN Q+YQQES KLRQQI MLQNSN    RHL+G+ L
Sbjct  61   SIKTTIDRYKKACSDSSATSSVTELNTQYYQQESAKLRQQIQMLQNSNSNLVRHLMGDSL  120

Query  550  GSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER  371
             +  V+ELKQLE+RLERGI++IRSKKH++++AE E LQKRE+ LE EN  +R KIAE ER
Sbjct  121  SALTVKELKQLENRLERGITRIRSKKHEMLLAEIEYLQKREIELENENVCIRTKIAEVER  180

Query  370  LQQLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            LQQ +M+  +GQE +AIQ   +RN    N+MEG   ++   DKK LHL
Sbjct  181  LQQANMV--SGQELNAIQALASRNFFNPNMMEGGAVTFSHQDKKMLHL  226



>ref|XP_006478206.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X1 
[Citrus sinensis]
 ref|XP_006478207.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X2 
[Citrus sinensis]
Length=224

 Score =   306 bits (784),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 182/225 (81%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSN+
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNS  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TIDRYKKA SD SN  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S 
Sbjct  61   NSIRSTIDRYKKACSDNSNSGTVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             V+ELKQLE+RLERGI++IRSKKH++++AE E LQKRE+ LE E+  LR+KIAE ER QQ
Sbjct  121  TVKELKQLENRLERGITRIRSKKHEMLLAEIEFLQKREIELENESVCLRSKIAEMERFQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +M+   GQE +AI    +RN     ++EG   +Y  PDKK LHL
Sbjct  181  ANMV--TGQELNAIHALASRNFFSPAIIEGGGTAYSHPDKKILHL  223



>ref|XP_008219059.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Prunus 
mume]
Length=221

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 184/224 (82%), Gaps = 4/224 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD+S   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + +
Sbjct  61   NIRNTIERYKKACSDSSGSTSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E LQK+E+ LE EN  LR KI+E ERLQQ 
Sbjct  121  VKELKQLENRLERGINRIRSKKHEMLLAEIEYLQKKEIELENENVCLRTKISEVERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+   G E +AIQ   +RN     +MEG  A+YP  DKK LHL
Sbjct  181  NMV---GPELNAIQALASRNFFSQTMMEG-GATYPQQDKKILHL  220



>ref|NP_001236130.1| MADS domain transporter AGL11 [Glycine max]
 ref|XP_006580912.1| PREDICTED: MADS domain transporter AGL11 isoform X1 [Glycine 
max]
 ref|XP_006580913.1| PREDICTED: MADS domain transporter AGL11 isoform X2 [Glycine 
max]
 gb|ABD28284.1| MADS domain transporter AGL11 [Glycine max]
Length=222

 Score =   305 bits (781),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 182/224 (81%), Gaps = 3/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD S+  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L +  
Sbjct  61   NIRSTIERYKKACSDHSSASTTTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E  QKRE+ LE EN  LR KI + ER+QQ+
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYFQKREIELENENLCLRTKITDVERIQQV  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+  +G E +AIQ   +RN    N++EG    YP  DKK LHL
Sbjct  181  NMV--SGPELNAIQALASRNFFNPNMLEG-GTVYPHSDKKILHL  221



>gb|ADB93926.1| SEEDSTICK-like protein [Prunus serrulata var. lannesiana]
Length=222

 Score =   305 bits (780),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 186/225 (83%), Gaps = 5/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSSRGRLYEYSNN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TI+RYKKA SD+S   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + 
Sbjct  61   NSIRNTIERYKKACSDSSGSTSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELKQLE+RLERGI++IRSKKH++++AE E LQK+E+ LE EN  LR KI+E ERLQQ
Sbjct  121  SVKELKQLENRLERGINRIRSKKHEMLLAEIEYLQKKEIELENENVCLRTKISEVERLQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +M+   G E +AIQ  ++RN    N+MEG  A+YP  DKK LHL
Sbjct  181  ANMV---GPELNAIQALVSRNFFSQNIMEG-GATYPQQDKKILHL  221



>gb|AAY30856.1| MADS-box transcription factor [Prunus dulcis]
Length=221

 Score =   305 bits (780),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 184/224 (82%), Gaps = 4/224 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+ YKKA SD+S   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + +
Sbjct  61   NIRNTIEGYKKACSDSSGSTSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E LQK+E+ LE EN  LR KI+E ERLQQ 
Sbjct  121  VKELKQLENRLERGINRIRSKKHEMLLAEIEYLQKKEIELENENVCLRTKISEVERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+   G E +AIQ   +RN    N+MEG  A+YP  DKK LHL
Sbjct  181  NMV---GPELNAIQALASRNFFSQNMMEG-GATYPQQDKKILHL  220



>ref|XP_009379167.1| PREDICTED: agamous-like MADS-box protein AGL11 [Pyrus x bretschneideri]
Length=224

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 186/225 (83%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFS+RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSTRGRLYEYSNN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+  I+RYKKA S+++   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + 
Sbjct  61   NSIRNIIERYKKACSESTGSTSVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELKQ+E+RLERGI++IRSKKH+L++AE E  QK+E+ LE EN +LR KI+E ERLQQ
Sbjct  121  SVKELKQVENRLERGITRIRSKKHELLLAEIEYFQKKEIELENENVYLRTKISEVERLQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +M+PG+  E +AIQ   +RN    N++EG  A++P  DKK LHL
Sbjct  181  ANMVPGS--EMNAIQALASRNFFSQNMIEGGGATFPQQDKKNLHL  223



>gb|AAO20104.1| mads-box transcription factor [Momordica charantia]
Length=227

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 182/228 (80%), Gaps = 6/228 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSN----RHLVGEGL  551
            +IK TI RYKKA SD+S   +  ELN Q+YQQES KLRQQI MLQNSN    RHL+G+ L
Sbjct  61   SIKTTIGRYKKACSDSSATSSVTELNTQYYQQESAKLRQQIQMLQNSNSNLVRHLMGDSL  120

Query  550  GSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER  371
             +  V+ELKQLE+RLERGI++IRSKKH++++AE E LQKRE+ LE EN  +R KIAE ER
Sbjct  121  SALTVKELKQLENRLERGITRIRSKKHEMLLAEIEYLQKREIELENENVCIRTKIAEVER  180

Query  370  LQQLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            LQQ +M+  +GQE +AIQ   +RN    N+MEG   ++   DKK LHL
Sbjct  181  LQQANMV--SGQELNAIQALASRNFFTPNMMEGGAVTFSHQDKKMLHL  226



>ref|XP_007223946.1| hypothetical protein PRUPE_ppa011140mg [Prunus persica]
 gb|ADD91578.1| SEEDSTICK-like protein [Prunus serrulata var. lannesiana]
 gb|EMJ25145.1| hypothetical protein PRUPE_ppa011140mg [Prunus persica]
Length=222

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 185/225 (82%), Gaps = 5/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSSRGRLYEYSNN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TI+RYKKA SD+S   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + 
Sbjct  61   NSIRNTIERYKKACSDSSGSTSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELKQLE+RLERGI++IRSKKH++++AE E LQK+E+ LE EN  LR KI+E ERLQQ
Sbjct  121  SVKELKQLENRLERGINRIRSKKHEMLLAEIEYLQKKEIELENENVCLRTKISEVERLQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +M+   G E +AIQ   +RN    N+MEG  A+YP  DKK LHL
Sbjct  181  ANMV---GPELNAIQALASRNFFSQNMMEG-GATYPQQDKKILHL  221



>ref|XP_008378732.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Malus 
domestica]
Length=224

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 185/225 (82%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFS+RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSTRGRLYEYSNN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TI+RYKKA SD++   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + 
Sbjct  61   NSIRNTIERYKKACSDSTGSSSVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             V+ELKQ+E+RLERGI++IRSKKH+L++AE E  QK+E+ LE EN +LR K++E ERLQQ
Sbjct  121  TVKELKQVENRLERGITRIRSKKHELLLAEIEYFQKKEIELENENVYLRTKVSEVERLQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +M+ G+  E +AIQ   +R+    N++EG  A++P  DKK LHL
Sbjct  181  ANMVSGS--EMNAIQALASRHFFSQNMIEGGXATFPQQDKKNLHL  223



>ref|NP_001280931.1| agamous-like MADS-box protein AGL11 [Malus domestica]
 gb|ADL36741.1| MADS domain class transcription factor [Malus domestica]
Length=224

 Score =   302 bits (774),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 185/225 (82%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFS+RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSTRGRLYEYSNN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TI+RYKKA SD++   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + 
Sbjct  61   NSIRNTIERYKKACSDSTGSSSVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             V+ELKQ+E+RLERGI++IRSKKH+L++AE E  QK+E+ LE EN +LR K++E ERLQQ
Sbjct  121  TVKELKQVENRLERGITRIRSKKHELLLAEIEYFQKKEIELENENVYLRTKVSEVERLQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +M+ G+  E +AIQ   +R+    N++EG  A++P  DKK LHL
Sbjct  181  ANMVSGS--EMNAIQALASRHFFSQNMIEGGGATFPQQDKKNLHL  223



>ref|XP_003598035.1| MADS box protein [Medicago truncatula]
 gb|AES68286.1| MADS-box transcription factor [Medicago truncatula]
Length=223

 Score =   302 bits (774),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 182/224 (81%), Gaps = 2/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKKA SD S+  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L +  
Sbjct  61   NIRSTIDRYKKACSDHSSTTTTTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E  QKRE+ LE EN  LR KI + ERL Q+
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYFQKREIELENENLCLRTKINDVERLPQV  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+  +GQE +AIQ   +RN    N+ME  + SY   DKK LHL
Sbjct  181  NMV--SGQELNAIQALASRNFFNPNMMEDGETSYHQSDKKILHL  222



>ref|NP_001289639.1| glycogen debranching enzyme [Eucalyptus grandis]
 dbj|BAH56659.1| agamous-like protein [Eucalyptus grandis]
Length=222

 Score =   302 bits (774),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 184/224 (82%), Gaps = 3/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +I+ TI+RYKKA SD+SN  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S +
Sbjct  61   SIRSTIERYKKANSDSSNTSTVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++ E E LQK+E+ LE E+ FLR KIAE +R+QQ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLTEIEYLQKKEIELENESVFLRTKIAEVDRIQQG  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+  AG + + ++   +RN    N++EG  A Y   DKK LHL
Sbjct  181  NMV--AGPQVNVMEALASRNFFPSNMVEGGTA-YSHSDKKVLHL  221



>ref|XP_004499566.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X1 
[Cicer arietinum]
 ref|XP_004499567.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X2 
[Cicer arietinum]
 ref|XP_004499568.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X3 
[Cicer arietinum]
Length=222

 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 183/224 (82%), Gaps = 3/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKKA SD S+  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L +  
Sbjct  61   NIRSTIDRYKKACSDHSSTSTTTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E  QKRE+ LE EN  LR+KI + ERL Q+
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYFQKREIELENENLCLRSKINDVERLPQV  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+  +GQE +AIQ   +RN    N+ME    SYP  DKK LHL
Sbjct  181  NMV--SGQELNAIQALASRNFFNPNMMED-GTSYPQSDKKILHL  221



>ref|XP_008219057.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Prunus 
mume]
 ref|XP_008219058.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Prunus 
mume]
Length=222

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 184/225 (82%), Gaps = 5/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSSRGRLYEYSNN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TI+RYKKA SD+S   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + 
Sbjct  61   NSIRNTIERYKKACSDSSGSTSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELKQLE+RLERGI++IRSKKH++++AE E LQK+E+ LE EN  LR KI+E ERLQQ
Sbjct  121  SVKELKQLENRLERGINRIRSKKHEMLLAEIEYLQKKEIELENENVCLRTKISEVERLQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +M+   G E +AIQ   +RN     +MEG  A+YP  DKK LHL
Sbjct  181  ANMV---GPELNAIQALASRNFFSQTMMEG-GATYPQQDKKILHL  221



>ref|XP_007148609.1| hypothetical protein PHAVU_005G000900g [Phaseolus vulgaris]
 ref|XP_007148610.1| hypothetical protein PHAVU_005G000900g [Phaseolus vulgaris]
 ref|XP_007148611.1| hypothetical protein PHAVU_005G000900g [Phaseolus vulgaris]
 gb|ESW20603.1| hypothetical protein PHAVU_005G000900g [Phaseolus vulgaris]
 gb|ESW20604.1| hypothetical protein PHAVU_005G000900g [Phaseolus vulgaris]
 gb|ESW20605.1| hypothetical protein PHAVU_005G000900g [Phaseolus vulgaris]
Length=222

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 183/224 (82%), Gaps = 3/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD S+  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L +  
Sbjct  61   NIRSTIERYKKACSDHSSTSTTTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E  QKRE+ LE EN  LR KI + ER+QQ+
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYFQKREIELENENLCLRTKITDVERIQQV  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+  +G E +AIQ   +RN    N+MEG  + YP  DKK LHL
Sbjct  181  NMV--SGPELNAIQALASRNFFNPNMMEG-GSVYPQSDKKILHL  221



>ref|NP_001267506.1| agamous-like MADS-box protein AGL11-like [Cucumis sativus]
 gb|AAD01742.1| agamous-like putative transcription factor [Cucumis sativus]
Length=225

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 182/226 (81%), Gaps = 4/226 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +IK TI+RYKKA SD+S   +  ELN Q+YQQES KLRQQI MLQNSNRHL+G+ L +  
Sbjct  61   SIKTTIERYKKACSDSSATSSVTELNTQYYQQESAKLRQQIQMLQNSNRHLMGDSLSALT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E LQKRE+ LE EN  +R KIAE ER+QQ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYLQKREIELENENVCIRTKIAEVERVQQA  180

Query  358  SMMPGAGQEYHAIQHYL-ARNMLQLNVMEGV-QASYPVPDKKTLHL  227
            +M+  +GQE +AIQ    +RN    N+ME     SY   DKK LHL
Sbjct  181  NMV--SGQELNAIQALANSRNFFSPNIMEPAGPVSYSHQDKKMLHL  224



>gb|ABM69043.1| MADS-box protein MADS5 [Gossypium hirsutum]
 gb|KHG02607.1| hypothetical protein F383_24789 [Gossypium arboreum]
Length=224

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA S  SN  T  E+NAQ+YQQES KLRQQI MLQNS+RHL+G+ L S  
Sbjct  61   NIRSTIERYKKACSGTSNTNTVTEINAQYYQQESAKLRQQIQMLQNSSRHLMGDSLSSLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E  QKREV LE E+  LRAKIAE ER+++ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYFQKREVELENESVCLRAKIAEIERVEEA  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVME-GVQASYPVPDKKTLHL  227
            +M+ GA  E +AIQ   +RN    NV+E G    Y   DKK LHL
Sbjct  181  NMVTGA--ELNAIQALASRNFFTPNVIERGTPTPYSHHDKKILHL  223



>gb|KCW69546.1| hypothetical protein EUGRSUZ_F02981 [Eucalyptus grandis]
Length=222

 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 183/224 (82%), Gaps = 3/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +I+ TI+RYKKA SD+SN  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S +
Sbjct  61   SIRSTIERYKKANSDSSNTSTVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++ E E LQK+E+ LE E+ FLR KIAE +R+QQ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLTEIEYLQKKEIELENESVFLRTKIAEVDRIQQG  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+  AG + + ++   +RN    N++EG    Y   DKK LHL
Sbjct  181  NMV--AGPQVNVMEALASRNFFPSNMVEG-GTVYSHSDKKVLHL  221



>ref|XP_003523484.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X1 
[Glycine max]
 ref|XP_006579009.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X2 
[Glycine max]
 ref|XP_006579010.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X3 
[Glycine max]
 ref|XP_006579011.1| PREDICTED: agamous-like MADS-box protein AGL11-like isoform X4 
[Glycine max]
Length=222

 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 181/224 (81%), Gaps = 3/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE++LIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD S+  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L +  
Sbjct  61   NIRSTIERYKKACSDHSSASTTTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERG+++IRSKKH++++AE E  QKRE+ LE EN  LR KI + ER+QQ+
Sbjct  121  VKELKQLENRLERGLTRIRSKKHEMLLAEIEYFQKREIELENENLCLRTKITDVERIQQV  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+  +G E + IQ   +RN    N+++G    YP  DKK LHL
Sbjct  181  NMV--SGPELNVIQALASRNFFNPNMLDG-GTVYPQTDKKILHL  221



>gb|ABQ85556.1| SEEDSTICK-like protein [Prunus persica]
Length=222

 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 184/225 (82%), Gaps = 5/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MG GKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGGGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSSRGRLYEYSNN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TI+RYKKA SD+S   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + 
Sbjct  61   NSIRNTIERYKKACSDSSGSTSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELKQLE+RLERGI++IRSKKH++++AE E LQK+E+ LE EN  LR KI+E ERLQQ
Sbjct  121  SVKELKQLENRLERGINRIRSKKHEMLLAEIEYLQKKEIELENENVCLRTKISEVERLQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +M+   G E +AIQ   +RN    N+MEG  A+YP  DKK LHL
Sbjct  181  ANMV---GPELNAIQALASRNFFSQNMMEG-GATYPQQDKKILHL  221



>gb|AAT46096.1| AGAMOUS-like protein [Akebia trifoliata]
Length=229

 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 185/227 (81%), Gaps = 3/227 (1%)
 Frame = -1

Query  907  EGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEY  728
            EG+MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YE+
Sbjct  5    EGDMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEF  64

Query  727  SNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLG  548
            SN++IK TI+RYKKA++D+SN  +  E NA +YQ E+ KLRQQI  LQ +NR L+G+ L 
Sbjct  65   SNSSIKSTIERYKKASADSSNTTSIIEANAHYYQHEATKLRQQIQNLQIANRQLMGDSLS  124

Query  547  SSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL  368
            S  V+ELKQLE+RLERG+++IRSKK +++ AE E +QKREV L++EN +LRAKIAENE  
Sbjct  125  SLTVKELKQLENRLERGLTRIRSKKQEIMFAEIEYMQKREVELQKENMYLRAKIAENENA  184

Query  367  QQLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            QQ SM+P   QE+ AIQ + +RN  Q+N++EG  A+Y   D+  LHL
Sbjct  185  QQTSMVP--AQEFDAIQTFDSRNYFQMNMLEG-GAAYSHADQTALHL  228



>gb|AEH41428.1| seedstick-like protein [Prunus avium]
Length=222

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 184/225 (82%), Gaps = 5/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MG GKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGGGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSSRGRLYEYSNN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TI+RYKKA SD+S   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + 
Sbjct  61   NSIRNTIERYKKACSDSSGSTSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELKQLE+RLERGI++IRSKKH++++AE E LQK+E+ LE EN  LR KI+E E+LQQ
Sbjct  121  SVKELKQLENRLERGINRIRSKKHEMLLAEIEYLQKKEIELENENVCLRTKISEVEKLQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +M+   G E +AIQ   +RN    N+MEG  A+YP  DKK LHL
Sbjct  181  ANMV---GPELNAIQALASRNFFSQNMMEG-GATYPQQDKKILHL  221



>ref|XP_008459658.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 [Cucumis 
melo]
Length=226

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 181/226 (80%), Gaps = 3/226 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +IK TI+RYKKA SD+S   +  ELN Q+YQQES KLRQQI MLQNSNRHL+G+ L +  
Sbjct  61   SIKTTIERYKKACSDSSATSSVTELNTQYYQQESAKLRQQIQMLQNSNRHLMGDSLSALT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E LQKRE+ LE EN  +R KIAE ER+QQ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYLQKREIELENENVCIRTKIAEVERVQQA  180

Query  358  SMMPGAGQEYHAIQHYL-ARNMLQLNVMEGV-QASYPVPDKKTLHL  227
            + M  +GQE +AIQ    +RN    N+ME     S+   DKK LHL
Sbjct  181  N-MAVSGQELNAIQALANSRNFFSPNIMEPAGPVSFSHQDKKMLHL  225



>gb|AAX13306.1| MADS box protein AGL11 [Lotus japonicus]
 gb|AFK44969.1| unknown [Lotus japonicus]
Length=223

 Score =   296 bits (759),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 183/225 (81%), Gaps = 4/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD S+  T  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L +  
Sbjct  61   NIRSTIERYKKACSDHSSTSTTTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E  QKRE+ LE EN  LR KI + ER+QQ+
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYFQKREIELENENLCLRTKITDVERIQQV  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYP-VPDKKTLHL  227
            +M+  +GQE +AIQ   +RN     ++E    SYP  PDKK LHL
Sbjct  181  NMV--SGQELNAIQALASRNFFNPPMIED-GTSYPQQPDKKILHL  222



>ref|XP_006376118.1| CUM10 family protein [Populus trichocarpa]
 gb|ERP53915.1| CUM10 family protein [Populus trichocarpa]
Length=224

 Score =   296 bits (759),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 184/225 (82%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE++LIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKK +SD+SN  +  E+NAQ+YQQES K+RQQI +LQNSNRHL+GE + + +
Sbjct  61   NIRSTIDRYKKVSSDSSNTASITEINAQYYQQESAKMRQQIQLLQNSNRHLMGEAVSNLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERG+++IRSKKH+L++AE E +QKRE+ LE E+A LR KIAE ERLQQ 
Sbjct  121  VKELKQLENRLERGMTRIRSKKHELLLAEIEYMQKREIELENESACLRTKIAEVERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLA-RNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+   G+E +AIQ   A RN    + +EG  A     +KK LHL
Sbjct  181  NMVT--GEELNAIQALAASRNFFAPHFLEGGTAYPHTYNKKILHL  223



>ref|XP_010312975.1| PREDICTED: TAGL11 transcription factor isoform X1 [Solanum lycopersicum]
Length=198

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            N+K TI+RYKKAT++ S+  T QELNAQFYQQESKKLRQQI M+QN+NRHLVGEGL S N
Sbjct  61   NVKATIERYKKATAETSSAYTTQELNAQFYQQESKKLRQQIQMMQNTNRHLVGEGLSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAK  389
            VRELKQLE+RLERGI++IRSKKH+ I+AETE+L KRE+ LEQENAFLR+K
Sbjct  121  VRELKQLENRLERGITRIRSKKHEAILAETEDLHKREIQLEQENAFLRSK  170



>gb|AAS45686.1| AGAMOUS-like protein [Meliosma dilleniifolia]
Length=225

 Score =   296 bits (758),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 175/209 (84%), Gaps = 1/209 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TIDRYKKA +D SN  +  E NAQFYQQES KLRQQI +LQNSNRHL+GE L +  
Sbjct  61   SVKATIDRYKKACADTSNTGSVSEANAQFYQQESSKLRQQIVILQNSNRHLMGEALSAMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
            V+ELKQLE RLE+GIS+IRSKK++++ AE E +QKRE+ ++ +N +LRAKIAENER QQ 
Sbjct  121  VKELKQLEGRLEKGISRIRSKKNEMLFAEIEYMQKREIDMQNDNMYLRAKIAENERAQQH  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            +SMMP +  E    Q + +RN LQ+N++E
Sbjct  181  MSMMPTSEYEAMPPQQFDSRNFLQVNLLE  209



>gb|ABV60385.1| floral organ identity protein [Carica papaya]
Length=219

 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 180/225 (80%), Gaps = 8/225 (4%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKKA SD+S   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + +
Sbjct  61   NIRSTIDRYKKACSDSSATTSVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLSALS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH++++AE E LQKRE+ LE E+  LR KIAE ER  Q+
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYLQKREIELENESVCLRTKIAEVERSLQV  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYP-VPDKKTLHL  227
            +M+ G   E +AIQ   +RN    N     + +Y   PDKK LHL
Sbjct  181  NMVTGP--ELNAIQALASRNFFIEN-----ETTYSHGPDKKILHL  218



>gb|AAC08529.1| CUM10 [Cucumis sativus]
Length=229

 Score =   295 bits (755),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 182/230 (79%), Gaps = 8/230 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSN----RHLVGEGL  551
            +IK TI+RYKKA SD+S   +  ELN Q+YQQES KLRQQI MLQNSN    RHL+G+ L
Sbjct  61   SIKTTIERYKKACSDSSATSSVTELNTQYYQQESAKLRQQIQMLQNSNSNLVRHLMGDSL  120

Query  550  GSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER  371
             +  V+ELKQLE+RLERGI++IRSKKH++++AE E LQKRE+ LE EN  +R KIAE ER
Sbjct  121  SALTVKELKQLENRLERGITRIRSKKHEMLLAEIEYLQKREIELENENVCIRTKIAEVER  180

Query  370  LQQLSMMPGAGQEYHAIQHYL-ARNMLQLNVMEGV-QASYPVPDKKTLHL  227
            +QQ +M+  +GQE +AIQ    +RN    N+ME     SY   DKK LHL
Sbjct  181  VQQANMV--SGQELNAIQALANSRNFFSPNIMEPAGPVSYSHQDKKMLHL  228



>ref|XP_009362389.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009362390.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009362391.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Pyrus 
x bretschneideri]
Length=224

 Score =   294 bits (753),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 184/225 (82%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAEIALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEIALIVFSSRGRLYEYSNN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TI+RYKKA SD++   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L + 
Sbjct  61   NSIRNTIERYKKACSDSTGPSSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSNL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            NV+ELKQLE++LERG+++IRSKK +++IAE E LQK+E+ LE EN +LR KI+E ERL Q
Sbjct  121  NVKELKQLENKLERGMTRIRSKKDEMLIAEIEYLQKKEIELENENVYLRTKISEVERLHQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +++  +  E +AIQ   +RN    N++EG  A++P  +KK LHL
Sbjct  181  ANIV--SVPEMNAIQALASRNFFSQNIIEGGGATFPQQNKKILHL  223



>ref|XP_008781978.1| PREDICTED: MADS-box transcription factor 3-like [Phoenix dactylifera]
 ref|XP_008781979.1| PREDICTED: MADS-box transcription factor 3-like [Phoenix dactylifera]
Length=234

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 182/225 (81%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI+RYKKA +D SN  +  E+N+ Q+YQQES KLR QI +LQN+NRHL+G+ LGS 
Sbjct  61   SIKSTIERYKKACADTSNSGSLVEVNSQQYYQQESAKLRHQIQILQNANRHLMGDSLGSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             V+ELKQLE+RLERGI++IRSKKH+L+ AE E +QKREV L+ +N +LRAKIAENER QQ
Sbjct  121  TVKELKQLENRLERGITRIRSKKHELLFAEIEYMQKREVELQNDNMYLRAKIAENERAQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            LS+M  AG E+ A+  + +RN   +N++E         D+  LHL
Sbjct  181  LSIMQ-AGPEFDALPAFDSRNYYHVNMLEAEPHYSHQQDQTALHL  224



>ref|XP_008459656.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Cucumis 
melo]
 ref|XP_008459657.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Cucumis 
melo]
Length=230

 Score =   293 bits (749),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 181/230 (79%), Gaps = 7/230 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSN----RHLVGEGL  551
            +IK TI+RYKKA SD+S   +  ELN Q+YQQES KLRQQI MLQNSN    RHL+G+ L
Sbjct  61   SIKTTIERYKKACSDSSATSSVTELNTQYYQQESAKLRQQIQMLQNSNSNLVRHLMGDSL  120

Query  550  GSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER  371
             +  V+ELKQLE+RLERGI++IRSKKH++++AE E LQKRE+ LE EN  +R KIAE ER
Sbjct  121  SALTVKELKQLENRLERGITRIRSKKHEMLLAEIEYLQKREIELENENVCIRTKIAEVER  180

Query  370  LQQLSMMPGAGQEYHAIQHYL-ARNMLQLNVMEGV-QASYPVPDKKTLHL  227
            +QQ + M  +GQE +AIQ    +RN    N+ME     S+   DKK LHL
Sbjct  181  VQQAN-MAVSGQELNAIQALANSRNFFSPNIMEPAGPVSFSHQDKKMLHL  229



>emb|CAA56655.1| SLM1 [Silene latifolia subsp. alba]
Length=248

 Score =   293 bits (750),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 180/230 (78%), Gaps = 4/230 (2%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  19   KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  78

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +++KGTIDRYKKA+SD S   +  E NAQ+YQQE+ KLR QI  +  +NRHL+GEGL S 
Sbjct  79   HSVKGTIDRYKKASSDNSGASSAAEANAQYYQQEAAKLRNQIRTVTENNRHLMGEGLSSL  138

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            N+++LK LE++LERGIS+IRSKK++L+ AE E +QKREV L   N +LRAKIAENER QQ
Sbjct  139  NMKDLKSLENKLERGISRIRSKKNELLFAEIEFMQKREVELHNNNQYLRAKIAENERAQQ  198

Query  361  -LSMMPGAGQEYH---AIQHYLARNMLQLNVMEGVQASYPVPDKKTLHLD  224
             +S+MPG   EY      Q + +RN  Q+N ++     Y  PD+ TL L+
Sbjct  199  SMSLMPGGSSEYELAPPPQSFDSRNYFQVNALQPNNTHYSRPDQTTLQLN  248



>ref|XP_002325531.1| CUM10 family protein [Populus trichocarpa]
 ref|XP_011031538.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X4 [Populus 
euphratica]
 ref|XP_011031539.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X5 [Populus 
euphratica]
 gb|EEE99912.1| CUM10 family protein [Populus trichocarpa]
Length=223

 Score =   292 bits (747),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 187/225 (83%), Gaps = 4/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKKA+SD+SN  +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ + + +
Sbjct  61   NIRSTIDRYKKASSDSSNASSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDAVSNLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH+L++AE E LQKRE+ LE E+  LR KIAE ERLQQ 
Sbjct  121  VKELKQLENRLERGITRIRSKKHELLLAEIEYLQKREIELENESVCLRTKIAEVERLQQA  180

Query  358  SMMPGAGQEYHAIQHYLA-RNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+ GA  E +AIQ   A RN    +++EG  A YP  DKK LHL
Sbjct  181  NMVTGA--ELNAIQALAASRNFFAPHLLEGGTA-YPHNDKKILHL  222



>gb|ABD62864.1| AG.1 [Persea americana]
Length=223

 Score =   292 bits (747),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 178/209 (85%), Gaps = 3/209 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSLLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA++D SN  +  E+N+QFYQQES KLRQQI +LQN+NRHL+GE L S  
Sbjct  61   SVKTTIERYKKASADTSNGGSTTEVNSQFYQQESSKLRQQIGILQNANRHLMGEALSSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKIAENER QQ 
Sbjct  121  VKELKQLETRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNLYLRAKIAENERAQQH  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            ++M+P    EY  +  + +RN LQ+N++E
Sbjct  181  MNMLPAP--EYDVMPAFDSRNFLQVNLLE  207



>gb|ACD76823.1| SEEDSTICK-like protein [Capsella bursa-pastoris]
Length=230

 Score =   291 bits (744),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 180/229 (79%), Gaps = 5/229 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L + +
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSALS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++AE EN+QKRE+ L+ EN +LR K+AE ER QQ 
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEVERFQQH  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPV-----PDKKTLHL  227
                 +G E +AI+   ARN    ++M     S        PDKK LHL
Sbjct  181  HHQMVSGSEINAIEALAARNYFGHSIMTAGSGSGNGGSYSDPDKKILHL  229



>gb|AFH74368.1| AGAMOUS-like protein [Michelia alba]
Length=223

 Score =   290 bits (742),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 176/210 (84%), Gaps = 3/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+S++    E N+Q+YQQES KLRQQI +LQN+NRHL+GE L S  
Sbjct  61   SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGLLQNANRHLMGEALSSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEG  272
            +SM+P    EY  +  + +RN LQ+N+M+ 
Sbjct  181  MSMLPAP--EYDVMPGFDSRNFLQVNLMDS  208



>ref|XP_009421148.1| PREDICTED: agamous-like MADS-box protein AGL11 [Musa acuminata 
subsp. malaccensis]
Length=234

 Score =   290 bits (743),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQ-FYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            NIK TI+RYKKA +D+SN     ++N+Q +YQQES KLR QI +LQN NR+L+G+ L S 
Sbjct  61   NIKSTIERYKKACADSSNSDAIVDVNSQHYYQQESAKLRHQIQILQNGNRNLMGDSLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELKQLE+RLER I++IRSKKH+L+ AE E +QKRE  L+ +N++LRAKIAENER QQ
Sbjct  121  SVKELKQLENRLERSITRIRSKKHELLFAEIEYMQKRESELQSDNSYLRAKIAENERAQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            LS+M  AG EY+ +  +  RN    N++E         D+ TLHL
Sbjct  181  LSIMQ-AGTEYYTLPTFDPRNYYHTNMLEAAADYSHHQDQTTLHL  224



>gb|AHX58668.1| AGAMOUS-like MADS-box transcription factor [Musa acuminata AAA 
Group]
Length=234

 Score =   290 bits (743),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQ-FYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            NIK TI+RYKKA +D+SN     ++N+Q +YQQES KLR QI +LQN NR+L+G+ L S 
Sbjct  61   NIKSTIERYKKACADSSNSGAIVDVNSQHYYQQESAKLRHQIQILQNGNRNLMGDSLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELKQLE+RLER I++IRSKKH+L+ AE E +QKRE  L+ +N++LRAKIAENER QQ
Sbjct  121  SVKELKQLENRLERSITRIRSKKHELLFAEIEYMQKRESELQSDNSYLRAKIAENERAQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            LS+M  AG EY+ +  +  RN    N++E         D+ TLHL
Sbjct  181  LSIMQ-AGTEYYTLPTFDPRNYYHTNMLEAAADYSHHQDQTTLHL  224



>ref|XP_006286826.1| hypothetical protein CARUB_v10003771mg [Capsella rubella]
 gb|EOA19724.1| hypothetical protein CARUB_v10003771mg [Capsella rubella]
Length=230

 Score =   290 bits (742),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 180/229 (79%), Gaps = 5/229 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L + +
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSALS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++AE EN+QKRE+ L+ EN +LR K+AE ER QQ 
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEVERFQQQ  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPV-----PDKKTLHL  227
                 +G E +A++   ARN    ++M     S        PDKK LHL
Sbjct  181  HHQMVSGSEINAMEALAARNYFGHSIMTAGSGSGNGGSYSDPDKKILHL  229



>ref|XP_010272685.1| PREDICTED: floral homeotic protein AGAMOUS-like [Nelumbo nucifera]
Length=224

 Score =   290 bits (741),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 179/210 (85%), Gaps = 4/210 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA++D+SN  +  E NAQFYQQE+ KLRQQI +LQNSNRHL+GE L +  
Sbjct  61   SVKTTIERYKKASADSSNSGSVSEANAQFYQQEANKLRQQIGILQNSNRHLMGEALSTMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
            V+ELKQLESRLE+GIS+IRSKK++L+ AE + +QKRE+ L+ +N +LRAKIAENER QQ 
Sbjct  121  VKELKQLESRLEKGISRIRSKKNELLYAEIQYMQKREIELQNDNMYLRAKIAENERAQQH  180

Query  361  LSMMPGAGQEYHAI-QHYLARNMLQLNVME  275
            +SMM  +  EY  + Q + +RN LQ+N++E
Sbjct  181  MSMMSAS--EYEVMPQTFDSRNFLQVNLLE  208



>gb|ADD25206.1| AG3 [Nymphaea odorata]
Length=218

 Score =   289 bits (740),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 183/224 (82%), Gaps = 7/224 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGK+EIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR++EY+NN
Sbjct  1    MGRGKVEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLFEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TIDRYKKA +++SN  +  E NAQ+YQQE+ K+RQQI +LQN+NRHL+GE L + +
Sbjct  61   NIKATIDRYKKACAESSNANSVTEANAQYYQQEATKVRQQIQILQNANRHLMGESLSNLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+++ERGI++IRSKK++L+ AE E +QKRE+ L+ +N +LRAK+AE+ER Q  
Sbjct  121  VKELKQLENKIERGITRIRSKKNELLFAEIEYMQKRELELQSDNMYLRAKVAESERAQHS  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+PG+  +Y  +Q + +RN   +N+++     Y   D+  LHL
Sbjct  181  NMLPGS--DYETMQTFDSRNFFSVNMLQ-----YSNQDQTALHL  217



>gb|AAZ53205.1| AG1 [Eschscholzia californica]
Length=241

 Score =   290 bits (742),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 179/225 (80%), Gaps = 1/225 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  16   MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  75

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKK  +D SN     E N QFYQQE+ KLRQQI +LQNSNR+L+GE + + +
Sbjct  76   SVKSTIERYKKTCADPSNSACASEANTQFYQQEATKLRQQIGILQNSNRNLMGEAISTMS  135

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKRE+ L+ +N +LRAKIA+NER  QQ
Sbjct  136  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREIDLQNDNMYLRAKIADNERAQQQ  195

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +S+MPG   E      Y +RN LQ+N+++     Y   ++ TL L
Sbjct  196  MSLMPGNEYEGMTSSGYDSRNFLQVNLLQSSSQHYSHQEQTTLQL  240



>ref|NP_001268097.1| agamous [Vitis vinifera]
 gb|ABN46892.1| AGAMOUS-like MADS-box protein [Vitis labrusca x Vitis vinifera]
 gb|ACZ26525.1| agamous [Vitis vinifera]
Length=226

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 180/226 (80%), Gaps = 3/226 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA++D+SN  +  E NAQFYQQES KL QQI  LQNSNRH++GE LGS N
Sbjct  61   SVKSTIERYKKASADSSNTGSVSEANAQFYQQESSKLHQQIRNLQNSNRHMLGESLGSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER-LQQ  362
             ++LK LE RLE+GIS+IRSKK++L+ AE E +QKRE+ L  +N +LRA+IAENER  QQ
Sbjct  121  FKDLKSLEIRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNDNQYLRARIAENERNEQQ  180

Query  361  LSMMP-GAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +S+MP GA  E    Q + +RN  QLN ++  Q SY   D+  L L
Sbjct  181  MSLMPGGANYELMPSQQFDSRNYFQLNGLQPNQ-SYSRQDQPALQL  225



>gb|AEO52692.1| AGAMOUS-like protein [Magnolia wufengensis]
 gb|AFH74373.1| AGAMOUS-like protein [Magnolia zenii]
 gb|AFH74374.1| AGAMOUS-like protein [Magnolia cylindrica]
 gb|AFH74377.1| AGAMOUS-like protein [Magnolia maudiae]
 gb|AFH74378.1| AGAMOUS-like protein [Magnolia amoena]
 gb|AFH74379.1| AGAMOUS-like protein [Magnolia biondii]
 gb|AFH74380.1| AGAMOUS-like protein [Magnolia denudata]
 gb|AFH74381.1| AGAMOUS-like protein [Magnolia liliiflora]
 gb|AFH74392.1| AGAMOUS-like protein [Magnolia stellata]
 gb|AFH74401.1| AGAMOUS-like protein [Magnolia salicifolia]
 gb|AFH74402.1| AGAMOUS-like protein [Magnolia chapensis]
 gb|AFH74404.1| AGAMOUS-like protein [Magnolia liliiflora]
 gb|AFH74405.1| AGAMOUS-like protein [Magnolia denudata]
 gb|AFN68772.1| AGAMOUS-like protein [Magnolia sprengeri]
Length=223

 Score =   289 bits (739),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+S++    E N+Q+YQQES KLRQQI +LQN+NRHL+GE L S  
Sbjct  61   SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIALLQNANRHLMGEALSSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEG  272
            + M+P    EY  +  + +RN LQ+N+M+ 
Sbjct  181  MGMLPAP--EYDVMPGFDSRNFLQVNLMDS  208



>ref|XP_010421900.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 [Camelina 
sativa]
 ref|XP_010455384.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Camelina 
sativa]
 ref|XP_010455385.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Camelina 
sativa]
Length=231

 Score =   289 bits (739),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 182/230 (79%), Gaps = 6/230 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L S +
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++AE EN+QKRE+ L+ EN +LR K+AE ER QQ 
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEVERFQQH  180

Query  358  SMMPGAGQEYHAIQ------HYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
                 +G E +AI+      +Y A +++      G   SY  PDKK LHL
Sbjct  181  HHQMVSGSEINAIEALAASRNYFAHSIMTAGSGSGNGGSYSDPDKKILHL  230



>ref|XP_010421899.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Camelina 
sativa]
 ref|XP_010455383.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Camelina 
sativa]
Length=248

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 182/230 (79%), Gaps = 6/230 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  18   MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  77

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L S +
Sbjct  78   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  137

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++AE EN+QKRE+ L+ EN +LR K+AE ER QQ 
Sbjct  138  VKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEVERFQQH  197

Query  358  SMMPGAGQEYHAIQ------HYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
                 +G E +AI+      +Y A +++      G   SY  PDKK LHL
Sbjct  198  HHQMVSGSEINAIEALAASRNYFAHSIMTAGSGSGNGGSYSDPDKKILHL  247



>ref|XP_004294526.1| PREDICTED: agamous-like MADS-box protein AGL11-like [Fragaria 
vesca subsp. vesca]
Length=249

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/251 (61%), Positives = 184/251 (73%), Gaps = 30/251 (12%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LC+AE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCEAEVALIVFSSRGRLYEYSNN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TI+RYKKA+SD S   T  E+NAQ+YQQES KLR QI MLQNSNRHL+G+ L + 
Sbjct  61   NSIRNTIERYKKASSDNSGATTITEINAQYYQQESTKLRHQIQMLQNSNRHLMGDSLSNL  120

Query  541  NVRELKQLESRLERGISKIRSKK--------------------------HDLIIAETENL  440
             V+ELKQLE+RLERG+++IRSKK                          H++++AE E L
Sbjct  121  TVKELKQLENRLERGLTRIRSKKVNIDEKECESYENACMHFTTKTEQQQHEMLLAEIEYL  180

Query  439  QKREVHLEQENAFLRAKIAENERLQQLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQAS  260
            QKRE+ LE EN  +RAKIAE ERLQQ  ++ GA  E +AIQ   +RN  +  +MEG + S
Sbjct  181  QKREIELENENVLIRAKIAEVERLQQADLVSGA--ELNAIQALASRNFFESTMMEG-ETS  237

Query  259  YPVPDKKTLHL  227
            Y  P+KK LHL
Sbjct  238  YSQPEKKLLHL  248



>gb|AID22158.1| AGAMOUS-like protein [Camellia sinensis]
Length=245

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 183/231 (79%), Gaps = 9/231 (4%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEYSN
Sbjct  17   KIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSN  76

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGTI+RYKKA SD+SN  +  ELNAQFYQQE+ KLR QI  +QNS+RH++GE L S 
Sbjct  77   NSVKGTIERYKKACSDSSNTGSVSELNAQFYQQEAAKLRGQISNMQNSHRHMLGESLSSM  136

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-Q  365
            ++R+LK LESRLERGIS+IRSKK++L+ AE E +QKRE+ L   N +LRAKIAENER  Q
Sbjct  137  SIRDLKNLESRLERGISRIRSKKNELLFAEIELMQKREIDLHNSNQYLRAKIAENERAQQ  196

Query  364  QLSMMPGAGQEYHAI---QHYLARNMLQLNVMEGVQAS--YPVPDKKTLHL  227
            Q+++MPG G EY  +   Q +  RN  Q+N   G+Q +  Y   D+  L L
Sbjct  197  QMNLMPGGGSEYELMPPPQSFDTRNYFQVN---GLQPNDHYSRHDQTALQL  244



>gb|AFH74375.1| AGAMOUS-like protein [Liriodendron chinense]
Length=223

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 175/209 (84%), Gaps = 3/209 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+SN+    E N+Q+YQQES KLRQQI +LQN+NRHL+GE L S  
Sbjct  61   SVRNTIDRYKKACADSSNLGCVSEANSQYYQQESSKLRQQIGILQNANRHLMGEALSSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            + M+P    EY  +  + +RN LQ+N+++
Sbjct  181  MGMLPAP--EYDVMPGFDSRNFLQVNLLD  207



>gb|AFH74386.1| AGAMOUS-like protein [Magnolia fulva var. calcicola]
 gb|AGZ63865.1| AGAMOUS-like protein [Magnolia sirindhorniae]
 gb|AGZ63866.1| AGAMOUS-like protein [Magnolia baillonii]
Length=223

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 175/209 (84%), Gaps = 3/209 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+S++    E N+Q+YQQES KLRQQI +LQN+NRHL+GE L S  
Sbjct  61   SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGLLQNANRHLMGEALSSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            + M+P    EY  +  + +RN LQ+N+M+
Sbjct  181  MGMLPAP--EYDVMPGFDSRNFLQVNLMD  207



>gb|AFH74385.1| AGAMOUS-like protein [Magnolia figo]
 gb|AFH74396.1| AGAMOUS-like protein [Magnolia crassipes]
Length=223

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+S++    E N+Q+YQQES KLRQQI +LQN+NRHL+GE L S  
Sbjct  61   SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIVLLQNANRHLMGEALSSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEG  272
            + M+P    EY  +  + +RN LQ+N+M+ 
Sbjct  181  MGMLPAP--EYDVMPGFDSRNFLQVNLMDS  208



>emb|CBI30760.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 180/226 (80%), Gaps = 3/226 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA++D+SN  +  E NAQFYQQES KL QQI  LQNSNRH++GE LGS N
Sbjct  61   SVKSTIERYKKASADSSNTGSVSEANAQFYQQESSKLHQQIRNLQNSNRHMLGESLGSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER-LQQ  362
             ++LK LE RLE+GIS+IRS+K++L+ AE E +QKRE+ L  +N +LRA+IAENER  QQ
Sbjct  121  FKDLKSLEIRLEKGISRIRSRKNELLFAEIEYMQKREIDLHNDNQYLRARIAENERNEQQ  180

Query  361  LSMMP-GAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +S+MP GA  E    Q + +RN  QLN ++  Q SY   D+  L L
Sbjct  181  MSLMPGGANYELMPSQQFDSRNYFQLNGLQPNQ-SYSRQDQPALQL  225



>gb|AEG19542.1| AGAMOUS-like protein [Vitis labrusca x Vitis vinifera]
Length=226

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 179/226 (79%), Gaps = 3/226 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA++D+SN  +  E NAQFYQQES KL QQI  LQNSNRH++ E LGS N
Sbjct  61   SVKSTIERYKKASADSSNTGSVSEANAQFYQQESSKLHQQIRNLQNSNRHMLAESLGSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER-LQQ  362
             ++LK LE RLE+GIS+IRSKK++L+ AE E +QKRE+ L  +N +LRA+IAENER  QQ
Sbjct  121  FKDLKSLEIRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNDNQYLRARIAENERNQQQ  180

Query  361  LSMMP-GAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +S+MP GA  E    Q + +RN  QLN ++  Q SY   D+  L L
Sbjct  181  MSLMPGGANYELMPSQQFDSRNYFQLNELQPNQ-SYSRQDQPALQL  225



>ref|XP_006371450.1| hypothetical protein POPTR_0019s10580g [Populus trichocarpa]
 ref|XP_011031534.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Populus 
euphratica]
 ref|XP_011031535.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Populus 
euphratica]
 ref|XP_011031536.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 [Populus 
euphratica]
 gb|ERP49247.1| hypothetical protein POPTR_0019s10580g [Populus trichocarpa]
Length=224

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 187/226 (83%), Gaps = 5/226 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TIDRYKKA+SD+SN  +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ + + 
Sbjct  61   NSIRSTIDRYKKASSDSSNASSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDAVSNL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELKQLE+RLERGI++IRSKKH+L++AE E LQKRE+ LE E+  LR KIAE ERLQQ
Sbjct  121  SVKELKQLENRLERGITRIRSKKHELLLAEIEYLQKREIELENESVCLRTKIAEVERLQQ  180

Query  361  LSMMPGAGQEYHAIQHYLA-RNMLQLNVMEGVQASYPVPDKKTLHL  227
             +M+ GA  E +AIQ   A RN    +++EG  A YP  DKK LHL
Sbjct  181  ANMVTGA--ELNAIQALAASRNFFAPHLLEGGTA-YPHNDKKILHL  223



>ref|XP_002874596.1| hypothetical protein ARALYDRAFT_489841 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50855.1| hypothetical protein ARALYDRAFT_489841 [Arabidopsis lyrata subsp. 
lyrata]
Length=230

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 177/229 (77%), Gaps = 5/229 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+GE L S +
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGESLSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++ E EN QKRE+ L+ EN +LR K+AE ER QQ 
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLVEIENAQKREIELDNENIYLRTKVAEVERYQQH  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPV-----PDKKTLHL  227
                 +G E  AI+   +RN    ++M     S        PDKK LHL
Sbjct  181  HHQMVSGSEITAIEALASRNYFAHSIMTAGSGSGNGGSYSDPDKKILHL  229



>ref|XP_010908080.1| PREDICTED: MADS-box transcription factor 21-like [Elaeis guineensis]
Length=238

 Score =   288 bits (738),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 180/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN T+RQVTFCKRRNGLLK AYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTSRQVTFCKRRNGLLKNAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +I+ TIDRYKKA +++SN     E+N+ Q+YQQES KLR QI +LQN+NRHL+GE L + 
Sbjct  61   SIRSTIDRYKKACANSSNSGATIEINSQQYYQQESAKLRHQIQILQNANRHLMGEALSTL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             V+ELKQLE+RLERGI++IRSKKH+L+ AE E +QKREV L+ +N +LRAKIAENER QQ
Sbjct  121  TVKELKQLENRLERGITRIRSKKHELLFAEIEYMQKREVELQNDNMYLRAKIAENERAQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
              ++P AG ++ A+  +  RN   +N++E  Q      D+ TLHL
Sbjct  181  AGIVP-AGPDFDALPTFDTRNYYHVNMLEAAQHYSHHQDQTTLHL  224



>ref|XP_010542871.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Tarenaya 
hassleriana]
Length=250

 Score =   288 bits (738),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 184/231 (80%), Gaps = 7/231 (3%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  20   KMGRGKIEIKRIENATNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  79

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            NNI+ TI+RYKKA SD++N  + QE+NA +YQQES KLRQQI MLQNSNR+L+G+ L S 
Sbjct  80   NNIRSTIERYKKACSDSTNTSSVQEINAAYYQQESAKLRQQIQMLQNSNRNLMGDSLSSL  139

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELK LE+RLE+ +S+IRSKKH+L++AE E LQKRE+ L+ E  +LR +IAE ERLQQ
Sbjct  140  SVKELKTLENRLEKAMSRIRSKKHELLLAEIEFLQKREMELDNEGIYLRTRIAEVERLQQ  199

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVM-----EGVQASYP-VPDKKTLHL  227
               M  +GQE +AI+   +RN    N++         A+Y  + DK+TLHL
Sbjct  200  HHSMV-SGQEINAIEALASRNFFGHNLIGSGASTSTGAAYSDLQDKRTLHL  249



>dbj|BAG48168.1| MADS-box transcription factor [Malus domestica]
Length=223

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 180/226 (80%), Gaps = 6/226 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELS+LCDAEIALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEIALIVFSSRGRLYEYSNN  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N I+ TI+RYKKA SD++   +  E+NAQ+YQQES KLRQQI MLQN NRHL+G+ L + 
Sbjct  61   NSIRNTIERYKKACSDSTGSTSITEINAQYYQQESAKLRQQIQMLQNYNRHLMGDALSNL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQ-  365
             V+ELKQLE+RLERG+++IRSKK +++IAE E LQK+E+ LE EN +LR KI+E ER Q 
Sbjct  121  TVKELKQLENRLERGMTRIRSKKDEMLIAEIEYLQKKEIELENENVYLRTKISEVERHQA  180

Query  364  QLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +  +P    E +AIQ   +RN    N++EG  A++P  +KK LHL
Sbjct  181  NMVSVP----EMNAIQALASRNFFSQNIIEGGGATFPQQNKKILHL  222



>ref|XP_010421898.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Camelina 
sativa]
Length=257

 Score =   288 bits (738),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 182/230 (79%), Gaps = 6/230 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  27   MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  86

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L S +
Sbjct  87   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  146

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++AE EN+QKRE+ L+ EN +LR K+AE ER QQ 
Sbjct  147  VKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEVERFQQH  206

Query  358  SMMPGAGQEYHAIQ------HYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
                 +G E +AI+      +Y A +++      G   SY  PDKK LHL
Sbjct  207  HHQMVSGSEINAIEALAASRNYFAHSIMTAGSGSGNGGSYSDPDKKILHL  256



>ref|XP_010542875.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Tarenaya 
hassleriana]
Length=230

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 183/230 (80%), Gaps = 7/230 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENATNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  + QE+NA +YQQES KLRQQI MLQNSNR+L+G+ L S +
Sbjct  61   NIRSTIERYKKACSDSTNTSSVQEINAAYYQQESAKLRQQIQMLQNSNRNLMGDSLSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELK LE+RLE+ +S+IRSKKH+L++AE E LQKRE+ L+ E  +LR +IAE ERLQQ 
Sbjct  121  VKELKTLENRLEKAMSRIRSKKHELLLAEIEFLQKREMELDNEGIYLRTRIAEVERLQQH  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVM-----EGVQASYP-VPDKKTLHL  227
              M  +GQE +AI+   +RN    N++         A+Y  + DK+TLHL
Sbjct  181  HSMV-SGQEINAIEALASRNFFGHNLIGSGASTSTGAAYSDLQDKRTLHL  229



>ref|NP_192734.1| agamous-like MADS-box protein AGL11 [Arabidopsis thaliana]
 sp|Q38836.1|AGL11_ARATH RecName: Full=Agamous-like MADS-box protein AGL11; AltName: Full=Protein 
SEEDSTICK [Arabidopsis thaliana]
 gb|AAC49080.1| MADS-box protein AGL11 [Arabidopsis thaliana]
 emb|CAB39620.1| MADS-box protein AGL11 [Arabidopsis thaliana]
 emb|CAB78119.1| MADS-box protein AGL11 [Arabidopsis thaliana]
 gb|AAM64757.1| MADS-box protein AGL11 [Arabidopsis thaliana]
 gb|AEE82817.1| agamous-like MADS-box protein AGL11 [Arabidopsis thaliana]
Length=230

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 178/229 (78%), Gaps = 5/229 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L S +
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++ E EN QKRE+ L+ EN +LR K+AE ER QQ 
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLVEIENAQKREIELDNENIYLRTKVAEVERYQQH  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPV-----PDKKTLHL  227
                 +G E +AI+   +RN    ++M     S        PDKK LHL
Sbjct  181  HHQMVSGSEINAIEALASRNYFAHSIMTAGSGSGNGGSYSDPDKKILHL  229



>ref|XP_010273432.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273433.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Nelumbo 
nucifera]
Length=225

 Score =   287 bits (735),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 174/209 (83%), Gaps = 1/209 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N+
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANH  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKK  +D+SN  +  E NAQFYQQE+ KLRQQI +LQNSNRHL+GE L +  
Sbjct  61   SVKTTIERYKKTLADSSNSGSVSEANAQFYQQEANKLRQQIGILQNSNRHLMGEALSTMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE RLE+GIS+IRSKK++L+ AE E +QKRE+ L+ +N  LRA+IAENER  QQ
Sbjct  121  VKELKQLEGRLEKGISRIRSKKNELLFAEIEYMQKREIDLQNDNMMLRARIAENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            +SM+P +  E    Q + +RN LQ+N++E
Sbjct  181  MSMIPASEYEVMPPQSFDSRNFLQVNLLE  209



>gb|AFH74369.1| AGAMOUS-like protein [Magnolia duclouxii]
 gb|AFH74383.1| AGAMOUS-like protein [Magnolia insignis]
 gb|AFH74384.1| AGAMOUS-like protein [Magnolia insignis]
 gb|AFH74387.1| AGAMOUS-like protein [Magnolia fordiana]
 gb|AFH74394.1| AGAMOUS-like protein [Magnolia aromatica]
 gb|AFH74395.1| AGAMOUS-like protein [Magnolia insignis]
 gb|AFH74397.1| AGAMOUS-like protein [Magnolia hookeri]
Length=223

 Score =   286 bits (733),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+S++    E NAQ+YQQES KLRQQI +LQN+NRHL+GE L +  
Sbjct  61   SVRNTIDRYKKACADSSSLGCVSEANAQYYQQESSKLRQQIVLLQNANRHLMGEALSAMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEG  272
            + M+P    EY  +  + +RN LQ+N+++ 
Sbjct  181  MGMLPAP--EYDVMPGFDSRNFLQVNLLDS  208



>ref|XP_010437827.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 [Camelina 
sativa]
 ref|XP_010437835.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 [Camelina 
sativa]
Length=231

 Score =   287 bits (734),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 181/230 (79%), Gaps = 6/230 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L S +
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++AE EN+QKRE+ L+ EN +LR K+AE ER QQ 
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEVERFQQH  180

Query  358  SMMPGAGQEYHAIQ------HYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
                 +  E +AI+      +Y A +++      G   SY  PDKK LHL
Sbjct  181  HHQMVSSSEINAIEALAASRNYFAHSIMTAGSGSGNGGSYSDPDKKILHL  230



>ref|XP_010437821.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Camelina 
sativa]
Length=248

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 181/230 (79%), Gaps = 6/230 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  18   MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  77

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L S +
Sbjct  78   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  137

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++AE EN+QKRE+ L+ EN +LR K+AE ER QQ 
Sbjct  138  VKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEVERFQQH  197

Query  358  SMMPGAGQEYHAIQ------HYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
                 +  E +AI+      +Y A +++      G   SY  PDKK LHL
Sbjct  198  HHQMVSSSEINAIEALAASRNYFAHSIMTAGSGSGNGGSYSDPDKKILHL  247



>gb|AFX82108.1| MADS-box transcription factor AG1 [Camellia japonica]
Length=255

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 175/209 (84%), Gaps = 3/209 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEYSN
Sbjct  17   KIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSN  76

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGTI+RYKKA SD+SN  +  ELNAQFYQQE+ KLR QI  LQNS+R ++GE L S 
Sbjct  77   NSVKGTIERYKKACSDSSNTGSVSELNAQFYQQEAAKLRGQISNLQNSHRQMLGESLSSM  136

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-Q  365
            ++R+LK LESRLERGIS+IRSKK++L+ AE E +Q+RE+ L   N +LRAKIAENER  Q
Sbjct  137  SIRDLKNLESRLERGISRIRSKKNELLFAEIELMQQREIDLHNSNQYLRAKIAENERAQQ  196

Query  364  QLSMMPGAGQEYHAI--QHYLARNMLQLN  284
            Q+++MPG G EY  +  Q + ARN LQ+N
Sbjct  197  QMNLMPGGGSEYELMPSQSFDARNYLQMN  225



>gb|AFH74389.1| AGAMOUS-like protein [Magnolia odoratissima]
 gb|AFH74398.1| AGAMOUS-like protein [Magnolia coco]
 gb|AFH74400.1| AGAMOUS-like protein [Magnolia championii]
 gb|AFH74403.1| AGAMOUS-like protein [Magnolia championii]
Length=223

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 175/209 (84%), Gaps = 3/209 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+S++    E N+Q+YQQES KLRQQI +LQN+NRHL+GE L S  
Sbjct  61   SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGILQNANRHLMGEALSSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            + M+P    EY  +  + +RN LQ+N+++
Sbjct  181  MGMLPAP--EYDVMPGFDSRNFLQVNLLD  207



>gb|ADC79699.1| AGAMOUS-like protein [Euptelea pleiosperma]
Length=225

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 180/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA +++SN  T  E NAQFYQQE+ KLRQQI  LQN+NR+L+G+ L S  
Sbjct  61   SVKTTIERYKKACANSSNSITVSEANAQFYQQEATKLRQQIVTLQNANRNLMGDALSSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
             +ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKRE+ L+ +N +LRAKI ENER  QQ
Sbjct  121  GKELKQLETRLEKGISRIRSKKNELLFAEIEYMQKREIDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ++M+P    E  ++  + +RN LQ+N++E     Y  P++  L L
Sbjct  181  MNMLPANEYEVMSLAPFDSRNFLQVNLLEH-NNQYSRPEQTALQL  224



>gb|AFY98824.1| AGAMOUS-like protein [Platanus x acerifolia]
 gb|AFY98825.1| AGAMOUS-like protein [Platanus x acerifolia]
Length=225

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 171/209 (82%), Gaps = 1/209 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TIDRYKKA +D+SN  +  E NA FYQQE+ KLRQQI  LQN  R L+GE L S N
Sbjct  61   SVKTTIDRYKKACADSSNSGSVSEANALFYQQEASKLRQQIGYLQNQQRELMGESLSSMN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V++LK LE+RLE+GI++IRSKK++L+ AE E +QKRE+ L+ +N +LRAKIAENER  QQ
Sbjct  121  VKQLKHLETRLEKGINRIRSKKNELLFAEIEFMQKREIDLQNDNMYLRAKIAENERTQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            L+MMPG   E    Q + +RN LQ+N ME
Sbjct  181  LNMMPGPSYEVMPPQAFDSRNFLQVNQME  209



>dbj|BAD18011.1| MADS-box transcription factor [Asparagus virgatus]
Length=226

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 175/210 (83%), Gaps = 2/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA +D +N  T  E N+Q+YQQE+ KLRQQI  LQNSNR+L+GE L S  
Sbjct  61   SVKATIERYKKACTDTTNTGTVSEANSQYYQQEASKLRQQITNLQNSNRNLMGESLSSMG  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            +R+LKQLESRLE+GISKIRSKK++L+ AE E +QKRE+ L+ +N +LR KIAENER  QQ
Sbjct  121  LRDLKQLESRLEKGISKIRSKKNELLYAEIEYMQKREMELQNDNMYLRNKIAENERAQQQ  180

Query  361  LSMMPGA-GQEYHAIQHYLARNMLQLNVME  275
            ++M+P A   EY  +  + +RN LQ+N+++
Sbjct  181  MNMLPAATSNEYEGMPQFDSRNFLQVNLLD  210



>ref|XP_008791901.1| PREDICTED: MADS-box transcription factor 3 isoform X1 [Phoenix 
dactylifera]
Length=224

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 177/224 (79%), Gaps = 1/224 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA +D SN  +  E N+Q+YQQES KLRQQI  LQNSNR+L+GE LGS N
Sbjct  61   SVKATIERYKKACTDTSNPGSVFEANSQYYQQESTKLRQQIINLQNSNRNLMGESLGSMN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            +R+LKQLE RLE+GI+KIR+KK++L+ AE E +QKRE+ L+ +N +LR KIAENER QQ 
Sbjct  121  LRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKREMELQNDNMYLRNKIAENERTQQQ  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
              M     EY  +  Y +RN LQ+N+M+  Q  YP   +  L L
Sbjct  181  MNMLHPTTEYEVMAPYDSRNFLQVNLMQSNQ-HYPHQQQTALQL  223



>gb|AIK66813.1| AGAMOUS-like MADS-box protein [Cocos nucifera]
Length=238

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 180/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN T+RQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +I+ TIDRYKKA +++S+     E+N+ Q+YQQES KLR QI +LQN+NRHL+GE L S 
Sbjct  61   SIRSTIDRYKKACANSSSSGATIEINSQQYYQQESAKLRHQIQILQNANRHLMGEALSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             V+ELKQLE+RLERGI++IRSKKH+L+ AE E +QKREV L+ +N +LRAKIAENER QQ
Sbjct  121  TVKELKQLENRLERGITRIRSKKHELLFAEIEYMQKREVDLQNDNMYLRAKIAENERAQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
              ++  AG E+  +  + +RN   +N++E  Q      D+ TLHL
Sbjct  181  AGIVQ-AGPEFDTLPTFDSRNYYHVNMLEAAQHYSHHQDQTTLHL  224



>gb|AFH74399.1| AGAMOUS-like protein [Magnolia paenetalauma]
Length=223

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 175/209 (84%), Gaps = 3/209 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+S++    E N+Q+YQQES KLRQQI +LQN+NRHL+GE L S  
Sbjct  61   SVRNTIDRYKKACADSSSLGCISEANSQYYQQESSKLRQQIGILQNANRHLMGEALSSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            + M+P    EY  +  + +RN LQ+N+++
Sbjct  181  MGMLPAP--EYDVMPGFDSRNFLQVNLLD  207



>gb|AFH74382.1| AGAMOUS-like protein [Magnolia grandiflora]
Length=223

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 175/209 (84%), Gaps = 3/209 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+S++    E N+Q+YQQES KLRQQI +LQN+NRHL+GE L +  
Sbjct  61   SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGILQNANRHLMGEALSAMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            + M+P    EY  +  + +RN LQ+N+M+
Sbjct  181  MGMLPPP--EYDVMPGFDSRNFLQVNLMD  207



>ref|NP_001078364.1| agamous-like MADS-box protein AGL11 [Arabidopsis thaliana]
 gb|AEE82818.1| agamous-like MADS-box protein AGL11 [Arabidopsis thaliana]
Length=256

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 178/229 (78%), Gaps = 5/229 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  27   MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  86

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L S +
Sbjct  87   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  146

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++ E EN QKRE+ L+ EN +LR K+AE ER QQ 
Sbjct  147  VKELKQVENRLEKAISRIRSKKHELLLVEIENAQKREIELDNENIYLRTKVAEVERYQQH  206

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPV-----PDKKTLHL  227
                 +G E +AI+   +RN    ++M     S        PDKK LHL
Sbjct  207  HHQMVSGSEINAIEALASRNYFAHSIMTAGSGSGNGGSYSDPDKKILHL  255



>gb|AFH74371.1| AGAMOUS-like protein [Magnolia crassipes]
 gb|AFH74372.1| AGAMOUS-like protein [Magnolia dandyi]
 gb|AFH74376.1| AGAMOUS-like protein [Magnolia conifera var. chingii]
 gb|AFH74391.1| AGAMOUS-like protein [Magnolia officinalis subsp. biloba]
 gb|AFH74393.1| AGAMOUS-like protein [Magnolia rufibarbata]
Length=223

 Score =   285 bits (730),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+S++    E N+Q+YQQES KLRQQI +LQN+NRHL+GE L +  
Sbjct  61   SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIVLLQNANRHLMGEALSAMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEG  272
            + M+P    EY  +  + +RN LQ+N+++ 
Sbjct  181  MGMLPAP--EYDVMPGFDSRNFLQVNLLDS  208



>ref|XP_009401103.1| PREDICTED: MADS-box transcription factor 3-like [Musa acuminata 
subsp. malaccensis]
Length=235

 Score =   286 bits (731),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 180/226 (80%), Gaps = 3/226 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQ-FYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            NIK TI+RYKKA +D+S+     ++N+Q +YQQES KLR QI +LQN+NRHL+G+ L S 
Sbjct  61   NIKSTIERYKKACADSSSSGAIVDVNSQHYYQQESAKLRHQIQILQNANRHLMGDALSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            NV+ELKQLE+RLER I++IRSKKH+L+ AE E +QKREV L+ +N +LRAKIAENER+QQ
Sbjct  121  NVKELKQLENRLERSITRIRSKKHELLFAEIEYMQKREVELQSDNMYLRAKIAENERVQQ  180

Query  361  LSMMPGAGQEYHAIQ-HYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            LS++  AG EY AI   + +RN    N++E         D+  L L
Sbjct  181  LSIVE-AGAEYDAIPGAFDSRNYYHANMLEAAAHYSHHQDQTALQL  225



>ref|XP_010437812.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Camelina 
sativa]
Length=266

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 183/235 (78%), Gaps = 6/235 (3%)
 Frame = -1

Query  913  GVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVY  734
            G+   MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+Y
Sbjct  31   GLRIRMGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLY  90

Query  733  EYSNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEG  554
            EY+NNNI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+G+ 
Sbjct  91   EYANNNIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDS  150

Query  553  LGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENE  374
            L S +V+ELKQ+E+RLE+ IS+IRSKKH+L++AE EN+QKRE+ L+ EN +LR K+AE E
Sbjct  151  LSSLSVKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEVE  210

Query  373  RLQQLSMMPGAGQEYHAIQ------HYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            R QQ      +  E +AI+      +Y A +++      G   SY  PDKK LHL
Sbjct  211  RFQQHHHQMVSSSEINAIEALAASRNYFAHSIMTAGSGSGNGGSYSDPDKKILHL  265



>gb|AIJ29174.1| AG-like MADS box protein [Lilium longiflorum]
Length=225

 Score =   285 bits (730),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 183/226 (81%), Gaps = 4/226 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TI+RYKKA++D SN  +  E NAQ+YQQES KLRQQI+ LQNSNR+L+GE L + N
Sbjct  61   SVEATIERYKKASTDISNTRSVSEANAQYYQQESTKLRQQINSLQNSNRNLLGESLSNMN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER--LQ  365
            +R+LKQLE+RLE+ I+KIR+KK++L+ AE E +QKRE+ L+ +N +LR K+AENER   Q
Sbjct  121  LRDLKQLENRLEKAINKIRTKKNELLYAEIEYMQKREMELQSDNMYLRNKVAENEREQQQ  180

Query  364  QLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            Q++MMP    EY A+ H+ +RN LQ+N+++  Q  Y    +  L L
Sbjct  181  QMNMMPSTS-EYEAMPHFDSRNFLQVNIVDPNQ-HYSCQQQTALQL  224



>gb|ACJ64682.1| MADS-box protein MADS5 [Musa acuminata AAA Group]
Length=235

 Score =   286 bits (731),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 180/226 (80%), Gaps = 3/226 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENYTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQ-FYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            NIK TI+RYKKA +D+S+     ++N+Q +YQQES KLR QI +LQN+NRHL+G+ L S 
Sbjct  61   NIKSTIERYKKACADSSSSGAIVDVNSQHYYQQESAKLRHQIQILQNANRHLMGDALSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            NV+ELKQLE+RLER I++IRSKKH+L+ AE E +QKREV L+ +N +LRAKIAENER+QQ
Sbjct  121  NVKELKQLENRLERSITRIRSKKHELLFAEIEYMQKREVELQSDNMYLRAKIAENERVQQ  180

Query  361  LSMMPGAGQEYHAIQ-HYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            LS++  AG EY AI   + +RN    N++E         D+  L L
Sbjct  181  LSIVE-AGAEYDAIPGAFDSRNYYHANILEAAAHYSHHQDQTALQL  225



>gb|AFH74390.1| AGAMOUS-like protein [Magnolia delavayi]
Length=223

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 175/209 (84%), Gaps = 3/209 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+S++    E N+Q+YQQES KLRQQI +LQN+NRHL+GE L S  
Sbjct  61   SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGILQNANRHLMGEALSSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            + M+P    EY  +  + +RN LQ+N+++
Sbjct  181  MGMLPAP--EYDVMPGFDSRNFLQVNLLD  207



>gb|ADC79702.1| AGAMOUS-like protein [Pachysandra terminalis]
Length=225

 Score =   285 bits (730),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 177/209 (85%), Gaps = 1/209 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKI IKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIAIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA++D+SN  +  E NAQ+YQQE+ KLRQQI  LQNS+R+++GE L S +
Sbjct  61   SVKATIERYKKASTDSSNPGSVSEANAQYYQQEANKLRQQIGNLQNSSRNMLGESLSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            ++ELK LE+RLE+ ISKIRSKK++L+ AE E +QKRE+ L+ +N +LRAKI ENER+ QQ
Sbjct  121  MKELKSLETRLEKAISKIRSKKNELLFAEIEYMQKREIDLQNDNMYLRAKITENERVQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            +++MPG+  E  A Q + +RN LQ+N+ME
Sbjct  181  MNLMPGSDYEVMASQSFDSRNFLQVNLME  209



>gb|AAT46102.1| AGAMOUS-like protein [Akebia trifoliata]
Length=245

 Score =   285 bits (730),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 183/234 (78%), Gaps = 9/234 (4%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFS+RGR+YEYSN
Sbjct  20   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSNRGRLYEYSN  79

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA  D+SN  +  E NAQFYQQES KLRQQI  LQN NRHL+GE LGS 
Sbjct  80   NSVKTTIERYKKACVDSSNSGSVSEANAQFYQQESLKLRQQIGNLQNLNRHLMGEALGSM  139

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-Q  365
            +++ELKQLE+R+E+GIS+IRSKK++L+ AE E +QKRE+ L+ +N +LRAKIAENER  Q
Sbjct  140  SIKELKQLETRIEKGISRIRSKKNELLFAEIEYMQKREIDLQNDNMYLRAKIAENERAGQ  199

Query  364  QLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHLD**TTQVG  203
             +++MPG   E  +   + +RN LQ+N++E        P+    H D    Q+G
Sbjct  200  HMNLMPGNEYEVMSSAPFDSRNFLQVNLLE--------PNNHYSHTDQTALQLG  245



>ref|XP_009134170.1| PREDICTED: agamous-like MADS-box protein AGL11 [Brassica rapa]
 ref|XP_009134171.1| PREDICTED: agamous-like MADS-box protein AGL11 [Brassica rapa]
 ref|XP_009134172.1| PREDICTED: agamous-like MADS-box protein AGL11 [Brassica rapa]
 ref|XP_009134173.1| PREDICTED: agamous-like MADS-box protein AGL11 [Brassica rapa]
 ref|XP_009134174.1| PREDICTED: agamous-like MADS-box protein AGL11 [Brassica rapa]
 emb|CDX90741.1| BnaA03g24210D [Brassica napus]
Length=231

 Score =   285 bits (729),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 179/231 (77%), Gaps = 8/231 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYEL+VLCDAE+ALIVFS+RGR+YEY NN
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELAVLCDAEVALIVFSTRGRLYEYGNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA+SD +N  + QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L + N
Sbjct  61   NIRATIERYKKASSDNANTHSVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSALN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++AE ENL KRE+ L+ E+ +LR KIAE ER QQ 
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLAEIENLHKREIKLDNESIYLRTKIAEVERFQQH  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVME-------GVQASYPVPDKKTLHL  227
                 +G E  AI+   +RN    N+M        G   SY  PDKKT HL
Sbjct  181  HHQMVSGTEMTAIEALASRNYFAHNIMTIGSGSGAGHGCSYFDPDKKT-HL  230



>emb|CAN83827.1| hypothetical protein VITISV_030947 [Vitis vinifera]
Length=251

 Score =   286 bits (731),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 181/228 (79%), Gaps = 4/228 (2%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  24   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  83

Query  721  NN-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGS  545
            N+ +K TI+RYKKA++D+SN  +  E NAQFYQQES KL QQI  LQNSNRH++GE LGS
Sbjct  84   NSSVKSTIERYKKASADSSNTGSVSEANAQFYQQESSKLHQQIRNLQNSNRHMLGESLGS  143

Query  544  SNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER-L  368
             N ++LK LE RLE+GIS+IRSKK++L+ AE E +QKRE+ L  +N +LRA+IAENER  
Sbjct  144  LNFKDLKSLEIRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNDNQYLRARIAENERNZ  203

Query  367  QQLSMMP-GAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            QQ+S+MP GA  E    Q + +RN  QLN ++  Q SY   D+  L L
Sbjct  204  QQMSLMPXGANYELMPSQQFDSRNYFQLNGLQPNQ-SYSRQDQPALQL  250



>ref|XP_008791911.1| PREDICTED: MADS-box transcription factor 3 isoform X2 [Phoenix 
dactylifera]
Length=234

 Score =   285 bits (729),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 177/224 (79%), Gaps = 1/224 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA +D SN  +  E N+Q+YQQES KLRQQI  LQNSNR+L+GE LGS N
Sbjct  61   SVKATIERYKKACTDTSNPGSVFEANSQYYQQESTKLRQQIINLQNSNRNLMGESLGSMN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            +R+LKQLE RLE+GI+KIR+KK++L+ AE E +QKRE+ L+ +N +LR KIAENER QQ 
Sbjct  121  LRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKREMELQNDNMYLRNKIAENERTQQQ  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
              M     EY  +  Y +RN LQ+N+M+  Q  YP   +  L L
Sbjct  181  MNMLHPTTEYEVMAPYDSRNFLQVNLMQSNQ-HYPHQQQTALQL  223



>ref|XP_011102155.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Sesamum 
indicum]
Length=243

 Score =   285 bits (729),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 182/229 (79%), Gaps = 10/229 (4%)
 Frame = -1

Query  895  GRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNNN  716
            GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN+
Sbjct  18   GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS  77

Query  715  IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSNV  536
            +K TI+RYKKA+SD+SN  +  E N Q+YQQE+ KLR QI  LQN NR+++GE LG+  +
Sbjct  78   VKATIERYKKASSDSSNNGSISEANTQYYQQEASKLRAQISNLQNQNRNMLGESLGALTL  137

Query  535  RELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-L  359
            R+LK LESR+ERGIS+IRSKK++L+ AE E +QKRE+ L   N FLRAKIAE ER QQ +
Sbjct  138  RDLKNLESRVERGISRIRSKKNELLFAEIEYMQKREIDLHHNNQFLRAKIAETERAQQHM  197

Query  358  SMMPGAGQEYHAI---QHYLARNMLQLNVMEGVQAS--YPVPDKKTLHL  227
            ++MPG+  E+  +   QH+ ARN LQ+N   G+Q +  YP PD+  L L
Sbjct  198  NLMPGSS-EFELVQQPQHFDARNYLQVN---GLQPNDDYPRPDQPPLQL  242



>ref|XP_010683283.1| PREDICTED: agamous-like MADS-box protein AGL11 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 178/224 (79%), Gaps = 4/224 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYE+SNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEFSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI++YKKA +D SN  T  E+NAQ+YQ ES KLR QI M+QNSNR+L+GE L S  
Sbjct  61   NIRSTIEKYKKANTDGSNSVT--EINAQYYQHESTKLRHQIQMMQNSNRNLMGECLSSLT  118

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            ++ELKQ+E+RLERGIS+IRSKK++L++A+ E LQK+E  L+ EN+FLRAKIAE +RLQQL
Sbjct  119  IKELKQVENRLERGISRIRSKKNELLLADIEFLQKKEKELDHENSFLRAKIAEVDRLQQL  178

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+P    +   +  +L R+ L    M    + +   DKK LHL
Sbjct  179  NMLPNDNLDL--VHPFLQRDPLLTENMLQDCSEFTDADKKILHL  220



>gb|ACB70410.1| agamous MADS-box transcription factor [Hosta plantaginea]
Length=225

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 174/209 (83%), Gaps = 1/209 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA +D +N  T  E N+Q+YQQE+ KLRQQI  LQNSNR+L+GE L + +
Sbjct  61   SVKATIERYKKACTDTTNTGTVSEANSQYYQQEASKLRQQITNLQNSNRNLLGESLSTMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            +R+LKQLE RLE+GI+KIR KK++L+ AE E +QKRE+ L+ +N +LR KIAENER  QQ
Sbjct  121  LRDLKQLEGRLEKGINKIRIKKNELLFAEIEYMQKREMELQNDNMYLRNKIAENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            ++M+P A  +Y  +  + +RN LQ+++ME
Sbjct  181  MNMLPAATTDYEGVPQFDSRNFLQVSLME  209



>gb|AFH74367.1| AGAMOUS-like protein [Magnolia kwangtungensis]
Length=223

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 174/210 (83%), Gaps = 3/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D+S++    E N+Q+YQQES KLRQQI  LQN+NRHL+GE L +  
Sbjct  61   SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIVHLQNANRHLMGEALSAMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEG  272
            + M+P    EY  +  + +RN LQ+N+++ 
Sbjct  181  MGMLPAP--EYDVMPGFDSRNFLQVNLLDS  208



>gb|ADK35760.1| agamous-like protein 2 [Hosta plantaginea]
Length=225

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 174/209 (83%), Gaps = 1/209 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA +D +N  T  E N+Q+YQQE+ KLRQQI  LQNSNR+L+GE L + +
Sbjct  61   SVKATIERYKKAFTDTTNTGTISEANSQYYQQEASKLRQQITNLQNSNRNLMGESLSTMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            +R+LKQLE RLE+GI+KIR+KK++L+ AE E +QKRE+ L+ +N +LR KIAENER  QQ
Sbjct  121  LRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKREMELQNDNMYLRNKIAENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            +SM+P    EY  +  + +RN LQ+++++
Sbjct  181  MSMLPATTTEYEEVPQFDSRNFLQVSLLQ  209



>gb|AAY53908.1| MADS-box protein MADS1 [Musa acuminata]
Length=235

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 179/226 (79%), Gaps = 3/226 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQ-FYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            NIK TI+RYKKA +D+S+     ++N+Q +YQQES KLR QI +LQN+NRHL+G+ L S 
Sbjct  61   NIKSTIERYKKACADSSSSDAIVDVNSQHYYQQESAKLRHQIQVLQNANRHLMGDALSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            NV+ELKQLE+RLER I++IRSKKH+L+ AE E +QKREV L+ +N + RAKIAENER+QQ
Sbjct  121  NVKELKQLENRLERSITRIRSKKHELLFAEIEYMQKREVELQSDNMYPRAKIAENERVQQ  180

Query  361  LSMMPGAGQEYHAIQ-HYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            LS++  AG EY AI   + +RN    N++E         D+  L L
Sbjct  181  LSIVE-AGAEYDAIPGAFDSRNYYHANILEAAAHYSHHQDQTALQL  225



>gb|ABQ28694.1| MADS box transcription factor [Narcissus tazetta var. chinensis]
Length=230

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 175/214 (82%), Gaps = 6/214 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA +D SN  T  E N+Q+YQQE+ KLRQQI  LQNSNR+L+GE L + +
Sbjct  61   SVKATIERYKKACTDTSNTATVSEANSQYYQQEASKLRQQITNLQNSNRNLMGESLSTMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            +R+LKQLESRLE+GISKIR+KK++L+ AE E +QKRE+ L+ +N +LR KI +NER  QQ
Sbjct  121  LRDLKQLESRLEKGISKIRTKKNELLFAEIEYMQKREIELQNDNMYLRNKITDNERAQQQ  180

Query  361  LSMMPGAG-----QEYHAIQHYLARNMLQLNVME  275
            ++M+P A       +Y  I  + +RN LQ+++M+
Sbjct  181  MNMLPSAATTSTHDQYEGIPQFDSRNFLQVSLMD  214



>gb|AAS45689.1| AGAMOUS-like protein [Saruma henryi]
Length=226

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 176/211 (83%), Gaps = 4/211 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLC+AE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA SD+SN  +  E N+Q+YQQE+ KLRQQI +LQN+NRHL+GE L S +
Sbjct  61   SVRTTIDRYKKA-SDSSNPASVSETNSQYYQQEATKLRQQIGILQNANRHLMGESLSSMS  119

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N FLR KI ENER QQ 
Sbjct  120  VKELKQLETRLEKGISRIRSKKNELLFAEIEYMQKREVELQNDNIFLRGKIVENERAQQN  179

Query  361  LSMMPGAGQEYHAIQH--YLARNMLQLNVME  275
            ++M+PG G      QH  Y +RN L +N++E
Sbjct  180  MNMLPGGGGYEVMSQHPPYDSRNYLPVNLLE  210



>gb|AAZ95250.1| AGAMOUS-like transcription factor [Dendrobium crumenatum]
Length=234

 Score =   283 bits (723),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 177/212 (83%), Gaps = 3/212 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL++FSSRGR+YEY+N
Sbjct  7    KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRLYEYAN  66

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGTI+RYKKA++D SN  +  E NAQ+Y QE+ KLRQQI  LQNSNR+L+GE L + 
Sbjct  67   NSVKGTIERYKKASADNSNSGSISETNAQYYLQEASKLRQQITNLQNSNRNLMGEALSTM  126

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            ++R+LKQLE+RLE+GI+KIRSKK++L+ AE E +QKRE+ L+ +N +LR KIA+NER QQ
Sbjct  127  SLRDLKQLETRLEKGINKIRSKKNELLYAEIEYMQKREMELQNDNMYLRNKIADNERTQQ  186

Query  361  ---LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
               ++M+P    EY  +  + +RN LQ+N+M+
Sbjct  187  QHHINMVPSTSTEYEVMPPFDSRNFLQVNLMD  218



>gb|AAY86365.1| SEEDSTICK-like protein [Dendrobium thyrsiflorum]
Length=234

 Score =   283 bits (723),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 182/225 (81%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGR+YEYSN+
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSNH  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI++YKKA +D+SN  +  E+N+ Q+YQQES KLR QI +LQNSNRHL+GEGL S 
Sbjct  61   SIKATIEKYKKACADSSNPGSLVEVNSQQYYQQESAKLRHQIQLLQNSNRHLMGEGLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             ++ELKQLE+RLERGI+++RSKKH+L+ AE E +QKREV L+ +N +LRAKI +NER +Q
Sbjct  121  TLKELKQLENRLERGITRVRSKKHELLFAEIEYMQKREVELQNDNMYLRAKINDNERAEQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +++  AG ++  + ++ +RN  Q+N++E         D+  LHL
Sbjct  181  ANIVQ-AGADFDTLPNFDSRNYYQVNILETAAHYSHHQDQTALHL  224



>ref|XP_008786400.1| PREDICTED: MADS-box transcription factor 3 isoform X2 [Phoenix 
dactylifera]
Length=272

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 179/225 (80%), Gaps = 1/225 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIE  TNRQVTFCKRRNGLLKKAYELSVLCD E+ALI+FSSRGR+YEYSNN
Sbjct  38   MGRGKIEIKRIEKTTNRQVTFCKRRNGLLKKAYELSVLCDVEVALIIFSSRGRLYEYSNN  97

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI+RYKKA++D+SN  +  E+N+ Q+YQQES KLR+QI +LQN+NRHL+G+ L S 
Sbjct  98   SIKSTIERYKKASADSSNSGSIIEVNSQQYYQQESAKLRRQIQILQNANRHLMGDALSSL  157

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+EL+QLE+RLERGI++IRSKKH+L+ AE EN+Q+REV L+ +N +LRAKIAENE   Q
Sbjct  158  SVKELRQLENRLERGITRIRSKKHELLFAEIENMQRREVELQNDNMYLRAKIAENEHATQ  217

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
               M  AG E+ A+  + +RN   +N++E         D+  LHL
Sbjct  218  QVSMVQAGPEFDALPAFDSRNYYHVNMLEAATHYLHQQDQTALHL  262



>ref|XP_010915446.1| PREDICTED: MADS-box transcription factor 3 isoform X5 [Elaeis 
guineensis]
Length=224

 Score =   282 bits (721),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYK+A +D SN  +  E ++Q+YQQES KLRQQI  LQNSNR+L+GE LGS +
Sbjct  61   SVKATIERYKRACTDTSNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
             R+LKQLE RLE+GI+KIR+KK++L+ AE E +QKREV L+  N +LR KIAENER  QQ
Sbjct  121  PRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKREVELQNANMYLRNKIAENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ++M+P    EY  +  Y +RN LQ+N+M+  Q  Y    + TL L
Sbjct  181  MNMLPQTT-EYEVMAPYDSRNFLQVNLMQSNQ-HYSHQQQTTLQL  223



>gb|AFH74370.1| AGAMOUS-like protein [Magnolia grandis]
 gb|AFH74388.1| AGAMOUS-like protein [Magnolia yunnanensis]
Length=223

 Score =   282 bits (721),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 173/209 (83%), Gaps = 3/209 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TI+RYKKA +D+S++    E N+Q+YQQES KLRQQI  LQ +NRHL+GE L S  
Sbjct  61   SVRNTINRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGNLQTANRHLMGEALSSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKREV L+ +N +LRAKI ENER  QQ
Sbjct  121  VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKREVDLQNDNMYLRAKITENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            + M+P    EY  +  + +RN LQ+N+M+
Sbjct  181  MGMLPAP--EYDVMPGFDSRNFLQVNLMD  207



>gb|ADP00516.1| MADS-box factor MADS2 [Cymbidium ensifolium]
Length=234

 Score =   282 bits (721),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 175/212 (83%), Gaps = 3/212 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL++FS+RGR+YEY+N
Sbjct  7    KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYAN  66

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI++YKKA SD SN  T  E NAQ+Y QE+ KLRQQI  LQNSNR+L+GE L + 
Sbjct  67   NSVKATIEKYKKACSDNSNSGTISETNAQYYMQEASKLRQQITNLQNSNRNLMGEALSTM  126

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            ++R+LKQLE+RLE+GI+KIRSKK++L+ AE E +QKRE+ L+ +N +LR KIAENER QQ
Sbjct  127  SLRDLKQLETRLEKGINKIRSKKNELLYAEIEYMQKREMELQNDNMYLRNKIAENERTQQ  186

Query  361  ---LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
               ++M+P    EY  +  + +RN LQ+N+M+
Sbjct  187  QPHINMVPSTSTEYEVMPPFDSRNFLQVNLMD  218



>ref|XP_009410729.1| PREDICTED: MADS-box transcription factor 21-like [Musa acuminata 
subsp. malaccensis]
Length=239

 Score =   282 bits (721),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 178/226 (79%), Gaps = 3/226 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIENNT+RQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENNTSRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASN-ICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI+RYKKA ++ SN  CT    + Q+YQQE+ KLR QI +LQN+N+HL+GE L S 
Sbjct  61   SIKSTIERYKKAYANTSNSSCTIDTNSQQYYQQEAAKLRHQIQILQNANKHLMGESLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELKQLE+RLERGI++IRSKKH+L+ AE E +QKREV L+ +N +LRAK+AENER QQ
Sbjct  121  SVKELKQLENRLERGITRIRSKKHELLFAEIEYMQKREVELQNDNIYLRAKVAENERAQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYP-VPDKKTLHL  227
              ++   G E+ A+  Y +RN   +N M    + Y    D+  LHL
Sbjct  181  -EVIVSTGAEFDALPTYDSRNYYHVNNMLEAASHYSHHQDQTALHL  225



>gb|AFI61557.1| MADS-box protein 7 [Phalaenopsis equestris]
Length=234

 Score =   282 bits (721),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 181/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLC+AEIALIVFSSRGRVYEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSSRGRVYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI++YKK  + +SN  +  E+N+ Q+YQQES K+R QI +LQNSNRHL+G+GL S 
Sbjct  61   SIKATIEKYKKTCAGSSNPGSLVEVNSHQYYQQESAKMRHQIQLLQNSNRHLMGDGLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            N++ELKQLE+RLERGI+++RSKKH+L+ AE E +QKREV L+ +N +LRAKIA+NER QQ
Sbjct  121  NLKELKQLENRLERGITRVRSKKHELLFAEIEYMQKREVELQNDNMYLRAKIADNERAQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +++  AG ++ +I  + +RN   +N++E         D+  LHL
Sbjct  181  ANIVQ-AGVDFESIPSFDSRNYYHINMLESASHYSHHQDQTALHL  224



>gb|ACU15109.1| unknown [Glycine max]
Length=190

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD S+  T  E++AQ+YQQES KLRQQI MLQNSNRHL+G+ L +  
Sbjct  61   NIRSTIERYKKACSDHSSASTTTEIDAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V ELKQLE+RLERGI++IRSKKH++++AE E  QKRE+ LE EN  LR KI + ER+QQ+
Sbjct  121  VEELKQLENRLERGITRIRSKKHEMLLAEIEYFQKREIELENENLCLRTKITDVERIQQV  180

Query  358  SMMPGA  341
            +M+ G 
Sbjct  181  NMVSGP  186



>ref|NP_001190696.1| agamous-like MADS-box protein AGL11 [Arabidopsis thaliana]
 gb|AEE82819.1| agamous-like MADS-box protein AGL11 [Arabidopsis thaliana]
Length=234

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 178/233 (76%), Gaps = 9/233 (4%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD++N  T QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L S +
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKR----EVHLEQENAFLRAKIAENER  371
            V+ELKQ+E+RLE+ IS+IRSKKH+L++ E EN QKR    E+ L+ EN +LR K+AE ER
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLVEIENAQKRLILQEIELDNENIYLRTKVAEVER  180

Query  370  LQQLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPV-----PDKKTLHL  227
             QQ      +G E +AI+   +RN    ++M     S        PDKK LHL
Sbjct  181  YQQHHHQMVSGSEINAIEALASRNYFAHSIMTAGSGSGNGGSYSDPDKKILHL  233



>gb|AAW66881.1| MADS box transcription factor [Elaeis guineensis]
Length=224

 Score =   281 bits (719),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYK+A +D SN  +  E ++Q+YQQES KLRQQI  LQNSNR+L+GE LGS +
Sbjct  61   SVKATIERYKRACTDTSNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
             R+LKQLE RLE+GI+KIR+KK++L+ AE E +QKREV L+  N +LR KIAENER  QQ
Sbjct  121  PRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKREVELQNANMYLRNKIAENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ++M+P    EY  +  Y +RN LQ+N+M+  Q  Y    + TL L
Sbjct  181  MNMLPQTT-EYEVMAPYDSRNFLQVNLMQSNQ-HYSHQQQTTLPL  223



>ref|XP_010915443.1| PREDICTED: MADS-box transcription factor 3 isoform X4 [Elaeis 
guineensis]
 ref|XP_010915444.1| PREDICTED: MADS-box transcription factor 3 isoform X4 [Elaeis 
guineensis]
 ref|XP_010915445.1| PREDICTED: MADS-box transcription factor 3 isoform X4 [Elaeis 
guineensis]
Length=234

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYK+A +D SN  +  E ++Q+YQQES KLRQQI  LQNSNR+L+GE LGS +
Sbjct  61   SVKATIERYKRACTDTSNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
             R+LKQLE RLE+GI+KIR+KK++L+ AE E +QKREV L+  N +LR KIAENER  QQ
Sbjct  121  PRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKREVELQNANMYLRNKIAENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ++M+P    EY  +  Y +RN LQ+N+M+  Q  Y    + TL L
Sbjct  181  MNMLPQTT-EYEVMAPYDSRNFLQVNLMQSNQ-HYSHQQQTTLQL  223



>ref|XP_008786399.1| PREDICTED: MADS-box transcription factor 3 isoform X1 [Phoenix 
dactylifera]
Length=286

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 179/225 (80%), Gaps = 1/225 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIE  TNRQVTFCKRRNGLLKKAYELSVLCD E+ALI+FSSRGR+YEYSNN
Sbjct  52   MGRGKIEIKRIEKTTNRQVTFCKRRNGLLKKAYELSVLCDVEVALIIFSSRGRLYEYSNN  111

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI+RYKKA++D+SN  +  E+N+ Q+YQQES KLR+QI +LQN+NRHL+G+ L S 
Sbjct  112  SIKSTIERYKKASADSSNSGSIIEVNSQQYYQQESAKLRRQIQILQNANRHLMGDALSSL  171

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+EL+QLE+RLERGI++IRSKKH+L+ AE EN+Q+REV L+ +N +LRAKIAENE   Q
Sbjct  172  SVKELRQLENRLERGITRIRSKKHELLFAEIENMQRREVELQNDNMYLRAKIAENEHATQ  231

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
               M  AG E+ A+  + +RN   +N++E         D+  LHL
Sbjct  232  QVSMVQAGPEFDALPAFDSRNYYHVNMLEAATHYLHQQDQTALHL  276



>gb|ADP00515.1| MADS-box factor MADS1 [Cymbidium ensifolium]
 gb|AFP19447.1| MADS-box protein AG1 [Cymbidium faberi]
Length=233

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 178/212 (84%), Gaps = 3/212 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL++FSSRGR+YEY+N
Sbjct  6    KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRLYEYAN  65

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGTIDRYKKA +D S+  +  E N+Q+YQQE+ KLRQQI  LQNSNR+L+G+ L + 
Sbjct  66   NSVKGTIDRYKKACTDNSSTGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGDALTTM  125

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            ++R+LKQLE+RLE+GISKIRSKK++L+ AE + +QKRE+ L+ +N +LR+KIA+NER QQ
Sbjct  126  SLRDLKQLETRLEKGISKIRSKKNELLHAEIDYMQKREMDLQTDNMYLRSKIADNERAQQ  185

Query  361  ---LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
               +S++P    EY  +  + +R+ LQ+N+++
Sbjct  186  HQHMSILPSTSTEYEVMPPFDSRSFLQVNLLD  217



>dbj|BAI59709.1| MADS-box transcription factor [Lobelia erinus]
Length=241

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 181/230 (79%), Gaps = 9/230 (4%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  15   KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  74

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGTI+RYKKA SD  N  +  E NAQFYQQE+ KLRQQI  LQN NR+++GE LGS 
Sbjct  75   NSVKGTIERYKKACSDPPNSGSVSEANAQFYQQEAAKLRQQISNLQNQNRNMMGESLGSL  134

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
              ++LK LE++LE+GISKIRSKK++L+ AE E +QKRE+ L   N +LRAKIAENER QQ
Sbjct  135  GPKDLKSLETKLEKGISKIRSKKNELLFAEIEYMQKREIDLHNSNQYLRAKIAENERAQQ  194

Query  361  -LSMMPGAGQEYHAI--QHYLARNMLQLNVMEGVQA--SYPVPDKKTLHL  227
             +S+MPG+  +Y  +  Q + ARN LQ+N   G+Q   +Y   D+  L L
Sbjct  195  HMSLMPGSS-DYELVQPQPFDARNYLQVN---GLQPNNNYSRQDQTPLQL  240



>ref|XP_009113582.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Brassica 
rapa]
 ref|XP_009113583.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Brassica 
rapa]
Length=230

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 180/231 (78%), Gaps = 9/231 (4%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD ++  + QE+NA +YQQES KLRQQI  +QNSNRHL+G+ L + +
Sbjct  61   NIRSTIERYKKA-SDNTSTHSVQEINAAYYQQESAKLRQQIQTIQNSNRHLMGDSLSALS  119

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++AE ENLQKRE+ L+ E+ +LR KIAE ER QQ 
Sbjct  120  VKELKQVENRLEKAISRIRSKKHELLLAEIENLQKREIELDNESIYLRTKIAEVERFQQH  179

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVME-------GVQASYPVPDKKTLHL  227
                 +G E  AI+   +RN    ++M        G   SY  PDKK +HL
Sbjct  180  HHQMVSGTEMTAIEVLASRNYFAHSIMTTGSGSGAGHGCSYSDPDKK-IHL  229



>ref|XP_010912706.1| PREDICTED: MADS-box transcription factor 21-like [Elaeis guineensis]
 ref|XP_010912707.1| PREDICTED: MADS-box transcription factor 21-like [Elaeis guineensis]
Length=234

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI+RYKKA ++ SN  +  ++++ Q+YQQES KLR QI +LQN+NRHL+G+ LGS 
Sbjct  61   SIKSTIERYKKACANTSNSGSIVDVDSQQYYQQESAKLRHQIQILQNANRHLMGDSLGSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             V+ELKQLE+RLERGI++IRSKKH+L+ AE E +QKRE+ L+  N  LRAKIAE ER QQ
Sbjct  121  TVKELKQLENRLERGITRIRSKKHELLFAEIEYMQKRELELQNANMHLRAKIAETERAQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +S++  AG E+ A+  + +RN   ++++E         D+  LHL
Sbjct  181  VSIIE-AGHEFDALPGFDSRNYYHVSMLEAAPHYSHQQDQTALHL  224



>ref|XP_009113581.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Brassica 
rapa]
Length=231

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 180/231 (78%), Gaps = 9/231 (4%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  2    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  61

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA SD ++  + QE+NA +YQQES KLRQQI  +QNSNRHL+G+ L + +
Sbjct  62   NIRSTIERYKKA-SDNTSTHSVQEINAAYYQQESAKLRQQIQTIQNSNRHLMGDSLSALS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++AE ENLQKRE+ L+ E+ +LR KIAE ER QQ 
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLAEIENLQKREIELDNESIYLRTKIAEVERFQQH  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVME-------GVQASYPVPDKKTLHL  227
                 +G E  AI+   +RN    ++M        G   SY  PDKK +HL
Sbjct  181  HHQMVSGTEMTAIEVLASRNYFAHSIMTTGSGSGAGHGCSYSDPDKK-IHL  230



>ref|XP_011102153.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Sesamum 
indicum]
 ref|XP_011102154.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Sesamum 
indicum]
Length=244

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 182/230 (79%), Gaps = 11/230 (5%)
 Frame = -1

Query  895  GRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNNN  716
            GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN+
Sbjct  18   GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS  77

Query  715  IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSNV  536
            +K TI+RYKKA+SD+SN  +  E N Q+YQQE+ KLR QI  LQN NR+++GE LG+  +
Sbjct  78   VKATIERYKKASSDSSNNGSISEANTQYYQQEASKLRAQISNLQNQNRNMLGESLGALTL  137

Query  535  RELKQLESRLERGISKIRSKKHDLIIAETENLQKR-EVHLEQENAFLRAKIAENERLQQ-  362
            R+LK LESR+ERGIS+IRSKK++L+ AE E +QKR E+ L   N FLRAKIAE ER QQ 
Sbjct  138  RDLKNLESRVERGISRIRSKKNELLFAEIEYMQKRQEIDLHHNNQFLRAKIAETERAQQH  197

Query  361  LSMMPGAGQEYHAI---QHYLARNMLQLNVMEGVQAS--YPVPDKKTLHL  227
            +++MPG+  E+  +   QH+ ARN LQ+N   G+Q +  YP PD+  L L
Sbjct  198  MNLMPGSS-EFELVQQPQHFDARNYLQVN---GLQPNDDYPRPDQPPLQL  243



>gb|AAY25577.1| AG [Amborella trichopoda]
Length=223

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 179/224 (80%), Gaps = 2/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TIDRYKKA +D+S+  T  E N+Q+YQQE+ KLR QI +L N+NR L+G+ +GS  
Sbjct  61   SVKTTIDRYKKACADSSHSGTVSEANSQYYQQEAAKLRNQIQVLTNTNRQLMGDSVGSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+EL+ LE++LE+GISKIRSKK++L+ AE + +Q RE+ L+++N  LRAKIAENER Q +
Sbjct  121  VKELRTLENKLEKGISKIRSKKNELLFAEIDYMQNRELELQKDNMLLRAKIAENERAQHM  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+PG   EY  +  + +RN LQ+N++E    +Y   ++  L L
Sbjct  181  NMLPGP--EYDVLPPFDSRNYLQVNLLEPNHHNYSHQEQTALQL  222



>ref|XP_008794140.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Phoenix 
dactylifera]
Length=224

 Score =   280 bits (716),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 170/211 (81%), Gaps = 0/211 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL++FS+RGR+YEY+N+
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYAND  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++KGTI+RYKKA +D SN  +  E N Q+YQQES KLRQQI  LQNSNR+L+GE LGS N
Sbjct  61   SVKGTIERYKKACTDTSNSGSVSEANFQYYQQESSKLRQQITNLQNSNRNLMGESLGSMN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            +R+LKQLE RLE+GI+KIR+KK++L++AE E +QKRE+ L+  N +LR KI ENER QQ 
Sbjct  121  LRDLKQLEGRLEKGINKIRTKKNELLLAEIEYMQKRELELQSANMYLRNKITENERAQQQ  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQ  266
              M     EY  +  Y +RN L +N+M+  Q
Sbjct  181  MNMLTPTTEYEVMPPYDSRNFLPMNLMQSNQ  211



>ref|XP_009399817.1| PREDICTED: MADS-box transcription factor 3-like [Musa acuminata 
subsp. malaccensis]
Length=230

 Score =   280 bits (716),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 181/228 (79%), Gaps = 4/228 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEY+ +
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYATS  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K +I+RYKKA SD +N   P E NAQ+YQQE+ KL QQI+ LQ++NR+L+GE L S +
Sbjct  61   SVKESIERYKKACSDTTNTGFPSEGNAQYYQQEASKLHQQINNLQSTNRNLMGESLNSMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            +R+LKQLE+RLE+GI+KIR+KK++L+ AETE +QKRE+ L+ +N +LR K+AENER+ QQ
Sbjct  121  LRDLKQLETRLEKGINKIRTKKNELLFAETEYMQKREMELQNDNMYLRNKVAENERVQQQ  180

Query  361  LSMMPGAG--QEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHLD  224
            + M+P      EY  +  Y +RN LQ+N+M+  Q  Y    +  L LD
Sbjct  181  MDMLPSTATTTEYEVMPSYDSRNFLQVNIMQPNQ-HYTHQQRTALQLD  227



>ref|XP_006358067.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006358068.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Solanum 
tuberosum]
Length=248

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 180/235 (77%), Gaps = 13/235 (6%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEY+N
Sbjct  16   KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYAN  75

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD+SN  +  E NAQ+YQQE+ KLR QI  LQN NR+++GE LGS 
Sbjct  76   NSVKATIERYKKACSDSSNTGSVSEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLGSM  135

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL--  368
            N +ELK LE ++E+GISKIRSKK++L+ AE E +QKREV L   N +LRAKIAE ER   
Sbjct  136  NSKELKSLEQKIEKGISKIRSKKNELLFAEIEYMQKREVDLHNNNQYLRAKIAETERAQH  195

Query  367  --QQLSMMPGAGQEYHAI----QHYLARNMLQLNVMEGVQAS--YPVPDKKTLHL  227
              QQ+++MPG+   YH +    Q +  RN LQ+N   G+Q +  YP  D+  + L
Sbjct  196  QHQQMNLMPGSSSSYHELVPPPQQFDTRNYLQVN---GLQTNNHYPRQDQPPIQL  247



>ref|XP_010915441.1| PREDICTED: MADS-box transcription factor 3 isoform X2 [Elaeis 
guineensis]
Length=258

 Score =   281 bits (718),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  35   MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  94

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYK+A +D SN  +  E ++Q+YQQES KLRQQI  LQNSNR+L+GE LGS +
Sbjct  95   SVKATIERYKRACTDTSNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSMS  154

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
             R+LKQLE RLE+GI+KIR+KK++L+ AE E +QKREV L+  N +LR KIAENER  QQ
Sbjct  155  PRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKREVELQNANMYLRNKIAENERAQQQ  214

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ++M+P    EY  +  Y +RN LQ+N+M+  Q  Y    + TL L
Sbjct  215  MNMLPQTT-EYEVMAPYDSRNFLQVNLMQSNQ-HYSHQQQTTLQL  257



>ref|XP_006852690.1| hypothetical protein AMTR_s00021p00254030 [Amborella trichopoda]
 gb|ERN14157.1| hypothetical protein AMTR_s00021p00254030 [Amborella trichopoda]
Length=234

 Score =   280 bits (715),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 179/224 (80%), Gaps = 2/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TIDRYKKA +D+S+  T  E N+Q+YQQE+ KLR QI +L N+NR L+G+ +GS  
Sbjct  61   SVKTTIDRYKKACADSSHSGTVSEANSQYYQQEAAKLRNQIQVLTNTNRQLMGDSVGSMT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+EL+ LE++LE+GISKIRSKK++L+ AE + +Q RE+ L+++N  LRAKIAENER Q +
Sbjct  121  VKELRTLENKLEKGISKIRSKKNELLFAEIDYMQNRELELQKDNMLLRAKIAENERAQHM  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+PG   EY  +  + +RN LQ+N++E    +Y   ++  L L
Sbjct  181  NMLPGP--EYDVLPPFDSRNYLQVNLLEPNHHNYSHQEQTALQL  222



>gb|AHM92097.1| MADS-box protein 21 [Erycina pusilla]
Length=233

 Score =   280 bits (715),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 178/212 (84%), Gaps = 3/212 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL++FSSRGR+YEY+N
Sbjct  6    KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRLYEYAN  65

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGTIDRYKKA +D S+  +  E N+Q+YQQE+ KLRQQI  LQNSNR+L+G+ L + 
Sbjct  66   NSVKGTIDRYKKACTDNSSTGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGDALTTM  125

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL--  368
            ++R+LKQLE+RLE+GI+KIRSKK++L+ AE + +QKRE+ L+ +N +LR KIA+NER+  
Sbjct  126  SLRDLKQLETRLEKGINKIRSKKNELLHAEIDYMQKREMELQTDNMYLRNKIADNERVQQ  185

Query  367  -QQLSMMPGAGQEYHAIQHYLARNMLQLNVME  275
             QQ+S++P    +Y  +  Y +R+ LQ+N+++
Sbjct  186  HQQMSILPSTSTDYEVMTPYDSRSFLQVNLLD  217



>ref|NP_001268105.1| MAD-box transcripion factor [Vitis vinifera]
 ref|XP_010656929.1| PREDICTED: MAD-box transcripion factor isoform X1 [Vitis vinifera]
 gb|AAK58564.1|AF265562_1 MAD-box transcripion factor [Vitis vinifera]
Length=225

 Score =   279 bits (714),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 173/209 (83%), Gaps = 1/209 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TI+RYKK  SD+SN  +  E NAQFYQQE+ KLR+QI  +QN NRH++GE L S N
Sbjct  61   SVRTTIERYKKVCSDSSNTGSVSEANAQFYQQEASKLRRQIRDIQNLNRHILGEALSSLN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
             +ELK LE+RLE+GIS+IRSKK++L+ AE E +QKRE+ L+  N FLRA+IAENER  QQ
Sbjct  121  FKELKNLETRLEKGISRIRSKKNELLFAEIEYMQKREIELQNSNLFLRAQIAENERAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            +++MPG+  E    Q Y ++N+L +N+++
Sbjct  181  MNLMPGSQYESVPQQPYDSQNLLPVNLLD  209



>ref|XP_010915440.1| PREDICTED: MADS-box transcription factor 3 isoform X1 [Elaeis 
guineensis]
Length=268

 Score =   281 bits (718),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  35   MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  94

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYK+A +D SN  +  E ++Q+YQQES KLRQQI  LQNSNR+L+GE LGS +
Sbjct  95   SVKATIERYKRACTDTSNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSMS  154

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
             R+LKQLE RLE+GI+KIR+KK++L+ AE E +QKREV L+  N +LR KIAENER  QQ
Sbjct  155  PRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKREVELQNANMYLRNKIAENERAQQQ  214

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ++M+P    EY  +  Y +RN LQ+N+M+  Q  Y    + TL L
Sbjct  215  MNMLPQTT-EYEVMAPYDSRNFLQVNLMQSNQ-HYSHQQQTTLQL  257



>gb|ABQ08574.1| MADS-box protein 2 [Dendrobium nobile]
Length=234

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 180/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGR+YEYSN+
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSNH  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI++YKKA +D+SN  +  E+N+ Q+YQQES KLR QI +LQNSNRHL+GEGL S 
Sbjct  61   SIKATIEKYKKACADSSNPGSLVEVNSQQYYQQESAKLRHQIQLLQNSNRHLMGEGLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             ++ELKQLE+RLERGI+++RSKKH+L+ AE E +QKREV L+ +N +LRAKI +NER + 
Sbjct  121  TLKELKQLENRLERGITRVRSKKHELLFAEIEYMQKREVELQNDNMYLRAKINDNERAEH  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +++  AG ++  + ++ +RN   LN++E         D+  LHL
Sbjct  181  ANIVQ-AGTDFDTLPNFDSRNYYHLNILETAPHYSHHQDQTALHL  224



>gb|AHM92098.1| MADS-box protein 22 [Erycina pusilla]
Length=234

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 174/211 (82%), Gaps = 3/211 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL++FSSRGR+YEY+NN
Sbjct  8    MGRGKIEIKRIENITNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRLYEYANN  67

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA+SD+SN     E NAQ+Y QE+ KLRQQI  LQNSNR+L+GE L + +
Sbjct  68   SVKATIERYKKASSDSSNSGPISETNAQYYMQEASKLRQQITNLQNSNRNLMGEALSTMS  127

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL---  368
            +R+LKQLE+RLE+GI+KIRSKK++L+ AE E +QKRE+ L+ +N +LR +IAE ER    
Sbjct  128  LRDLKQLETRLEKGINKIRSKKNELLYAEIEYMQKREMELQNDNMYLRNQIAETERSQQQ  187

Query  367  QQLSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            QQ++M+P    EY  +  + +RN LQ+N+M+
Sbjct  188  QQINMVPSTSTEYEVMPPFDSRNFLQVNLMD  218



>ref|XP_006858589.1| hypothetical protein AMTR_s00071p00193200 [Amborella trichopoda]
 gb|ERN20056.1| hypothetical protein AMTR_s00071p00193200 [Amborella trichopoda]
Length=222

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 181/224 (81%), Gaps = 3/224 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NIK TI+RYKKA++D+S+  +  E N+Q+YQQE+ KLRQQI +LQN+NRH +G+GL +  
Sbjct  61   NIKTTIERYKKASADSSSATSISEANSQYYQQEATKLRQQIQLLQNANRHFMGDGLSALT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            ++ELKQLE RLERG+++IRSKK++L+ AE E +Q +E  L+++N +LRAKIAE +R QQ 
Sbjct  121  IKELKQLEGRLERGLTRIRSKKNELLFAEIEYMQNKEAELQKDNMYLRAKIAEQDRTQQS  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+P    E+ AI  + ++N  Q+N+MEG    Y   D+  LHL
Sbjct  181  NMLPAP--EFDAIPTFDSQNYYQVNLMEGAH-HYRNQDQTALHL  221



>ref|XP_010925573.1| PREDICTED: floral homeotic protein AGAMOUS-like [Elaeis guineensis]
 gb|AAW66882.1| MADS box transcription factor [Elaeis guineensis]
Length=224

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 174/212 (82%), Gaps = 2/212 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALI+FSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA +D SN  +  E ++Q+YQQES KLRQQI  LQNSNR+L+G+ LGS +
Sbjct  61   SVKATIERYKKACTDTSNSGSVSEADSQYYQQESLKLRQQITSLQNSNRNLMGDSLGSMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            +R+LKQLE RLE+GI+KIR+KK++L+ AE E +QKRE  L+  N +LR KIAENE   QQ
Sbjct  121  LRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKRETELQNANMYLRNKIAENEGAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQ  266
            ++M+P A  EY  +  Y +RN LQ+N+M+  Q
Sbjct  181  MNMLP-ATTEYEVMPPYDSRNFLQVNLMQSNQ  211



>gb|AEZ51868.1| AG MADS-box protein [Cymbidium ensifolium]
Length=233

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 177/212 (83%), Gaps = 3/212 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL++FSSRGR+YEY+N
Sbjct  6    KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRLYEYAN  65

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGT DRYKKA +D S+  +  E N+Q+YQQE+ KLRQQI  LQNSNR+L+G+ L + 
Sbjct  66   NSVKGTTDRYKKACTDNSSTGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGDALTTM  125

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            ++R+LKQLE+RLE+GISKIRSKK++L+ AE + +QKRE+ L+ +N +LR+KIA+NER QQ
Sbjct  126  SLRDLKQLETRLEKGISKIRSKKNELLHAEIDYMQKREMDLQTDNMYLRSKIADNERAQQ  185

Query  361  ---LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
               +S++P    EY  +  + +R+ LQ+N+++
Sbjct  186  HQHISILPSTSTEYEVMPPFDSRSFLQVNLLD  217



>emb|CAK55150.1| agamous-like MADS-box protein AGL11 homologue [Betula pendula]
Length=216

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 174/218 (80%), Gaps = 3/218 (1%)
 Frame = -1

Query  880  EIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNNNIKGTI  701
            EIKRIEN TNRQVTFCKRRNGLLKKAY LSVLCDAE+ALIVFS+RGR+YEYSNNNIK TI
Sbjct  1    EIKRIENTTNRQVTFCKRRNGLLKKAYGLSVLCDAEVALIVFSTRGRLYEYSNNNIKSTI  60

Query  700  DRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSNVRELKQ  521
            +RYKKA SD S   +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S ++++LKQ
Sbjct  61   ERYKKACSDDSGTSSMAEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALTSLSIKDLKQ  120

Query  520  LESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQLSMMPGA  341
            LE+RLERGIS+IRSKKH++++++ E LQKRE+ LE EN  LR KIAE ERLQQ ++   +
Sbjct  121  LETRLERGISRIRSKKHEMLLSDIECLQKREIQLEDENICLRTKIAEIERLQQTNLNI-S  179

Query  340  GQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            G E +AI H L+RN     +++G    Y  PD+K L L
Sbjct  180  GPELNAI-HALSRNFFSPIMVDG-DTPYSQPDQKILRL  215



>gb|AIP87050.1| AG [Camellia japonica]
Length=258

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 173/214 (81%), Gaps = 4/214 (2%)
 Frame = -1

Query  916  LGVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRV  737
            L  + +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+
Sbjct  13   LSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRL  72

Query  736  YEYSNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGE  557
            YEY+NN++K TI+RYKKA S  SN  +  ELNAQFYQQE+ KLR QI  LQNSNRH+ GE
Sbjct  73   YEYANNSVKATIERYKKACSGPSNTGSVSELNAQFYQQEAAKLRVQIGNLQNSNRHMRGE  132

Query  556  GLGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAEN  377
             L S ++R+LK LE RLERGIS+IRSKK++L+ AE E +QKRE+ L   N +LRAKIAEN
Sbjct  133  SLCSLSMRDLKNLEGRLERGISRIRSKKNELLFAEIELMQKREIDLHNNNQYLRAKIAEN  192

Query  376  ERL-QQLSMMPGAGQEYHAI--QHYLARNMLQLN  284
            ER  QQ+S+MPG G EY  +  Q + ARN LQ+N
Sbjct  193  ERAQQQMSLMPG-GPEYELMPSQSFDARNYLQMN  225



>ref|XP_006397127.1| hypothetical protein EUTSA_v10028938mg [Eutrema salsugineum]
 gb|ESQ38580.1| hypothetical protein EUTSA_v10028938mg [Eutrema salsugineum]
Length=230

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 181/231 (78%), Gaps = 9/231 (4%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN+TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TI+RYKKA+SD +N  + QE+NA +YQQES KLRQQI  +QNSNR+L+G+ L S +
Sbjct  61   NIRSTIERYKKASSDGTNTHSVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQ+E+RLE+ IS+IRSKKH+L++AE ENLQKRE+ L+ E+ +LR KIAE ER Q  
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLAEIENLQKREIELDNESIYLRTKIAEIERFQHH  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQ-------ASYPVPDKKTLHL  227
              M  +G E +A++   ARN    +++            SY  PDKK +HL
Sbjct  181  HQMV-SGTEINAMEALAARNYFAHSIIASGSGSGAGHGCSYSDPDKK-IHL  229



>gb|AEX92974.1| MADS box protein 4 [Agave tequilana]
Length=225

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 174/209 (83%), Gaps = 1/209 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRI+N TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIDNTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K T++RYKKA +D +N  T  E N+Q+YQQE+ KLRQQI  LQNSNR+L+GE L + +
Sbjct  61   SVKATVERYKKACTDTNNTGTVSEANSQYYQQEASKLRQQITNLQNSNRNLMGESLSTMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            +R+LKQLE RLE+GI+KIR KK++L+ AE E +QKRE+ L+ +N +LR KIAEN+R  QQ
Sbjct  121  LRDLKQLEGRLEKGINKIRIKKNELLFAEIEYMQKREMELQNDNMYLRNKIAENDRAQQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            ++++P A  EY  +  + +RN LQ++++E
Sbjct  181  MNILPAATAEYDGVPQFDSRNFLQVSLIE  209



>gb|AAY86364.1| AGAMOUS-like protein [Dendrobium thyrsiflorum]
Length=233

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 177/212 (83%), Gaps = 3/212 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALI+FSSRGR+YEY+N
Sbjct  6    KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLYEYAN  65

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGTIDRYKKA SD SN  +  E N+Q+YQQE+ KLRQQI  LQNSNR+L+G+ L + 
Sbjct  66   NSVKGTIDRYKKANSDNSNSGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGDALTTM  125

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            ++R+LKQLE+RLE+GI+KIRSKK++L+ AE + +QKRE+ L+ +N +LR KIA+NER QQ
Sbjct  126  SLRDLKQLETRLEKGINKIRSKKNELLHAEIDYMQKREMDLQTDNMYLRNKIADNERAQQ  185

Query  361  ---LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
               ++++P    EY  +  + +R+ LQ+N+++
Sbjct  186  HQHMNILPSTSAEYEVMPPFDSRSFLQVNLLD  217



>emb|CAJ44134.1| plena protein [Misopates orontium]
Length=238

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 174/225 (77%), Gaps = 2/225 (1%)
 Frame = -1

Query  895  GRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNNN  716
            GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEY+NN+
Sbjct  13   GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYANNS  72

Query  715  IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSNV  536
            ++ TIDRYKKA++D+SN  +  E N QFYQQE+ KLR+QI  +Q SNR ++GEG+G+  +
Sbjct  73   VRATIDRYKKASADSSNSVSTSEANTQFYQQEANKLRRQIREIQTSNRQMLGEGVGNMAL  132

Query  535  RELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL--QQ  362
            ++LK  E+++E+ IS+IRSKK++L+ AE E +QKRE+ L   N FLRAKIAE ER   QQ
Sbjct  133  KDLKSTEAKVEKAISRIRSKKNELLFAEIELMQKRELELHNANMFLRAKIAEGERAQQQQ  192

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +++MPG+  +    Q Y  RN L +N+ME  Q  Y   D+  L L
Sbjct  193  MNLMPGSDYQPMTSQSYDVRNFLPMNLMEPNQQQYSRHDQTALQL  237



>ref|XP_009380480.1| PREDICTED: MADS-box transcription factor 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=226

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 174/213 (82%), Gaps = 2/213 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDA++ALIVFSSRGR+YEY+ N
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDADVALIVFSSRGRLYEYATN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TIDRYKKA +  +N     E NAQ+YQQE+ KLRQQI+ LQ++NR L+GE LGS +
Sbjct  61   SVKATIDRYKKACNGTTNTGFASEDNAQYYQQEASKLRQQINNLQSTNRSLMGESLGSMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            +R++KQLE+RLE+GI+KIR+KK++L+ AE E +QKRE+ L+ +N +LR KIAENER  QQ
Sbjct  121  LRDMKQLETRLEKGINKIRNKKNELLFAEIEYMQKREMELQNDNMYLRNKIAENERAQQQ  180

Query  361  LSMMPGA-GQEYHAIQHYLARNMLQLNVMEGVQ  266
            +SM+P A   EY  +  Y +RN LQ+N ++  Q
Sbjct  181  MSMLPSARTTEYEIMPPYDSRNFLQVNAVQPTQ  213



>gb|AAD19360.2| AGAMOUS homolog transcription factor [Hyacinthus orientalis]
Length=228

 Score =   277 bits (709),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 171/210 (81%), Gaps = 2/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN T+RQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEYSN+
Sbjct  1    MGRGKIEIKRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSNS  60

Query  718  N-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N +K TI+RYKKA +D +N  T  E N+Q+YQQE+ KLRQQI  LQN+NR L+GE L + 
Sbjct  61   NSVKTTIERYKKACTDTTNTGTVSEANSQYYQQEATKLRQQITNLQNTNRTLMGESLSTM  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-Q  365
            ++RELKQLE RLERGI+KIR+KK++L+ AE E +QKRE  +  +N +LR KIAENER  Q
Sbjct  121  SLRELKQLEGRLERGINKIRTKKNELLSAEIEYMQKREAEMHNDNMYLRNKIAENERAQQ  180

Query  364  QLSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            Q++M+P    EY  I  + +RN LQ+++ME
Sbjct  181  QMNMLPSTATEYEGIPQFDSRNFLQVSLME  210



>gb|AFU81322.1| C-class MADS-box-like protein [Orchis italica]
 gb|AFU81324.1| C-class MADS-box-like protein [Orchis italica]
Length=234

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 176/212 (83%), Gaps = 3/212 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL++FS+RGR+YEY+N
Sbjct  7    KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYAN  66

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGTI+RYKKA+SD S+  +    NAQ+Y QE+ KLRQQI  LQNSNRHL+GE L + 
Sbjct  67   NSVKGTIERYKKASSDNSSSGSISATNAQYYLQEASKLRQQITSLQNSNRHLMGEALSTM  126

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            N+R+LKQLESRLE+GI+KIR+KK++L+ AE E +QKREV L+ +N +LR KIA+NER QQ
Sbjct  127  NLRDLKQLESRLEKGINKIRTKKNELLYAEIEYMQKREVELQNDNMYLRNKIADNERSQQ  186

Query  361  ---LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
               ++MMP    +Y  +  + +RN LQ+N+M+
Sbjct  187  QQHMNMMPSTSTDYEMMPPFDSRNFLQVNLMD  218



>dbj|BAK20023.1| PgMADS protein8 [Panax ginseng]
Length=253

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 178/230 (77%), Gaps = 6/230 (3%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+N
Sbjct  24   QVGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYAN  83

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N+I+ TIDRYKK  +D+SN  +  E N QFYQQE+ KLR+ I  +QNSNR++VGEGLGS 
Sbjct  84   NSIRSTIDRYKKVCADSSNTRSVSEANTQFYQQEASKLRRDIKSIQNSNRNIVGEGLGSL  143

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-Q  365
            + +ELK LE RLE+ ISKIRSKK++L+ AE E +QKRE  L+  N +LRAKI+ENER  Q
Sbjct  144  SFKELKNLEGRLEKAISKIRSKKNELLFAEIELMQKRESELQHANMYLRAKISENERAEQ  203

Query  364  QLSMMPGAG-QEYH--AIQHYL-ARNMLQLNVMEGVQASYPVPDKKTLHL  227
            Q++MMPG G  EY   A QHY  ARN L +N +E     Y   D+  L L
Sbjct  204  QMNMMPGGGSHEYQTMASQHYQDARNFLPVNFLEP-NHHYSRQDQTALQL  252



>ref|XP_010687173.1| PREDICTED: floral homeotic protein AGAMOUS isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=250

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 178/228 (78%), Gaps = 5/228 (2%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  24   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  83

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +++KGTIDRYKKA SD S   +  E NAQ+YQQE+ KLR QI     +NRH++GEGL S 
Sbjct  84   HSVKGTIDRYKKACSDQSGAGSVAEANAQYYQQEAAKLRNQIRTATENNRHMMGEGLSSL  143

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +++ELK LE++LERGIS+IRSKK++L+ AE E +QKRE+ L   N FLRA+I+ENER QQ
Sbjct  144  SMKELKNLETKLERGISRIRSKKNELLFAEIEFMQKREIELHNNNQFLRARISENERAQQ  203

Query  361  -LSMMPGAGQEYHAI--QHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +S+MPG G +Y  +  Q + +RN  Q+N ++   + Y   D+  L L
Sbjct  204  SMSLMPG-GSDYDLVPSQSFDSRNYFQVNALQ-PSSQYARQDQTPLQL  249



>ref|XP_009380477.1| PREDICTED: MADS-box transcription factor 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009380478.1| PREDICTED: MADS-box transcription factor 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009380479.1| PREDICTED: MADS-box transcription factor 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=232

 Score =   277 bits (709),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 174/213 (82%), Gaps = 2/213 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDA++ALIVFSSRGR+YEY+ N
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDADVALIVFSSRGRLYEYATN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TIDRYKKA +  +N     E NAQ+YQQE+ KLRQQI+ LQ++NR L+GE LGS +
Sbjct  61   SVKATIDRYKKACNGTTNTGFASEDNAQYYQQEASKLRQQINNLQSTNRSLMGESLGSMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQ  362
            +R++KQLE+RLE+GI+KIR+KK++L+ AE E +QKRE+ L+ +N +LR KIAENER  QQ
Sbjct  121  LRDMKQLETRLEKGINKIRNKKNELLFAEIEYMQKREMELQNDNMYLRNKIAENERAQQQ  180

Query  361  LSMMPGA-GQEYHAIQHYLARNMLQLNVMEGVQ  266
            +SM+P A   EY  +  Y +RN LQ+N ++  Q
Sbjct  181  MSMLPSARTTEYEIMPPYDSRNFLQVNAVQPTQ  213



>ref|XP_006449577.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
 ref|XP_006449578.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
 ref|XP_006449580.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
 dbj|BAF34911.1| MADS-box protein [Citrus unshiu]
 gb|ESR62817.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
 gb|ESR62818.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
 gb|ESR62820.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
Length=245

 Score =   278 bits (710),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 178/233 (76%), Gaps = 5/233 (2%)
 Frame = -1

Query  916  LGVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRV  737
            L  + +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGR+
Sbjct  14   LSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRL  73

Query  736  YEYSNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGE  557
            YEYSNN++K TIDRYKKAT+D SN  +  E NAQFYQQE+ KLR QI  +QNSNR+++GE
Sbjct  74   YEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLRIQISNMQNSNRNMLGE  133

Query  556  GLGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAEN  377
             L   N +ELK +E+RLE+GIS+IRSKK++L+ AE E +QKREV L   N  LRAKIAEN
Sbjct  134  SLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKREVDLHNSNQLLRAKIAEN  193

Query  376  ERLQQ-LSMMPGAGQEYHAIQH--YLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ER QQ +++M G G  Y  IQ   + +R+  Q+N ++     YP  D+  L L
Sbjct  194  ERGQQNMNLMQG-GSSYEIIQSQPFDSRSYFQVNALQPTN-HYPRQDQMALQL  244



>ref|XP_010656928.1| PREDICTED: MAD-box transcripion factor isoform X2 [Vitis vinifera]
Length=303

 Score =   280 bits (715),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 174/210 (83%), Gaps = 1/210 (0%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  78   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  137

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N+++ TI+RYKK  SD+SN  +  E NAQFYQQE+ KLR+QI  +QN NRH++GE L S 
Sbjct  138  NSVRTTIERYKKVCSDSSNTGSVSEANAQFYQQEASKLRRQIRDIQNLNRHILGEALSSL  197

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-Q  365
            N +ELK LE+RLE+GIS+IRSKK++L+ AE E +QKRE+ L+  N FLRA+IAENER  Q
Sbjct  198  NFKELKNLETRLEKGISRIRSKKNELLFAEIEYMQKREIELQNSNLFLRAQIAENERAQQ  257

Query  364  QLSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            Q+++MPG+  E    Q Y ++N+L +N+++
Sbjct  258  QMNLMPGSQYESVPQQPYDSQNLLPVNLLD  287



>dbj|BAG69622.1| MADS-box transcription factor [Lilium formosanum x Lilium longiflorum]
Length=232

 Score =   276 bits (707),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 175/225 (78%), Gaps = 4/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TIDRYKKA  D+SN  +  ++N+ Q++QQES KLR QI +L N+NRHLVGE L S 
Sbjct  61   SIKQTIDRYKKAC-DSSNSNSLIQVNSQQYFQQESAKLRHQIQILTNANRHLVGEALSSL  119

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             V+ELKQLE+RLERG+++IRSKKH+L+ AE E  QKREV L+ +N +LRAKIAENER Q 
Sbjct  120  TVKELKQLENRLERGLTRIRSKKHELLFAEIEFSQKREVELQSDNMYLRAKIAENERTQ-  178

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             + +  A  E+ A+  + +RN  Q+N M      Y   D+  LHL
Sbjct  179  -AAIVQARAEFDALPTFDSRNFYQVNNMLEAPPHYLHQDQTALHL  222



>gb|AAF08830.2| transcription factor MADS1 [Hyacinthus orientalis]
Length=234

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 178/225 (79%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQ-FYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI+R KKA +D+S+     E+N Q +YQQE+ KLRQQI +LQN+NRHL+GE L   
Sbjct  61   SIKSTIERDKKACADSSSSSAVIEVNTQRYYQQEASKLRQQIQILQNANRHLMGESLDPL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            NV+ELKQLE+RLERGI+++RSKKH+L+ AE E +QKREV L+ +N +LRAKI ENER  Q
Sbjct  121  NVKELKQLETRLERGITRVRSKKHELLFAELEYMQKREVELQTDNMYLRAKIGENERAHQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             S++  AG E+ A+  + +RN  Q+++++         D+  LHL
Sbjct  181  ASVVQ-AGTEFDALPTFDSRNYYQVHMLQAASHYSHHQDQTALHL  224



>gb|ADW08393.1| AGAMOUS MADS box factor transcription factor [Musa acuminata 
AAA Group]
Length=243

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 180/234 (77%), Gaps = 11/234 (5%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N+
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAND  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQ-FYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            NIK TI+RYKKA +D+S+     ++N+Q +YQQES KLR QI +LQN+NRHL+G+ L S 
Sbjct  61   NIKSTIERYKKACADSSSSGAIVDVNSQHYYQQESAKLRHQIQILQNANRHLMGDALSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIA--------ETENLQKREVHLEQENAFLRAKI  386
            NV+ELKQLE+RLER I++IRSKKH+L+ A        E E +QKREV L+ +N +LRAKI
Sbjct  121  NVKELKQLENRLERSITRIRSKKHELLFAEIEYMQKREVEYMQKREVELQSDNMYLRAKI  180

Query  385  AENERLQQLSMMPGAGQEYHAIQ-HYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            AENER+QQLS++  AG EY AI   + +RN    N++E         D+  L L
Sbjct  181  AENERVQQLSIVE-AGAEYDAIPGAFDSRNYYHGNILEAAAHYSHHQDQTALQL  233



>ref|XP_011085309.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X4 [Sesamum 
indicum]
Length=243

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 180/234 (77%), Gaps = 6/234 (3%)
 Frame = -1

Query  916  LGVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRV  737
            +  E + GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+
Sbjct  11   MSSERKTGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  70

Query  736  YEYSNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGE  557
            YEY+NN++K TI+RYKKATSD+ N  +  E N Q+YQQE+ KLR QI  LQN N++++GE
Sbjct  71   YEYANNSVKATIERYKKATSDSPNSGSVSEANTQYYQQEASKLRAQISNLQNQNKNMLGE  130

Query  556  GLGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAEN  377
             LG+  +RELK LE+R+ERGISKIRSKK++L+ AE E +QKRE+ L   N FLRAKIAE 
Sbjct  131  SLGALTLRELKNLETRVERGISKIRSKKNELLYAEIEYMQKREIDLHHNNHFLRAKIAET  190

Query  376  ERLQQ-LSMMPGAGQEYHAI---QHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ER QQ +S+MPG   EYH +   Q + +R+ LQ++ ++     YP  D+  L L
Sbjct  191  ERGQQHMSLMPG-NSEYHELVQSQPFDSRDYLQVSGLQ-THNGYPRQDQPPLQL  242



>gb|AAS01766.1| MADS-box protein 2 [Lilium longiflorum]
 dbj|BAG69624.1| MADS-box transcription factor [Lilium hybrid cultivar]
Length=232

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 175/225 (78%), Gaps = 4/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TIDRYKKA  D+SN  +  ++N+ Q++QQES KLR QI +L N+NRHLVGE L S 
Sbjct  61   SIKQTIDRYKKAC-DSSNSNSLIQVNSQQYFQQESAKLRHQIQILTNANRHLVGEALSSL  119

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             V+ELKQLE+RLERG+++IRSKKH+L+ AE E  QKREV L+ +N +LRAKIAENER Q 
Sbjct  120  TVKELKQLENRLERGLTRIRSKKHELLFAEIEFSQKREVELQSDNMYLRAKIAENERTQ-  178

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             + +  A  E+ A+  + +RN  Q+N M      Y   D+  LHL
Sbjct  179  -AAIVQARAEFDALPTFDSRNFYQVNNMLEAPPHYHHQDQTALHL  222



>dbj|BAD83772.1| MADS-box transcription factor [Asparagus virgatus]
Length=234

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 177/225 (79%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI+RYKKA +D+SN     E+N+ Q+YQQE+ KLR QI +LQN+NRHL+G+ L S 
Sbjct  61   SIKSTIERYKKACADSSNSNAVIEVNSQQYYQQEAAKLRHQIQILQNANRHLMGDSLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             V+ELKQLE+RLERGI++IRSKKH+L+ AE E +QKRE  L+ +N +LRAKI+ENER  Q
Sbjct  121  TVKELKQLENRLERGITRIRSKKHELLFAEIEYMQKREAELQNDNMYLRAKISENERAHQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +S++   G E+  +  + +RN   ++++E         D+  LHL
Sbjct  181  VSVVQ-PGPEFDTLPTFDSRNYYNVHMLEAAPHYSHHQDQTALHL  224



>gb|AAL76415.1|AF234617_1 MADS-box transcription factor [Phalaenopsis equestris]
 dbj|BAE80120.1| MADS-box transcription factor [Phalaenopsis hybrid cultivar]
 gb|ABF61451.1| AGAMOUSE-like protein [Phalaenopsis hybrid cultivar]
Length=239

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 177/213 (83%), Gaps = 4/213 (2%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALI+FS+RGR+YEY+N
Sbjct  11   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSTRGRLYEYAN  70

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGTI+RYKKA++D SN  +  E N+Q+YQQE+ KLRQQI  LQNSNR+L+G+ L + 
Sbjct  71   NSVKGTIERYKKASTDNSNTGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGDALTTM  130

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            ++R+LKQLE+RLE+GI+KIR+KK++L+ AE + +QKRE+ L+ +N FLR KI++NER QQ
Sbjct  131  SLRDLKQLETRLEKGINKIRAKKNELLHAEIDYMQKREMELQTDNMFLRNKISDNERAQQ  190

Query  361  ----LSMMPGAGQEYHAIQHYLARNMLQLNVME  275
                +S++P    EY  +  + +R+ L +N+M+
Sbjct  191  QHQHMSILPSTSTEYEVMPPFDSRSFLHVNLMD  223



>gb|ADC79698.1| AGAMOUS-like protein [Euptelea pleiosperma]
Length=225

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 177/225 (79%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA++D+SN     E N QFYQQE+ KLR+ I  +QN NR+L+GEGL S +
Sbjct  61   SVKTTIERYKKASADSSNNGYFLEANTQFYQQEAAKLRKDIGNIQNENRNLMGEGLSSKS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
            V+ELKQLE++LE+ IS+IRSKK++L+ AE E +Q+RE+ L+ +N + RAKIAENE+ QQ 
Sbjct  121  VKELKQLENKLEKSISRIRSKKNELLFAEIEYMQRREIDLQNDNMYFRAKIAENEKAQQH  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +S+M G   E      + +RN +Q+N+ME     Y  PD+  L L
Sbjct  181  MSLMAGNEYEVMTSAPFDSRNFVQVNLMEP-NHHYSRPDQTALQL  224



>gb|AGV31153.1| C-class MADS-box protein [Allium cepa]
Length=229

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 177/228 (78%), Gaps = 4/228 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEY+ N
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYATN  60

Query  718  NIKGTIDRYKKATSDASNICT-PQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            ++K TI+RYKKA++D SN  T   E+N+Q+YQQE+ KLRQQI  LQNSNR+L+GE L S 
Sbjct  61   SVKQTIERYKKASTDTSNTGTHVSEVNSQYYQQEAMKLRQQIASLQNSNRNLLGESLSSM  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER--L  368
            N +ELKQLE+RLE+GISKIR+KK++L+ AE E +QKRE+ L+ +N +LR KIAENE    
Sbjct  121  NHKELKQLETRLEKGISKIRAKKNELLFAEIEYMQKREMELQNDNMYLRNKIAENESRAQ  180

Query  367  QQLSMMPGAG-QEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            QQ++++P A   EY  +  Y +RN +  N+M+     Y    +  L L
Sbjct  181  QQMNVLPTASTSEYETMTQYDSRNYMHTNLMDPSNGHYGSQQQTALQL  228



>gb|AAS67611.1| agamous MADS-box transcription factor 1b [Crocus sativus]
 gb|AHH41529.1| MADS-box transcription factor 1b [Crocus sativus]
Length=228

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 174/210 (83%), Gaps = 2/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++KGTIDRYKKA +D SN  T  E N+Q+YQQE+ KL QQI  LQNSNR+L+GE L + +
Sbjct  61   SVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
             REL+QLE +LE+GI+KIR+KK++L+ AE E +QKRE+ L+ +N +LR KI+ENER QQ 
Sbjct  121  PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENERAQQH  180

Query  361  LSMMPGA-GQEYHAIQHYLARNMLQLNVME  275
            ++M+P A   EY A+  + +R+ LQ N+++
Sbjct  181  MNMLPSATATEYEAMPPFDSRSFLQANLVD  210



>gb|AAS67610.1| agamous MADS-box transcription factor 1a [Crocus sativus]
Length=226

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 174/210 (83%), Gaps = 2/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++KGTIDRYKKA +D SN  T  E N+Q+YQQE+ KL QQI  LQNSNR+L+GE L + +
Sbjct  61   SVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
             REL+QLE +LE+GI+KIR+KK++L+ AE E +QKRE+ L+ +N +LR KI+ENER QQ 
Sbjct  121  PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENERAQQH  180

Query  361  LSMMPGA-GQEYHAIQHYLARNMLQLNVME  275
            ++M+P A   EY A+  + +R+ LQ N+++
Sbjct  181  MNMLPSATATEYEAMPPFDSRSFLQANLVD  210



>gb|AHH41528.1| MADS-box transcription factor 1a [Crocus sativus]
Length=226

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 174/210 (83%), Gaps = 2/210 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++KGTIDRYKKA +D SN  T  E N+Q+YQQE+ KL QQI  LQNSNR+L+GE L + +
Sbjct  61   SVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
             REL+QLE +LE+GI+KIR+KK++L+ AE E +QKRE+ L+ +N +LR KI+ENER QQ 
Sbjct  121  PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENERAQQH  180

Query  361  LSMMPGA-GQEYHAIQHYLARNMLQLNVME  275
            ++M+P A   EY A+  + +R+ LQ N+++
Sbjct  181  MNMLPSATATEYEAMPPFDSRSFLQANLVD  210



>emb|CBI31767.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 174/210 (83%), Gaps = 1/210 (0%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  89   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  148

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N+++ TI+RYKK  SD+SN  +  E NAQFYQQE+ KLR+QI  +QN NRH++GE L S 
Sbjct  149  NSVRTTIERYKKVCSDSSNTGSVSEANAQFYQQEASKLRRQIRDIQNLNRHILGEALSSL  208

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-Q  365
            N +ELK LE+RLE+GIS+IRSKK++L+ AE E +QKRE+ L+  N FLRA+IAENER  Q
Sbjct  209  NFKELKNLETRLEKGISRIRSKKNELLFAEIEYMQKREIELQNSNLFLRAQIAENERAQQ  268

Query  364  QLSMMPGAGQEYHAIQHYLARNMLQLNVME  275
            Q+++MPG+  E    Q Y ++N+L +N+++
Sbjct  269  QMNLMPGSQYESVPQQPYDSQNLLPVNLLD  298



>gb|KDO77975.1| hypothetical protein CISIN_1g036452mg, partial [Citrus sinensis]
Length=244

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 178/233 (76%), Gaps = 5/233 (2%)
 Frame = -1

Query  916  LGVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRV  737
            L  + +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE++LIVFSSRGR+
Sbjct  14   LSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRL  73

Query  736  YEYSNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGE  557
            YEYSNN++K TIDRYKKAT+D SN  +  E NAQFYQQE+ KLR QI  +QNSNR+++GE
Sbjct  74   YEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLRIQISNMQNSNRNMLGE  133

Query  556  GLGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAEN  377
             L   N +ELK +E+RLE+GIS+IRSKK++L+ AE E +QKREV L   N  LRAKIAEN
Sbjct  134  SLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKREVDLHNSNQLLRAKIAEN  193

Query  376  ERLQQ-LSMMPGAGQEYHAIQH--YLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ER QQ +++M G G  Y  IQ   + +R+  Q+N ++     YP  D+  L L
Sbjct  194  ERGQQNMNLMQG-GSSYEIIQSQPFDSRSYFQVNALQPTN-HYPRQDQMALQL  244



>dbj|BAG74745.1| HmAGAMOUS protein [Hydrangea macrophylla]
Length=251

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 181/236 (77%), Gaps = 11/236 (5%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+N
Sbjct  15   KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYAN  74

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGTI+RYKKA SD++N  +  E+NAQ YQQE+ KLR QI  LQNSNR+++GE LGS 
Sbjct  75   NSVKGTIERYKKACSDSTNTGSVAEINAQQYQQEASKLRSQIANLQNSNRNMLGESLGSL  134

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL--  368
            + R+LK LE RLERGIS+IRSKK++L+ AE E +QKREV L   N +LRAKIAENER   
Sbjct  135  SPRDLKNLEGRLERGISRIRSKKNELLFAEIEYMQKREVDLHNNNQYLRAKIAENERAQQ  194

Query  367  -----QQLSMMPGAGQ-EYHAI---QHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
                 QQ+++MPG G  EY  +   Q + ARN LQ+N ++     Y   D+  L L
Sbjct  195  QQQHQQQMNLMPGGGSCEYELMPPTQPFDARNYLQINGLQSNNHHYSRDDQTALQL  250



>ref|XP_006467576.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Citrus 
sinensis]
Length=252

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 178/233 (76%), Gaps = 5/233 (2%)
 Frame = -1

Query  916  LGVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRV  737
            L  + +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE++LIVFSSRGR+
Sbjct  21   LSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRL  80

Query  736  YEYSNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGE  557
            YEYSNN++K TIDRYKKAT+D SN  +  E NAQFYQQE+ KLR QI  +QNSNR+++GE
Sbjct  81   YEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLRIQISNMQNSNRNMLGE  140

Query  556  GLGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAEN  377
             L   N +ELK +E+RLE+GIS+IRSKK++L+ AE E +QKREV L   N  LRAKIAEN
Sbjct  141  SLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKREVDLHNSNQLLRAKIAEN  200

Query  376  ERLQQ-LSMMPGAGQEYHAIQH--YLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ER QQ +++M G G  Y  IQ   + +R+  Q+N ++     YP  D+  L L
Sbjct  201  ERGQQNMNLMQG-GSSYEIIQSQPFDSRSYFQVNALQPTN-HYPRQDQMALQL  251



>ref|XP_006467577.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Citrus 
sinensis]
 ref|XP_006467578.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X4 [Citrus 
sinensis]
 ref|XP_006467579.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X5 [Citrus 
sinensis]
Length=245

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 178/233 (76%), Gaps = 5/233 (2%)
 Frame = -1

Query  916  LGVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRV  737
            L  + +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE++LIVFSSRGR+
Sbjct  14   LSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRL  73

Query  736  YEYSNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGE  557
            YEYSNN++K TIDRYKKAT+D SN  +  E NAQFYQQE+ KLR QI  +QNSNR+++GE
Sbjct  74   YEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLRIQISNMQNSNRNMLGE  133

Query  556  GLGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAEN  377
             L   N +ELK +E+RLE+GIS+IRSKK++L+ AE E +QKREV L   N  LRAKIAEN
Sbjct  134  SLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKREVDLHNSNQLLRAKIAEN  193

Query  376  ERLQQ-LSMMPGAGQEYHAIQH--YLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ER QQ +++M G G  Y  IQ   + +R+  Q+N ++     YP  D+  L L
Sbjct  194  ERGQQNMNLMQG-GSSYEIIQSQPFDSRSYFQVNALQPTN-HYPRQDQMALQL  244



>sp|Q40885.1|AG_PETHY RecName: Full=Floral homeotic protein AGAMOUS; AltName: Full=pMADS3 
[Petunia x hybrida]
 emb|CAA51417.1| pMADS3 [Petunia x hybrida]
Length=242

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 179/230 (78%), Gaps = 9/230 (4%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  16   KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  75

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD+SN  +  E NAQ+YQQE+ KLR QI  LQN NR+ +GE L + 
Sbjct  76   NSVKATIERYKKACSDSSNTGSIAEANAQYYQQEASKLRAQIGNLQNQNRNFLGESLAAL  135

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            N+R+L+ LE ++E+GISKIR+KK++L+ AE E +QKRE+ L   N +LRAKIAE ER QQ
Sbjct  136  NLRDLRNLEQKIEKGISKIRAKKNELLFAEIEYMQKREIDLHNNNQYLRAKIAETERSQQ  195

Query  361  LSMMPGAGQEYHAI---QHYLARNMLQLNVMEGVQAS--YPVPDKKTLHL  227
            +++MPG+   Y  +   Q + ARN LQ+N   G+Q +  YP  D+  L L
Sbjct  196  MNLMPGSS-SYDLVPPQQSFDARNYLQVN---GLQTNNHYPRQDQPPLQL  241



>ref|XP_006358066.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Solanum 
tuberosum]
Length=249

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 180/236 (76%), Gaps = 14/236 (6%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEY+N
Sbjct  16   KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYAN  75

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD+SN  +  E NAQ+YQQE+ KLR QI  LQN NR+++GE LGS 
Sbjct  76   NSVKATIERYKKACSDSSNTGSVSEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLGSM  135

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKR-EVHLEQENAFLRAKIAENERL-  368
            N +ELK LE ++E+GISKIRSKK++L+ AE E +QKR EV L   N +LRAKIAE ER  
Sbjct  136  NSKELKSLEQKIEKGISKIRSKKNELLFAEIEYMQKRQEVDLHNNNQYLRAKIAETERAQ  195

Query  367  ---QQLSMMPGAGQEYHAI----QHYLARNMLQLNVMEGVQAS--YPVPDKKTLHL  227
               QQ+++MPG+   YH +    Q +  RN LQ+N   G+Q +  YP  D+  + L
Sbjct  196  HQHQQMNLMPGSSSSYHELVPPPQQFDTRNYLQVN---GLQTNNHYPRQDQPPIQL  248



>ref|XP_006467575.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Citrus 
sinensis]
Length=254

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 178/233 (76%), Gaps = 5/233 (2%)
 Frame = -1

Query  916  LGVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRV  737
            L  + +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE++LIVFSSRGR+
Sbjct  23   LSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRL  82

Query  736  YEYSNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGE  557
            YEYSNN++K TIDRYKKAT+D SN  +  E NAQFYQQE+ KLR QI  +QNSNR+++GE
Sbjct  83   YEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLRIQISNMQNSNRNMLGE  142

Query  556  GLGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAEN  377
             L   N +ELK +E+RLE+GIS+IRSKK++L+ AE E +QKREV L   N  LRAKIAEN
Sbjct  143  SLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKREVDLHNSNQLLRAKIAEN  202

Query  376  ERLQQ-LSMMPGAGQEYHAIQH--YLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ER QQ +++M G G  Y  IQ   + +R+  Q+N ++     YP  D+  L L
Sbjct  203  ERGQQNMNLMQG-GSSYEIIQSQPFDSRSYFQVNALQPTN-HYPRQDQMALQL  253



>gb|ADP02394.1| AGAMOUS-like protein [Citrus sinensis]
Length=246

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 178/233 (76%), Gaps = 5/233 (2%)
 Frame = -1

Query  916  LGVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRV  737
            L  + +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE++LIVFSSRGR+
Sbjct  14   LSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRL  73

Query  736  YEYSNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGE  557
            YEYSNN++K TIDRYKKAT+D SN  +  E NAQFYQQE+ KLR QI  +QNSNR+++GE
Sbjct  74   YEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLRIQISNMQNSNRNMLGE  133

Query  556  GLGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAEN  377
             L   N +ELK +E+RLE+GIS+IRSKK++L+ AE E +QKREV L   N  LRAKIAEN
Sbjct  134  SLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKREVDLHNSNQLLRAKIAEN  193

Query  376  ERLQQ-LSMMPGAGQEYHAIQH--YLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ER QQ +++M G G  Y  IQ   + +R+  Q+N ++     YP  D+  L L
Sbjct  194  ERGQQNMNLMQG-GSSYEIIQSQPFDSRSYFQVNALQPTN-HYPRQDQMALQL  244



>sp|Q40872.1|AG_PANGI RecName: Full=Floral homeotic protein AGAMOUS; AltName: Full=GAG2 
[Panax ginseng]
 emb|CAA86585.1| agamous [Panax ginseng]
 dbj|BAK20020.1| PgMADS protein5 [Panax ginseng]
Length=242

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 182/234 (78%), Gaps = 7/234 (3%)
 Frame = -1

Query  916  LGVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRV  737
            L  + ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+
Sbjct  11   LSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRL  70

Query  736  YEYSNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGE  557
            YEY+NN++KGTI+RYKKA +D+ N  +  E NAQFYQQE+ KLRQ+I  +Q +NR+++GE
Sbjct  71   YEYANNSVKGTIERYKKACTDSPNTSSVSEANAQFYQQEASKLRQEISSIQKNNRNMMGE  130

Query  556  GLGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAEN  377
             LGS  VR+LK LE++LE+GIS+IRSKK++L+ AE E +QK+E+ L   N +LRAKIAEN
Sbjct  131  SLGSLTVRDLKGLETKLEKGISRIRSKKNELLFAEIEYMQKKEIDLHNNNQYLRAKIAEN  190

Query  376  ERLQQ-LSMMPGAGQ-EYHAIQHYLARNMLQLNVMEGVQAS--YPVPDKKTLHL  227
            ER QQ +++MPG+   E    Q +  RN +QLN   G+Q +  Y   D+  L L
Sbjct  191  ERAQQHMNLMPGSSDYELAPPQSFDGRNYIQLN---GLQPNNHYSRQDQTALQL  241



>gb|AAZ53206.1| AG2 [Eschscholzia californica]
Length=236

 Score =   275 bits (703),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 177/225 (79%), Gaps = 6/225 (3%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIK+IEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFS+RGR+YEY+NN
Sbjct  16   MGRGKIEIKKIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSNRGRLYEYANN  75

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TI+RYKK  +D SN     E N QF+QQE+ KLRQQI +LQNSNRHL+GE L S N
Sbjct  76   SVRSTIERYKKTCADPSNSSCSSEANIQFFQQEASKLRQQIAILQNSNRHLMGESLSSMN  135

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
            V+ELKQLE+RLE+GIS+IRSKK++L+ AE E +QKRE+ L+  N +LR+KIAE ER +Q 
Sbjct  136  VKELKQLETRLEKGISRIRSKKNELLFAEIELMQKREIDLQNHNMYLRSKIAEKERAEQH  195

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            + + P  G EY+ +   ++RN LQ+N ++     Y   ++ +L L
Sbjct  196  MRLTP--GNEYNDM---ISRNFLQVNFLQSSNHQYSHQEQTSLQL  235



>ref|XP_003565181.1| PREDICTED: MADS-box transcription factor 3 isoform X3 [Brachypodium 
distachyon]
Length=263

 Score =   276 bits (705),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 170/211 (81%), Gaps = 3/211 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRG+IEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEYSN
Sbjct  34   KMGRGRIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN  93

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD SN  T  E+NAQ YQQES KLRQQI  LQNSNR LV + + + 
Sbjct  94   NSVKATIERYKKANSDTSNSGTVAEVNAQHYQQESSKLRQQISSLQNSNRSLVKDSVSTM  153

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             +R+LKQLE RLE+GI+KIR++K++L+ AE E +QKRE+ L  +N +LR+K+AENER QQ
Sbjct  154  TLRDLKQLEGRLEKGIAKIRARKNELLYAEVEYMQKREMELHNDNMYLRSKVAENERGQQ  213

Query  361  -LSMMPGA--GQEYHAIQHYLARNMLQLNVM  278
             ++MM  A    EY  +  Y +RN LQ+N M
Sbjct  214  PMNMMAAASTSSEYDHMVQYDSRNFLQVNPM  244



>dbj|BAI59708.1| MADS-box transcription factor [Lobelia erinus]
Length=245

 Score =   275 bits (703),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 181/234 (77%), Gaps = 13/234 (6%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  15   KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  74

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSN----RHLVGEG  554
            N++KGTI+RYKKA SD  N  +  E NAQFYQQE+ KLRQQI  LQN N    R+++GE 
Sbjct  75   NSVKGTIERYKKACSDPPNSGSVSEANAQFYQQEAAKLRQQISNLQNQNRQFYRNMMGES  134

Query  553  LGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENE  374
            LGS   ++LK LE++LE+GISKIRSKK++L+ AE E +QKRE+ L   N +LRAKIAENE
Sbjct  135  LGSLGPKDLKSLETKLEKGISKIRSKKNELLFAEIEYMQKREIDLHNSNQYLRAKIAENE  194

Query  373  RLQQ-LSMMPGAGQEYHAI--QHYLARNMLQLNVMEGVQA--SYPVPDKKTLHL  227
            R QQ +S+MPG+  +Y  +  Q + ARN LQ+N   G+Q   +Y   D+  L L
Sbjct  195  RAQQHMSLMPGSS-DYELVQPQPFDARNYLQVN---GLQPNNNYSRQDQTPLQL  244



>gb|AGC31682.1| MADS-box transcription factor [Allium cepa]
Length=230

 Score =   274 bits (701),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 178/229 (78%), Gaps = 5/229 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICT-PQELNAQFYQQESKKLRQQIHMLQNSN-RHLVGEGLGS  545
            ++K TI+RYKKA++D SN  T   E+N+Q+YQQE+ KLRQQI  LQNSN R+L+GE L S
Sbjct  61   SVKQTIERYKKASTDTSNTGTHVSEVNSQYYQQEAMKLRQQIASLQNSNRRNLLGESLSS  120

Query  544  SNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-  368
             N +ELKQLE+RLE+GISKIR+KK++L+ AE E +QKRE+ L+ +N +LR KIAENE   
Sbjct  121  MNHKELKQLETRLEKGISKIRAKKNELLFAEIEYMQKREMELQNDNMYLRNKIAENESRA  180

Query  367  -QQLSMMPGAG-QEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             QQ++++P A   EY  +  Y +RN +  N+M+     Y    +  L L
Sbjct  181  QQQMNVLPTASTSEYETMTQYDSRNYMHTNLMDTSNGHYGSQQQTALQL  229



>gb|ACI23561.1| agamous-like protein 2 [Gossypium barbadense]
Length=244

 Score =   275 bits (702),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 182/232 (78%), Gaps = 10/232 (4%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  15   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  74

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD+SN  +  E+NAQFYQQE+ KLR QI  LQN+NRH++GE +G  
Sbjct  75   NSVKATIERYKKA-SDSSNTGSVAEVNAQFYQQEADKLRNQIRNLQNTNRHMLGESVGGL  133

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             ++ELK LESRLE+GIS+IRSKK++L+ AE E +QK+E+ L   N  LRAKIAENER QQ
Sbjct  134  PMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKKEIDLHNNNQLLRAKIAENERKQQ  193

Query  361  -LSMMP-GAGQEYHAI--QHYLARNMLQLNVMEGVQASYPVP----DKKTLH  230
             +++MP G+   + AI  Q Y +RN  Q++ ++   A+Y  P    D+  LH
Sbjct  194  SMNLMPGGSSNNFEAIHSQPYDSRNYFQVDTLQPA-ANYYNPQQQQDQIALH  244



>ref|XP_010230593.1| PREDICTED: MADS-box transcription factor 3 isoform X2 [Brachypodium 
distachyon]
Length=268

 Score =   275 bits (704),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 170/211 (81%), Gaps = 3/211 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRG+IEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEYSN
Sbjct  34   KMGRGRIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN  93

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD SN  T  E+NAQ YQQES KLRQQI  LQNSNR LV + + + 
Sbjct  94   NSVKATIERYKKANSDTSNSGTVAEVNAQHYQQESSKLRQQISSLQNSNRSLVKDSVSTM  153

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             +R+LKQLE RLE+GI+KIR++K++L+ AE E +QKRE+ L  +N +LR+K+AENER QQ
Sbjct  154  TLRDLKQLEGRLEKGIAKIRARKNELLYAEVEYMQKREMELHNDNMYLRSKVAENERGQQ  213

Query  361  -LSMMPGA--GQEYHAIQHYLARNMLQLNVM  278
             ++MM  A    EY  +  Y +RN LQ+N M
Sbjct  214  PMNMMAAASTSSEYDHMVQYDSRNFLQVNPM  244



>gb|AAD38119.1| AGAMOUS homolog [Liquidambar styraciflua]
Length=244

 Score =   275 bits (702),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 169/225 (75%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGR+YEY+NN
Sbjct  20   MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYANN  79

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA SD SN  +  E NAQFYQQES KLR+QI  +QN NRH++GE L S  
Sbjct  80   SVKSTIERYKKA-SDTSNPGSVSETNAQFYQQESSKLRRQIRDIQNLNRHIMGEALSSLT  138

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER-LQQ  362
             RELK LE RLE+GIS+IRSKK++L+ AE E +QKRE+ L+  N +LRAKIAENER  QQ
Sbjct  139  FRELKNLEGRLEKGISRIRSKKNELLFAEIEYMQKREIELQNANMYLRAKIAENERNQQQ  198

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
              +MPG+  E         R+ L  N++E     Y   D+  L L
Sbjct  199  TELMPGSVYETMPSSQPYDRSFLVANLLEPPNHHYSRQDQTPLQL  243



>ref|XP_008794138.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008794139.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Phoenix 
dactylifera]
Length=229

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 170/216 (79%), Gaps = 5/216 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL++FS+RGR+YEY+N+
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYAND  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++KGTI+RYKKA +D SN  +  E N Q+YQQES KLRQQI  LQNSNR+L+GE LGS N
Sbjct  61   SVKGTIERYKKACTDTSNSGSVSEANFQYYQQESSKLRQQITNLQNSNRNLMGESLGSMN  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAK-----IAENE  374
            +R+LKQLE RLE+GI+KIR+KK++L++AE E +QKRE+ L+  N +LR K     I ENE
Sbjct  121  LRDLKQLEGRLEKGINKIRTKKNELLLAEIEYMQKRELELQSANMYLRNKLMWKQITENE  180

Query  373  RLQQLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQ  266
            R QQ   M     EY  +  Y +RN L +N+M+  Q
Sbjct  181  RAQQQMNMLTPTTEYEVMPPYDSRNFLPMNLMQSNQ  216



>dbj|BAC66963.1| MADS-box transcription factor AG [Agapanthus praecox]
Length=235

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 174/226 (77%), Gaps = 3/226 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI+RYKKA +D+SN     E+N  Q+YQQE+ KLR QI  LQNSNRHL+G+ L S 
Sbjct  61   SIKSTIERYKKACADSSNSTAVVEVNTQQYYQQEAAKLRHQIQSLQNSNRHLMGDSLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +++ELKQLE+RLERGI++IRSKKH+L+ AE E +QKRE  L+ +N +LRAKI +NER  Q
Sbjct  121  SIKELKQLENRLERGITRIRSKKHELLFAEIEYMQKREAELQNDNMYLRAKITDNERAHQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNML-QLNVMEGVQASYPVPDKKTLHL  227
            +S++  +G EY  +  + +RN    + ++E         D   LHL
Sbjct  181  VSVVQ-SGTEYDTLPTFDSRNYYTHVTMLEAAPHFSHHQDHTALHL  225



>gb|ADU15476.1| AG [Actinidia arguta]
Length=239

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 178/227 (78%), Gaps = 5/227 (2%)
 Frame = -1

Query  895  GRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNNN  716
            GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN+
Sbjct  13   GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNS  72

Query  715  IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSNV  536
            +KGTI+RYKKA+S +SN  +  ELNAQFYQQE+ KLR QI+ LQ+SN H+ G+ L S ++
Sbjct  73   VKGTIERYKKASSGSSNTGSVSELNAQFYQQEAAKLRVQINNLQSSNSHMHGDSLSSMSL  132

Query  535  RELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQLS  356
            RELK LE RLERGIS+IRSKK++L+ AE E +QKRE +L Q    LRAKIAE ER+QQ++
Sbjct  133  RELKNLEGRLERGISRIRSKKNELLFAEIELMQKREAYLPQNTQCLRAKIAEGERVQQMN  192

Query  355  MMPGAGQEYHAIQHYLA---RNMLQLNV-MEGVQASYPVPDKKTLHL  227
            +MP AG +Y  +Q   +   RN LQ++  ++    SY   D+  L L
Sbjct  193  LMP-AGSDYELMQQPPSLDTRNYLQVDGRLQSDHNSYSRQDQTVLQL  238



>gb|ACY26070.1| MADS-box transcription factor 3 [Oryza sativa]
Length=235

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 177/215 (82%), Gaps = 4/215 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K T++RYKKA SD SN  T  E+NAQ YQQES KLRQQI  LQN+NR +VG+ + + +
Sbjct  61   SVKSTVERYKKANSDTSNSGTVAEVNAQHYQQESSKLRQQISSLQNANRTIVGDSINTMS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
            +R+LKQ+E+RLE+GI+KIR++K++L+ AE E +QKREV L+ +N +LR+K+ ENER QQ 
Sbjct  121  LRDLKQVENRLEKGIAKIRARKNELLYAEVEYMQKREVELQNDNMYLRSKVVENERGQQP  180

Query  361  LSMMPGAG-QEY-HAIQH-YLARNMLQLNVMEGVQ  266
            L+MM  A   EY H + + Y +RN LQ+N+M+  Q
Sbjct  181  LNMMGAASTSEYDHMVNNPYDSRNFLQVNIMQQPQ  215



>gb|AHM92099.1| MADS-box protein 23 [Erycina pusilla]
Length=234

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 178/225 (79%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ LIV S+RGRVYEYSN+
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVGLIVISTRGRVYEYSNS  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI++YKK  +  SN     E+N+ Q+YQQES K+R QI +L NS+RHL+GEGL S 
Sbjct  61   SIKATIEKYKKHYASGSNSGALVEVNSQQYYQQESAKMRHQIQLLNNSSRHLMGEGLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            N++ELKQLE+RLERGI+++RSKKH+L+ AE E +QKREV L+ +N +LR KIAE+ER Q+
Sbjct  121  NLKELKQLENRLERGITRVRSKKHELLFAEIEYMQKREVELQNDNMYLRTKIAESERAQE  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +M+  AG ++ +++++ +RN   +N+ME         D+ +LHL
Sbjct  181  TNMVQ-AGVDFESLENFNSRNYYHVNIMETAPPYSHHQDQTSLHL  224



>dbj|BAM71400.1| transcription factor [Pyrus pyrifolia]
Length=242

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 165/217 (76%), Gaps = 2/217 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            +GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  16   LGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYANN  75

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA SD +N  +  E N QFYQQE+ KLR+QI  +QNSNRH++GE L + N
Sbjct  76   SVRATIDRYKKACSDPTNGGSVSEANTQFYQQEASKLRRQIREIQNSNRHILGEALSTLN  135

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENER--LQ  365
             +ELK LE RLE+GIS+IRSKK++++ +E E +QKRE  L+  N FLRAK+AENER   Q
Sbjct  136  TKELKNLEGRLEKGISRIRSKKNEMLFSEIEFMQKRETELQHHNNFLRAKMAENEREQQQ  195

Query  364  QLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYP  254
            Q  MMPG   +     H   RN L   ++E     YP
Sbjct  196  QTHMMPGTSYDQSMPSHSYDRNFLPAVILESNNNHYP  232



>gb|AHH28261.1| MADS-box transcription factor, partial [Rhizanthes lowii]
Length=225

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 176/225 (78%), Gaps = 3/225 (1%)
 Frame = -1

Query  895  GRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNNN  716
            GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN+
Sbjct  1    GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS  60

Query  715  IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSNV  536
            +K TIDRYKKA++D+SN  +  E NAQFYQQE+ KLR QI  LQNSNRH++GE L + ++
Sbjct  61   VKSTIDRYKKASADSSNSGSVSEANAQFYQQEAAKLRVQIGNLQNSNRHMLGESLDALSI  120

Query  535  RELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-L  359
            +ELK LE RLE+GIS+IRSKK++L+ AE E +Q+RE+ L   N  LRAKIAENER  Q +
Sbjct  121  KELKSLEIRLEKGISRIRSKKNELLFAEIEYMQRREIDLHNNNQLLRAKIAENERKHQNM  180

Query  358  SMMPGAGQ-EYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ++MPG G  E    Q + +RN  Q+N ++ +   Y   D+ +L L
Sbjct  181  NLMPGEGNYEIMQSQPFDSRNYFQVNALQPIN-HYHHQDQMSLQL  224



>gb|AIJ29176.1| AG-like MADS box protein [Oncidium hybrid cultivar]
Length=233

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 178/219 (81%), Gaps = 3/219 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEI+RIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL +FSSRGR+YEY+N
Sbjct  6    KMGRGKIEIRRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALAIFSSRGRLYEYAN  65

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++KGTIDRYKKA +D S+  +  E N+Q+YQQE+ KLRQQI  LQNSNR+L+G+ L + 
Sbjct  66   NSVKGTIDRYKKACTDNSSTGSISEANSQYYQQEATKLRQQIINLQNSNRNLLGDALTTM  125

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL--  368
            ++R+LKQLE+RLE+GI+KIRSKK++L+ +E + +QKRE+ L+ +N +LR KIA+NER+  
Sbjct  126  SLRDLKQLETRLEKGINKIRSKKNELLHSEIDYMQKREMELQTDNMYLRNKIADNERVRQ  185

Query  367  -QQLSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYP  254
             QQ+S++P    +Y  +  + +R+ LQ+N+++      P
Sbjct  186  HQQMSILPSTSTDYEVMTPFDSRSFLQVNLLDPSDHYSP  224



>ref|NP_001280918.1| agamous-like MADS-box protein AGL1 [Malus domestica]
 gb|AAQ03090.1| AGAMOUS-like protein [Malus domestica]
Length=242

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 165/217 (76%), Gaps = 2/217 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            +GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN
Sbjct  16   LGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYANN  75

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +++ TIDRYKKA +D +N  +  E N QFYQQE+ KLR+QI  +QNSNRH++GE L S N
Sbjct  76   SVRATIDRYKKAYADPTNSGSVSEANTQFYQQEASKLRRQIREIQNSNRHILGEALSSLN  135

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
             +ELK LE RLE+GIS+IRSKK++++ +E E +QKRE  L+  N FLRAKIAENER +Q 
Sbjct  136  AKELKNLEGRLEKGISRIRSKKNEMLFSEIEFMQKRETELQHHNNFLRAKIAENEREEQQ  195

Query  361  -LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYP  254
               MMPG   +     H   RN L   ++E     YP
Sbjct  196  HTHMMPGTSYDQSMPSHSYDRNFLPAVILESNNNHYP  232



>gb|ADP06386.1| AGAMOUS-LIKE2 [Capsicum annuum]
Length=247

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 177/234 (76%), Gaps = 12/234 (5%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  16   KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  75

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD+SN  +  E NAQ+YQQES KLR QI  LQN NR+ +GE L + 
Sbjct  76   NSVKATIERYKKACSDSSNTGSISEANAQYYQQESSKLRAQIGNLQNQNRNYMGEALAAL  135

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL--  368
            N REL+ LE ++E+GISK+RSKK++++ AE E +QKREV L   N +LRAKIAE ER   
Sbjct  136  NHRELRNLEQKIEKGISKVRSKKNEMLFAEIEYMQKREVDLHNNNQYLRAKIAETERAQQ  195

Query  367  --QQLSMMPGAGQEYHAI---QHYLARNMLQLNVMEGVQAS--YPVPDKKTLHL  227
              QQ+++MPG+   Y  +   Q +  RN LQ+N   G+Q +  YP  D+  L L
Sbjct  196  HQQQMNLMPGSSSSYELVPPPQQFDTRNYLQVN---GLQTNNHYPRQDQPPLQL  246



>gb|AAB25101.1| promotes sex organ development [Antirrhinum majus]
 dbj|BAI68391.1| PLENA protein [Antirrhinum majus]
Length=239

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 174/224 (78%), Gaps = 1/224 (0%)
 Frame = -1

Query  895  GRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNNN  716
            GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEY+NN+
Sbjct  15   GRGKIEIKRIENITNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYANNS  74

Query  715  IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSNV  536
            ++ TI+RYKKA++D+SN  +  E N QFYQQE+ KLR+QI  +Q SNR ++GEG+ +  +
Sbjct  75   VRATIERYKKASADSSNSVSTSEANTQFYQQEANKLRRQIREIQTSNRQMLGEGVSNMAL  134

Query  535  RELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL-QQL  359
            ++LK  E+++E+ IS+IRSKK++L+ AE E++QKRE+ L   N FLRAKIAE ER  QQ+
Sbjct  135  KDLKSTEAKVEKAISRIRSKKNELLFAEIEHMQKRELELHNANMFLRAKIAEGERAQQQM  194

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ++MPG+  +    Q Y  RN L +N+ME  Q  Y   D+  L L
Sbjct  195  NLMPGSDYQPMTSQSYDVRNFLPMNLMEPNQQQYSRHDQTALQL  238



>gb|AEU08497.1| MADS1 [Corylus heterophylla]
Length=241

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 174/227 (77%), Gaps = 3/227 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGR+YEY+N
Sbjct  15   KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYAN  74

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA +D+SN  +  E N QFYQQE+ KLR QI  +Q+SNRH++GE L   
Sbjct  75   NSVKTTIERYKKACADSSNSGSVSEANTQFYQQEAAKLRGQIRSVQDSNRHMLGEALSEL  134

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            N +ELK LE  LE+GI++IRSKK++L+ AE E +QKREV L   N FLRAKIAENER QQ
Sbjct  135  NFKELKSLEKNLEKGINRIRSKKNELLFAEIEYMQKREVDLHNNNQFLRAKIAENERNQQ  194

Query  361  -LSMMPGAGQ-EYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             L++MPG G  E    Q + +RN  Q++ ++     YP  D+  L L
Sbjct  195  NLNVMPGGGNYELMQSQSFDSRNYFQVDALQP-NHHYPRQDQMALQL  240



>dbj|BAB79434.1| PMADS3 [Petunia x hybrida]
Length=242

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 178/230 (77%), Gaps = 9/230 (4%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  16   KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  75

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD+SN  +  E NAQ+YQQE+ KLR QI   QN NR+ +GE L + 
Sbjct  76   NSVKATIERYKKACSDSSNTGSIAEANAQYYQQEASKLRAQIGNXQNQNRNFLGESLAAL  135

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            N+R+L+ LE ++E+GISKIR+KK++L+ AE E +QKRE+ L   N +LRAKIAE ER QQ
Sbjct  136  NLRDLRNLEQKIEKGISKIRAKKNELLFAEIEYMQKREIDLHNNNQYLRAKIAETERSQQ  195

Query  361  LSMMPGAGQEYHAI---QHYLARNMLQLNVMEGVQAS--YPVPDKKTLHL  227
            +++MPG+   Y  +   Q + ARN LQ+N   G+Q +  YP  D+  L L
Sbjct  196  MNLMPGSS-SYDLVPPQQSFDARNYLQVN---GLQTNNHYPRQDQPPLQL  241



>gb|EYU28136.1| hypothetical protein MIMGU_mgv1a012605mg [Erythranthe guttata]
Length=244

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 175/227 (77%), Gaps = 5/227 (2%)
 Frame = -1

Query  895  GRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNNN  716
            GRGKI IKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN+
Sbjct  18   GRGKIAIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNS  77

Query  715  IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSNV  536
            +K TI+RYKKA+SD+ N  +  E N QFYQQE+ KLR QI+ LQN NR+++GE LG  N+
Sbjct  78   VKATIERYKKASSDSPNNGSISEANTQFYQQEASKLRAQINNLQNQNRNMLGESLGGLNL  137

Query  535  RELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ--  362
            R+LK LES++ERGIS+IRSKK++L+ AE E +QKRE+ L   N +LRAKIAE ER  Q  
Sbjct  138  RDLKNLESKVERGISRIRSKKNELLFAEIEYMQKREIELHHNNQYLRAKIAETERAHQQN  197

Query  361  LSMMPGAGQEYHAI--QHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +++MPG+   ++ +  Q + ARN LQ+N ++     Y V D   L L
Sbjct  198  MNLMPGSS-SFNLVQPQPFDARNYLQINGLQSNDHDYTVQDHPPLQL  243



>gb|ABR68012.1| C-class floral identity [Carica papaya]
Length=228

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 173/228 (76%), Gaps = 5/228 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            M RGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  1    MARGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA SDA+N  +  E N QFYQQE+ KLR+QI  +QNSNRH++GE LGS  
Sbjct  61   SVKATIERYKKACSDATNPGSVTEANTQFYQQEATKLRRQIREIQNSNRHILGEALGSLT  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL---  368
             +ELK LE RLE+GIS+IRSKK++L+ AE E +QKRE+ L+ +N +LRAKIAENER+   
Sbjct  121  FKELKNLEGRLEKGISRIRSKKNELLFAEIEYMQKREIELQNDNMYLRAKIAENERVQEQ  180

Query  367  QQLSMMPGAGQEYHAIQ-HYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            QQ ++M G+  E    Q     RN L +N++E     Y   D   L L
Sbjct  181  QQSNLMQGSVYESMPSQSQTYNRNFLPVNLLEP-NHQYSADDHTALQL  227



>gb|KHG12869.1| Floral homeotic AGAMOUS -like protein [Gossypium arboreum]
 gb|KHG29394.1| Floral homeotic AGAMOUS -like protein [Gossypium arboreum]
Length=246

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 175/219 (80%), Gaps = 5/219 (2%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+N
Sbjct  15   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYAN  74

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD+SN  +  E+NAQFYQQE+ KLR QI  LQN+NRH++GE +G  
Sbjct  75   NSVKATIERYKKA-SDSSNTGSVAEVNAQFYQQEADKLRNQIRNLQNANRHMLGESIGGL  133

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             ++ELK LESRLE+GIS+IRSKK++L+ AE E +QKRE+ L   N  LRAKIAENER QQ
Sbjct  134  PMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAENERKQQ  193

Query  361  -LSMMP-GAGQEYHAI--QHYLARNMLQLNVMEGVQASY  257
             +++MP G+   + A+  Q Y +RN  Q++ ++     Y
Sbjct  194  SMNLMPGGSSANFEALHSQPYDSRNYFQVDALQPATNYY  232



>ref|XP_007025251.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 ref|XP_007025252.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 ref|XP_007025253.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|ABA39727.1| AGAMOUS-like protein [Theobroma cacao]
 gb|EOY27873.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|EOY27874.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|EOY27875.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
Length=241

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 175/227 (77%), Gaps = 3/227 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  15   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  74

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKK  +D+SN  +  E NAQFYQQE+ KLR QI  LQNSNRH++GE L + 
Sbjct  75   NSVKATIERYKKTCADSSNTGSVSEANAQFYQQEAAKLRVQIGNLQNSNRHMLGESLSAL  134

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             +++L+ LE+RLE+GIS+IRSKK++L+ AE E +QKRE+ L   N  LRAKIAENER QQ
Sbjct  135  PMKDLRSLENRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAENERKQQ  194

Query  361  -LSMMPGAGQ-EYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +++MPG    E    Q + +RN  Q+N ++     YP  D+  L L
Sbjct  195  NINLMPGGSNFEIMHSQPFDSRNYFQVNALQPAN-HYPHQDQMALQL  240



>emb|CAJ44130.1| farinelli protein [Misopates orontium]
Length=247

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 180/233 (77%), Gaps = 6/233 (3%)
 Frame = -1

Query  907  EGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEY  728
            E ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIAL+VFSSRGR+YEY
Sbjct  14   ERKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALVVFSSRGRLYEY  73

Query  727  SNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLG  548
            +NN++K TIDRYKKA+SD+S   +  E N Q+YQQE+ KLR QI  LQN NR+++GE LG
Sbjct  74   ANNSVKETIDRYKKASSDSSLNGSISEANTQYYQQEASKLRAQISNLQNQNRNMLGESLG  133

Query  547  SSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKR-EVHLEQENAFLRAKIAENER  371
            + ++RELK LESR+ERGIS+IRSKK++L+ AE E +QKR E+ L   N +LRAKIAE+ER
Sbjct  134  ALSLRELKNLESRVERGISRIRSKKNELLFAEIEYMQKRQEIDLHHNNQYLRAKIAESER  193

Query  370  L--QQLSMMPGAGQEYHAI---QHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +  Q +++MPG    +  +   Q + ARN LQ+N ++     YP  D+  L L
Sbjct  194  VQGQHMNLMPGGSSGFEQLVETQPFDARNYLQVNGLQQPNNDYPRQDQLPLQL  246



>dbj|BAH56656.1| MADS-box transcription factor [Triticum aestivum]
Length=273

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 173/213 (81%), Gaps = 5/213 (2%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRG+IEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSN
Sbjct  37   KMGRGRIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN  96

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSN-RHLVGEGLGS  545
            N++K TI+RYKKA SD SN  T  E+NAQ+YQQES KLRQQI  LQNSN R LV + + +
Sbjct  97   NSVKATIERYKKANSDTSNSGTVAEVNAQYYQQESSKLRQQISSLQNSNSRSLVRDSVST  156

Query  544  SNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQ  365
              +R+LKQLE RLE+GI+KIR++K++L+ AE E +QKRE+ L+ +N +LR+K++ENER Q
Sbjct  157  MTLRDLKQLEGRLEKGIAKIRARKNELMYAEVEYMQKREMELQNDNIYLRSKVSENERGQ  216

Query  364  Q-LSMMP--GAGQEY-HAIQHYLARNMLQLNVM  278
            Q ++MM    A  EY H +  Y +RN LQ N+M
Sbjct  217  QPVNMMASGSASSEYDHMVSPYDSRNFLQANIM  249



>gb|AEA11211.1| AGAMOUS-like protein [Jatropha curcas]
 gb|KDP21163.1| hypothetical protein JCGZ_21634 [Jatropha curcas]
Length=241

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 174/227 (77%), Gaps = 5/227 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN
Sbjct  16   MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  75

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA +D+SN  +  E NAQFYQQ++ KLR QI  LQ S R+++GE LG  N
Sbjct  76   SVKSTIERYKKACADSSNTGSVSEANAQFYQQQAAKLRDQISGLQKSIRNMLGESLGGIN  135

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
             ++L+ LESRLE+GIS+IRSKK++L+ AE E +QKRE+ L   N  LRAKIAENER QQ 
Sbjct  136  PKDLRGLESRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAENERKQQN  195

Query  361  LSMMPGAGQEYHAIQH--YLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +++MPG G  Y  IQ   +  RN  Q+N ++     YP  D+  L L
Sbjct  196  MNLMPGGG-NYEIIQSQPFDNRNYFQVNALQPTN-HYPQQDQMALQL  240



>gb|AHY82572.1| MADS-box protein 5 [Lilium formosanum]
Length=232

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 173/225 (77%), Gaps = 4/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRVYEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
             IK TIDRYKKA  D+SN  +  ++N+ Q++QQES KLR QI +L N+NRHLVGE L S 
Sbjct  61   GIKQTIDRYKKAC-DSSNSNSLIQVNSQQYFQQESAKLRHQIQILTNANRHLVGEALSSL  119

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             V+ELKQLE+RLERG+++IRSKKH+L+ AE E  QK EV L+ +N +LRAKIAENER Q 
Sbjct  120  TVKELKQLENRLERGLTRIRSKKHELLFAEIEFSQKGEVELQSDNMYLRAKIAENERTQ-  178

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             + +  A  E+ A+  + +RN  Q+N M      Y   D+  LHL
Sbjct  179  -AAIVQARAEFDALPTFDSRNFYQVNNMLEAPPHYLHQDQTALHL  222



>ref|XP_010930411.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Elaeis 
guineensis]
 ref|XP_010930412.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Elaeis 
guineensis]
Length=234

 Score =   272 bits (696),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 171/224 (76%), Gaps = 0/224 (0%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIALI+FS RGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIIFSGRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            +IK TI+RYK A +D+SN     ++N+Q+YQQES KLR QI  LQN+NRHL+G+ L S +
Sbjct  61   SIKSTIERYKNACADSSNSGAIIDVNSQYYQQESAKLRHQIQTLQNANRHLMGDALSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKKH+L+ +E E +Q+RE  L+ +N  LRAKIAENE+    
Sbjct  121  VKELKQLENRLERGITRIRSKKHELLFSEIEYMQRREAELQNDNMCLRAKIAENEQAALQ  180

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
              +   G ++ A+  + +RN   +N++E         D+  LHL
Sbjct  181  VSIAQEGPQFDALPAFDSRNYYHVNLLEAATHYSHQQDQTALHL  224



>ref|XP_010687172.1| PREDICTED: floral homeotic protein AGAMOUS isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=252

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 178/230 (77%), Gaps = 7/230 (3%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  24   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  83

Query  721  NN--IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLG  548
            ++  +KGTIDRYKKA SD S   +  E NAQ+YQQE+ KLR QI     +NRH++GEGL 
Sbjct  84   HSCSVKGTIDRYKKACSDQSGAGSVAEANAQYYQQEAAKLRNQIRTATENNRHMMGEGLS  143

Query  547  SSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL  368
            S +++ELK LE++LERGIS+IRSKK++L+ AE E +QKRE+ L   N FLRA+I+ENER 
Sbjct  144  SLSMKELKNLETKLERGISRIRSKKNELLFAEIEFMQKREIELHNNNQFLRARISENERA  203

Query  367  QQ-LSMMPGAGQEYHAI--QHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            QQ +S+MPG G +Y  +  Q + +RN  Q+N ++   + Y   D+  L L
Sbjct  204  QQSMSLMPG-GSDYDLVPSQSFDSRNYFQVNALQ-PSSQYARQDQTPLQL  251



>ref|XP_011085307.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Sesamum 
indicum]
Length=244

 Score =   272 bits (696),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 180/235 (77%), Gaps = 7/235 (3%)
 Frame = -1

Query  916  LGVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRV  737
            +  E + GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+
Sbjct  11   MSSERKTGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  70

Query  736  YEYSNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGE  557
            YEY+NN++K TI+RYKKATSD+ N  +  E N Q+YQQE+ KLR QI  LQN N++++GE
Sbjct  71   YEYANNSVKATIERYKKATSDSPNSGSVSEANTQYYQQEASKLRAQISNLQNQNKNMLGE  130

Query  556  GLGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKR-EVHLEQENAFLRAKIAE  380
             LG+  +RELK LE+R+ERGISKIRSKK++L+ AE E +QKR E+ L   N FLRAKIAE
Sbjct  131  SLGALTLRELKNLETRVERGISKIRSKKNELLYAEIEYMQKRQEIDLHHNNHFLRAKIAE  190

Query  379  NERLQQ-LSMMPGAGQEYHAI---QHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             ER QQ +S+MPG   EYH +   Q + +R+ LQ++ ++     YP  D+  L L
Sbjct  191  TERGQQHMSLMPG-NSEYHELVQSQPFDSRDYLQVSGLQ-THNGYPRQDQPPLQL  243



>gb|AEZ51869.1| MADS-box protein 3 [Cymbidium ensifolium]
Length=234

 Score =   272 bits (695),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFS+RGR+YEYSN+
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSNS  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +I  TI++YKK ++  SN  +  E+N+ Q+YQQES K+  QI +LQNS+RHL+GEGL S 
Sbjct  61   SITATIEKYKKTSAGGSNSGSLMEVNSQQYYQQESAKMSHQIQILQNSSRHLMGEGLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            N++ELKQLE+RLERGI+++RSKKH+L+ AE E +QKREV L+ +N +LRAK+AE+ER QQ
Sbjct  121  NLKELKQLENRLERGITRVRSKKHELLFAEIEYMQKREVELQNDNMYLRAKLAESERAQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +++  AG ++  +  + +RN   +N++E         D+ +LHL
Sbjct  181  ANIVQ-AGIDFETLPTFDSRNYYHINMLENEPPYSHHQDQTSLHL  224



>gb|ACF93432.1| MADS10 [Gossypium hirsutum]
Length=246

 Score =   272 bits (696),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 175/219 (80%), Gaps = 5/219 (2%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEY+N
Sbjct  15   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYAN  74

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD+SN  +  E+NA+FYQQE+ KLR QI  LQN+NRH++GE +G  
Sbjct  75   NSVKATIERYKKA-SDSSNTGSVAEVNARFYQQEADKLRNQIRNLQNANRHMLGESIGGL  133

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             ++ELK LESRLE+GIS+IRSKK++L+ AE E +QKRE+ L   N  LRAKIAENER QQ
Sbjct  134  PMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAENERKQQ  193

Query  361  -LSMMP-GAGQEYHAI--QHYLARNMLQLNVMEGVQASY  257
             +++MP G+   + A+  Q Y +RN  Q++ ++     Y
Sbjct  194  SMNLMPGGSSANFEALHSQPYDSRNYFQVDALQPATNYY  232



>gb|AAL92522.1| AG-like protein [Gossypium hirsutum]
Length=244

 Score =   272 bits (696),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 174/219 (79%), Gaps = 5/219 (2%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+ FSSRGR+YEY+N
Sbjct  15   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVAFSSRGRLYEYAN  74

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD+SN  +  E+NAQFYQQE+ KLR QI  LQN+NRH++GE +G  
Sbjct  75   NSVKATIERYKKA-SDSSNTGSVAEVNAQFYQQEADKLRNQIRNLQNANRHMLGESIGGL  133

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             ++ELK LESRLE+GIS+IRSKK++L+ AE E +QKRE+ L   N  LRAKIAENER QQ
Sbjct  134  PMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAENERKQQ  193

Query  361  -LSMMP-GAGQEYHAI--QHYLARNMLQLNVMEGVQASY  257
             +++MP G+   + A+  Q Y +RN  Q++ ++     Y
Sbjct  194  SMNLMPGGSSANFEALHSQPYDSRNYFQVDALQPATNYY  232



>ref|XP_011085308.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Sesamum 
indicum]
Length=244

 Score =   272 bits (696),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 180/235 (77%), Gaps = 7/235 (3%)
 Frame = -1

Query  916  LGVEGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRV  737
            +  E + GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+
Sbjct  11   MSSERKTGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  70

Query  736  YEYSNNN-IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVG  560
            YEY+NN+ +K TI+RYKKATSD+ N  +  E N Q+YQQE+ KLR QI  LQN N++++G
Sbjct  71   YEYANNSSVKATIERYKKATSDSPNSGSVSEANTQYYQQEASKLRAQISNLQNQNKNMLG  130

Query  559  EGLGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAE  380
            E LG+  +RELK LE+R+ERGISKIRSKK++L+ AE E +QKRE+ L   N FLRAKIAE
Sbjct  131  ESLGALTLRELKNLETRVERGISKIRSKKNELLYAEIEYMQKREIDLHHNNHFLRAKIAE  190

Query  379  NERLQQ-LSMMPGAGQEYHAI---QHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             ER QQ +S+MPG   EYH +   Q + +R+ LQ++ ++     YP  D+  L L
Sbjct  191  TERGQQHMSLMPG-NSEYHELVQSQPFDSRDYLQVSGLQ-THNGYPRQDQPPLQL  243



>ref|NP_001266181.1| floral homeotic protein AGAMOUS [Solanum lycopersicum]
 sp|Q40168.1|AG_SOLLC RecName: Full=Floral homeotic protein AGAMOUS; AltName: Full=TAG1 
[Solanum lycopersicum]
 gb|AAA34197.1| TAG1 [Solanum lycopersicum]
Length=248

 Score =   272 bits (696),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 177/235 (75%), Gaps = 13/235 (6%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFS+RGR+YEY+N
Sbjct  16   KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSNRGRLYEYAN  75

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD+SN  +  E NAQ+YQQE+ KLR QI  L N NR+++GE L   
Sbjct  76   NSVKATIERYKKACSDSSNTGSVSEANAQYYQQEASKLRAQIGNLMNQNRNMMGEALAGM  135

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL--  368
             ++ELK LE R+E+GISKIRSKK++L+ AE E +QKREV L   N +LRAKIAE ER   
Sbjct  136  KLKELKNLEQRIEKGISKIRSKKNELLFAEIEYMQKREVDLHNNNQYLRAKIAETERAQH  195

Query  367  --QQLSMMPGAGQEYHAI----QHYLARNMLQLNVMEGVQAS--YPVPDKKTLHL  227
              QQ+++MPG+   YH +    Q +  RN LQ+N   G+Q +  YP  D+  + L
Sbjct  196  QHQQMNLMPGSSSNYHELVPPPQQFDTRNYLQVN---GLQTNNHYPRQDQPPIQL  247



>ref|XP_007025250.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
 gb|EOY27872.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
Length=294

 Score =   274 bits (700),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 175/227 (77%), Gaps = 3/227 (1%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  68   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  127

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKK  +D+SN  +  E NAQFYQQE+ KLR QI  LQNSNRH++GE L + 
Sbjct  128  NSVKATIERYKKTCADSSNTGSVSEANAQFYQQEAAKLRVQIGNLQNSNRHMLGESLSAL  187

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
             +++L+ LE+RLE+GIS+IRSKK++L+ AE E +QKRE+ L   N  LRAKIAENER QQ
Sbjct  188  PMKDLRSLENRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAENERKQQ  247

Query  361  -LSMMPGAGQ-EYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +++MPG    E    Q + +RN  Q+N ++     YP  D+  L L
Sbjct  248  NINLMPGGSNFEIMHSQPFDSRNYFQVNALQPAN-HYPHQDQMALQL  293



>ref|XP_010687170.1| PREDICTED: floral homeotic protein AGAMOUS isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=254

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 178/232 (77%), Gaps = 9/232 (4%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  24   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  83

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSN----RHLVGEG  554
            +++KGTIDRYKKA SD S   +  E NAQ+YQQE+ KLR QI     +N    RH++GEG
Sbjct  84   HSVKGTIDRYKKACSDQSGAGSVAEANAQYYQQEAAKLRNQIRTATENNRLLSRHMMGEG  143

Query  553  LGSSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENE  374
            L S +++ELK LE++LERGIS+IRSKK++L+ AE E +QKRE+ L   N FLRA+I+ENE
Sbjct  144  LSSLSMKELKNLETKLERGISRIRSKKNELLFAEIEFMQKREIELHNNNQFLRARISENE  203

Query  373  RLQQ-LSMMPGAGQEYHAI--QHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            R QQ +S+MPG G +Y  +  Q + +RN  Q+N ++   + Y   D+  L L
Sbjct  204  RAQQSMSLMPG-GSDYDLVPSQSFDSRNYFQVNALQ-PSSQYARQDQTPLQL  253



>gb|AAY25575.1| AG [Illicium floridanum]
Length=216

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 174/217 (80%), Gaps = 3/217 (1%)
 Frame = -1

Query  874  KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNNNIKGTIDR  695
            KRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY+NN++KGTI+R
Sbjct  1    KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNSVKGTIER  60

Query  694  YKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSNVRELKQLE  515
            YKKA +D SN     E N+Q+YQQES KLR+QI +LQ +NRHL+G+G+ S +++ELKQLE
Sbjct  61   YKKACTDTSNSGCITEANSQYYQQESSKLREQIGILQKANRHLMGDGISSMSIKELKQLE  120

Query  514  SRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-LSMMPGAG  338
            +RLE+GI KIR+KK++L+ AE E +QKRE  L+++N +LRAKI ENER QQ ++M+PG  
Sbjct  121  NRLEKGIGKIRTKKNELLYAEIEYMQKRETDLQKDNMYLRAKITENERAQQHMNMLPGP-  179

Query  337  QEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             EY  +  + +RN LQ+N++E     Y   ++ TL L
Sbjct  180  -EYDMMPQFDSRNFLQVNLLEPSHHQYSHQEQTTLQL  215



>emb|CAC81071.1| MADS box transcription factor [Daucus carota subsp. sativus]
Length=255

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 182/236 (77%), Gaps = 9/236 (4%)
 Frame = -1

Query  907  EGEMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEY  728
            E + GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFS+RGR+YEY
Sbjct  15   ERKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEY  74

Query  727  SNNNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLG  548
            +NN+++GTI+RYKKA SD  N  T  E N Q+YQ+E+ +LRQQI  LQNSNRHL+GE LG
Sbjct  75   ANNSVRGTIERYKKANSDTPNTATVSEANTQYYQKEAARLRQQISNLQNSNRHLMGEALG  134

Query  547  SSNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERL  368
            +   +ELK LE++L+ G+S++RSKK++L+ AE E ++KRE+ L   N +LRAKI+ENER 
Sbjct  135  AVPAKELKGLETKLQNGLSRVRSKKNELLFAEIEFMRKREIDLHNNNQYLRAKISENERA  194

Query  367  -QQLSMMPGA---GQEYHAI----QHYLARNMLQLNVMEGVQASYPV-PDKKTLHL  227
             QQ+S+MPGA    ++Y  +    + + ARN LQ+N ++   A+Y    D +T H+
Sbjct  195  QQQMSLMPGASGSSEQYRDVGQPHESFDARNYLQVNGLQPNNANYSSHQDHQTQHV  250



>ref|XP_002305048.1| hypothetical protein POPTR_0004s06300g [Populus trichocarpa]
 gb|AAC06237.1| AGAMOUS homolog [Populus trichocarpa]
 gb|EEE85559.1| hypothetical protein POPTR_0004s06300g [Populus trichocarpa]
 gb|AFH66690.1| flowering locus C [Populus simonii x Populus nigra]
Length=241

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 179/227 (79%), Gaps = 5/227 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            +GRGK+EIKRIEN TNRQVTFCKRR+GLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSN+
Sbjct  16   LGRGKVEIKRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSND  75

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKA++D+SN  +  E NAQ+YQQE+ KLR QI  LQNSNRH++GE L S +
Sbjct  76   SVKSTIERYKKASADSSNTGSVSEANAQYYQQEAAKLRSQIGNLQNSNRHMLGEALSSLS  135

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
            V+ELK LE RLE+GIS+IRSKK++L+ AE E +QKREV L   N  LRAKI+ENER +Q 
Sbjct  136  VKELKSLEIRLEKGISRIRSKKNELLFAEIEYMQKREVDLHNNNQLLRAKISENERKRQS  195

Query  361  LSMMPGAGQEYHAIQH--YLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +++MPG G ++  +Q   Y +RN  Q+N ++   + Y   D+  L L
Sbjct  196  MNLMPG-GADFEIVQSQPYDSRNYSQVNGLQPA-SHYSHQDQMALQL  240



>ref|XP_010101273.1| Agamous-like MADS-box protein AGL11 [Morus notabilis]
 gb|EXB88208.1| Agamous-like MADS-box protein AGL11 [Morus notabilis]
Length=210

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 172/224 (77%), Gaps = 16/224 (7%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            NI+ TIDRYKKA SD+S+  +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S +
Sbjct  61   NIRSTIDRYKKANSDSSSASSIIEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSSLS  120

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQL  359
            V+ELKQLE+RLERGI++IRSKK              E+ LE EN  +R KI+E ERLQQ 
Sbjct  121  VKELKQLENRLERGITRIRSKK--------------EMELENENVCIRTKISEVERLQQA  166

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            +M+ G+  E  AIQ   +RN    N++EG   ++   DKK LHL
Sbjct  167  NMVSGS--ELTAIQALTSRNFFSPNLIEGPGPAFSHLDKKILHL  208



>gb|AHH28311.1| MADS-box transcription factor, partial [Clutia sp. DAV B80.252/F1980.8371]
Length=202

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = -1

Query  838  FCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNNNIKGTIDRYKKATSDASNIC  659
            FCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN+IK +IDRYKKA SD++N  
Sbjct  1    FCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNSIKSSIDRYKKACSDSTNTS  60

Query  658  TPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSNVRELKQLESRLERGISKIRS  479
            +  E+NAQ+YQQES KLRQQI MLQNSNRHL+G+ L S  V+ELKQ+E+RLERG+++IRS
Sbjct  61   SITEVNAQYYQQESAKLRQQIQMLQNSNRHLMGDSLSSLTVKELKQIENRLERGLTRIRS  120

Query  478  KKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQLSMMPGAGQEYHAIQHYLARN  299
            KKH+L++AE E LQKRE+ LE E+  LR KIAE ERLQQ +M+ GA  E +AIQ   +RN
Sbjct  121  KKHELLLAEIEYLQKREIELENESVCLRTKIAEIERLQQANMVTGA--ELNAIQALTSRN  178

Query  298  MLQLNVMEGVQASYPVPDKKTLHL  227
                ++M+G   S+P  DKK LHL
Sbjct  179  FFGPHIMDGGTYSHP-SDKKILHL  201



>gb|AIJ29175.1| STK-like MADS box protein [Oncidium hybrid cultivar]
Length=234

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 175/225 (78%), Gaps = 2/225 (1%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRGKIEIK+IEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ LIV S+RGRVYEYSN+
Sbjct  1    MGRGKIEIKKIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVGLIVISTRGRVYEYSNS  60

Query  718  NIKGTIDRYKKATSDASNICTPQELNA-QFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +IK TI++YKK  +  SN     E+N+ Q+YQQES K+R QI +L NS+RHL+GEGL S 
Sbjct  61   SIKATIEKYKKHYASGSNSGALVEVNSQQYYQQESAKMRHQIQLLNNSSRHLMGEGLSSL  120

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            N++ELKQLE+RLERGI+++RSKKH+L+ AE E +QKREV L+ +N +LR KIAE+ER QQ
Sbjct  121  NLKELKQLENRLERGITRVRSKKHELLFAEIEYMQKREVELQNDNMYLRTKIAESERAQQ  180

Query  361  LSMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +++  AG ++  +Q + +RN    N+ME         D+ +LHL
Sbjct  181  TNIVQ-AGVDFETLQTFNSRNYYHANIMETAPPYSHHQDQTSLHL  224



>gb|AGV40795.1| MADS-box transcription factor 12 [Pisum sativum]
Length=248

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 175/234 (75%), Gaps = 10/234 (4%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  15   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  74

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TI+RYKKA SD+S   +  E NAQFYQQE+ KLR QI  LQN+NR ++GE LGS 
Sbjct  75   NSVKATIERYKKACSDSSGTGSASEANAQFYQQEADKLRVQISNLQNNNRQMMGESLGSM  134

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            N +ELK LES+LE+GIS+IRSKK++L+ AE E +Q+RE+ L   N  LRAKIAE+ER   
Sbjct  135  NAKELKNLESKLEKGISRIRSKKNELLFAEIEYMQRREIDLHNNNQLLRAKIAESERNHH  194

Query  361  ----LSMMPGAGQEYHAI-----QHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
                LS++PG G  Y  +     Q Y +R   Q++ ++   + Y   D+ +L L
Sbjct  195  HNINLSVLPG-GTNYETMQSQTQQQYDSRGYFQVSGLQSSSSQYGRQDQMSLQL  247



>dbj|BAC97837.1| duplicated [Ipomoea nil]
 dbj|BAF36711.1| DUPLICATED protein [Ipomoea nil]
Length=247

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 178/233 (76%), Gaps = 10/233 (4%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+N
Sbjct  16   KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  75

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            N++K TIDRYKKA SD++N  +  E N QFYQQE+ KLRQQI  LQN NR+ +GEGLG  
Sbjct  76   NSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGF  135

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKR-EVHLEQENAFLRAKIAENER--  371
            N+R+LK LES++E+GISKIR+KK++L+ AE + +QKR E+ L   N +LRAKI E ER  
Sbjct  136  NLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAQ  195

Query  370  --LQQLSMMPGAGQEYHAI---QHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
               QQ+++MPG+   YH +   Q + ARN LQL+  +   +SY   D   L L
Sbjct  196  QQQQQMNLMPGSS-SYHELAPPQQFDARNYLQLDGFQST-SSYSKQDHLPLQL  246



>emb|CAM59076.1| MIKC-type MADS-box transcription factor WM29A [Triticum aestivum]
Length=273

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 173/213 (81%), Gaps = 5/213 (2%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRG+IEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSN
Sbjct  37   KMGRGRIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN  96

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSN-RHLVGEGLGS  545
            N++K TI+RYKKA SD S+  T  E+NAQ+YQQES KLRQQI  LQNSN R LV + + +
Sbjct  97   NSVKATIERYKKANSDTSSSGTVAEVNAQYYQQESSKLRQQISSLQNSNSRSLVRDSVST  156

Query  544  SNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQ  365
              +R+LKQLE RLE+GI+KIR++K++L+ AE E +QKRE+ L+ +N +LR+K++ENER Q
Sbjct  157  MTLRDLKQLEGRLEKGIAKIRARKNELMYAEVEYMQKREMELQNDNIYLRSKVSENERGQ  216

Query  364  Q-LSMMP--GAGQEY-HAIQHYLARNMLQLNVM  278
            Q ++MM    A  EY H +  Y +RN LQ N+M
Sbjct  217  QPVNMMASGSASSEYDHMVSPYDSRNFLQANIM  249



>ref|XP_011009675.1| PREDICTED: floral homeotic protein AGAMOUS-like [Populus euphratica]
 ref|XP_011009676.1| PREDICTED: floral homeotic protein AGAMOUS-like [Populus euphratica]
 ref|XP_011009678.1| PREDICTED: floral homeotic protein AGAMOUS-like [Populus euphratica]
Length=241

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 179/228 (79%), Gaps = 5/228 (2%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            ++GRGK+EIKRIEN TNRQVTFCKRR+GLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSN
Sbjct  15   KLGRGKVEIKRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN  74

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSS  542
            +++K TI+RYKKA++D+SN  +  E NAQ+YQQE+ KLR QI  LQNSNRH++GE L S 
Sbjct  75   DSVKSTIERYKKASADSSNTGSVSEANAQYYQQEAAKLRSQIGNLQNSNRHMLGEALSSL  134

Query  541  NVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ  362
            +V+ELK LE RLE+GIS+IRSKK++L+ AE E +QKREV L   N  LRAKI+ENER +Q
Sbjct  135  SVKELKSLEIRLEKGISRIRSKKNELLFAEIEYMQKREVDLHNNNQLLRAKISENERKRQ  194

Query  361  -LSMMPGAGQEYHAIQH--YLARNMLQLNVMEGVQASYPVPDKKTLHL  227
             +++MPG G ++  +Q   Y +RN  Q+N +    + Y   D+  L L
Sbjct  195  SMNLMPG-GADFEIVQSQPYDSRNYSQVNGLPPA-SHYSHQDQMALQL  240



>emb|CDP18724.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 175/224 (78%), Gaps = 2/224 (1%)
 Frame = -1

Query  895  GRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNNN  716
            GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEY+NN+
Sbjct  22   GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS  81

Query  715  IKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSNV  536
            ++GTI+RYKKA +D+SN  +  E NAQFYQQE+ KLR+ I  +QNSNRH++G+G+   N 
Sbjct  82   VRGTIERYKKACADSSNPGSVSEANAQFYQQEASKLRKHIREIQNSNRHILGDGVDGLNF  141

Query  535  RELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-L  359
            +ELK LE ++E+ I +IR++K++L+ AE E + KRE+ L+  N +LRAKIAENER QQ +
Sbjct  142  KELKNLEGKVEKAIGRIRTRKNELLFAEIELMHKREIELQNANTYLRAKIAENERAQQHM  201

Query  358  SMMPGAGQEYHAIQHYLARNMLQLNVMEGVQASYPVPDKKTLHL  227
            ++MPG+  +  A Q Y  RN L +N++E  Q  Y   D+  L L
Sbjct  202  NLMPGSEYQPLASQPYDVRNFLPVNLLEPDQ-HYSRQDQTALQL  244



>ref|NP_001288321.1| MADS-box transcription factor 58-like [Brachypodium distachyon]
 gb|AIG21827.1| MADS-box transcription factor 18 [Brachypodium distachyon]
Length=267

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 173/225 (77%), Gaps = 5/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRG+IEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  36   MGRGRIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  95

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKATSD SN  T  E+NAQ YQQES KLR QI  LQNSNR L+GE + + +
Sbjct  96   SVKATIERYKKATSDTSNTGTVAEINAQHYQQESAKLRHQITNLQNSNRTLIGESMATMS  155

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
             R+LKQLE RL++G+ KIR++K++L+ AE E +Q+RE+ L+ +N +LR+K+AENER QQ 
Sbjct  156  HRDLKQLEGRLDKGLGKIRARKNELLCAEIEYMQRREMELQNDNLYLRSKVAENERGQQQ  215

Query  361  -LSMMPGAG---QEYHAIQHYLARNMLQLNVMEGVQASYPVPDKK  239
             L+MM  A    Q    + H   RN LQ N+M+  Q      D+K
Sbjct  216  TLNMMGAASTSDQYEQNMIHCDPRNFLQFNIMQQPQYYQQQEDRK  260



>ref|XP_010230318.1| PREDICTED: MADS-box transcription factor 58-like isoform X2 [Brachypodium 
distachyon]
Length=265

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 173/225 (77%), Gaps = 5/225 (2%)
 Frame = -1

Query  898  MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSNN  719
            MGRG+IEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR+YEYSNN
Sbjct  34   MGRGRIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  93

Query  718  NIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSNRHLVGEGLGSSN  539
            ++K TI+RYKKATSD SN  T  E+NAQ YQQES KLR QI  LQNSNR L+GE + + +
Sbjct  94   SVKATIERYKKATSDTSNTGTVAEINAQHYQQESAKLRHQITNLQNSNRTLIGESMATMS  153

Query  538  VRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQQ-  362
             R+LKQLE RL++G+ KIR++K++L+ AE E +Q+RE+ L+ +N +LR+K+AENER QQ 
Sbjct  154  HRDLKQLEGRLDKGLGKIRARKNELLCAEIEYMQRREMELQNDNLYLRSKVAENERGQQQ  213

Query  361  -LSMMPGAG---QEYHAIQHYLARNMLQLNVMEGVQASYPVPDKK  239
             L+MM  A    Q    + H   RN LQ N+M+  Q      D+K
Sbjct  214  TLNMMGAASTSDQYEQNMIHCDPRNFLQFNIMQQPQYYQQQEDRK  258



>ref|NP_001289811.1| MADS-box transcription factor 3 [Brachypodium distachyon]
 ref|XP_010230591.1| PREDICTED: MADS-box transcription factor 3 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010230592.1| PREDICTED: MADS-box transcription factor 3 isoform X1 [Brachypodium 
distachyon]
 gb|AIG21823.1| MADS-box transcription factor 14 [Brachypodium distachyon]
Length=269

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 170/212 (80%), Gaps = 4/212 (2%)
 Frame = -1

Query  901  EMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN  722
            +MGRG+IEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VFSSRGR+YEYSN
Sbjct  34   KMGRGRIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN  93

Query  721  NNIKGTIDRYKKATSDASNICTPQELNAQFYQQESKKLRQQIHMLQNSN-RHLVGEGLGS  545
            N++K TI+RYKKA SD SN  T  E+NAQ YQQES KLRQQI  LQNSN R LV + + +
Sbjct  94   NSVKATIERYKKANSDTSNSGTVAEVNAQHYQQESSKLRQQISSLQNSNSRSLVKDSVST  153

Query  544  SNVRELKQLESRLERGISKIRSKKHDLIIAETENLQKREVHLEQENAFLRAKIAENERLQ  365
              +R+LKQLE RLE+GI+KIR++K++L+ AE E +QKRE+ L  +N +LR+K+AENER Q
Sbjct  154  MTLRDLKQLEGRLEKGIAKIRARKNELLYAEVEYMQKREMELHNDNMYLRSKVAENERGQ  213

Query  364  Q-LSMMPGA--GQEYHAIQHYLARNMLQLNVM  278
            Q ++MM  A    EY  +  Y +RN LQ+N M
Sbjct  214  QPMNMMAAASTSSEYDHMVQYDSRNFLQVNPM  245



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2725021258018