BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c90857_g1_i1 len=888 path=[1:0-887]

Length=888
                                                                      Score     E

emb|CDO98011.1|  unnamed protein product                                309   4e-102   
ref|XP_011080698.1|  PREDICTED: nicotinamidase-like                     306   7e-101   
ref|XP_004235684.1|  PREDICTED: uncharacterized protein LOC101267390    305   2e-100   
ref|XP_009759230.1|  PREDICTED: uncharacterized protein LOC104211...    304   4e-100   
ref|XP_006343089.1|  PREDICTED: uncharacterized protein LOC102594407    303   6e-100   
ref|XP_009628047.1|  PREDICTED: uncharacterized protein LOC104118...    301   5e-99    
ref|XP_002304210.2|  isochorismatase hydrolase family protein           299   3e-98    Populus trichocarpa [western balsam poplar]
ref|XP_011013250.1|  PREDICTED: uncharacterized protein LOC105117...    296   6e-97    
gb|EYU24707.1|  hypothetical protein MIMGU_mgv1a014082mg                292   1e-95    
gb|KDP37261.1|  hypothetical protein JCGZ_06317                         291   3e-95    
ref|XP_010249652.1|  PREDICTED: nicotinamidase isoform X1               288   7e-94    
gb|AEC10981.1|  isochorismatase hydrolase family protein                283   4e-92    
ref|XP_004506892.1|  PREDICTED: peroxyureidoacrylate/ureidoacryla...    281   2e-91    
gb|KHN04223.1|  Peroxyureidoacrylate/ureidoacrylate amidohydrolas...    281   4e-90    
gb|ACJ85352.1|  unknown                                                 278   7e-90    Medicago truncatula
ref|XP_006857450.1|  hypothetical protein AMTR_s00067p00177560          276   1e-89    
ref|XP_010033854.1|  PREDICTED: uncharacterized protein LOC104423...    276   3e-89    
ref|XP_010915868.1|  PREDICTED: uncharacterized protein LOC105040...    275   7e-89    
ref|XP_007215992.1|  hypothetical protein PRUPE_ppa011798mg             274   2e-88    
ref|XP_010033855.1|  PREDICTED: uncharacterized protein LOC104423...    274   2e-88    
ref|XP_009775692.1|  PREDICTED: uncharacterized protein LOC104225565    273   3e-88    
ref|XP_009593687.1|  PREDICTED: uncharacterized protein LOC104090325    272   9e-88    
ref|XP_009759231.1|  PREDICTED: uncharacterized protein LOC104211...    272   9e-88    
ref|XP_011080713.1|  PREDICTED: uncharacterized protein LOC105163888    271   1e-87    
ref|XP_008228484.1|  PREDICTED: uncharacterized protein LOC103327891    271   2e-87    
ref|XP_006406865.1|  hypothetical protein EUTSA_v10021560mg             271   3e-87    
ref|XP_002284348.1|  PREDICTED: uncharacterized protein LOC100242883    270   5e-87    Vitis vinifera
ref|NP_001236656.1|  uncharacterized protein LOC100527482               272   9e-87    
emb|CBI36112.3|  unnamed protein product                                272   9e-87    
ref|XP_008783254.1|  PREDICTED: uncharacterized protein LOC103702...    270   1e-86    
ref|XP_009628048.1|  PREDICTED: uncharacterized protein LOC104118...    269   2e-86    
ref|XP_006465637.1|  PREDICTED: uncharacterized protein LOC102620945    269   2e-86    
ref|XP_010545692.1|  PREDICTED: uncharacterized protein LOC104817977    268   3e-86    
ref|XP_006426933.1|  hypothetical protein CICLE_v10026541mg             268   5e-86    
ref|XP_006359482.1|  PREDICTED: uncharacterized protein LOC102601317    268   6e-86    
ref|XP_008380905.1|  PREDICTED: uncharacterized protein LOC103443787    268   6e-86    
ref|XP_007135662.1|  hypothetical protein PHAVU_010G147700g             270   6e-86    
ref|NP_001235163.1|  uncharacterized protein LOC100499982               267   8e-86    
ref|XP_009353589.1|  PREDICTED: uncharacterized protein LOC103944...    266   2e-85    
ref|XP_007024219.1|  Isochorismatase family protein isoform 1           266   3e-85    
gb|KFK38971.1|  hypothetical protein AALP_AA3G183400                    266   3e-85    
ref|NP_566539.1|  Isochorismatase family protein                        265   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691375.1|  PREDICTED: uncharacterized protein LOC104904714    264   2e-84    
ref|XP_010915865.1|  PREDICTED: uncharacterized protein LOC105040846    265   9e-84    
ref|XP_008783250.1|  PREDICTED: uncharacterized protein LOC103702553    265   1e-83    
ref|XP_002284352.1|  PREDICTED: uncharacterized protein LOC100265171    261   3e-83    Vitis vinifera
ref|XP_006465738.1|  PREDICTED: uncharacterized protein LOC102624440    259   9e-83    
ref|XP_010503927.1|  PREDICTED: uncharacterized protein LOC104781...    259   1e-82    
ref|XP_011013249.1|  PREDICTED: uncharacterized protein LOC105117...    259   2e-82    
ref|XP_010465631.1|  PREDICTED: uncharacterized protein LOC104745947    258   2e-82    
ref|XP_002885128.1|  predicted protein                                  257   7e-82    
emb|CBI36111.3|  unnamed protein product                                259   7e-82    
gb|KFK38973.1|  hypothetical protein AALP_AA3G183500                    257   8e-82    
ref|XP_010249653.1|  PREDICTED: nicotinamidase isoform X2               256   9e-82    
ref|XP_009380566.1|  PREDICTED: uncharacterized protein LOC103968930    256   1e-81    
ref|XP_006465737.1|  PREDICTED: uncharacterized protein LOC102624158    254   1e-80    
ref|XP_006298602.1|  hypothetical protein CARUB_v10014686mg             253   2e-80    
gb|EPS67306.1|  hypothetical protein M569_07469                         254   3e-80    
ref|XP_010487470.1|  PREDICTED: LOW QUALITY PROTEIN: nicotinamida...    253   3e-80    
gb|EYU24708.1|  hypothetical protein MIMGU_mgv1a015045mg                252   4e-80    
ref|XP_004302886.1|  PREDICTED: peroxyureidoacrylate/ureidoacryla...    251   2e-79    
ref|XP_003571198.1|  PREDICTED: uncharacterized protein LOC100846...    253   2e-79    
gb|AFK39682.1|  unknown                                                 249   4e-79    
ref|XP_009146161.1|  PREDICTED: uncharacterized protein LOC103869846    249   9e-79    
ref|XP_007135663.1|  hypothetical protein PHAVU_010G147800g             248   4e-78    
ref|XP_010098097.1|  Peroxyureidoacrylate/ureidoacrylate amidohyd...    246   9e-78    
emb|CDX97729.1|  BnaA05g23500D                                          246   1e-77    
ref|XP_002516006.1|  catalytic, putative                                244   2e-76    Ricinus communis
dbj|BAD21815.1|  isochorismatase hydrolase-like                         244   5e-76    Oryza sativa Japonica Group [Japonica rice]
gb|KEH28721.1|  isochorismatase hydrolase family protein                241   5e-76    
ref|NP_001046544.1|  Os02g0276400                                       243   5e-76    Oryza sativa Japonica Group [Japonica rice]
gb|ACJ83333.1|  unknown                                                 240   3e-75    Medicago truncatula
ref|XP_006406866.1|  hypothetical protein EUTSA_v10021560mg             238   6e-75    
ref|XP_010915869.1|  PREDICTED: uncharacterized protein LOC105040...    238   1e-74    
gb|KDO56949.1|  hypothetical protein CISIN_1g030598mg                   238   2e-74    
ref|XP_007024221.1|  Isochorismatase family protein isoform 3           237   2e-74    
ref|XP_004141764.1|  PREDICTED: peroxyureidoacrylate/ureidoacryla...    238   3e-74    
gb|EEE56729.1|  hypothetical protein OsJ_06234                          237   6e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008465520.1|  PREDICTED: uncharacterized protein LOC103503139    236   1e-73    
emb|CDY30142.1|  BnaC05g37200D                                          236   2e-73    
ref|XP_004952218.1|  PREDICTED: uncharacterized protein LOC101763822    235   2e-73    
ref|XP_008783256.1|  PREDICTED: uncharacterized protein LOC103702...    233   8e-73    
ref|XP_002453690.1|  hypothetical protein SORBIDRAFT_04g010640          233   1e-72    Sorghum bicolor [broomcorn]
ref|XP_008783258.1|  PREDICTED: uncharacterized protein LOC103702...    233   1e-72    
ref|XP_006648538.1|  PREDICTED: uncharacterized protein LOC102711781    235   2e-72    
ref|XP_009353592.1|  PREDICTED: uncharacterized protein LOC103944...    231   3e-72    
ref|NP_001148649.1|  LOC100282265                                       232   3e-72    Zea mays [maize]
ref|XP_009353591.1|  PREDICTED: uncharacterized protein LOC103944...    231   6e-72    
ref|XP_009353587.1|  PREDICTED: uncharacterized protein LOC103944...    232   7e-72    
gb|AFW70916.1|  isochorismatase family protein rutB                     233   8e-72    
gb|KDO56948.1|  hypothetical protein CISIN_1g045208mg                   231   9e-72    
ref|XP_002453691.1|  hypothetical protein SORBIDRAFT_04g010650          230   3e-71    Sorghum bicolor [broomcorn]
gb|KFK38970.1|  hypothetical protein AALP_AA3G183400                    229   3e-71    
ref|XP_009353588.1|  PREDICTED: uncharacterized protein LOC103944...    230   4e-71    
ref|XP_007024220.1|  Isochorismatase family protein isoform 2           228   6e-71    
ref|XP_009759232.1|  PREDICTED: uncharacterized protein LOC104211...    227   1e-70    
ref|XP_004952220.1|  PREDICTED: uncharacterized protein LOC101764...    229   2e-70    
ref|XP_002972881.1|  hypothetical protein SELMODRAFT_98142              227   4e-70    
dbj|BAJ90557.1|  predicted protein                                      228   8e-70    
gb|AFW70918.1|  hypothetical protein ZEAMMB73_638698                    228   8e-70    
ref|XP_009628049.1|  PREDICTED: uncharacterized protein LOC104118...    225   8e-70    
dbj|BAJ88415.1|  predicted protein                                      228   9e-70    
ref|XP_002988054.1|  hypothetical protein SELMODRAFT_183601             224   6e-69    
gb|KFK38972.1|  hypothetical protein AALP_AA3G183500                    221   7e-68    
ref|XP_006426937.1|  hypothetical protein CICLE_v10026617mg             218   4e-67    
gb|EEC72908.1|  hypothetical protein OsI_06736                          203   7e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_001771068.1|  predicted protein                                  202   2e-60    
gb|ADE77768.1|  unknown                                                 198   3e-59    
ref|XP_004952219.1|  PREDICTED: uncharacterized protein LOC101764...    197   7e-58    
gb|EMT18998.1|  Putative isochorismatase family protein rutB            196   1e-57    
gb|EMS50491.1|  Peroxyureidoacrylate/ureidoacrylate amidohydrolas...    196   2e-57    
ref|XP_010234136.1|  PREDICTED: uncharacterized protein LOC100846...    192   3e-56    
ref|XP_006298601.1|  hypothetical protein CARUB_v10014686mg             187   2e-55    
ref|XP_011013251.1|  PREDICTED: uncharacterized protein LOC105117...    187   3e-55    
dbj|BAD21813.1|  isochorismatase hydrolase-like                         196   3e-55    Oryza sativa Japonica Group [Japonica rice]
gb|KHN47837.1|  hypothetical protein glysoja_029255                     180   2e-51    
ref|XP_001695827.1|  hypothetical protein CHLREDRAFT_103992             166   2e-46    Chlamydomonas reinhardtii
ref|XP_009353593.1|  PREDICTED: uncharacterized protein LOC103944...    164   7e-46    
ref|XP_005849810.1|  hypothetical protein CHLNCDRAFT_50982              164   1e-45    
ref|XP_002949507.1|  hypothetical protein VOLCADRAFT_59236              162   4e-45    
ref|XP_006369197.1|  hypothetical protein POPTR_0001s18650g             157   4e-44    
gb|AFW70917.1|  hypothetical protein ZEAMMB73_638698                    157   4e-43    
ref|XP_011008325.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    157   7e-43    
ref|WP_015284272.1|  nicotinamidase-like amidase                        156   8e-43    
ref|WP_011736809.1|  isochorismatase                                    150   2e-40    
ref|WP_027984630.1|  isochorismatase                                    147   2e-39    
ref|NP_001046543.2|  Os02g0276200                                       145   4e-39    Oryza sativa Japonica Group [Japonica rice]
ref|WP_012107800.1|  isochorismatase hydrolase                          145   1e-38    
ref|WP_011699486.1|  isochorismatase                                    144   7e-38    
ref|WP_006847929.1|  isochorismatase                                    141   8e-37    
ref|WP_014807235.1|  nicotinamidase-like amidase                        141   9e-37    
ref|WP_035105234.1|  hypothetical protein                               139   4e-36    
ref|WP_011447213.1|  isochorismatase hydrolase                          135   6e-35    
ref|WP_015540064.1|  Amidases related to nicotinamidase                 136   7e-35    
ref|WP_006508291.1|  nicotinamidase-like amidase                        135   8e-35    
ref|WP_028571956.1|  isochorismatase                                    135   1e-34    
ref|WP_005030489.1|  isochorismatase                                    135   1e-34    
ref|WP_029437032.1|  isochorismatase                                    135   1e-34    
ref|WP_015775476.1|  isochorismatase                                    134   3e-34    
ref|WP_011980618.1|  isochorismatase                                    133   5e-34    
ref|WP_009369225.1|  isochorismatase                                    133   5e-34    
ref|WP_027184219.1|  hypothetical protein                               133   7e-34    
ref|WP_010937344.1|  isochorismatase                                    133   1e-33    
ref|WP_028586584.1|  isochorismatase                                    132   1e-33    
ref|WP_020879378.1|  isochorismatase hydrolase                          132   2e-33    
ref|WP_028578072.1|  isochorismatase                                    131   3e-33    
ref|WP_031388075.1|  isochorismatase                                    131   4e-33    
ref|WP_008871388.1|  isochorismatase                                    131   4e-33    
pdb|3HU5|A  Chain A, Crystal Structure Of Isochorismatase Family ...    127   2e-31    
emb|CBX30283.1|  hypothetical protein N47_D30920                        125   9e-31    
ref|WP_009608165.1|  isochorismatase hydrolase                          125   1e-30    
ref|WP_036630059.1|  isochorismatase                                    124   3e-30    
ref|WP_009305788.1|  MULTISPECIES: isochorismatase hydrolase            124   3e-30    
ref|WP_022289918.1|  isochorismatase hydrolase                          124   3e-30    
gb|ERK60745.1|  isochorismatase family protein                          124   6e-30    
ref|WP_015758258.1|  isochorismatase hydrolase                          123   9e-30    
ref|WP_035386908.1|  hypothetical protein                               120   3e-29    
ref|WP_035022374.1|  isochorismatase                                    119   1e-28    
ref|WP_016408509.1|  isochorismatase hydrolase                          117   8e-28    
ref|WP_013344816.1|  isochorismatase hydrolase                          115   2e-27    
ref|WP_018659025.1|  hypothetical protein                               116   3e-27    
ref|WP_013978833.1|  isochorismatase hydrolase                          115   4e-27    
ref|WP_013008113.1|  nicotinamidase                                     112   2e-26    
ref|WP_014117646.1|  putative hydrolase                                 114   4e-26    
ref|WP_015750724.1|  isochorismatase                                    112   4e-26    
ref|WP_035009280.1|  isochorismatase                                    112   4e-26    
gb|EOS52365.1|  hypothetical protein C811_00395                         112   9e-25    
ref|WP_022177182.1|  amidase related to nicotinamidase                  108   1e-24    
ref|WP_020495338.1|  hypothetical protein                               108   2e-24    
ref|WP_013886620.1|  nicotinamidase                                     107   2e-24    
ref|WP_022254807.1|  putative hydrolase                                 107   7e-24    
ref|WP_014452790.1|  putative hydrolase                                 105   1e-23    
ref|WP_013484860.1|  isochorismatase hydrolase                          105   2e-23    
ref|WP_009138962.1|  isochorismatase hydrolase                          104   3e-23    
ref|WP_013977866.1|  isochorismatase hydrolase                          103   6e-23    
ref|WP_035133791.1|  hypothetical protein                               103   7e-23    
ref|WP_022364427.1|  putative hydrolase                                 102   2e-22    
ref|WP_016413614.1|  amidase related to nicotinamidase                  101   3e-22    
ref|WP_025999931.1|  isochorismatase                                    102   3e-22    
ref|WP_009673344.1|  MULTISPECIES: isochorismatase hydrolase            101   8e-22    
ref|WP_031305530.1|  hypothetical protein                               100   1e-21    
ref|WP_036922034.1|  cysteine hydrolase                                 100   2e-21    
gb|EST54863.1|  isochorismatase hydrolase                               100   2e-21    
ref|WP_024578955.1|  isochorismatase                                  99.8    3e-21    
ref|WP_016841118.1|  hypothetical protein                             99.8    3e-21    
ref|WP_018750863.1|  hypothetical protein                             99.4    4e-21    
ref|WP_028340494.1|  isochorismatase                                  99.0    4e-21    
ref|WP_015050898.1|  nicotinamidase                                   98.2    5e-21    
ref|WP_019121745.1|  hypothetical protein                             99.0    5e-21    
ref|WP_022671011.1|  nicotinamidase                                   97.8    5e-21    
ref|WP_028333784.1|  isochorismatase                                  99.0    5e-21    
ref|WP_018608119.1|  MULTISPECIES: putative isochorismatase hydro...  98.6    5e-21    
ref|WP_029082938.1|  isochorismatase                                  98.6    8e-21    
emb|CEI51942.1|  Nicotinamidase                                       98.2    9e-21    
ref|WP_031361441.1|  isochorismatase                                  97.8    1e-20    
ref|WP_035581656.1|  isochorismatase                                  97.8    1e-20    
ref|WP_002717979.1|  tat (twin-arginine translocation) pathway si...  98.6    1e-20    
ref|WP_013909211.1|  nicotinamidase                                   96.7    1e-20    
ref|WP_037603655.1|  cysteine hydrolase                               97.4    2e-20    
gb|KFF90113.1|  isochorismatase                                       97.1    2e-20    
ref|WP_037386669.1|  isochorismatase                                  97.1    2e-20    
ref|WP_039237375.1|  isochorismatase                                  97.1    2e-20    
ref|WP_037344892.1|  isochorismatase                                  97.4    2e-20    
gb|KEY57324.1|  N-carbamoylsarcosine amidase                          97.1    2e-20    
ref|WP_004830927.1|  hypothetical protein                             97.1    2e-20    
ref|WP_005099166.1|  cysteine hydrolase                               97.1    2e-20    
ref|WP_017524172.1|  hypothetical protein                             97.1    2e-20    
ref|WP_026919521.1|  isochorismatase                                  99.0    3e-20    
ref|WP_037411134.1|  hypothetical protein                             95.9    3e-20    
ref|WP_037534165.1|  hypothetical protein                             96.7    3e-20    
ref|WP_009584969.1|  isochorismatase family protein                   96.3    3e-20    
ref|WP_035587446.1|  nicotinamidase                                   95.1    4e-20    
ref|WP_033633676.1|  isochorismatase                                  95.9    4e-20    
ref|WP_005029167.1|  hypothetical protein                             95.5    7e-20    
ref|WP_024016992.1|  pyrimidine utilization protein B                 96.3    8e-20    
ref|WP_012123347.1|  nicotinamidase                                   94.4    1e-19    
ref|WP_023559915.1|  amidohydrolase                                   95.9    1e-19    
ref|WP_005087581.1|  cysteine hydrolase                               95.1    1e-19    
ref|WP_005093220.1|  MULTISPECIES: cysteine hydrolase                 95.1    1e-19    
ref|WP_016889150.1|  cysteine hydrolase                               95.1    1e-19    
ref|WP_027033918.1|  isochorismatase                                  95.1    1e-19    
ref|WP_027059651.1|  isochorismatase                                  95.1    1e-19    
ref|WP_017205388.1|  cysteine hydrolase                               95.1    1e-19    
ref|WP_005085198.1|  cysteine hydrolase                               94.7    1e-19    
ref|WP_034089665.1|  cysteine hydrolase                               94.7    1e-19    
ref|WP_018159779.1|  hypothetical protein                             94.7    1e-19    
ref|WP_027479482.1|  cysteine hydrolase                               95.1    1e-19    
ref|WP_009077965.1|  pyrimidine utilization protein B                 94.7    1e-19    
ref|WP_014977454.1|  amidohydrolase                                   95.1    2e-19    
emb|CAJ72591.1|  strongly similar to isochorismatase (2,3 dihydro...  94.0    2e-19    Candidatus Kuenenia stuttgartiensis
ref|WP_024502292.1|  isochorismatase                                  94.7    2e-19    
ref|WP_022521193.1|  MULTISPECIES: Benzamide amidohydrolase           94.4    2e-19    
ref|WP_033294644.1|  hypothetical protein                             93.6    2e-19    
ref|WP_005067321.1|  cysteine hydrolase                               94.7    2e-19    
ref|WP_013681190.1|  nicotinamidase                                   93.6    2e-19    
ref|WP_018182879.1|  isochorismatase hydrolase                        94.4    2e-19    
ref|WP_005074742.1|  cysteine hydrolase                               94.0    2e-19    
ref|WP_015068127.1|  pyrimidine utilization protein B                 94.7    2e-19    
ref|WP_005060529.1|  cysteine hydrolase                               94.0    3e-19    
ref|WP_025253976.1|  amidohydrolase                                   94.4    3e-19    
ref|WP_016895104.1|  cysteine hydrolase                               94.0    3e-19    
ref|WP_027045720.1|  isochorismatase                                  93.6    3e-19    
ref|WP_013530303.1|  isochorismatase hydrolase                        93.6    3e-19    
ref|WP_025270667.1|  nicotinamidase                                   92.8    4e-19    
ref|WP_027056010.1|  isochorismatase                                  93.6    4e-19    
ref|WP_027162238.1|  isochorismatase                                  93.6    4e-19    
dbj|BAJ23975.1|  benzamide amidohydrolase                             93.6    4e-19    
ref|WP_039228642.1|  amidohydrolase                                   93.6    5e-19    
ref|WP_014950779.1|  amidohydrolase                                   93.6    6e-19    
ref|WP_039231260.1|  amidohydrolase                                   93.6    7e-19    
ref|WP_009680932.1|  isochorismatase hydrolase                        95.1    7e-19    
ref|WP_013897003.1|  isochorismatase hydrolase                        92.4    9e-19    
ref|WP_027035621.1|  isochorismatase                                  92.4    9e-19    
ref|WP_029074752.1|  isochorismatase                                  92.0    1e-18    
ref|WP_036711357.1|  isochorismatase                                  92.0    1e-18    
ref|WP_023809099.1|  isochorismatase hydrolase                        92.0    1e-18    
ref|WP_006897486.1|  hypothetical protein                             94.0    2e-18    
ref|WP_008514445.1|  nicotinamidase-like amidase                      90.9    2e-18    
ref|WP_028355208.1|  isochorismatase                                  91.7    2e-18    
ref|WP_027624254.1|  isochorismatase                                  91.3    2e-18    
ref|WP_006329815.1|  Isochorismatase hydrolase                        91.7    2e-18    
ref|WP_037814372.1|  isochorismatase                                  91.3    2e-18    
ref|WP_013778665.1|  nicotinamidase                                   90.1    3e-18    
ref|WP_037999268.1|  nicotinamidase                                   90.1    3e-18    
ref|WP_039216376.1|  amidohydrolase                                   91.3    3e-18    
ref|WP_018430656.1|  isochorismatase hydrolase                        90.5    4e-18    
ref|WP_014968933.1|  isochorismatase EntB                             90.1    4e-18    
ref|WP_008876088.1|  Isochorismatase hydrolase                        90.5    4e-18    
ref|WP_031932263.1|  isochorismatase                                  90.5    4e-18    
ref|XP_007734323.1|  hypothetical protein A1O3_06013                  90.9    4e-18    
ref|WP_037366923.1|  isochorismatase                                  90.5    4e-18    
ref|WP_029003123.1|  N-carbamoylsarcosine amidase                     90.5    5e-18    
ref|WP_007468027.1|  cysteine hydrolase                               90.1    5e-18    
ref|WP_022853180.1|  nicotinamidase                                   89.4    6e-18    
ref|WP_011969296.1|  isochorismatase hydrolase                        90.1    6e-18    
ref|WP_035146426.1|  nicotinamidase                                   89.0    6e-18    
ref|WP_030166006.1|  MULTISPECIES: isochorismatase                    90.1    6e-18    
ref|WP_024048477.1|  Isochorismatase hydrolase                        89.0    6e-18    
ref|WP_020617982.1|  hypothetical protein                             89.7    8e-18    
ref|WP_034438278.1|  nicotinamidase                                   88.6    8e-18    
emb|CDX29676.1|  Isochorismatase hydrolase                            89.7    9e-18    
gb|AHG65477.1|  isochorismatase domain-containing protein             89.7    9e-18    
ref|WP_024190151.1|  amidohydrolase                                   89.7    9e-18    
gb|EQP75270.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  89.7    9e-18    
ref|WP_007316355.1|  putative hydrolase                               91.3    1e-17    
ref|WP_037062687.1|  hypothetical protein                             88.6    1e-17    
ref|WP_011343610.1|  MULTISPECIES: isochorismatase                    88.6    1e-17    
ref|WP_018011365.1|  isochorismatase hydrolase                        88.6    2e-17    
gb|EKE20244.1|  Isochorismatase hydrolase                             88.2    2e-17    
ref|WP_035989453.1|  isochorismatase                                  88.2    2e-17    
gb|EMT53047.1|  isochorismatase hydrolase                             88.6    2e-17    
ref|WP_014690570.1|  cysteine hydrolase                               88.6    2e-17    
ref|WP_012236010.1|  isochorismatase hydrolase                        88.2    2e-17    
ref|WP_004029324.1|  nicotinamidase                                   87.4    2e-17    
ref|WP_038697450.1|  isochorismatase                                  87.8    2e-17    
ref|WP_039121595.1|  isochorismatase                                  87.8    3e-17    
gb|EYD70142.1|  isochorismatase EntB                                  87.4    3e-17    
ref|WP_029993360.1|  isochorismatase                                  87.8    3e-17    
ref|WP_030095349.1|  cysteine hydrolase                               87.8    3e-17    
ref|WP_028602194.1|  isochorismatase                                  87.8    3e-17    
ref|WP_004103887.1|  cysteine hydrolase                               87.0    3e-17    
ref|WP_026060970.1|  cysteine hydrolase                               87.8    4e-17    
ref|WP_007322333.1|  cysteine hydrolase                               87.8    4e-17    
emb|CDX28419.1|  Isochorismatase hydrolase                            87.4    5e-17    
ref|WP_022394977.1|  isochorismatase hydrolase                        86.7    5e-17    
ref|WP_036715224.1|  hypothetical protein                             87.4    5e-17    
ref|WP_017349769.1|  amidohydrolase                                   87.8    5e-17    
ref|WP_030090738.1|  isochorismatase                                  87.4    5e-17    
ref|WP_024251934.1|  amidohydrolase                                   87.4    6e-17    
ref|WP_030268837.1|  isochorismatase                                  87.8    6e-17    
gb|EHG01665.1|  putative isochorismatase family protein, rutB         87.4    6e-17    
ref|WP_020042352.1|  hypothetical protein                             87.4    6e-17    
ref|WP_006875307.1|  isochorismatase hydrolase                        86.7    6e-17    
ref|WP_024922149.1|  MULTISPECIES: isochorismatase                    87.0    6e-17    
gb|ETZ71484.1|  isochorismatase family protein                        86.7    7e-17    
ref|WP_007222632.1|  nicotinamidase                                   86.3    7e-17    
emb|CDX43798.1|  Isochorismatase hydrolase                            87.0    7e-17    
ref|WP_037322377.1|  isochorismatase                                  86.7    7e-17    
ref|WP_001485666.1|  pyrimidine utilization protein B                 87.0    8e-17    
ref|WP_027898843.1|  amidohydrolase                                   87.4    8e-17    
ref|WP_036638686.1|  hypothetical protein                             87.0    8e-17    
ref|WP_037566026.1|  amidohydrolase                                   87.0    8e-17    
ref|WP_028269739.1|  N-carbamoylsarcosine amidase                     87.0    9e-17    
ref|WP_035342012.1|  isochorismatase                                  86.3    1e-16    
dbj|GAE29830.1|  amidohydrolase RutB                                  86.3    1e-16    
ref|WP_012602395.1|  amidohydrolase                                   86.7    1e-16    
gb|KGA95977.1|  isochorismatase                                       86.3    1e-16    
ref|WP_037063373.1|  hypothetical protein                             86.3    1e-16    
ref|WP_016432696.1|  hypothetical protein                             85.9    1e-16    
ref|WP_009461152.1|  MULTISPECIES: isochorismatase                    86.3    1e-16    
ref|WP_018179294.1|  hypothetical protein                             86.3    1e-16    
ref|WP_006182685.1|  cysteine hydrolase                               85.5    1e-16    
ref|WP_035903686.1|  isochorismatase                                  85.9    1e-16    
ref|WP_024195286.1|  amidohydrolase                                   86.3    2e-16    
ref|WP_035915681.1|  isochorismatase                                  85.5    2e-16    
gb|KDE64426.1|  isochorismatase EntB                                  85.9    2e-16    
ref|WP_005118762.1|  cysteine hydrolase                               85.5    2e-16    
ref|WP_024175781.1|  amidohydrolase                                   86.3    2e-16    
gb|EOU93545.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  86.3    2e-16    
ref|WP_001460746.1|  pyrimidine utilization protein B                 86.3    2e-16    
ref|WP_001651802.1|  pyrimidine utilization protein B                 86.3    2e-16    
ref|WP_005250317.1|  isochorismatase hydrolase                        85.9    2e-16    
ref|WP_000989155.1|  amidohydrolase                                   86.3    2e-16    
gb|KDE63599.1|  isochorismatase EntB                                  85.5    2e-16    
ref|WP_032359899.1|  amidohydrolase                                   85.9    2e-16    
ref|WP_014639575.1|  amidohydrolase                                   85.9    2e-16    
gb|KDE72154.1|  isochorismatase EntB                                  85.5    2e-16    
ref|WP_000989139.1|  amidohydrolase                                   85.9    2e-16    
gb|EEJ49254.1|  pyrimidine utilization protein B                      85.9    2e-16    
dbj|GAM15920.1|  nicotinamidase                                       85.9    2e-16    
ref|WP_024258950.1|  amidohydrolase                                   85.9    2e-16    
ref|WP_012939425.1|  isochorismatase                                  84.7    2e-16    
ref|WP_007640641.1|  isochorismatase family protein                   85.9    2e-16    
ref|WP_033545006.1|  amidohydrolase                                   85.9    2e-16    
ref|WP_024190359.1|  amidohydrolase                                   85.9    2e-16    
ref|WP_035855056.1|  isochorismatase                                  85.5    2e-16    
ref|WP_001447208.1|  MULTISPECIES: amidohydrolase                     85.9    2e-16    
ref|WP_001331943.1|  amidohydrolase                                   85.9    2e-16    
ref|WP_022960159.1|  isochorismatase hydrolase                        85.5    2e-16    
ref|WP_013986268.1|  isochorismatase hydrolase                        86.3    2e-16    
ref|WP_025755880.1|  amidohydrolase                                   85.5    2e-16    
gb|ETE12750.1|  amidohydrolase                                        85.9    2e-16    
ref|WP_024186896.1|  amidohydrolase                                   85.5    2e-16    
ref|WP_001815788.1|  amidohydrolase                                   85.5    2e-16    
ref|WP_001317756.1|  amidohydrolase                                   85.5    2e-16    
ref|WP_033817116.1|  amidohydrolase                                   85.5    2e-16    
gb|ELC38242.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  85.5    2e-16    
gb|EGB77150.1|  pyrimidine utilization protein B                      85.5    2e-16    
gb|KHI26839.1|  amidohydrolase                                        85.5    2e-16    
ref|WP_001137948.1|  amidohydrolase                                   85.9    2e-16    
ref|WP_020252678.1|  MULTISPECIES: hypothetical protein               85.5    2e-16    
ref|WP_029704343.1|  cysteine hydrolase                               85.5    2e-16    
gb|ELF20932.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  85.5    2e-16    
gb|KHI45459.1|  amidohydrolase                                        85.5    2e-16    
ref|WP_001489846.1|  amidohydrolase                                   85.5    2e-16    
gb|KHH69771.1|  amidohydrolase                                        85.5    3e-16    
ref|WP_033560847.1|  amidohydrolase                                   85.5    3e-16    
gb|EFK20859.1|  pyrimidine utilization protein B                      85.5    3e-16    
ref|WP_001345643.1|  amidohydrolase                                   85.5    3e-16    
ref|WP_015234867.1|  nicotinamidase-like amidase                      86.3    3e-16    
ref|WP_000989143.1|  amidohydrolase                                   85.5    3e-16    
gb|ELH95306.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  85.5    3e-16    
ref|WP_024188736.1|  amidohydrolase                                   85.5    3e-16    
ref|WP_007269686.1|  isochorismatase hydrolase                        85.9    3e-16    
ref|WP_032191657.1|  amidohydrolase                                   85.5    3e-16    
ref|WP_001137950.1|  amidohydrolase                                   85.5    3e-16    
ref|WP_024248165.1|  amidohydrolase                                   85.5    3e-16    
ref|WP_013416168.1|  cysteine hydrolase                               85.1    3e-16    
ref|WP_025650451.1|  amidohydrolase                                   85.5    3e-16    
ref|XP_002516007.1|  hypothetical protein RCOM_1493000                81.6    3e-16    
ref|WP_017499781.1|  amidohydrolase                                   85.9    3e-16    
ref|WP_022803005.1|  isochorismatase hydrolase                        85.9    3e-16    
ref|WP_010338177.1|  amidohydrolase                                   85.9    3e-16    
ref|WP_037063544.1|  hypothetical protein                             84.3    3e-16    
ref|WP_005512881.1|  cysteine hydrolase                               85.1    3e-16    
ref|WP_009535110.1|  isochorismatase                                  84.3    3e-16    
ref|WP_037051607.1|  isochorismatase                                  85.5    3e-16    
ref|WP_037163530.1|  isochorismatase                                  84.7    3e-16    
ref|WP_038020632.1|  amidohydrolase                                   85.5    3e-16    
ref|WP_001350176.1|  amidohydrolase                                   85.1    3e-16    
gb|ELC30149.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  85.1    3e-16    
emb|CDK70859.1|  Predicted amidohydrolase RutB in novel pyrimidin...  85.1    4e-16    
ref|WP_000989146.1|  amidohydrolase                                   85.1    4e-16    
ref|WP_006375864.1|  isochorismatase family protein                   85.1    4e-16    
ref|WP_022871444.1|  N-carbamoylsarcosine amidase                     85.5    4e-16    
ref|WP_001580400.1|  pyrimidine utilization protein B                 85.1    4e-16    
ref|WP_028642102.1|  isochorismatase                                  84.7    4e-16    
ref|WP_035936411.1|  isochorismatase                                  84.7    4e-16    
ref|WP_038340058.1|  amidohydrolase                                   85.1    4e-16    
ref|WP_037512499.1|  amidohydrolase                                   85.5    4e-16    
gb|KDW59543.1|  pyrimidine utilization protein B                      84.3    4e-16    
ref|WP_024179105.1|  amidohydrolase                                   85.1    4e-16    
gb|EGH39335.1|  putative amidohydrolase RutB in novel pyrimidine ...  85.1    4e-16    
ref|WP_019908463.1|  hypothetical protein                             84.3    4e-16    
ref|WP_024229984.1|  amidohydrolase                                   85.1    4e-16    
ref|WP_013357375.1|  amidohydrolase                                   85.1    4e-16    
ref|WP_024240448.1|  amidohydrolase                                   84.7    4e-16    
gb|ERB38566.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  84.7    4e-16    
ref|WP_037527662.1|  amidohydrolase                                   85.1    4e-16    
ref|WP_001445752.1|  amidohydrolase                                   84.7    4e-16    
gb|EFJ80693.1|  pyrimidine utilization protein B                      84.7    4e-16    
ref|WP_001312732.1|  amidohydrolase                                   85.1    4e-16    
ref|WP_032258509.1|  amidohydrolase                                   84.7    4e-16    
gb|AHM43177.1|  amidohydrolase                                        84.7    4e-16    
ref|WP_024186570.1|  amidohydrolase                                   84.7    4e-16    
ref|WP_024186820.1|  amidohydrolase                                   84.7    5e-16    
gb|EKQ57501.1|  nicotinamidase-like amidase                           84.0    5e-16    
ref|WP_013733878.1|  isochorismatase hydrolase                        84.3    5e-16    
ref|WP_033549907.1|  amidohydrolase                                   84.7    5e-16    
gb|EII93610.1|  pyrimidine utilization protein B                      84.7    5e-16    
ref|WP_021043161.1|  nicotinamidase-like amidase                      84.0    5e-16    
gb|EGI17148.1|  pyrimidine utilization protein B                      84.7    5e-16    
ref|WP_001487883.1|  amidohydrolase                                   84.7    5e-16    
gb|KDE63186.1|  isochorismatase EntB                                  84.3    5e-16    
ref|WP_024192310.1|  amidohydrolase                                   84.7    5e-16    
ref|WP_023563262.1|  isochorismatase hydrolase                        84.7    5e-16    
ref|WP_024196288.1|  amidohydrolase                                   84.7    6e-16    
ref|WP_024228636.1|  amidohydrolase                                   84.7    6e-16    
ref|WP_033761869.1|  amidohydrolase                                   84.7    6e-16    
ref|WP_020268940.1|  hypothetical protein                             83.6    6e-16    
ref|WP_032191665.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_001307100.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_031328131.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_032162543.1|  amidohydrolase                                   84.3    6e-16    
gb|ELH41957.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  84.3    6e-16    
gb|ELP26095.1|  Putative amidohydrolase RutB                          84.7    6e-16    
ref|WP_032255822.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_012896765.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_032280704.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_006334537.1|  isochorismatase hydrolase                        84.3    6e-16    
ref|WP_024247339.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_001393558.1|  MULTISPECIES: ureidoacrylate amidohydrolase      84.3    6e-16    
ref|WP_000989141.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_027462181.1|  isochorismatase                                  85.1    6e-16    
ref|WP_001308546.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_001307708.1|  MULTISPECIES: amidohydrolase                     84.3    6e-16    
gb|EQZ96423.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  84.3    6e-16    
gb|ELE56613.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  84.3    6e-16    
ref|WP_011993811.1|  cysteine hydrolase                               83.6    6e-16    
ref|WP_038989454.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_032353172.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_000855110.1|  MULTISPECIES: amidohydrolase                     84.3    6e-16    
ref|WP_014258791.1|  isochorismatase hydrolase                        84.3    6e-16    
ref|WP_001295945.1|  amidohydrolase                                   84.3    6e-16    
gb|KDS91163.1|  cysteine hydrolase                                    83.6    6e-16    
ref|WP_022678580.1|  isochorismatase hydrolase                        84.0    6e-16    
gb|EST54682.1|  cysteine hydrolase                                    84.0    6e-16    
ref|WP_029393922.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_000989144.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_024244780.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_001481501.1|  pyrimidine utilization protein B                 84.3    6e-16    
ref|WP_001690764.1|  pyrimidine utilization protein B                 84.3    6e-16    
ref|WP_000989140.1|  amidohydrolase                                   84.3    6e-16    
ref|WP_001446784.1|  MULTISPECIES: amidohydrolase                     84.3    6e-16    
ref|WP_014131534.1|  isochorismatase family protein                   84.3    6e-16    
ref|WP_033743177.1|  MULTISPECIES: amidohydrolase                     84.3    7e-16    
ref|WP_025640337.1|  nicotinamidase                                   83.2    7e-16    
ref|WP_024214678.1|  amidohydrolase                                   84.3    7e-16    
ref|WP_000988282.1|  amidohydrolase                                   84.3    7e-16    
ref|WP_007671721.1|  amidohydrolase                                   84.3    7e-16    
ref|WP_024185248.1|  amidohydrolase                                   84.3    7e-16    
emb|CDP72006.1|  Peroxyureidoacrylate/ureidoacrylate amidohydrola...  84.3    7e-16    
ref|WP_011443836.1|  isochorismatase hydrolase                        84.0    7e-16    
ref|WP_035919771.1|  isochorismatase                                  84.0    7e-16    
ref|WP_001404973.1|  pyrimidine utilization protein B                 84.3    7e-16    
ref|WP_001313728.1|  amidohydrolase                                   84.3    7e-16    
ref|WP_035316152.1|  isochorismatase                                  84.0    7e-16    
ref|WP_026845810.1|  cysteine hydrolase                               84.3    7e-16    
gb|ELG87423.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  84.3    7e-16    
gb|ELD36103.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  84.3    7e-16    
gb|EFM19653.1|  pyrimidine utilization protein B                      84.3    7e-16    
ref|WP_020269179.1|  hypothetical protein                             83.6    7e-16    
ref|WP_001340067.1|  amidohydrolase                                   84.3    7e-16    
ref|WP_024225134.1|  amidohydrolase                                   84.3    7e-16    
ref|WP_001386319.1|  amidohydrolase                                   84.3    7e-16    
ref|WP_010900881.1|  nicotinamidase                                   83.2    7e-16    
ref|WP_024187487.1|  amidohydrolase                                   84.3    7e-16    
ref|WP_001625380.1|  pyrimidine utilization protein B                 84.3    7e-16    
gb|EQN82203.1|  peroxyureidoacrylate/ureidoacrylate amidohydrolas...  84.3    7e-16    
ref|WP_005008792.1|  peroxyureidoacrylate/ureidoacrylate amidohyd...  84.3    8e-16    



>emb|CDO98011.1| unnamed protein product [Coffea canephora]
Length=198

 Score =   309 bits (791),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW+ TALL+IDMQNDFILPGGPM V G QAIVPNVI+AVEVAR RGIPIIWVVREHDPSG
Sbjct  7    KWKKTALLVIDMQNDFILPGGPMLVKGGQAIVPNVIRAVEVARGRGIPIIWVVREHDPSG  66

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLYSPGKPKPTSKGS GAELVDGL IK  DY+LVKTRFSAFFNT+LHSYLQ 
Sbjct  67   RDVELFRRHLYSPGKPKPTSKGSFGAELVDGLEIKGDDYKLVKTRFSAFFNTHLHSYLQG  126

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
             GI++LVITGVQTPNCIRQTVFDAVA +YQ VTVI+DATAAATPEIH +NI DM NIGV 
Sbjct  127  AGISNLVITGVQTPNCIRQTVFDAVALDYQSVTVIIDATAAATPEIHVANILDMNNIGVA  186

Query  260  TPTLEEWCES  231
             PTL EW ES
Sbjct  187  APTLAEWAES  196



>ref|XP_011080698.1| PREDICTED: nicotinamidase-like [Sesamum indicum]
Length=198

 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW NTALL+IDMQ DFILPGGPMHV G +AIVP+VIKAVEVAR+R IP+IWVVREHDP G
Sbjct  7    KWNNTALLVIDMQKDFILPGGPMHVKGGEAIVPSVIKAVEVARSRSIPVIWVVREHDPLG  66

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLY+  KPKPTSKGSVGAELVDGLVIK+GDY+LVK RFSAFFNT+LHSYLQ 
Sbjct  67   RDVELFRRHLYAADKPKPTSKGSVGAELVDGLVIKDGDYKLVKMRFSAFFNTHLHSYLQG  126

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
             G+  LVITGVQTPNCIRQTVFDAVA +Y  VTVIVDATAAATP+IH +NI DM N+GV 
Sbjct  127  AGVNKLVITGVQTPNCIRQTVFDAVALDYHKVTVIVDATAAATPDIHIANIIDMTNVGVA  186

Query  260  TPTLEEWCES  231
            TPTLEEWC+S
Sbjct  187  TPTLEEWCKS  196



>ref|XP_004235684.1| PREDICTED: uncharacterized protein LOC101267390 [Solanum lycopersicum]
Length=197

 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW  TA+++IDMQ DFILP  PM V G +AIVPNVIK VEVARNRGIPIIWVVREHDP G
Sbjct  8    KWSKTAVVVIDMQKDFILPDAPMLVRGGEAIVPNVIKTVEVARNRGIPIIWVVREHDPLG  67

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLY  GKPKPTSKG VGAELVDGLVI+EGDY+LVKTRFSAFFNTNLHSYLQ 
Sbjct  68   RDVELFRRHLYGDGKPKPTSKGCVGAELVDGLVIQEGDYKLVKTRFSAFFNTNLHSYLQG  127

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
             GIT+LV+ GVQTPNCIRQTVFDAVA +YQ VTVI+DATAAATP+IH +NIFDMKN+GV 
Sbjct  128  IGITNLVVIGVQTPNCIRQTVFDAVALDYQRVTVIIDATAAATPDIHIANIFDMKNVGVA  187

Query  260  TPTLEEWCES  231
            TPTLEEWC+S
Sbjct  188  TPTLEEWCQS  197



>ref|XP_009759230.1| PREDICTED: uncharacterized protein LOC104211802 isoform X1 [Nicotiana 
sylvestris]
Length=200

 Score =   304 bits (778),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW  TALL+IDMQ DF+LPG PM V G +AIVPNVIK VEVARNR IPIIWVVREHDP G
Sbjct  8    KWNKTALLVIDMQKDFVLPGAPMLVKGGEAIVPNVIKTVEVARNRCIPIIWVVREHDPLG  67

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLY  GKPKPTSKGSVGAELVDGLVI+E DY+LVKTRFSAFFNTNLHSYLQ 
Sbjct  68   RDVELFRRHLYGDGKPKPTSKGSVGAELVDGLVIQEDDYKLVKTRFSAFFNTNLHSYLQG  127

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
             GIT+LVI GVQTPNCIRQTVFDAVA +Y+ VTVI+DATAAATP+IH +NI DMKN+GV+
Sbjct  128  IGITNLVIIGVQTPNCIRQTVFDAVALDYERVTVIIDATAAATPDIHIANIIDMKNVGVV  187

Query  260  TPTLEEWCES  231
            TPTLEEWC+S
Sbjct  188  TPTLEEWCQS  197



>ref|XP_006343089.1| PREDICTED: uncharacterized protein LOC102594407 [Solanum tuberosum]
Length=197

 Score =   303 bits (777),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KWR TA+++IDMQ DFILPG PM V   +AIVPNVIK VEVARNRGIPIIWVVREHDP G
Sbjct  8    KWRKTAVVVIDMQKDFILPGAPMLVRDGEAIVPNVIKTVEVARNRGIPIIWVVREHDPLG  67

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLY  GKPKPTSKG VGAELVDGL+I+EGDY+LVKTRFSAFFNTNLHSYLQ 
Sbjct  68   RDVELFRRHLYGDGKPKPTSKGCVGAELVDGLLIQEGDYKLVKTRFSAFFNTNLHSYLQG  127

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
              +T+LV+ GVQTPNCIRQTVFDAVA +YQ VTVI+DATAAATP+IH +NIFDMKN+GV 
Sbjct  128  IAVTNLVVIGVQTPNCIRQTVFDAVALDYQRVTVIIDATAAATPDIHIANIFDMKNVGVA  187

Query  260  TPTLEEWCES  231
            TPTLEEWC+S
Sbjct  188  TPTLEEWCQS  197



>ref|XP_009628047.1| PREDICTED: uncharacterized protein LOC104118502 isoform X1 [Nicotiana 
tomentosiformis]
Length=203

 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW  TALL+IDMQ DF+LPG PM V G +AIVPNVIK VEV R+RGIPIIWVVREHD  G
Sbjct  8    KWNKTALLVIDMQKDFVLPGAPMLVKGGEAIVPNVIKTVEVTRSRGIPIIWVVREHDQLG  67

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLY  GKPKPTSKGSVGAELVDGLVI+E DY+LVKTRFSAFFNTNLHSYLQ 
Sbjct  68   RDVELFRRHLYGDGKPKPTSKGSVGAELVDGLVIEEDDYKLVKTRFSAFFNTNLHSYLQG  127

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
             GIT+LVI GVQTPNCIRQTVFDAVA +Y+ VTVI+DATAAATP+IH +NIFDMKN+GV 
Sbjct  128  IGITNLVIIGVQTPNCIRQTVFDAVALDYERVTVIIDATAAATPDIHIANIFDMKNVGVA  187

Query  260  TPTLEEWCES  231
            TPTLEEWC S
Sbjct  188  TPTLEEWCRS  197



>ref|XP_002304210.2| isochorismatase hydrolase family protein [Populus trichocarpa]
 gb|EEE79189.2| isochorismatase hydrolase family protein [Populus trichocarpa]
Length=197

 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 172/196 (88%), Gaps = 1/196 (1%)
 Frame = -2

Query  815  SMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
            SMA  KW  TALL+IDMQNDFIL  G M V G +AIVPNVIKAV++AR RGI ++WVVRE
Sbjct  2    SMAD-KWNQTALLVIDMQNDFILEDGLMKVNGGKAIVPNVIKAVDIARQRGILVVWVVRE  60

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            HDP GRDAELFRRHLYSPG   PTSKGSVGAELVDGLVIKEGDY+LVKTRFSAFF T+LH
Sbjct  61   HDPQGRDAELFRRHLYSPGNVGPTSKGSVGAELVDGLVIKEGDYKLVKTRFSAFFATHLH  120

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMK  276
            S+L++ GI SLVI+GVQTPNC+RQTVFDAVA +YQPVTVIVDATAAATP+IH +NI DMK
Sbjct  121  SFLRTEGIKSLVISGVQTPNCVRQTVFDAVALDYQPVTVIVDATAAATPDIHDANISDMK  180

Query  275  NIGVMTPTLEEWCESG  228
            NIGV TPTL+EWC SG
Sbjct  181  NIGVATPTLQEWCGSG  196



>ref|XP_011013250.1| PREDICTED: uncharacterized protein LOC105117329 isoform X2 [Populus 
euphratica]
Length=197

 Score =   296 bits (757),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -2

Query  815  SMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
            SMA  KW  TALL+IDMQNDFIL  G M V G +AIVPNVIKAV++AR RGI ++WVVRE
Sbjct  2    SMAD-KWNQTALLVIDMQNDFILEDGLMKVNGGRAIVPNVIKAVDIARQRGILVVWVVRE  60

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            HDP GRDAELFRRHLYSPG   PTSKGSVGAELVDGLVIKEGDY+LVKTRFSAFF T+LH
Sbjct  61   HDPQGRDAELFRRHLYSPGNVGPTSKGSVGAELVDGLVIKEGDYKLVKTRFSAFFATHLH  120

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMK  276
            S+L + GI SLVI+GVQTPNCIRQTVFDAVA +YQPVTVIVDATAAATP IH +N+ DMK
Sbjct  121  SFLGTEGIKSLVISGVQTPNCIRQTVFDAVALDYQPVTVIVDATAAATPGIHDANVSDMK  180

Query  275  NIGVMTPTLEEWCESG  228
            NIGV TPTL+EWC SG
Sbjct  181  NIGVATPTLQEWCGSG  196



>gb|EYU24707.1| hypothetical protein MIMGU_mgv1a014082mg [Erythranthe guttata]
Length=201

 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW+NTALL+IDMQ DFILPGGPMHV G ++IV NVIKAV+V+RNR IPIIWVVREHDP G
Sbjct  11   KWKNTALLVIDMQKDFILPGGPMHVRGGESIVANVIKAVQVSRNRTIPIIWVVREHDPFG  70

Query  620  RDAELFRRHLY-SPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
            RD ELFRRHLY S  KPKPTSKG+VGAELVDGLVI+EGDY+LVKTRFSAFFNT+L+SYL 
Sbjct  71   RDVELFRRHLYDSAEKPKPTSKGTVGAELVDGLVIEEGDYKLVKTRFSAFFNTHLNSYLH  130

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
              G+T+LVI GVQTPNCIRQTVFDAVA +Y+ VTVIVDATAAATP+IH +N+ DM NIGV
Sbjct  131  CAGVTNLVIIGVQTPNCIRQTVFDAVALDYKTVTVIVDATAAATPDIHIANVVDMTNIGV  190

Query  263  MTPTLEEWCE  234
             TPT++EWC+
Sbjct  191  ATPTMQEWCD  200



>gb|KDP37261.1| hypothetical protein JCGZ_06317 [Jatropha curcas]
Length=195

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            + KW+ TALL+IDMQNDFIL  G M V G +AIVPNVIKAVE+AR RGI ++W VREHDP
Sbjct  2    ADKWKQTALLVIDMQNDFILEDGLMRVNGGEAIVPNVIKAVEIARQRGILVVWAVREHDP  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
             GRD ELFRRH YS GK  PTSKGS GAELVDGLVIKEGDY++VKTRFSAFFNT+LHS+L
Sbjct  62   LGRDVELFRRHYYSAGKVGPTSKGSEGAELVDGLVIKEGDYKVVKTRFSAFFNTHLHSFL  121

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            Q+ GI +LVI GVQTPNCIRQTVFDAVA +YQ V+V+VDATAAATP++H +NIFDMKNIG
Sbjct  122  QTEGIKNLVIVGVQTPNCIRQTVFDAVALDYQNVSVVVDATAAATPDVHIANIFDMKNIG  181

Query  266  VMTPTLEEWCES  231
            V  PTL EWCES
Sbjct  182  VAIPTLNEWCES  193



>ref|XP_010249652.1| PREDICTED: nicotinamidase isoform X1 [Nelumbo nucifera]
Length=195

 Score =   288 bits (736),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW++TALL+IDMQ DFILPGG M V G QAIVP+V+KAVEVAR R IP+IWVVREHDP G
Sbjct  4    KWKSTALLVIDMQKDFILPGGLMQVAGGQAIVPSVVKAVEVARQRDIPVIWVVREHDPMG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRH+Y  GK  P +KGSVG+ELVDGLVIKEGDY+LVKTRFSAFF T+LHS+LQ 
Sbjct  64   RDVELFRRHMYGDGKFGPITKGSVGSELVDGLVIKEGDYKLVKTRFSAFFATHLHSFLQG  123

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
             G+ +LVITGVQTPNCIRQTVFDAV+ +YQ VTVIVDATAAAT E+H +NIFDMKNIGV 
Sbjct  124  AGVNNLVITGVQTPNCIRQTVFDAVSLDYQTVTVIVDATAAATSEVHLANIFDMKNIGVA  183

Query  260  TPTLEEWCESG  228
             PTL+EW  SG
Sbjct  184  IPTLQEWIGSG  194



>gb|AEC10981.1| isochorismatase hydrolase family protein [Camellia sinensis]
Length=200

 Score =   283 bits (725),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = -2

Query  818  TSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVR  639
            +S  + K  NTALL+IDMQ DFILP G M V G Q+IVP VI AVE+AR RGI +IWVVR
Sbjct  3    SSSDNHKSNNTALLVIDMQKDFILPDGLMRVDGGQSIVPKVINAVELARRRGILVIWVVR  62

Query  638  EHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNL  459
            EHDP GRD ELFRRHLYS  K  PTSKGSVGAELVDGLVIKEGDY++VKTRFSAFF T+L
Sbjct  63   EHDPLGRDVELFRRHLYSGEKAGPTSKGSVGAELVDGLVIKEGDYKVVKTRFSAFFATHL  122

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDM  279
            +S+L++ GI+SLV+ GVQTPNCIRQTVFDAVA +Y+ VTVIVDATAAATP++H +NIFDM
Sbjct  123  NSFLKTAGISSLVVIGVQTPNCIRQTVFDAVALDYKNVTVIVDATAAATPDVHAANIFDM  182

Query  278  KNIGVMTPTLEEWCES  231
            KNIGV TPTLEEWC+S
Sbjct  183  KNIGVSTPTLEEWCKS  198



>ref|XP_004506892.1| PREDICTED: peroxyureidoacrylate/ureidoacrylate amidohydrolase 
RutB-like [Cicer arietinum]
Length=195

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W +TALL+IDMQN+FI   GP+ V G   IVPNVIKAVEVAR RGI I+WVVREHDP GR
Sbjct  5    WNHTALLVIDMQNNFIEDEGPIQVKGGXEIVPNVIKAVEVARQRGILIVWVVREHDPLGR  64

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRHLY+  K  PTSKG+ GAELV+GLVI+EGDY+LVKTRFSAFF+T+LHS+LQ  
Sbjct  65   DVELFRRHLYTSAKVGPTSKGNEGAELVEGLVIREGDYKLVKTRFSAFFSTHLHSFLQGA  124

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMT  258
            GI SLVITGVQTPNCIRQTVFDAVA +YQPVTV+VDATAAATP+IH +N+FDMKNIGV T
Sbjct  125  GINSLVITGVQTPNCIRQTVFDAVALDYQPVTVLVDATAAATPDIHLANVFDMKNIGVST  184

Query  257  PTLEEWCES  231
            PTL+EW ES
Sbjct  185  PTLQEWSES  193



>gb|KHN04223.1| Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB [Glycine 
soja]
Length=266

 Score =   281 bits (718),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 174/211 (82%), Gaps = 2/211 (1%)
 Frame = -2

Query  866  SIQFKNSL*LS*AAPFTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKA  687
            S++ K+ L ++ A P   MA   W  TALL+IDMQ DFI  GGPM V G + IVPNVIKA
Sbjct  55   SLRSKSVLAVAGADPL-EMAE-DWNRTALLVIDMQKDFIEDGGPMLVKGGKDIVPNVIKA  112

Query  686  VEVARNRGIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGD  507
            V+VAR RGI I+WVVREHDP GRD ELFRRHLY+ GK  PTSKGS GAELVDGLVIKEGD
Sbjct  113  VDVARQRGILIVWVVREHDPLGRDVELFRRHLYAAGKVGPTSKGSEGAELVDGLVIKEGD  172

Query  506  YRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivda  327
            Y+LVKTRFSAFF T+LHS LQ  GI SLV+TGVQTPNCIRQTV+DAVA +YQPVTVIVDA
Sbjct  173  YKLVKTRFSAFFATHLHSVLQGAGINSLVVTGVQTPNCIRQTVYDAVALDYQPVTVIVDA  232

Query  326  taaaTPEIHTSNIFDMKNIGVMTPTLEEWCE  234
            TAAATP+IH +N+FDM+NIGV TPTL+EW E
Sbjct  233  TAAATPDIHLANVFDMENIGVATPTLQEWSE  263



>gb|ACJ85352.1| unknown [Medicago truncatula]
 gb|AFK39405.1| unknown [Medicago truncatula]
 gb|KEH28720.1| isochorismatase hydrolase family protein [Medicago truncatula]
Length=195

 Score =   278 bits (710),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W +TALL+IDMQ DFI    P++V G + +VPNVIKAVE+AR RGI I+WVVREHDP GR
Sbjct  5    WNHTALLVIDMQKDFIKDESPVNVKGGKDVVPNVIKAVEIARQRGILIVWVVREHDPLGR  64

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRHLY+ GK  PTSKG+ GAELV+GLVIKEGDY++VKTRFSAFF+T+LHS+LQ  
Sbjct  65   DVELFRRHLYAEGKVGPTSKGTEGAELVNGLVIKEGDYKVVKTRFSAFFSTHLHSFLQGA  124

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMT  258
            G+ SLV+TGVQTPNCIRQTVFDAVA +YQPVTV+VDATAAATP+IH +N+ DMKNIGV T
Sbjct  125  GVNSLVVTGVQTPNCIRQTVFDAVALDYQPVTVLVDATAAATPDIHLANVLDMKNIGVAT  184

Query  257  PTLEEWCES  231
            PTL+EW ES
Sbjct  185  PTLQEWSES  193



>ref|XP_006857450.1| hypothetical protein AMTR_s00067p00177560 [Amborella trichopoda]
 gb|ERN18917.1| hypothetical protein AMTR_s00067p00177560 [Amborella trichopoda]
Length=193

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREH  633
            M   KW+ TALL+IDMQNDFILPGG MHV G Q+++P V KAV +AR RG  I+WVVREH
Sbjct  1    MEENKWKKTALLVIDMQNDFILPGGSMHVAGGQSVIPAVKKAVAIARERGALIVWVVREH  60

Query  632  DPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHS  453
            DPSGRD E FRRHLY  GK +P SKG+ GAELV+GLVI+EGDY+L KTR SAFF T+LH 
Sbjct  61   DPSGRDVEYFRRHLYGVGKERPVSKGTKGAELVEGLVIEEGDYKLEKTRMSAFFATHLHL  120

Query  452  YLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKN  273
             LQS GIT +V+ GVQTPNCIRQTVFDAVA +Y+ VTV+ DATAAA+PE+H +N+FDMKN
Sbjct  121  LLQSVGITDIVVVGVQTPNCIRQTVFDAVALDYRSVTVLTDATAAASPEVHEANLFDMKN  180

Query  272  IGVMTPTLEEWC  237
            +GV TPTL EWC
Sbjct  181  VGVATPTLLEWC  192



>ref|XP_010033854.1| PREDICTED: uncharacterized protein LOC104423090 isoform X1 [Eucalyptus 
grandis]
 gb|KCW53692.1| hypothetical protein EUGRSUZ_J02954 [Eucalyptus grandis]
Length=195

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +W+ TALL+IDMQ DFI  G  M VGG +AIVPNV++AVE+AR RG+ ++WVVREHDP G
Sbjct  4    QWKRTALLVIDMQKDFIEEGSVMWVGGGKAIVPNVMEAVELARRRGLLVVWVVREHDPQG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRH YS GK  PTSKGS GAELVDGL I+EGDY+LVKTRFSAFF T+LHS LQ 
Sbjct  64   RDVELFRRHFYSSGKLGPTSKGSAGAELVDGLEIREGDYKLVKTRFSAFFATHLHSVLQG  123

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
             GI SLVI GVQTPNCIRQTVFDAVA +Y+ VTV+VDATAAATPE+H +NIFDMKNIGV 
Sbjct  124  AGIDSLVIAGVQTPNCIRQTVFDAVALDYRSVTVLVDATAAATPEVHHANIFDMKNIGVS  183

Query  260  TPTLEEWCESG  228
            TPTL+EW +S 
Sbjct  184  TPTLQEWRQSA  194



>ref|XP_010915868.1| PREDICTED: uncharacterized protein LOC105040847 isoform X1 [Elaeis 
guineensis]
Length=197

 Score =   275 bits (703),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 3/194 (2%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVR  639
            MA+ K   TA+L+IDMQNDF+LP    PM V G +AIVP+V+KA+ VAR RGI +IWVVR
Sbjct  1    MAAAKRSETAMLVIDMQNDFVLPEMESPMLVAGGEAIVPSVVKAISVARERGIFVIWVVR  60

Query  638  EHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNL  459
            EHDP GRD ELFRRHLYS G+  PT+KG+ GA LVDGL IKEG+Y+LVKTRFSAFF T+L
Sbjct  61   EHDPMGRDVELFRRHLYSNGE-GPTAKGAKGAALVDGLAIKEGEYKLVKTRFSAFFATHL  119

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDM  279
            HS LQS+GI SLVI GVQTPNCIRQTVFDAVA +YQ VTVIVDATAAATPEIH++NI DM
Sbjct  120  HSLLQSSGIKSLVIVGVQTPNCIRQTVFDAVALDYQTVTVIVDATAAATPEIHSANIRDM  179

Query  278  KNIGVMTPTLEEWC  237
            KNIGV+TPTL+EWC
Sbjct  180  KNIGVLTPTLQEWC  193



>ref|XP_007215992.1| hypothetical protein PRUPE_ppa011798mg [Prunus persica]
 gb|EMJ17191.1| hypothetical protein PRUPE_ppa011798mg [Prunus persica]
Length=195

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            + KW++TALL+IDMQ+DF+   GPM V G +AIVPNVIKAV++AR RG+ ++WVVREHDP
Sbjct  2    ANKWKHTALLVIDMQHDFVDVDGPMLVSGGKAIVPNVIKAVQIARQRGMLVVWVVREHDP  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
             GRD ELFRRHLY  GK  PT KG  GAELV GLVI+EGDY+LVKTRFSAFF T+L S+L
Sbjct  62   LGRDVELFRRHLYPAGKVGPTVKGQFGAELVHGLVIQEGDYKLVKTRFSAFFATHLDSFL  121

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            +  GI SLV+TGVQTPNCIRQTVFD VA +Y+ VTV++DATAAATPE+H +NI DMKNIG
Sbjct  122  KGAGIDSLVVTGVQTPNCIRQTVFDGVALDYKSVTVVLDATAAATPEVHAANILDMKNIG  181

Query  266  VMTPTLEEWCES  231
            V TPTL+EWCES
Sbjct  182  VATPTLQEWCES  193



>ref|XP_010033855.1| PREDICTED: uncharacterized protein LOC104423090 isoform X2 [Eucalyptus 
grandis]
Length=195

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +W+ TALL+IDM  DFI  G  M VGG +AIVPNV++AVE+AR RG+ ++WVVREHDP G
Sbjct  4    QWKRTALLVIDMHKDFIEEGSVMWVGGGKAIVPNVMEAVELARRRGLLVVWVVREHDPQG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRH YS GK  PTSKGS GAELVDGL I+EGDY+LVKTRFSAFF T+LHS LQ 
Sbjct  64   RDVELFRRHFYSSGKLGPTSKGSAGAELVDGLEIREGDYKLVKTRFSAFFATHLHSVLQG  123

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
             GI SLVI GVQTPNCIRQTVFDAVA +Y+ VTV+VDATAAATPE+H +NIFDMKNIGV 
Sbjct  124  AGIDSLVIAGVQTPNCIRQTVFDAVALDYRSVTVLVDATAAATPEVHHANIFDMKNIGVS  183

Query  260  TPTLEEWCESG  228
            TPTL+EW +S 
Sbjct  184  TPTLQEWRQSA  194



>ref|XP_009775692.1| PREDICTED: uncharacterized protein LOC104225565 [Nicotiana sylvestris]
Length=194

 Score =   273 bits (699),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 163/197 (83%), Gaps = 7/197 (4%)
 Frame = -2

Query  818  TSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVR  639
            + +  GKW+N ALL+IDMQ DFI   GPM V G QAIVPNVIKAVEVARN GI I+WVVR
Sbjct  3    SELNVGKWKNVALLVIDMQKDFIF--GPMQVKGGQAIVPNVIKAVEVARNCGIHIVWVVR  60

Query  638  EHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIK-EGDYRLVKTRFSAFFNTN  462
            E+DP GRD ELFRRH     KPK  SKGSVGAELVDGLV+  E DY+LVKTRFSAF NT+
Sbjct  61   ENDPLGRDVELFRRHF----KPKLASKGSVGAELVDGLVMDVEEDYKLVKTRFSAFLNTH  116

Query  461  LHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFD  282
            LHSYLQ+NGIT LV TGVQTPNCIRQTVFDAV+ +Y+ VTVI DATAAATP+IH +NI D
Sbjct  117  LHSYLQTNGITDLVFTGVQTPNCIRQTVFDAVSLDYKQVTVITDATAAATPDIHIANILD  176

Query  281  MKNIGVMTPTLEEWCES  231
            MKNIGV TPTLEEWC+S
Sbjct  177  MKNIGVATPTLEEWCQS  193



>ref|XP_009593687.1| PREDICTED: uncharacterized protein LOC104090325 [Nicotiana tomentosiformis]
Length=193

 Score =   272 bits (696),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 162/192 (84%), Gaps = 7/192 (4%)
 Frame = -2

Query  803  GKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            GKW+N ALL+IDMQ DFI   GPM V G QAIVPNVIKAVEVARN GI I+WVVRE+DP 
Sbjct  7    GKWKNVALLVIDMQIDFIF--GPMQVKGGQAIVPNVIKAVEVARNCGIHIVWVVRENDPL  64

Query  623  GRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIK-EGDYRLVKTRFSAFFNTNLHSYL  447
            GRD ELFRRHL    KPK  SKGSVGAEL+DGLV+  E DY+LVKTRFSAF NT+LHSY 
Sbjct  65   GRDVELFRRHL----KPKLASKGSVGAELIDGLVMDVEKDYKLVKTRFSAFLNTHLHSYF  120

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            Q+NGIT+LV TGVQTPNCIRQTVFDAV+ +Y+ VTVI DATAAATP+IH +NI DMKNIG
Sbjct  121  QTNGITNLVFTGVQTPNCIRQTVFDAVSLDYKQVTVITDATAAATPDIHIANILDMKNIG  180

Query  266  VMTPTLEEWCES  231
            V TPTLEEWC+S
Sbjct  181  VATPTLEEWCQS  192



>ref|XP_009759231.1| PREDICTED: uncharacterized protein LOC104211802 isoform X2 [Nicotiana 
sylvestris]
Length=186

 Score =   272 bits (695),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  743  GGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPT  564
            G PM V G +AIVPNVIK VEVARNR IPIIWVVREHDP GRD ELFRRHLY  GKPKPT
Sbjct  13   GAPMLVKGGEAIVPNVIKTVEVARNRCIPIIWVVREHDPLGRDVELFRRHLYGDGKPKPT  72

Query  563  SKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQ  384
            SKGSVGAELVDGLVI+E DY+LVKTRFSAFFNTNLHSYLQ  GIT+LVI GVQTPNCIRQ
Sbjct  73   SKGSVGAELVDGLVIQEDDYKLVKTRFSAFFNTNLHSYLQGIGITNLVIIGVQTPNCIRQ  132

Query  383  TVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLEEWCES  231
            TVFDAVA +Y+ VTVI+DATAAATP+IH +NI DMKN+GV+TPTLEEWC+S
Sbjct  133  TVFDAVALDYERVTVIIDATAAATPDIHIANIIDMKNVGVVTPTLEEWCQS  183



>ref|XP_011080713.1| PREDICTED: uncharacterized protein LOC105163888 [Sesamum indicum]
Length=194

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W+NTALL+IDMQ DFI   GP+ V   +AIVPNVIKAVEVAR+R IPI+WVVREHDP GR
Sbjct  8    WKNTALLVIDMQKDFIY--GPICVKDGEAIVPNVIKAVEVARSRSIPIVWVVREHDPLGR  65

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D EL RRH YS  K KP +KGSVGAELV+GLVIK+ DY+LVKTRFSAFFNT+LHS+LQ  
Sbjct  66   DVELCRRHFYSADKLKPAAKGSVGAELVEGLVIKDDDYKLVKTRFSAFFNTHLHSFLQGA  125

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMT  258
            G+  LVITGVQTPNCIRQTVFDAVA +Y  VTVIVDATAAATP+IH +NI DMKNIG+ T
Sbjct  126  GVNKLVITGVQTPNCIRQTVFDAVALDYHTVTVIVDATAAATPDIHNANIIDMKNIGIAT  185

Query  257  PTLEEWC  237
            PT+EEWC
Sbjct  186  PTVEEWC  192



>ref|XP_008228484.1| PREDICTED: uncharacterized protein LOC103327891 [Prunus mume]
Length=195

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            + KW++TALL+IDMQ+DF+   GP  V G +AIVPNVIKAV++AR RG+ ++WVVREHDP
Sbjct  2    ADKWKHTALLVIDMQHDFVDVDGPTLVSGGKAIVPNVIKAVQIARQRGMLVVWVVREHDP  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
             GRD ELFRRHLY  GK  PT KG  GAELVDGLVI+EGDY+LVKTRFSAFF T+L S+L
Sbjct  62   LGRDVELFRRHLYPAGKVGPTVKGQFGAELVDGLVIQEGDYKLVKTRFSAFFATHLDSFL  121

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            +  GI SLV+TGVQTPNCIRQTVFD VA +Y+ VTV++DATAAATP++H +NI DMK+IG
Sbjct  122  KGAGIDSLVVTGVQTPNCIRQTVFDGVALDYKSVTVVLDATAAATPDVHAANILDMKSIG  181

Query  266  VMTPTLEEWCES  231
            V TPTL+EWCES
Sbjct  182  VATPTLQEWCES  193



>ref|XP_006406865.1| hypothetical protein EUTSA_v10021560mg [Eutrema salsugineum]
 dbj|BAJ33727.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48318.1| hypothetical protein EUTSA_v10021560mg [Eutrema salsugineum]
Length=196

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 158/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +W NTALL+IDMQNDFI  G  M V G ++IVPNVIK VE+AR RGI +IWVVREHDP G
Sbjct  4    RWTNTALLVIDMQNDFIEEGSVMQVKGGKSIVPNVIKVVELARQRGILVIWVVREHDPRG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIK-EGDYRLVKTRFSAFFNTNLHSYLQ  444
            RD ELFRRHLYS  K  PT KG+VGAELVDGL+I+ E DY++VKTRFSAFF TNLHS+LQ
Sbjct  64   RDVELFRRHLYSSEKVGPTVKGTVGAELVDGLIIREEEDYKIVKTRFSAFFGTNLHSFLQ  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            ++G+T LVI GVQTPNCIRQTVFDAV  +Y  VTVI DATAAATPEIHT+NI DMKNIGV
Sbjct  124  TSGVTKLVIAGVQTPNCIRQTVFDAVELDYPYVTVIADATAAATPEIHTANILDMKNIGV  183

Query  263  MTPTLEEWCES  231
             TPTL EW E 
Sbjct  184  KTPTLHEWSEE  194



>ref|XP_002284348.1| PREDICTED: uncharacterized protein LOC100242883 [Vitis vinifera]
Length=195

 Score =   270 bits (691),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            ++TALL+IDMQ DF+   G   V G +AIVP+VIKAVEVAR  GI ++WVVREHDP GRD
Sbjct  6    KHTALLVIDMQKDFVEEDGLTRVDGGKAIVPSVIKAVEVARELGIFVVWVVREHDPLGRD  65

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
             ELFRRH Y PGK  P S+GSVGAELVDGLVIKEGDY+LVKTRFSAFF T+LHS+LQSNG
Sbjct  66   VELFRRHFYGPGKIGPVSEGSVGAELVDGLVIKEGDYKLVKTRFSAFFATHLHSFLQSNG  125

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTP  255
            I S+VI GVQTPNCIRQTVFDAVA +YQ VTVIVDATAAATP+IH +N+ DMKN+GV TP
Sbjct  126  INSVVIVGVQTPNCIRQTVFDAVALDYQSVTVIVDATAAATPDIHFANVRDMKNVGVATP  185

Query  254  TLEEWCES  231
            TL+EW ES
Sbjct  186  TLQEWRES  193



>ref|NP_001236656.1| uncharacterized protein LOC100527482 [Glycine max]
 gb|ACU16576.1| unknown [Glycine max]
Length=271

 Score =   272 bits (696),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 171/207 (83%), Gaps = 2/207 (1%)
 Frame = -2

Query  866  SIQFKNSL*LS*AAPFTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKA  687
            S++ K+ L ++ A P   MA   W  TALL+IDMQ DFI  GGPM V G + IVPNVIKA
Sbjct  55   SLRSKSVLAVAGADPL-EMAE-DWNRTALLVIDMQKDFIEDGGPMLVKGGKDIVPNVIKA  112

Query  686  VEVARNRGIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGD  507
            V+VAR RGI I+WVVREHDP GRD ELFRRHLY+ GK  PTSKGS GAELVDGLVIKEGD
Sbjct  113  VDVARQRGILIVWVVREHDPLGRDVELFRRHLYAAGKVGPTSKGSEGAELVDGLVIKEGD  172

Query  506  YRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivda  327
            Y+LVKTRFSAFF T+LHS LQ  GI SLV+TGVQTPNCIRQTV+DAVA +YQPVTVIVDA
Sbjct  173  YKLVKTRFSAFFATHLHSVLQGVGINSLVVTGVQTPNCIRQTVYDAVALDYQPVTVIVDA  232

Query  326  taaaTPEIHTSNIFDMKNIGVMTPTLE  246
            TAAATP+IH +N+FDM+NIGV TPTL+
Sbjct  233  TAAATPDIHLANVFDMENIGVATPTLQ  259



>emb|CBI36112.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   272 bits (696),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 176/226 (78%), Gaps = 8/226 (4%)
 Frame = -2

Query  884  YAWKFNSIQFKNSL*LS*AAPFTSMASGK-W-------RNTALLIIDMQNDFILPGGPMH  729
            +++    I FK +  L    P++ ++S + W       ++TALL+IDMQ DF+   G   
Sbjct  42   HSFPRKKISFKTNRVLRIRFPYSYLSSSRNWVAMANTRKHTALLVIDMQKDFVEEDGLTR  101

Query  728  VGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPTSKGSV  549
            V G +AIVP+VIKAVEVAR  GI ++WVVREHDP GRD ELFRRH Y PGK  P S+GSV
Sbjct  102  VDGGKAIVPSVIKAVEVARELGIFVVWVVREHDPLGRDVELFRRHFYGPGKIGPVSEGSV  161

Query  548  GAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDA  369
            GAELVDGLVIKEGDY+LVKTRFSAFF T+LHS+LQSNGI S+VI GVQTPNCIRQTVFDA
Sbjct  162  GAELVDGLVIKEGDYKLVKTRFSAFFATHLHSFLQSNGINSVVIVGVQTPNCIRQTVFDA  221

Query  368  VAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLEEWCES  231
            VA +YQ VTVIVDATAAATP+IH +N+ DMKN+GV TPTL+EW ES
Sbjct  222  VALDYQSVTVIVDATAAATPDIHFANVRDMKNVGVATPTLQEWRES  267



>ref|XP_008783254.1| PREDICTED: uncharacterized protein LOC103702554 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008783255.1| PREDICTED: uncharacterized protein LOC103702554 isoform X1 [Phoenix 
dactylifera]
Length=197

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 163/194 (84%), Gaps = 3/194 (2%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVR  639
            MA+ K   TA+L+IDMQNDFILP    P+ V G +AIV +VIKAV VAR RG+ +IWVVR
Sbjct  1    MAAAKGSETAMLVIDMQNDFILPELESPVMVAGGEAIVSSVIKAVSVARERGMFVIWVVR  60

Query  638  EHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNL  459
            EHDP GRD ELFRRHLYS G+  PT KG+ GA LVDGL IKEG+Y+LVKTRFSAFF T+L
Sbjct  61   EHDPLGRDVELFRRHLYSNGE-GPTMKGAKGAALVDGLAIKEGEYKLVKTRFSAFFATHL  119

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDM  279
            HS LQS+GI SLV+ GVQTPNCIRQTVFDAVA +YQ VTVIVDATAAATPEIH++NI DM
Sbjct  120  HSLLQSSGIKSLVVVGVQTPNCIRQTVFDAVALDYQTVTVIVDATAAATPEIHSANIRDM  179

Query  278  KNIGVMTPTLEEWC  237
            KNIGV+TPTL+EWC
Sbjct  180  KNIGVLTPTLQEWC  193



>ref|XP_009628048.1| PREDICTED: uncharacterized protein LOC104118502 isoform X2 [Nicotiana 
tomentosiformis]
Length=189

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  743  GGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPT  564
            G PM V G +AIVPNVIK VEV R+RGIPIIWVVREHD  GRD ELFRRHLY  GKPKPT
Sbjct  13   GAPMLVKGGEAIVPNVIKTVEVTRSRGIPIIWVVREHDQLGRDVELFRRHLYGDGKPKPT  72

Query  563  SKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQ  384
            SKGSVGAELVDGLVI+E DY+LVKTRFSAFFNTNLHSYLQ  GIT+LVI GVQTPNCIRQ
Sbjct  73   SKGSVGAELVDGLVIEEDDYKLVKTRFSAFFNTNLHSYLQGIGITNLVIIGVQTPNCIRQ  132

Query  383  TVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLEEWCES  231
            TVFDAVA +Y+ VTVI+DATAAATP+IH +NIFDMKN+GV TPTLEEWC S
Sbjct  133  TVFDAVALDYERVTVIIDATAAATPDIHIANIFDMKNVGVATPTLEEWCRS  183



>ref|XP_006465637.1| PREDICTED: uncharacterized protein LOC102620945 [Citrus sinensis]
Length=196

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREH  633
            MA  K+ NTALL+IDMQNDFIL  G M V G +AIVPNVIKAVE+AR  GI ++WVVREH
Sbjct  1    MADTKFNNTALLVIDMQNDFILDDGLMRVDGGKAIVPNVIKAVEIARQHGILVVWVVREH  60

Query  632  DPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHS  453
            DP GRD ELFRRHLYS G   PTSKGS GAELVDGL IKEGDY++VK RFSAFF T+L+S
Sbjct  61   DPQGRDVELFRRHLYSTGTVGPTSKGSPGAELVDGLEIKEGDYKVVKMRFSAFFATHLNS  120

Query  452  YLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKN  273
            +L++ GI SLVI GVQTPNCIRQTVFDAV  +Y+ +T+IVDATAAATPEIH +NIFDMKN
Sbjct  121  FLRTAGIDSLVIVGVQTPNCIRQTVFDAVELDYKSITIIVDATAAATPEIHAANIFDMKN  180

Query  272  IGVMTPTLEEWCES  231
             GV   +L+EW E+
Sbjct  181  AGVAALSLQEWSEA  194



>ref|XP_010545692.1| PREDICTED: uncharacterized protein LOC104817977 [Tarenaya hassleriana]
Length=196

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            + +W+NTALL+IDMQ DFI  G  M V G +AIVPNVI+ VE+AR RG+ +IWVVREHDP
Sbjct  2    ADRWKNTALLVIDMQKDFIREGSVMQVKGGKAIVPNVIRTVELARRRGVLVIWVVREHDP  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
             GRD ELFRRHLY+PGK  PT K + GAEL DGL+IKEGDY++VKTRFSAFF T+LHS+L
Sbjct  62   RGRDVELFRRHLYTPGKVGPTVKDTSGAELEDGLIIKEGDYKIVKTRFSAFFATHLHSFL  121

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            Q++G+  LVI GVQTPNCIR T FDAVA +Y  VTVIVD TAA+TPEIH +NI DMKN+G
Sbjct  122  QTSGVNKLVIAGVQTPNCIRATAFDAVAMDYPSVTVIVDTTAASTPEIHAANILDMKNVG  181

Query  266  VMTPTLEEWCES  231
            + TPTL+EW E 
Sbjct  182  IATPTLQEWSED  193



>ref|XP_006426933.1| hypothetical protein CICLE_v10026541mg [Citrus clementina]
 gb|ESR40173.1| hypothetical protein CICLE_v10026541mg [Citrus clementina]
Length=196

 Score =   268 bits (684),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREH  633
            MA  K+ NTALL+IDMQNDFIL  G M V G +AIVPNVIKAVE+AR  GI ++WVVREH
Sbjct  1    MADTKFNNTALLVIDMQNDFILDDGLMRVDGGKAIVPNVIKAVEIARQHGILVVWVVREH  60

Query  632  DPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHS  453
            DP GRD ELFR+HLYS G   PTSKGS GAELVDGL IKEGDY++VK RFSAFF T+L+S
Sbjct  61   DPLGRDVELFRQHLYSTGTVGPTSKGSPGAELVDGLEIKEGDYKVVKMRFSAFFATHLNS  120

Query  452  YLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKN  273
            +L++ GI SLVI GVQTPNCIRQTVFDAV  +Y+ +T+IVDATAAATPEIH +NIFDMKN
Sbjct  121  FLRTAGIDSLVIVGVQTPNCIRQTVFDAVELDYKSITIIVDATAAATPEIHAANIFDMKN  180

Query  272  IGVMTPTLEEWCES  231
            +GV   +L+EW E+
Sbjct  181  VGVAALSLQEWSEA  194



>ref|XP_006359482.1| PREDICTED: uncharacterized protein LOC102601317 [Solanum tuberosum]
Length=222

 Score =   268 bits (686),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 164/211 (78%), Gaps = 22/211 (10%)
 Frame = -2

Query  803  GKWRNTALLIIDMQ--------------------NDFILPGGPMHVGGAQAIVPNVIKAV  684
            GKW+N ALL+IDMQ                     DFI  GGP+ V G +AIVPNVIKAV
Sbjct  8    GKWKNVALLVIDMQPRYQQKILLTLAPPLLISFRKDFI--GGPVKVKGGEAIVPNVIKAV  65

Query  683  EVARNRGIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDY  504
            +VAR  GI I+WVVRE DP GRD ELFRRH Y+  K K  SKGSVGAELVDGL+I+E DY
Sbjct  66   QVARKCGIHIVWVVREIDPLGRDVELFRRHFYTAAKTKVASKGSVGAELVDGLIIEENDY  125

Query  503  RLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdat  324
            +LVKTRFSAF NT+LHSYL +NGIT LVITGVQTPNCIRQTVFDAV+ +Y+ V+VI DAT
Sbjct  126  KLVKTRFSAFLNTHLHSYLHTNGITDLVITGVQTPNCIRQTVFDAVSLDYKHVSVITDAT  185

Query  323  aaaTPEIHTSNIFDMKNIGVMTPTLEEWCES  231
            AAATP++HT+NI DMKNIGV+TPTLEEWC+S
Sbjct  186  AAATPDVHTANIVDMKNIGVVTPTLEEWCQS  216



>ref|XP_008380905.1| PREDICTED: uncharacterized protein LOC103443787 [Malus domestica]
Length=201

 Score =   268 bits (684),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            + KW++TALL+IDMQ+DFI   GPM + G +AIVPNVIKAV++AR RGI ++WVVREHDP
Sbjct  2    ADKWKHTALLVIDMQHDFIDVDGPMLINGGKAIVPNVIKAVQIARQRGIQVVWVVREHDP  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
             GRD ELFRRHLY  GK  PT KG  GAELVDGLVI++GDY+LVKTRFSAFF T+L S+L
Sbjct  62   LGRDVELFRRHLYPAGKVGPTVKGERGAELVDGLVIEQGDYKLVKTRFSAFFATHLDSFL  121

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            + +GI SLV+TGVQTPNCIRQTVFD VA +Y+ VTVI+DATAAATP++H +NI DMKNIG
Sbjct  122  KGSGIDSLVVTGVQTPNCIRQTVFDGVALDYKYVTVILDATAAATPDVHAANILDMKNIG  181

Query  266  VMTPTLEEWCE  234
            V TP+L+EW E
Sbjct  182  VATPSLQEWSE  192



>ref|XP_007135662.1| hypothetical protein PHAVU_010G147700g [Phaseolus vulgaris]
 gb|ESW07656.1| hypothetical protein PHAVU_010G147700g [Phaseolus vulgaris]
Length=270

 Score =   270 bits (691),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 164/202 (81%), Gaps = 1/202 (0%)
 Frame = -2

Query  839  LS*AAPFTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGI  660
            L+ A    +MA    R TALL+IDMQ DFI  GG + V G + IVPNVIKAV+VAR RGI
Sbjct  67   LARAHSLETMAEESNR-TALLVIDMQKDFIEGGGSLLVKGGKEIVPNVIKAVDVARQRGI  125

Query  659  PIIWVVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFS  480
             I+WVVREHDP GRD ELFRRHLY+ GK  P SKGS G ELVDGLVIKE DY+LVKTRFS
Sbjct  126  LIVWVVREHDPLGRDVELFRRHLYAAGKVGPLSKGSEGLELVDGLVIKEEDYKLVKTRFS  185

Query  479  AFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
            AFF T+LHS LQ  GI SLVITGVQTPNCIRQTV+DAVA +YQPVTVIVDATAAATP+IH
Sbjct  186  AFFATHLHSVLQGAGINSLVITGVQTPNCIRQTVYDAVALDYQPVTVIVDATAAATPDIH  245

Query  299  TSNIFDMKNIGVMTPTLEEWCE  234
             +N+FDMKNIGV TPTL+EW E
Sbjct  246  LANLFDMKNIGVATPTLQEWSE  267



>ref|NP_001235163.1| uncharacterized protein LOC100499982 [Glycine max]
 gb|ACU14483.1| unknown [Glycine max]
 gb|KHN47835.1| Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB [Glycine 
soja]
Length=195

 Score =   267 bits (683),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W  TALL+IDMQ DFI    P+ + G + IVPNVIKAVEVAR RGI I+WVVRE+DP GR
Sbjct  5    WNRTALLVIDMQKDFIEDWSPVALKGGKDIVPNVIKAVEVARQRGILIVWVVRENDPLGR  64

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRH Y+ GK  P +KGS GAELVDGLVIKEGDY+LVKTRFSAFF T+LHS LQ  
Sbjct  65   DVELFRRHHYTAGKVGPANKGSEGAELVDGLVIKEGDYKLVKTRFSAFFATHLHSVLQGA  124

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMT  258
            GI +LV+TGVQTPNCIRQTVFDAV+ +YQPVTVIVDATAAATP++H +N+FDMKNIGV T
Sbjct  125  GINNLVVTGVQTPNCIRQTVFDAVSLDYQPVTVIVDATAAATPDVHQANMFDMKNIGVAT  184

Query  257  PTLEEWCES  231
            PTL+EW ES
Sbjct  185  PTLQEWSES  193



>ref|XP_009353589.1| PREDICTED: uncharacterized protein LOC103944848 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009353590.1| PREDICTED: uncharacterized protein LOC103944848 isoform X3 [Pyrus 
x bretschneideri]
Length=200

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W++TALL+IDMQ+DFI   GPM V G +AIVPNVIKAV++AR RGI ++WVVREHDP GR
Sbjct  4    WKHTALLVIDMQHDFIDVAGPMLVNGGKAIVPNVIKAVQIARQRGIQVVWVVREHDPLGR  63

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRHLY  GK  PT KG  GAELVDGLVI++GDY+LVKTRFSAFF T L S+L+ +
Sbjct  64   DVELFRRHLYPAGKVGPTVKGERGAELVDGLVIEQGDYKLVKTRFSAFFATPLDSFLKGS  123

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMT  258
            GI SLV+TGVQTPNCIRQTVFD VA +Y+ VTVI+DATAAATP+IH +NI DMKNIGV T
Sbjct  124  GIDSLVVTGVQTPNCIRQTVFDGVALDYKSVTVILDATAAATPDIHAANILDMKNIGVAT  183

Query  257  PTLEEWCE  234
            P+L+EW E
Sbjct  184  PSLQEWSE  191



>ref|XP_007024219.1| Isochorismatase family protein isoform 1 [Theobroma cacao]
 gb|EOY26841.1| Isochorismatase family protein isoform 1 [Theobroma cacao]
Length=195

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            + KW+ TAL++IDMQ D+IL    M V G +AIVPNVIKAVE+AR RGI ++WVVREHD 
Sbjct  2    ADKWKQTALIVIDMQKDYILEDKIMAVKGGKAIVPNVIKAVEIARQRGILVVWVVREHDY  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
             GRD ELFRRH YSP K  PT+KGSVGAELVDGLVIKE DY+LVKTRFSAFFNTNLH +L
Sbjct  62   FGRDVELFRRHFYSPEKGGPTTKGSVGAELVDGLVIKEEDYKLVKTRFSAFFNTNLHIFL  121

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            QSNG+ +LV+ GVQTPNCIRQTVFDAVA +YQ V VIVDATAAATPE+H ++IFDMKNIG
Sbjct  122  QSNGVNNLVVVGVQTPNCIRQTVFDAVAHDYQSVAVIVDATAAATPEVHDASIFDMKNIG  181

Query  266  VMTPTLEEWCES  231
            V TPTL+EWC++
Sbjct  182  VATPTLQEWCKT  193



>gb|KFK38971.1| hypothetical protein AALP_AA3G183400 [Arabis alpina]
Length=196

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 158/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +W+NTALL+IDMQNDFI  G  M V G ++I+PNV++ VE+AR RGI +IWVVREHDP G
Sbjct  4    RWKNTALLVIDMQNDFIDEGSVMQVKGGKSIIPNVVRVVELARQRGILVIWVVREHDPQG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIK-EGDYRLVKTRFSAFFNTNLHSYLQ  444
            RD ELFRRHLY   K  PT KG+VGAELVDGL+ K E DY++VKTRFSAFF TNLHS+LQ
Sbjct  64   RDVELFRRHLYKSEKVGPTVKGTVGAELVDGLMTKEEEDYKIVKTRFSAFFGTNLHSFLQ  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            ++G+ +LVI GVQTPNCIRQTVFDAV  +Y  VTVI DATAAATPEIHT+NI DMKNIGV
Sbjct  124  TSGVNNLVIAGVQTPNCIRQTVFDAVELDYPSVTVITDATAAATPEIHTANILDMKNIGV  183

Query  263  MTPTLEEWCES  231
             TP+L+EW E 
Sbjct  184  KTPSLQEWSEE  194



>ref|NP_566539.1| Isochorismatase family protein [Arabidopsis thaliana]
 sp|Q93Z51.1|NIC4_ARATH RecName: Full=Probable inactive nicotinamidase At3g16190 [Arabidopsis 
thaliana]
 gb|AAL25541.1| AT3g16190/MYA6_2 [Arabidopsis thaliana]
 gb|AAM64447.1| putative hydrolase [Arabidopsis thaliana]
 gb|AAN28858.1| At3g16190/MYA6_2 [Arabidopsis thaliana]
 gb|AEE75782.1| Isochorismatase family protein [Arabidopsis thaliana]
Length=196

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 157/191 (82%), Gaps = 1/191 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +WRNTALL+IDMQNDFI  G    V G ++IVPNVI+ VE+AR RGI +IWVVREHD  G
Sbjct  4    RWRNTALLVIDMQNDFIEEGAVTQVKGGKSIVPNVIRVVELARQRGILVIWVVREHDRQG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVI-KEGDYRLVKTRFSAFFNTNLHSYLQ  444
            RD ELFRRH YS  K  P  KG+VGAELVDGL+I +E DY++VKTRFSAFF+TNLHS+LQ
Sbjct  64   RDVELFRRHNYSSEKVGPVIKGTVGAELVDGLMINEEDDYKIVKTRFSAFFSTNLHSFLQ  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            ++G+T LVI GVQTPNCIRQTVFDAVA +Y  VTVI DATAAATPEIHT+NI DMKNIGV
Sbjct  124  TSGVTKLVIAGVQTPNCIRQTVFDAVALDYPNVTVITDATAAATPEIHTANILDMKNIGV  183

Query  263  MTPTLEEWCES  231
             TPTL EW E 
Sbjct  184  KTPTLHEWSEE  194



>ref|XP_010691375.1| PREDICTED: uncharacterized protein LOC104904714 [Beta vulgaris 
subsp. vulgaris]
Length=194

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 155/192 (81%), Gaps = 1/192 (1%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            + KW+ TAL +IDMQ DFILP GP+ V G  AI+PNVIKAVEVAR RG+ ++WVVREHD 
Sbjct  2    TDKWKKTALFVIDMQKDFILPDGPLLVDGGAAIIPNVIKAVEVARERGMLVVWVVREHDK  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
             GRD ELFRRHLYS  K  PT KG  GAELV+GL I EGDY+LVKTRFSAFF T+LHS L
Sbjct  62   LGRDVELFRRHLYSE-KGGPTVKGHEGAELVEGLEIHEGDYKLVKTRFSAFFATHLHSTL  120

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
               GI SLVI G+QTPNCIRQTVFDAVA NY  V+VIVDATAA TPE+H +NIFDM+NIG
Sbjct  121  LGAGIDSLVIVGIQTPNCIRQTVFDAVALNYPSVSVIVDATAAKTPEVHDANIFDMENIG  180

Query  266  VMTPTLEEWCES  231
            V TPTLEEWC +
Sbjct  181  VATPTLEEWCNA  192



>ref|XP_010915865.1| PREDICTED: uncharacterized protein LOC105040846 [Elaeis guineensis]
 ref|XP_010915866.1| PREDICTED: uncharacterized protein LOC105040846 [Elaeis guineensis]
 ref|XP_010915867.1| PREDICTED: uncharacterized protein LOC105040846 [Elaeis guineensis]
Length=278

 Score =   265 bits (677),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW  TA+L+IDMQNDFILP  PM V G QAIVP+VI+A+ VAR RGI +IWVVREHDP G
Sbjct  88   KWSKTAMLVIDMQNDFILPDRPMCVAGGQAIVPSVIQAISVARERGIFVIWVVREHDPLG  147

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLY+ G+  P   GS GA+LVDGL+IKEGDY+LVKTRFSAF  T LH  LQ+
Sbjct  148  RDVELFRRHLYTDGE-GPAMNGSKGADLVDGLLIKEGDYKLVKTRFSAFCATQLHLLLQT  206

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
            +G+ SLV+ GVQTPNCIRQTVFDAV+ +YQ VTVIVDATAAATPEIH +NI DMKNIGV 
Sbjct  207  SGVKSLVVVGVQTPNCIRQTVFDAVSLDYQSVTVIVDATAAATPEIHLANIRDMKNIGVA  266

Query  260  TPTLEEWCE  234
            TPTL+EWC 
Sbjct  267  TPTLQEWCS  275



>ref|XP_008783250.1| PREDICTED: uncharacterized protein LOC103702553 [Phoenix dactylifera]
 ref|XP_008783251.1| PREDICTED: uncharacterized protein LOC103702553 [Phoenix dactylifera]
 ref|XP_008783252.1| PREDICTED: uncharacterized protein LOC103702553 [Phoenix dactylifera]
 ref|XP_008783253.1| PREDICTED: uncharacterized protein LOC103702553 [Phoenix dactylifera]
Length=278

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW  TA+L+IDMQNDFILP  PM V G QAIVP+VI+A+ VAR RGI +IWVVREHDP G
Sbjct  88   KWSKTAMLVIDMQNDFILPESPMCVAGGQAIVPSVIQAISVARERGIFVIWVVREHDPLG  147

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLY+ GK  P + GS GA+LVDGL+IKEGDY+LVKTRFSAF    LHS LQ+
Sbjct  148  RDVELFRRHLYTDGK-GPATNGSKGADLVDGLLIKEGDYKLVKTRFSAFCAIQLHSLLQT  206

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
            +G+ SLV+ GVQTPNCIRQTVFDAV+ +YQ VTVIVDATAAATPEIH  NI DMKNIGV 
Sbjct  207  SGVKSLVVVGVQTPNCIRQTVFDAVSLDYQSVTVIVDATAAATPEIHLGNIRDMKNIGVA  266

Query  260  TPTLEEWCE  234
             PTL+EWC 
Sbjct  267  IPTLQEWCS  275



>ref|XP_002284352.1| PREDICTED: uncharacterized protein LOC100265171 [Vitis vinifera]
Length=195

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            ++TALL++DMQ DF+    P+ + G +AI+P+ IKAVEVAR  GI ++WVVREHDP GRD
Sbjct  6    KHTALLVVDMQKDFLDEDRPISLEGGKAIIPSAIKAVEVARELGILVVWVVREHDPQGRD  65

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
             E+FRR+ Y PGK  P +KGS GAEL+DGL IKEGDY+LVKTRFSAFF T+LHS LQSNG
Sbjct  66   VEVFRRNFYGPGKLSPATKGSEGAELIDGLAIKEGDYKLVKTRFSAFFATHLHSLLQSNG  125

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTP  255
            I S+V+ GVQTPNCIRQT FDAV+ +YQ VTVIVDATAAATP+IH +NI DMKN+GV TP
Sbjct  126  INSVVVVGVQTPNCIRQTAFDAVSLDYQSVTVIVDATAAATPDIHLANILDMKNVGVATP  185

Query  254  TLEEWCES  231
            TL++WC+S
Sbjct  186  TLQKWCQS  193



>ref|XP_006465738.1| PREDICTED: uncharacterized protein LOC102624440 [Citrus sinensis]
Length=198

 Score =   259 bits (663),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREH  633
            MA   W+NTALL++DMQNDFI   G + + G + I+PNVI+AVE+AR RGI ++WVVREH
Sbjct  1    MAHQNWKNTALLVMDMQNDFIADDGLVKMDGGKVILPNVIRAVEIARQRGILVVWVVREH  60

Query  632  DPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHS  453
            +P GRD ELFRRH YSPGK  P  KGS GAELVDGLVI+EGDY+LVKTRFSAFF T+LHS
Sbjct  61   NPLGRDVELFRRHRYSPGKVGPAVKGSRGAELVDGLVIREGDYKLVKTRFSAFFATHLHS  120

Query  452  YLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKN  273
            +LQ+    +++ +GVQTPNCIRQT FDA+A +YQPVTV+VDATAAATP++H +NI DMKN
Sbjct  121  FLQAIRAINVISSGVQTPNCIRQTAFDAIALDYQPVTVVVDATAAATPDVHAANIVDMKN  180

Query  272  IGVMTPTLEEWCE  234
             G+ T TL+EW E
Sbjct  181  FGIATATLQEWSE  193



>ref|XP_010503927.1| PREDICTED: uncharacterized protein LOC104781048 isoform X1 [Camelina 
sativa]
 ref|XP_010503935.1| PREDICTED: uncharacterized protein LOC104781048 isoform X2 [Camelina 
sativa]
 ref|XP_010503944.1| PREDICTED: uncharacterized protein LOC104781048 isoform X3 [Camelina 
sativa]
Length=196

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 155/191 (81%), Gaps = 1/191 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +W NTALL+IDMQNDFI  G  M V G ++IV NVIK VE+AR RGI +IWVVREHDP G
Sbjct  4    RWTNTALLVIDMQNDFIEEGSVMQVKGGKSIVANVIKVVELARQRGILVIWVVREHDPQG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIK-EGDYRLVKTRFSAFFNTNLHSYLQ  444
            RD E+FRRH Y+  K  PT KG+VGA LVDGLVI+ E DY++VKTRFSAFF TNLHS+LQ
Sbjct  64   RDVEIFRRHHYNSEKVGPTVKGTVGARLVDGLVIREEEDYKIVKTRFSAFFGTNLHSFLQ  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            ++G++ LVI GVQTPNCIRQTVFDAV  +Y  VTVI DATAAATPEIHT+NI DMKNIGV
Sbjct  124  TSGVSKLVIAGVQTPNCIRQTVFDAVELDYPNVTVIADATAAATPEIHTANILDMKNIGV  183

Query  263  MTPTLEEWCES  231
             TPTL EW + 
Sbjct  184  KTPTLHEWSKE  194



>ref|XP_011013249.1| PREDICTED: uncharacterized protein LOC105117329 isoform X1 [Populus 
euphratica]
Length=198

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = -2

Query  815  SMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
            SMA  KW  TALL+IDMQNDFIL  G M V G +AIVPNVIKAV++AR RGI ++WVVRE
Sbjct  2    SMAD-KWNQTALLVIDMQNDFILEDGLMKVNGGRAIVPNVIKAVDIARQRGILVVWVVRE  60

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            HDP GRDAELFRRHLYSPG   PTSKGSVGAELVDGLVIKEGDY+LVKTRFSAFF T+LH
Sbjct  61   HDPQGRDAELFRRHLYSPGNVGPTSKGSVGAELVDGLVIKEGDYKLVKTRFSAFFATHLH  120

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMK  276
            S+L + GI SLVI+GVQTPNCIRQTVFDAVA +YQPVTVIVDATAAATP IH  +  +  
Sbjct  121  SFLGTEGIKSLVISGVQTPNCIRQTVFDAVALDYQPVTVIVDATAAATPGIHDGSRKEEN  180

Query  275  NIGVMTPTLE  246
              G     LE
Sbjct  181  RKGKEEENLE  190



>ref|XP_010465631.1| PREDICTED: uncharacterized protein LOC104745947 [Camelina sativa]
Length=196

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +W NTALL+IDMQNDFI  G  M V G ++IV NVI  VE+AR RGI +IWVVREHDP G
Sbjct  4    RWTNTALLVIDMQNDFIEEGSVMQVKGGKSIVANVIGVVELARQRGILVIWVVREHDPQG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIK-EGDYRLVKTRFSAFFNTNLHSYLQ  444
            RD E+FRRH Y+  K  PT KG+VGA LVDGL+I+ E DY++VKTRFSAFF TNLHS+LQ
Sbjct  64   RDVEIFRRHHYNSEKVGPTVKGTVGARLVDGLIIREEEDYKIVKTRFSAFFGTNLHSFLQ  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            ++G++ LVI GVQTPNCIRQTVFDAV  +Y  VTVI DATAAATPEIHT+NI DMKNIGV
Sbjct  124  TSGVSKLVIAGVQTPNCIRQTVFDAVELDYPNVTVITDATAAATPEIHTANILDMKNIGV  183

Query  263  MTPTLEEWCE  234
             TPTL+EW E
Sbjct  184  KTPTLDEWSE  193



>ref|XP_002885128.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61387.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=196

 Score =   257 bits (657),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 156/191 (82%), Gaps = 1/191 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +WRNTALL+IDMQ DFI     + V G ++IVPNVI+ VE+AR  GI +IWVVREHDP G
Sbjct  4    RWRNTALLVIDMQKDFIEESSMIRVKGGKSIVPNVIRVVELARQHGILVIWVVREHDPRG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIK-EGDYRLVKTRFSAFFNTNLHSYLQ  444
            RD E+FRRH Y+  +  PT KG+VGAELVDGL+IK E DY++VKTRFSAFF+TNLHS+LQ
Sbjct  64   RDVEIFRRHHYNSDQVGPTVKGTVGAELVDGLIIKEEEDYKIVKTRFSAFFSTNLHSFLQ  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            ++G+T+LVI GVQTPNCIR TVFDAV  +Y  VTVI DATAAATPEIHT+NI DMKNIGV
Sbjct  124  TSGVTNLVIAGVQTPNCIRHTVFDAVELDYPNVTVITDATAAATPEIHTANILDMKNIGV  183

Query  263  MTPTLEEWCES  231
             TPTL EW E 
Sbjct  184  KTPTLHEWSEE  194



>emb|CBI36111.3| unnamed protein product [Vitis vinifera]
Length=263

 Score =   259 bits (663),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            ++TALL++DMQ DF+    P+ + G +AI+P+ IKAVEVAR  GI ++WVVREHDP GRD
Sbjct  74   KHTALLVVDMQKDFLDEDRPISLEGGKAIIPSAIKAVEVARELGILVVWVVREHDPQGRD  133

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
             E+FRR+ Y PGK  P +KGS GAEL+DGL IKEGDY+LVKTRFSAFF T+LHS LQSNG
Sbjct  134  VEVFRRNFYGPGKLSPATKGSEGAELIDGLAIKEGDYKLVKTRFSAFFATHLHSLLQSNG  193

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTP  255
            I S+V+ GVQTPNCIRQT FDAV+ +YQ VTVIVDATAAATP+IH +NI DMKN+GV TP
Sbjct  194  INSVVVVGVQTPNCIRQTAFDAVSLDYQSVTVIVDATAAATPDIHLANILDMKNVGVATP  253

Query  254  TLEEWCES  231
            TL++WC+S
Sbjct  254  TLQKWCQS  261



>gb|KFK38973.1| hypothetical protein AALP_AA3G183500 [Arabis alpina]
Length=196

 Score =   257 bits (657),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 154/191 (81%), Gaps = 1/191 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +WRNTALL+IDMQ DFI       V G ++IVPNV+  VE+AR RGI +IWVVREHDP G
Sbjct  4    RWRNTALLVIDMQKDFIEEASVRRVKGGKSIVPNVVGVVELARQRGIIVIWVVREHDPQG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIK-EGDYRLVKTRFSAFFNTNLHSYLQ  444
            RD ELFRRHLY+  K  P  KG+VGAELVDGL+IK E DY++VKTRFSAFF TNLHS+LQ
Sbjct  64   RDVELFRRHLYNSEKVGPVVKGTVGAELVDGLMIKEEEDYKIVKTRFSAFFGTNLHSFLQ  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            ++G+ +LVI GVQTPNCIRQTVFDAV  +Y  VTVI DATAAATPEIHT+NI DMKNIG+
Sbjct  124  TSGVNNLVIAGVQTPNCIRQTVFDAVELDYPSVTVITDATAAATPEIHTANILDMKNIGI  183

Query  263  MTPTLEEWCES  231
             TP+L EW E 
Sbjct  184  KTPSLHEWSEE  194



>ref|XP_010249653.1| PREDICTED: nicotinamidase isoform X2 [Nelumbo nucifera]
Length=175

 Score =   256 bits (654),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW++TALL+IDMQ DFILPGG M V G QAIVP+V+KAVEVAR R IP+IWVVREHDP G
Sbjct  4    KWKSTALLVIDMQKDFILPGGLMQVAGGQAIVPSVVKAVEVARQRDIPVIWVVREHDPMG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRH+Y  GK  P +KGSVG+ELVDGLVIKEGDY+LVKTRFSAFF T+LHS+LQ 
Sbjct  64   RDVELFRRHMYGDGKFGPITKGSVGSELVDGLVIKEGDYKLVKTRFSAFFATHLHSFLQG  123

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIF  285
             G+ +LVITGVQTPNCIRQTVFDAV+ +YQ VTVIVDATAAAT E+H + IF
Sbjct  124  AGVNNLVITGVQTPNCIRQTVFDAVSLDYQTVTVIVDATAAATSEVHLALIF  175



>ref|XP_009380566.1| PREDICTED: uncharacterized protein LOC103968930 [Musa acuminata 
subsp. malaccensis]
Length=195

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 157/195 (81%), Gaps = 3/195 (2%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILP--GGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVR  639
            MA+  W  TA+L+IDMQNDF+LP  G    V G +AIV +VI+AV +AR RGI +IWVVR
Sbjct  1    MAAPNWSETAMLVIDMQNDFVLPETGSQFIVSGGEAIVASVIQAVAIARERGILVIWVVR  60

Query  638  EHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNL  459
            EHDP GRD ELFRRH YS GK  PT+KG  GAELVDGLVIK+ DY+LVKTRFSAFF T+L
Sbjct  61   EHDPLGRDVELFRRHFYSDGK-GPTAKGCKGAELVDGLVIKDRDYKLVKTRFSAFFATHL  119

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDM  279
            HS LQS GI SLV+ GVQTPNCIRQTVFDAVA +Y  VTVIVDATAAATP+IH  NI DM
Sbjct  120  HSLLQSCGIKSLVVVGVQTPNCIRQTVFDAVALDYHHVTVIVDATAAATPQIHYDNIRDM  179

Query  278  KNIGVMTPTLEEWCE  234
            KNIGV TPTL+EW +
Sbjct  180  KNIGVATPTLQEWLQ  194



>ref|XP_006465737.1| PREDICTED: uncharacterized protein LOC102624158 [Citrus sinensis]
Length=203

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREH  633
            MA  KW++TALL+I MQNDFI   G   + G +AI+P++IKAVE+AR RGI I+WVVREH
Sbjct  1    MAHQKWKSTALLVIAMQNDFIADDGLARLDGGKAILPSIIKAVEIARQRGIRIVWVVREH  60

Query  632  DPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHS  453
            DPSG+D+ELFRRH YS G+  P  KGS GA LVDGL IK+GDY++ KTRFSAF+ T LHS
Sbjct  61   DPSGKDSELFRRHRYSNGRVGPVIKGSRGAALVDGLEIKQGDYKVAKTRFSAFYATPLHS  120

Query  452  YLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKN  273
            +LQ  G+ SLVITG+QTPNCIRQT FDA+ ++Y+ VTVIVDATAA TPE+H++NI+DMK 
Sbjct  121  FLQDAGVDSLVITGIQTPNCIRQTAFDAITYDYRSVTVIVDATAAVTPEVHSANIYDMKK  180

Query  272  IGVMTPTLEEWC  237
            + + TPTL+EW 
Sbjct  181  VKIATPTLQEWS  192



>ref|XP_006298602.1| hypothetical protein CARUB_v10014686mg [Capsella rubella]
 gb|EOA31500.1| hypothetical protein CARUB_v10014686mg [Capsella rubella]
Length=198

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 153/192 (80%), Gaps = 2/192 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +W NTALL+IDMQ DFI  G  M V G ++IV NVI+ VE+AR RGI +IWVVREHDP G
Sbjct  4    RWTNTALLVIDMQKDFIEEGSVMQVKGGKSIVANVIRVVELARQRGILVIWVVREHDPRG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEG--DYRLVKTRFSAFFNTNLHSYL  447
            RD E+FRRH Y+     PT KG+VGAELV+GL+I+E   DY++VKTRFSAFF TNLHS+L
Sbjct  64   RDVEVFRRHHYNSETVGPTVKGTVGAELVEGLIIREEEEDYKIVKTRFSAFFGTNLHSFL  123

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            Q++G+  LVI GVQTPNCIRQTVFDAV  +Y  VTVI DATAAATPEIHT+NI DMKNIG
Sbjct  124  QTSGVNKLVIAGVQTPNCIRQTVFDAVELDYPNVTVITDATAAATPEIHTANILDMKNIG  183

Query  266  VMTPTLEEWCES  231
            V TPTL EW E 
Sbjct  184  VKTPTLHEWSED  195



>gb|EPS67306.1| hypothetical protein M569_07469 [Genlisea aurea]
Length=218

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 159/209 (76%), Gaps = 23/209 (11%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWV---------  645
            W+NTALL+IDMQ DFIL GGP+HV G ++I+PNV+ AV +AR R +P++WV         
Sbjct  8    WKNTALLVIDMQKDFILAGGPLHVKGGESILPNVVAAVGLARARNLPVVWVSYSNPIANR  67

Query  644  --------------VREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGD  507
                          VREHDP GRD ELFRRHLYSPG P+PTSKG+ GAEL DGL I EG+
Sbjct  68   RDFQSLTTYLPTQVVREHDPLGRDVELFRRHLYSPGNPRPTSKGTPGAELADGLSIGEGE  127

Query  506  YRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivda  327
            Y+LVKTRFSAFFNTNLHS+LQ   I +L++TGVQTPNCIRQTV+DAVA +Y+ +TVI DA
Sbjct  128  YKLVKTRFSAFFNTNLHSFLQGLHIHNLIVTGVQTPNCIRQTVYDAVALDYRKITVISDA  187

Query  326  taaaTPEIHTSNIFDMKNIGVMTPTLEEW  240
            TAAATPEIH +N+ DM NIGV + TL+EW
Sbjct  188  TAAATPEIHFANLTDMMNIGVESQTLQEW  216



>ref|XP_010487470.1| PREDICTED: LOW QUALITY PROTEIN: nicotinamidase-like [Camelina 
sativa]
Length=196

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 152/192 (79%), Gaps = 1/192 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +W NTALL+IDMQNDFI     M V G ++IV NVI+ VE+AR R I +IWVVREHDP G
Sbjct  4    RWTNTALLVIDMQNDFIEEDSVMQVKGGKSIVANVIRVVELARQRXILVIWVVREHDPQG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEG-DYRLVKTRFSAFFNTNLHSYLQ  444
            RD E+FRRH Y+  K  PT K +VG+ELVDGLVIKE  DY++VKTRFSAFF TNLHS+LQ
Sbjct  64   RDVEIFRRHHYNSEKVGPTVKDTVGSELVDGLVIKEEEDYKIVKTRFSAFFGTNLHSFLQ  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            ++G++ LVI GVQTPNCIRQTVFD V  +Y  VTVI DATAAATPEIHT+NI DMKNIGV
Sbjct  124  TSGVSKLVIAGVQTPNCIRQTVFDVVELDYPNVTVITDATAAATPEIHTANILDMKNIGV  183

Query  263  MTPTLEEWCESG  228
             TPTL EW E  
Sbjct  184  KTPTLHEWSEES  195



>gb|EYU24708.1| hypothetical protein MIMGU_mgv1a015045mg [Erythranthe guttata]
Length=169

 Score =   252 bits (643),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  734  MHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAELFRRHLY-SPGKPKPTSK  558
            MHV   + +VPNVIKAVEVARNR +PIIWVVREHDP GRD ELFRRHLY S  KPKP SK
Sbjct  2    MHVKAFEDVVPNVIKAVEVARNRSVPIIWVVREHDPLGRDVELFRRHLYGSADKPKPVSK  61

Query  557  GSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTV  378
            G+VGAELVDGL I+EGDY+LVKTRFS+FFNT+LHSYLQ  G+  L+ITGVQTPNCIRQT 
Sbjct  62   GTVGAELVDGLFIEEGDYKLVKTRFSSFFNTHLHSYLQGLGVNKLIITGVQTPNCIRQTA  121

Query  377  FDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLEEWC  237
            FDAVA +Y+ VTVIVDATAAATP+IH +NI DMKNIGV TPTLEEWC
Sbjct  122  FDAVALDYETVTVIVDATAAATPDIHIANIIDMKNIGVATPTLEEWC  168



>ref|XP_004302886.1| PREDICTED: peroxyureidoacrylate/ureidoacrylate amidohydrolase 
RutB-like [Fragaria vesca subsp. vesca]
Length=195

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            K ++TALL+IDMQ DFI   GP+ V G +AIVPNVI+AV++AR RGI ++WVVREHDP G
Sbjct  4    KRKHTALLVIDMQKDFIDGDGPVLVKGGKAIVPNVIEAVQIARQRGILVVWVVREHDPLG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLY  GK  PT KG  GAELVDGLVI+E DY+LVKTRFSAFF T+L S+L+S
Sbjct  64   RDVELFRRHLYPAGKEGPTVKGKKGAELVDGLVIEERDYKLVKTRFSAFFATHLDSFLKS  123

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
            NG+ SLV+ GVQTPNCIRQTVFD VA +Y+ +TVIVDATAAAT E+H +NIFDMKN+GV 
Sbjct  124  NGVDSLVVIGVQTPNCIRQTVFDGVALDYKSITVIVDATAAATAEVHAANIFDMKNVGVA  183

Query  260  TPTLEEWCESG  228
            TPTL+EW E G
Sbjct  184  TPTLQEWFELG  194



>ref|XP_003571198.1| PREDICTED: uncharacterized protein LOC100846613 isoform X1 [Brachypodium 
distachyon]
Length=247

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 159/202 (79%), Gaps = 7/202 (3%)
 Frame = -2

Query  827  APFTSM----ASGKWRNTALLIIDMQNDFILP--GGPMHVGGAQAIVPNVIKAVEVARNR  666
            +PF S     A+ KW  TA+L+IDMQ DF+ P  G P+ V G + +VP V +AV VAR R
Sbjct  45   SPFKSQRSMAAAAKWTETAMLVIDMQKDFVDPAMGSPVLVAGGEGVVPTVAEAVSVARER  104

Query  665  GIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTR  486
            GI ++WVVREHDPSGRD ELFRRHLYS GK  PT+KGS GAEL DGLVIKEGDY+LVKTR
Sbjct  105  GIFVVWVVREHDPSGRDVELFRRHLYSGGK-GPTAKGSKGAELADGLVIKEGDYKLVKTR  163

Query  485  FSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPE  306
            FSAFF T+L S L++ GI +LVI GVQTPNCIRQT +DAVA +Y+ VTVI+DATAAA P+
Sbjct  164  FSAFFATHLDSVLKTLGIKNLVIVGVQTPNCIRQTAYDAVALDYEKVTVIIDATAAARPD  223

Query  305  IHTSNIFDMKNIGVMTPTLEEW  240
            IH SNI DMKNIGV  PTLEEW
Sbjct  224  IHLSNIRDMKNIGVEAPTLEEW  245



>gb|AFK39682.1| unknown [Lotus japonicus]
Length=177

 Score =   249 bits (637),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W+ TALL+IDMQ DF+  GGPM V G + +VPNVIKAVEVAR RGI I+WVVREHDP GR
Sbjct  5    WKRTALLVIDMQKDFV-EGGPMLVKGGKDVVPNVIKAVEVARERGILIVWVVREHDPLGR  63

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRHLYSPGK  PTSKGS GAELVDGLVI+EGDY+LVKTRFSAFF+T+LHS LQ  
Sbjct  64   DVELFRRHLYSPGKVGPTSKGSEGAELVDGLVIREGDYKLVKTRFSAFFSTHLHSVLQGA  123

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
            GI SLV+TGVQTPNCIRQTVFDAVA +Y+PVTVIVDATAAATP+IH
Sbjct  124  GINSLVVTGVQTPNCIRQTVFDAVALDYKPVTVIVDATAAATPDIH  169



>ref|XP_009146161.1| PREDICTED: uncharacterized protein LOC103869846 [Brassica rapa]
Length=196

 Score =   249 bits (636),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 153/191 (80%), Gaps = 1/191 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +W NTALL+IDMQNDFI  G    V G +AIVPNVI  VE+AR RGI ++WVVREHDP G
Sbjct  4    RWTNTALLVIDMQNDFIEEGSVTQVKGGKAIVPNVIGVVELARQRGILVVWVVREHDPQG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEG-DYRLVKTRFSAFFNTNLHSYLQ  444
            RD E+FRRH Y   K  P  KG++G++LVDGL I+E  DY++VKTRFSAFF T+LHS+LQ
Sbjct  64   RDVEIFRRHHYRSEKVGPVVKGTLGSKLVDGLNIREEEDYKIVKTRFSAFFGTHLHSFLQ  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            ++GIT LVI GVQTPNCIRQTVFDAV  +Y  VTVIVDATAAATPEIHT+N+ DM+NIGV
Sbjct  124  TSGITKLVIAGVQTPNCIRQTVFDAVELDYPDVTVIVDATAAATPEIHTANLLDMRNIGV  183

Query  263  MTPTLEEWCES  231
             TPTL EW E 
Sbjct  184  KTPTLHEWSEE  194



>ref|XP_007135663.1| hypothetical protein PHAVU_010G147800g [Phaseolus vulgaris]
 gb|ESW07657.1| hypothetical protein PHAVU_010G147800g [Phaseolus vulgaris]
Length=195

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W+ TALL+IDMQ DFI    P+ +   + IVPNV+KAVE+AR RGI I+WVVRE+DP GR
Sbjct  5    WKQTALLVIDMQKDFIEDWSPVALKAGKNIVPNVVKAVEIARERGILIVWVVRENDPLGR  64

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRH Y+  K K   KGS GA LVDGL+IKE DY+LVK+RFSAFF T+LHS LQ+ 
Sbjct  65   DVELFRRHYYTEMKVKIGCKGSEGAGLVDGLLIKEEDYKLVKSRFSAFFATHLHSVLQAT  124

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMT  258
            GI +LVITG+QTPNCIRQTVFDAVA +Y  VTVIVDATAAATPE+H +N+FDMKNIGV T
Sbjct  125  GIHNLVITGIQTPNCIRQTVFDAVALDYPQVTVIVDATAAATPEVHQANLFDMKNIGVAT  184

Query  257  PTLEEWCES  231
             TL+EW E+
Sbjct  185  QTLQEWSEA  193



>ref|XP_010098097.1| Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB [Morus 
notabilis]
 gb|EXB74534.1| Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB [Morus 
notabilis]
Length=179

 Score =   246 bits (628),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW  TALL+IDMQ DFI   G M V G +AIVPNVIKAV+VAR RGI +IWVVREHDP G
Sbjct  4    KWNRTALLVIDMQKDFIHEDGLMRVNGGKAIVPNVIKAVQVARQRGILLIWVVREHDPLG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLY  GK  PT+KGSVG ELV+GLVI+EGDY+LVKTRFSAFF T+LHS+L+ 
Sbjct  64   RDVELFRRHLYGDGKVGPTAKGSVGGELVEGLVIEEGDYKLVKTRFSAFFATHLHSFLKG  123

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIF  285
             GI SLVITGVQTPNCIRQTVFDAVA +YQPVTVIVDATAAATPEIH    F
Sbjct  124  AGIDSLVITGVQTPNCIRQTVFDAVALDYQPVTVIVDATAAATPEIHAGMNF  175



>emb|CDX97729.1| BnaA05g23500D [Brassica napus]
Length=197

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 154/192 (80%), Gaps = 2/192 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQ-NDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            +W NTALL+IDMQ NDFI  G    V G +AIVPNVI+ VE+AR RGI ++WVVREHDP 
Sbjct  4    RWTNTALLVIDMQQNDFIEEGSVTQVKGGKAIVPNVIRVVELARQRGILVVWVVREHDPQ  63

Query  623  GRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEG-DYRLVKTRFSAFFNTNLHSYL  447
            GRD E+FRRH Y   K  P  KG++G++LVDGL ++E  DY++VKTRFSAFF T+LHS+L
Sbjct  64   GRDVEIFRRHHYRSEKVGPVVKGTLGSKLVDGLNMREEEDYKIVKTRFSAFFGTHLHSFL  123

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            Q++GIT LVI GVQTPNCIRQTVFDAV  +Y  VTVIVDATAAATPEIHT+NI DM+NIG
Sbjct  124  QTSGITKLVIAGVQTPNCIRQTVFDAVELDYPDVTVIVDATAAATPEIHTANILDMRNIG  183

Query  266  VMTPTLEEWCES  231
            V TPTL EW E 
Sbjct  184  VKTPTLHEWSEE  195



>ref|XP_002516006.1| catalytic, putative [Ricinus communis]
 gb|EEF46426.1| catalytic, putative [Ricinus communis]
Length=231

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            + TALL+IDMQNDFIL  G M V G +AI+PNVIKAV++AR RGI ++WVVREHDP GRD
Sbjct  61   KQTALLVIDMQNDFILEDGLMRVNGGKAILPNVIKAVDIARQRGILVVWVVREHDPLGRD  120

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
             ELFRRH YS GK  P SKGS GAELVDGLVI+EGDY+LVKTRFSAFFNTNLHS+LQ+ G
Sbjct  121  VELFRRHFYSAGKVPPVSKGSPGAELVDGLVIEEGDYKLVKTRFSAFFNTNLHSFLQTEG  180

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTS  294
            I SLVI GVQTPNCIRQTVFDAVA +Y  V VIVDATAAATPEIH +
Sbjct  181  IKSLVIAGVQTPNCIRQTVFDAVALDYHDVLVIVDATAAATPEIHAA  227



>dbj|BAD21815.1| isochorismatase hydrolase-like [Oryza sativa Japonica Group]
 dbj|BAD28672.1| isochorismatase hydrolase-like [Oryza sativa Japonica Group]
 gb|EEC72909.1| hypothetical protein OsI_06738 [Oryza sativa Indica Group]
 gb|EEE56730.1| hypothetical protein OsJ_06236 [Oryza sativa Japonica Group]
Length=239

 Score =   244 bits (622),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 149/189 (79%), Gaps = 3/189 (2%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            KW  TA+L+IDMQ DF+ P    PM V G QA+VP V +AV VAR RGI ++WVVREHDP
Sbjct  50   KWSETAMLVIDMQKDFVDPAMRSPMLVDGGQAVVPTVAEAVAVARERGIYVVWVVREHDP  109

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
            SG D E+FRR  YS GK  PT KG  GA+L DGLVIKEG+Y+LVKTRFSAFF T L S L
Sbjct  110  SGADVEIFRRRYYSGGK-GPTVKGLKGADLADGLVIKEGEYKLVKTRFSAFFATPLDSVL  168

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            +++GI  LVI GVQTPNCIRQTVFDAVA +Y+ VTVI+DATAAA PEIH SNI DMKNIG
Sbjct  169  KTSGIKKLVIVGVQTPNCIRQTVFDAVALDYEKVTVIIDATAAARPEIHLSNIRDMKNIG  228

Query  266  VMTPTLEEW  240
            V TPTLEEW
Sbjct  229  VETPTLEEW  237



>gb|KEH28721.1| isochorismatase hydrolase family protein [Medicago truncatula]
Length=177

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W +TALL+IDMQ DFI    P++V G + +VPNVIKAVE+AR RGI I+WVVREHDP GR
Sbjct  5    WNHTALLVIDMQKDFIKDESPVNVKGGKDVVPNVIKAVEIARQRGILIVWVVREHDPLGR  64

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRHLY+ GK  PTSKG+ GAELV+GLVIKEGDY++VKTRFSAFF+T+LHS+LQ  
Sbjct  65   DVELFRRHLYAEGKVGPTSKGTEGAELVNGLVIKEGDYKVVKTRFSAFFSTHLHSFLQGA  124

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDM  279
            G+ SLV+TGVQTPNCIRQTVFDAVA +YQPVTV+VDATAAATP+IH    + +
Sbjct  125  GVNSLVVTGVQTPNCIRQTVFDAVALDYQPVTVLVDATAAATPDIHLGMYYQL  177



>ref|NP_001046544.1| Os02g0276400 [Oryza sativa Japonica Group]
 dbj|BAF08458.1| Os02g0276400, partial [Oryza sativa Japonica Group]
Length=236

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 149/189 (79%), Gaps = 3/189 (2%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            KW  TA+L+IDMQ DF+ P    PM V G QA+VP V +AV VAR RGI ++WVVREHDP
Sbjct  47   KWSETAMLVIDMQKDFVDPAMRSPMLVDGGQAVVPTVAEAVAVARERGIYVVWVVREHDP  106

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
            SG D E+FRR  YS GK  PT KG  GA+L DGLVIKEG+Y+LVKTRFSAFF T L S L
Sbjct  107  SGADVEIFRRRYYSGGK-GPTVKGLKGADLADGLVIKEGEYKLVKTRFSAFFATPLDSVL  165

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            +++GI  LVI GVQTPNCIRQTVFDAVA +Y+ VTVI+DATAAA PEIH SNI DMKNIG
Sbjct  166  KTSGIKKLVIVGVQTPNCIRQTVFDAVALDYEKVTVIIDATAAARPEIHLSNIRDMKNIG  225

Query  266  VMTPTLEEW  240
            V TPTLEEW
Sbjct  226  VETPTLEEW  234



>gb|ACJ83333.1| unknown [Medicago truncatula]
 gb|KEH28719.1| isochorismatase hydrolase family protein [Medicago truncatula]
Length=201

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W +TALL+IDMQ DFI    P++V G + +VPNVIKAVE+AR RGI I+WVVREHDP GR
Sbjct  5    WNHTALLVIDMQKDFIKDESPVNVKGGKDVVPNVIKAVEIARQRGILIVWVVREHDPLGR  64

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRHLY+ GK  PTSKG+ GAELV+GLVIKEGDY++VKTRFSAFF+T+LHS+LQ  
Sbjct  65   DVELFRRHLYAEGKVGPTSKGTEGAELVNGLVIKEGDYKVVKTRFSAFFSTHLHSFLQGA  124

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
            G+ SLV+TGVQTPNCIRQTVFDAVA +YQPVTV+VDATAAATP+IH
Sbjct  125  GVNSLVVTGVQTPNCIRQTVFDAVALDYQPVTVLVDATAAATPDIH  170



>ref|XP_006406866.1| hypothetical protein EUTSA_v10021560mg [Eutrema salsugineum]
 gb|ESQ48319.1| hypothetical protein EUTSA_v10021560mg [Eutrema salsugineum]
Length=171

 Score =   238 bits (608),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  734  MHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPTSKG  555
            M V G ++IVPNVIK VE+AR RGI +IWVVREHDP GRD ELFRRHLYS  K  PT KG
Sbjct  1    MQVKGGKSIVPNVIKVVELARQRGILVIWVVREHDPRGRDVELFRRHLYSSEKVGPTVKG  60

Query  554  SVGAELVDGLVIK-EGDYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTV  378
            +VGAELVDGL+I+ E DY++VKTRFSAFF TNLHS+LQ++G+T LVI GVQTPNCIRQTV
Sbjct  61   TVGAELVDGLIIREEEDYKIVKTRFSAFFGTNLHSFLQTSGVTKLVIAGVQTPNCIRQTV  120

Query  377  FDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLEEWCE  234
            FDAV  +Y  VTVI DATAAATPEIHT+NI DMKNIGV TPTL EW E
Sbjct  121  FDAVELDYPYVTVIADATAAATPEIHTANILDMKNIGVKTPTLHEWSE  168



>ref|XP_010915869.1| PREDICTED: uncharacterized protein LOC105040847 isoform X2 [Elaeis 
guineensis]
Length=186

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 146/174 (84%), Gaps = 3/174 (2%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVR  639
            MA+ K   TA+L+IDMQNDF+LP    PM V G +AIVP+V+KA+ VAR RGI +IWVVR
Sbjct  1    MAAAKRSETAMLVIDMQNDFVLPEMESPMLVAGGEAIVPSVVKAISVARERGIFVIWVVR  60

Query  638  EHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNL  459
            EHDP GRD ELFRRHLYS G+  PT+KG+ GA LVDGL IKEG+Y+LVKTRFSAFF T+L
Sbjct  61   EHDPMGRDVELFRRHLYSNGE-GPTAKGAKGAALVDGLAIKEGEYKLVKTRFSAFFATHL  119

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHT  297
            HS LQS+GI SLVI GVQTPNCIRQTVFDAVA +YQ VTVIVDATAAATPEIH+
Sbjct  120  HSLLQSSGIKSLVIVGVQTPNCIRQTVFDAVALDYQTVTVIVDATAAATPEIHS  173



>gb|KDO56949.1| hypothetical protein CISIN_1g030598mg [Citrus sinensis]
Length=174

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREH  633
            MA  K+ NTALL+IDMQNDFIL  G M V G +AIVPNVIKAVE+AR  GI ++WVVREH
Sbjct  1    MADTKFNNTALLVIDMQNDFILDDGLMRVDGGKAIVPNVIKAVEIARQHGILVVWVVREH  60

Query  632  DPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHS  453
            DP GRD ELFR+HLYS G   PTSKGS GAELVDGL IKEGDY++VK RFSAFF T+L+S
Sbjct  61   DPLGRDVELFRQHLYSTGTVGPTSKGSPGAELVDGLEIKEGDYKVVKMRFSAFFATHLNS  120

Query  452  YLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
            +L++ GI SLVI GVQTPNCIRQTVFDAV  +Y+ +T+IVDATAAATPEIH
Sbjct  121  FLRTAGIDSLVIVGVQTPNCIRQTVFDAVELDYKSITIIVDATAAATPEIH  171



>ref|XP_007024221.1| Isochorismatase family protein isoform 3 [Theobroma cacao]
 gb|EOY26843.1| Isochorismatase family protein isoform 3 [Theobroma cacao]
Length=170

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  734  MHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPTSKG  555
            M V G +AIVPNVIKAVE+AR RGI ++WVVREHD  GRD ELFRRH YSP K  PT+KG
Sbjct  1    MAVKGGKAIVPNVIKAVEIARQRGILVVWVVREHDYFGRDVELFRRHFYSPEKGGPTTKG  60

Query  554  SVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVF  375
            SVGAELVDGLVIKE DY+LVKTRFSAFFNTNLH +LQSNG+ +LV+ GVQTPNCIRQTVF
Sbjct  61   SVGAELVDGLVIKEEDYKLVKTRFSAFFNTNLHIFLQSNGVNNLVVVGVQTPNCIRQTVF  120

Query  374  DAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLEEWCES  231
            DAVA +YQ V VIVDATAAATPE+H ++IFDMKNIGV TPTL+EWC++
Sbjct  121  DAVAHDYQSVAVIVDATAAATPEVHDASIFDMKNIGVATPTLQEWCKT  168



>ref|XP_004141764.1| PREDICTED: peroxyureidoacrylate/ureidoacrylate amidohydrolase 
RutB-like [Cucumis sativus]
 ref|XP_004158993.1| PREDICTED: peroxyureidoacrylate/ureidoacrylate amidohydrolase 
RutB-like [Cucumis sativus]
 gb|KGN45388.1| hypothetical protein Csa_7G447030 [Cucumis sativus]
Length=193

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 146/191 (76%), Gaps = 0/191 (0%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            + +W+ TALL+IDMQ DF        V GA  I+P+V  A+E+ARNRG+ IIWVVREHD 
Sbjct  2    TDQWKRTALLVIDMQTDFFDEHSAFAVPGASTIIPSVSNAIEIARNRGLFIIWVVREHDG  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
             GRD E FRRH Y  GKP P+ KGS GAELV+GL IKEG+Y+LVKTRFSAFFNTNLHS L
Sbjct  62   EGRDVERFRRHYYGNGKPNPSVKGSKGAELVEGLEIKEGEYKLVKTRFSAFFNTNLHSLL  121

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            Q  GIT LV+ GVQTPNCIRQTVFDAVA +Y  +T++ DATAAATP+IH  N  DM+N+G
Sbjct  122  QGAGITDLVVCGVQTPNCIRQTVFDAVALDYHSITLLYDATAAATPKIHHDNTTDMENVG  181

Query  266  VMTPTLEEWCE  234
            V+   +++W E
Sbjct  182  VVVKRVDQWGE  192



>gb|EEE56729.1| hypothetical protein OsJ_06234 [Oryza sativa Japonica Group]
Length=198

 Score =   237 bits (604),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 145/188 (77%), Gaps = 2/188 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPG-GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            +W  TA+L+IDMQ DF+ P      +   +AI+P V  AV VAR RGI I+WVVREHDPS
Sbjct  10   EWSETAMLVIDMQKDFVDPATSSAALLAGEAILPTVTAAVAVARQRGIFIVWVVREHDPS  69

Query  623  GRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
            GRD ELFRRH YS GK     +GS GAEL DGL IK+GDY+LVKTRFSAFF T+L S L+
Sbjct  70   GRDVELFRRHFYSSGKGLGV-EGSKGAELADGLTIKDGDYKLVKTRFSAFFATHLDSVLK  128

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            ++GI +LVI GVQTPNCIRQTVFDAVA +Y  V VI+DATAAA PEIH SN+ DMKNIGV
Sbjct  129  TSGIKNLVIVGVQTPNCIRQTVFDAVALDYDKVAVIIDATAAAKPEIHLSNMIDMKNIGV  188

Query  263  MTPTLEEW  240
             TPTLEEW
Sbjct  189  ETPTLEEW  196



>ref|XP_008465520.1| PREDICTED: uncharacterized protein LOC103503139 [Cucumis melo]
Length=197

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            + +W+ TALL+IDMQ DFI       V GA  I+P+V  AVE+ARNRG+ IIWVVREHD 
Sbjct  2    ADQWKRTALLVIDMQRDFIDEHSVFAVPGASTIIPSVSTAVEIARNRGLFIIWVVREHDG  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
             GRD E FRRH Y  GKP P  KGS GAELV GL IKEG+Y+LVKTRFSAFFNTNL S L
Sbjct  62   EGRDVERFRRHYYGNGKPNPLVKGSKGAELVQGLEIKEGEYKLVKTRFSAFFNTNLRSLL  121

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            Q  GIT LV+ GVQTPNCIRQTVFDAVA +Y  +T++ DATAAATP++H  NI DM N+G
Sbjct  122  QGAGITDLVVCGVQTPNCIRQTVFDAVALDYHSITLLYDATAAATPKVHHDNITDMVNVG  181

Query  266  VMTPTLEEWCES  231
            V    ++EW ES
Sbjct  182  VEVKRVDEWGES  193



>emb|CDY30142.1| BnaC05g37200D [Brassica napus]
Length=207

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 153/202 (76%), Gaps = 12/202 (6%)
 Frame = -2

Query  800  KWRNTALLIIDMQ-NDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIW--------  648
            +W NTALL+IDMQ NDFI  G    V G +AIV NVI+ VE+AR RG+ ++W        
Sbjct  4    RWTNTALLVIDMQQNDFIEEGSVTQVKGGKAIVRNVIRVVELARQRGVLVVWDKRFLLSV  63

Query  647  --VVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEG-DYRLVKTRFSA  477
              VVREHDP GRD E+FRRH Y   K  P  KG++G++LVDGL I+E  DY++VKTRFSA
Sbjct  64   SKVVREHDPQGRDVEIFRRHHYRSEKVGPVVKGTLGSKLVDGLNIREEEDYKIVKTRFSA  123

Query  476  FFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHT  297
            FF T+LHS+LQ++G+T LVI GVQTPNCIRQTVFDAV  +Y  VTVIVDATAAATPEIHT
Sbjct  124  FFGTHLHSFLQTSGVTKLVIAGVQTPNCIRQTVFDAVELDYPDVTVIVDATAAATPEIHT  183

Query  296  SNIFDMKNIGVMTPTLEEWCES  231
            +NI DM+NIGV TPTL EW E 
Sbjct  184  ANILDMRNIGVKTPTLHEWSEE  205



>ref|XP_004952218.1| PREDICTED: uncharacterized protein LOC101763822 [Setaria italica]
Length=199

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 149/195 (76%), Gaps = 3/195 (2%)
 Frame = -2

Query  815  SMASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
            S  + KW  TA+L+IDMQ +F+ P    P  + G + I+P V +AVE+AR RGI ++WVV
Sbjct  3    SANNNKWSETAMLVIDMQKEFVDPAMSSPAFLAGGEKIIPAVAEAVELARKRGIFVVWVV  62

Query  641  REHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTN  462
            REHDP GRD ELFRRHLYS GK  P  KGS GAE+ DGLV+KE DY++VKTRFS+FF TN
Sbjct  63   REHDPDGRDVELFRRHLYSGGKG-PAMKGSKGAEMADGLVVKEEDYKVVKTRFSSFFATN  121

Query  461  LHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFD  282
            L S L+++GI +LV+ GVQTPNC+RQTVFDAVA +Y+ VTVIVDATA A  EIH SNI D
Sbjct  122  LDSVLKTSGIKNLVVVGVQTPNCVRQTVFDAVALDYEKVTVIVDATAGANQEIHLSNIRD  181

Query  281  MKNIGVMTPTLEEWC  237
            MKNIGV  PT+E W 
Sbjct  182  MKNIGVEAPTVEAWS  196



>ref|XP_008783256.1| PREDICTED: uncharacterized protein LOC103702554 isoform X2 [Phoenix 
dactylifera]
Length=182

 Score =   233 bits (595),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 144/174 (83%), Gaps = 3/174 (2%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVR  639
            MA+ K   TA+L+IDMQNDFILP    P+ V G +AIV +VIKAV VAR RG+ +IWVVR
Sbjct  1    MAAAKGSETAMLVIDMQNDFILPELESPVMVAGGEAIVSSVIKAVSVARERGMFVIWVVR  60

Query  638  EHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNL  459
            EHDP GRD ELFRRHLYS G+  PT KG+ GA LVDGL IKEG+Y+LVKTRFSAFF T+L
Sbjct  61   EHDPLGRDVELFRRHLYSNGE-GPTMKGAKGAALVDGLAIKEGEYKLVKTRFSAFFATHL  119

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHT  297
            HS LQS+GI SLV+ GVQTPNCIRQTVFDAVA +YQ VTVIVDATAAATPEIH+
Sbjct  120  HSLLQSSGIKSLVVVGVQTPNCIRQTVFDAVALDYQTVTVIVDATAAATPEIHS  173



>ref|XP_002453690.1| hypothetical protein SORBIDRAFT_04g010640 [Sorghum bicolor]
 gb|EES06666.1| hypothetical protein SORBIDRAFT_04g010640 [Sorghum bicolor]
Length=190

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 148/188 (79%), Gaps = 3/188 (2%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            W  TA+L+IDMQ +F+ P    P  +   +AI+P V +AV VAR RGI I+WVVREHDP+
Sbjct  2    WSETAMLVIDMQKEFVDPAMSSPALLPAGEAIIPAVTEAVAVARQRGIFIVWVVREHDPT  61

Query  623  GRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
            GRD ELFRRH YS G   P  KGS GAEL +G VIK+G+Y+LVK RFS+FF TNL S L+
Sbjct  62   GRDVELFRRHFYSRGS-GPAVKGSKGAELAEGFVIKDGEYKLVKGRFSSFFATNLDSVLK  120

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            ++GI +LV+TGVQTPNCIRQTVFDAVA +Y+ VTVI+DATAAA PEIH +NI DMKNIGV
Sbjct  121  TSGIKNLVVTGVQTPNCIRQTVFDAVALDYEKVTVIIDATAAANPEIHLANIRDMKNIGV  180

Query  263  MTPTLEEW  240
             TPTLEEW
Sbjct  181  ETPTLEEW  188



>ref|XP_008783258.1| PREDICTED: uncharacterized protein LOC103702554 isoform X3 [Phoenix 
dactylifera]
Length=176

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 144/174 (83%), Gaps = 3/174 (2%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVR  639
            MA+ K   TA+L+IDMQNDFILP    P+ V G +AIV +VIKAV VAR RG+ +IWVVR
Sbjct  1    MAAAKGSETAMLVIDMQNDFILPELESPVMVAGGEAIVSSVIKAVSVARERGMFVIWVVR  60

Query  638  EHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNL  459
            EHDP GRD ELFRRHLYS G+  PT KG+ GA LVDGL IKEG+Y+LVKTRFSAFF T+L
Sbjct  61   EHDPLGRDVELFRRHLYSNGE-GPTMKGAKGAALVDGLAIKEGEYKLVKTRFSAFFATHL  119

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHT  297
            HS LQS+GI SLV+ GVQTPNCIRQTVFDAVA +YQ VTVIVDATAAATPEIH+
Sbjct  120  HSLLQSSGIKSLVVVGVQTPNCIRQTVFDAVALDYQTVTVIVDATAAATPEIHS  173



>ref|XP_006648538.1| PREDICTED: uncharacterized protein LOC102711781 [Oryza brachyantha]
Length=241

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = -2

Query  827  APFTSMASGKWRNTALLIIDMQNDFILP--GGPMHVGGAQAIVPNVIKAVEVARNRGIPI  654
            AP  +++ G+W  TA+L++DMQ DF+ P  G    +   +AIVP+V  A+ VAR RG+ I
Sbjct  43   APAAAVSGGRWSETAMLVMDMQKDFVDPAMGSSALLAPGEAIVPSVADAIAVARQRGVFI  102

Query  653  IWVVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAF  474
            +WVVREHDP GRD ELFRRHLYS GK  P  KGS G E+ DGL +++GDY++VKTRFSAF
Sbjct  103  VWVVREHDPFGRDVELFRRHLYSDGK-GPAIKGSEGVEMADGLTVEQGDYKVVKTRFSAF  161

Query  473  FNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTS  294
            F T+L S L+++GI +LV+ GVQTPNC+RQTV DAVA +Y+ VTVI DATAAATP+IH S
Sbjct  162  FATHLDSVLKTSGIKNLVVVGVQTPNCVRQTVCDAVALDYEKVTVITDATAAATPDIHLS  221

Query  293  NIFDMKNIGVMTPTLEEW  240
            NI DMKNIGV TPTL EW
Sbjct  222  NIRDMKNIGVETPTLAEW  239



>ref|XP_009353592.1| PREDICTED: uncharacterized protein LOC103944848 isoform X5 [Pyrus 
x bretschneideri]
Length=171

 Score =   231 bits (590),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W++TALL+IDMQ+DFI   GPM V G +AIVPNVIKAV++AR RGI ++WVVREHDP GR
Sbjct  4    WKHTALLVIDMQHDFIDVAGPMLVNGGKAIVPNVIKAVQIARQRGIQVVWVVREHDPLGR  63

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRHLY  GK  PT KG  GAELVDGLVI++GDY+LVKTRFSAFF T L S+L+ +
Sbjct  64   DVELFRRHLYPAGKVGPTVKGERGAELVDGLVIEQGDYKLVKTRFSAFFATPLDSFLKGS  123

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTS  294
            GI SLV+TGVQTPNCIRQTVFD VA +Y+ VTVI+DATAAATP+IH  
Sbjct  124  GIDSLVVTGVQTPNCIRQTVFDGVALDYKSVTVILDATAAATPDIHAD  171



>ref|NP_001148649.1| LOC100282265 [Zea mays]
 gb|ACG32379.1| isochorismatase family protein rutB [Zea mays]
Length=194

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVR  639
            MA+ KW  TA+L+IDMQ DF+ P    PM V G +A+VP V  AV VA  RGI ++WVVR
Sbjct  1    MAAAKWSETAMLVIDMQKDFVDPAMRSPMLVAGGEAVVPAVAGAVAVAMERGIFVVWVVR  60

Query  638  EHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNL  459
            EHDPSGRD ELFRRH YS GK  PT KG  GAEL DGLVIKEG+Y+LVKTRFSAFF T+L
Sbjct  61   EHDPSGRDVELFRRHHYSGGK-GPTVKGLKGAELADGLVIKEGEYKLVKTRFSAFFATHL  119

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDM  279
             S L++ GI +LVI GVQTPNCIRQTVFDA+A +Y+ VTV++DATAAA PEIH SNI DM
Sbjct  120  DSVLKTAGIKNLVIVGVQTPNCIRQTVFDAIALDYEKVTVLIDATAAARPEIHLSNIRDM  179

Query  278  KNIGVMTPTLEEW  240
            KNIGV TPTLEEW
Sbjct  180  KNIGVDTPTLEEW  192



>ref|XP_009353591.1| PREDICTED: uncharacterized protein LOC103944848 isoform X4 [Pyrus 
x bretschneideri]
Length=185

 Score =   231 bits (590),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W++TALL+IDMQ+DFI   GPM V G +AIVPNVIKAV++AR RGI ++WVVREHDP GR
Sbjct  4    WKHTALLVIDMQHDFIDVAGPMLVNGGKAIVPNVIKAVQIARQRGIQVVWVVREHDPLGR  63

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRHLY  GK  PT KG  GAELVDGLVI++GDY+LVKTRFSAFF T L S+L+ +
Sbjct  64   DVELFRRHLYPAGKVGPTVKGERGAELVDGLVIEQGDYKLVKTRFSAFFATPLDSFLKGS  123

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSN  291
            GI SLV+TGVQTPNCIRQTVFD VA +Y+ VTVI+DATAAATP+IH   
Sbjct  124  GIDSLVVTGVQTPNCIRQTVFDGVALDYKSVTVILDATAAATPDIHAGK  172



>ref|XP_009353587.1| PREDICTED: uncharacterized protein LOC103944848 isoform X1 [Pyrus 
x bretschneideri]
Length=209

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W++TALL+IDMQ+DFI   GPM V G +AIVPNVIKAV++AR RGI ++WVVREHDP GR
Sbjct  4    WKHTALLVIDMQHDFIDVAGPMLVNGGKAIVPNVIKAVQIARQRGIQVVWVVREHDPLGR  63

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRHLY  GK  PT KG  GAELVDGLVI++GDY+LVKTRFSAFF T L S+L+ +
Sbjct  64   DVELFRRHLYPAGKVGPTVKGERGAELVDGLVIEQGDYKLVKTRFSAFFATPLDSFLKGS  123

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHT  297
            GI SLV+TGVQTPNCIRQTVFD VA +Y+ VTVI+DATAAATP+IH 
Sbjct  124  GIDSLVVTGVQTPNCIRQTVFDGVALDYKSVTVILDATAAATPDIHA  170



>gb|AFW70916.1| isochorismatase family protein rutB [Zea mays]
Length=243

 Score =   233 bits (594),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 155/194 (80%), Gaps = 3/194 (2%)
 Frame = -2

Query  815  SMASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
            +MA+ KW  TA+L+IDMQ DF+ P    PM V G +A+VP V  AV VAR RGI ++WVV
Sbjct  49   NMAAAKWSETAMLVIDMQKDFVDPAMRSPMLVAGGEAVVPAVAGAVAVARERGIFVVWVV  108

Query  641  REHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTN  462
            REHDPSGRD ELFRRH YS GK  PT KG  GAEL DGLVIKEG+Y+LVKTRFSAFF T+
Sbjct  109  REHDPSGRDVELFRRHHYSGGK-GPTVKGLKGAELADGLVIKEGEYKLVKTRFSAFFATH  167

Query  461  LHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFD  282
            L S L++ GI +LVI GVQTPNCIRQTVFDA+A +Y+ VTV++DATAAA PEIH SNI D
Sbjct  168  LDSVLKTAGIKNLVIVGVQTPNCIRQTVFDAIALDYEKVTVLIDATAAARPEIHLSNIRD  227

Query  281  MKNIGVMTPTLEEW  240
            MKNIGV TPTLEEW
Sbjct  228  MKNIGVDTPTLEEW  241



>gb|KDO56948.1| hypothetical protein CISIN_1g045208mg, partial [Citrus sinensis]
Length=176

 Score =   231 bits (588),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 141/176 (80%), Gaps = 5/176 (3%)
 Frame = -2

Query  761  NDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAELFRRHLYSP  582
            NDFI   G + + G + I+PNVI+AVE+AR RGI ++WVVREH+P GRD ELFRRH YSP
Sbjct  1    NDFIADDGLVKMDGGKVILPNVIRAVEIARQRGILVVWVVREHNPLGRDVELFRRHRYSP  60

Query  581  GKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQT  402
            GK  P  KGS GAELVDGLVI+EGDY+LVKTRFSAFF T+LHS+LQ  G+ S     VQT
Sbjct  61   GKVGPAVKGSRGAELVDGLVIREGDYKLVKTRFSAFFATHLHSFLQGAGVDS-----VQT  115

Query  401  PNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLEEWCE  234
            PNCIRQT FDA+A +YQPVTV+VDATAAATP++H +NI DMKN G+ T TL+EW E
Sbjct  116  PNCIRQTAFDAIALDYQPVTVVVDATAAATPDVHAANIVDMKNFGIATATLQEWSE  171



>ref|XP_002453691.1| hypothetical protein SORBIDRAFT_04g010650 [Sorghum bicolor]
 gb|EES06667.1| hypothetical protein SORBIDRAFT_04g010650 [Sorghum bicolor]
Length=194

 Score =   230 bits (586),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVR  639
            MA+ KW  TA+L+IDMQ DF+ P    PM V G +A+VP V +AV VAR RGI ++WVVR
Sbjct  1    MAAAKWSETAMLVIDMQKDFVDPAMRSPMLVAGGEAVVPAVAEAVAVARERGIFLVWVVR  60

Query  638  EHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNL  459
            EHDPSGRD ELFRR  YS GK  PT KG  GAEL DGLVIKEG+Y+LVKTRFSAFF T+L
Sbjct  61   EHDPSGRDVELFRRQHYSGGKG-PTVKGLKGAELADGLVIKEGEYKLVKTRFSAFFATHL  119

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDM  279
             S L++ GI +LVI GVQTPNCIRQTVFDAVA +Y+ VTV++DATAAA PEIH SNI DM
Sbjct  120  DSVLKTAGIKNLVIVGVQTPNCIRQTVFDAVALDYEKVTVLIDATAAARPEIHLSNIRDM  179

Query  278  KNIGVMTPTLEEW  240
            KNIGV TPT+EEW
Sbjct  180  KNIGVDTPTVEEW  192



>gb|KFK38970.1| hypothetical protein AALP_AA3G183400 [Arabis alpina]
Length=177

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 142/191 (74%), Gaps = 20/191 (10%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +W+NTALL+IDMQNDFI  G  M V G ++I+PNV++ VE+AR RGI +IWVVREHDP G
Sbjct  4    RWKNTALLVIDMQNDFIDEGSVMQVKGGKSIIPNVVRVVELARQRGILVIWVVREHDPQG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIK-EGDYRLVKTRFSAFFNTNLHSYLQ  444
            RD ELFRRHLY   K  PT KG+VGAELVDGL+ K E DY++VKTRFSAFF         
Sbjct  64   RDVELFRRHLYKSEKVGPTVKGTVGAELVDGLMTKEEEDYKIVKTRFSAFF---------  114

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
                      GVQTPNCIRQTVFDAV  +Y  VTVI DATAAATPEIHT+NI DMKNIGV
Sbjct  115  ----------GVQTPNCIRQTVFDAVELDYPSVTVITDATAAATPEIHTANILDMKNIGV  164

Query  263  MTPTLEEWCES  231
             TP+L+EW E 
Sbjct  165  KTPSLQEWSEE  175



>ref|XP_009353588.1| PREDICTED: uncharacterized protein LOC103944848 isoform X2 [Pyrus 
x bretschneideri]
Length=206

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W++TALL+IDMQ+DFI   GPM V G +AIVPNVIKAV++AR RGI ++WVVREHDP GR
Sbjct  4    WKHTALLVIDMQHDFIDVAGPMLVNGGKAIVPNVIKAVQIARQRGIQVVWVVREHDPLGR  63

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRHLY  GK  PT KG  GAELVDGLVI++GDY+LVKTRFSAFF T L S+L+ +
Sbjct  64   DVELFRRHLYPAGKVGPTVKGERGAELVDGLVIEQGDYKLVKTRFSAFFATPLDSFLKGS  123

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSN  291
            GI SLV+TGVQTPNCIRQTVFD VA +Y+ VTVI+DATAAATP+IH  +
Sbjct  124  GIDSLVVTGVQTPNCIRQTVFDGVALDYKSVTVILDATAAATPDIHAGS  172



>ref|XP_007024220.1| Isochorismatase family protein isoform 2 [Theobroma cacao]
 gb|EOY26842.1| Isochorismatase family protein isoform 2 [Theobroma cacao]
Length=175

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            + KW+ TAL++IDMQ D+IL    M V G +AIVPNVIKAVE+AR RGI ++WVVREHD 
Sbjct  2    ADKWKQTALIVIDMQKDYILEDKIMAVKGGKAIVPNVIKAVEIARQRGILVVWVVREHDY  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
             GRD ELFRRH YSP K  PT+KGSVGAELVDGLVIKE DY+LVKTRFSAFFNTNLH +L
Sbjct  62   FGRDVELFRRHFYSPEKGGPTTKGSVGAELVDGLVIKEEDYKLVKTRFSAFFNTNLHIFL  121

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNI  288
            QSNG+ +LV+ GVQTPNCIRQTVFDAVA +YQ V VIVDATAAATPE+H  ++
Sbjct  122  QSNGVNNLVVVGVQTPNCIRQTVFDAVAHDYQSVAVIVDATAAATPEVHDVSL  174



>ref|XP_009759232.1| PREDICTED: uncharacterized protein LOC104211802 isoform X3 [Nicotiana 
sylvestris]
Length=162

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 138/190 (73%), Gaps = 38/190 (20%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW  TALL+IDMQ                                      VVREHDP G
Sbjct  8    KWNKTALLVIDMQ--------------------------------------VVREHDPLG  29

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLY  GKPKPTSKGSVGAELVDGLVI+E DY+LVKTRFSAFFNTNLHSYLQ 
Sbjct  30   RDVELFRRHLYGDGKPKPTSKGSVGAELVDGLVIQEDDYKLVKTRFSAFFNTNLHSYLQG  89

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
             GIT+LVI GVQTPNCIRQTVFDAVA +Y+ VTVI+DATAAATP+IH +NI DMKN+GV+
Sbjct  90   IGITNLVIIGVQTPNCIRQTVFDAVALDYERVTVIIDATAAATPDIHIANIIDMKNVGVV  149

Query  260  TPTLEEWCES  231
            TPTLEEWC+S
Sbjct  150  TPTLEEWCQS  159



>ref|XP_004952220.1| PREDICTED: uncharacterized protein LOC101764217 isoform X2 [Setaria 
italica]
Length=242

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 154/192 (80%), Gaps = 3/192 (2%)
 Frame = -2

Query  809  ASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
            A+ KW  TA+L+IDMQ DF+ P    PM V G +A+VP V +AV VAR RGI ++WVVRE
Sbjct  50   AAAKWSETAMLVIDMQKDFVDPAMRSPMLVAGGEAVVPAVAEAVAVARERGIFLVWVVRE  109

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            HDPSGRD ELFRRH YS GK  PT KG  GAEL DGLVIKEG+Y+LVKTRFSAFF T+L 
Sbjct  110  HDPSGRDVELFRRHHYSGGK-GPTVKGLKGAELADGLVIKEGEYKLVKTRFSAFFATHLD  168

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMK  276
            S L++ GI +LVI GVQTPNCIRQTVFDAVA +Y+ +TV++DATAAA PEIH SNI DMK
Sbjct  169  SVLKTAGIKNLVIVGVQTPNCIRQTVFDAVALDYEKITVLIDATAAARPEIHLSNIRDMK  228

Query  275  NIGVMTPTLEEW  240
            NIGV TPTL+EW
Sbjct  229  NIGVETPTLDEW  240



>ref|XP_002972881.1| hypothetical protein SELMODRAFT_98142 [Selaginella moellendorffii]
 gb|EFJ26102.1| hypothetical protein SELMODRAFT_98142 [Selaginella moellendorffii]
Length=193

 Score =   227 bits (578),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            +G  R TALL+IDMQNDF+LPGGPMHV GA AIVP V K+VE+AR  G  I+WVVREHD 
Sbjct  2    AGPQRRTALLVIDMQNDFVLPGGPMHVLGAPAIVPAVQKSVEIARRHGHFIVWVVREHDA  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
            SGRD ELFR+HLY  G+  PT KG  GA LVDGL+ + GD+   K RFSAFF TNL   L
Sbjct  62   SGRDVELFRQHLYD-GETGPTCKGESGAALVDGLIPQPGDHMQRKFRFSAFFATNLDLVL  120

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            +  GI+ LVI GVQTPNCIR TVFDA+A +Y  VTVI DATAAA+PE+H  N+ DM+N+ 
Sbjct  121  RRAGISHLVIVGVQTPNCIRATVFDAIALDYA-VTVIADATAAASPEVHAGNLLDMRNVS  179

Query  266  VMTPTLEEWCE  234
              TPTLEEW +
Sbjct  180  AATPTLEEWAK  190



>dbj|BAJ90557.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=237

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 153/192 (80%), Gaps = 3/192 (2%)
 Frame = -2

Query  809  ASGKWRNTALLIIDMQNDFILP--GGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
            A+GKW  TA+L+IDMQ DF+ P  G P+ V G +A+VP V +AV VAR RGI ++WVVRE
Sbjct  45   AAGKWSETAMLVIDMQKDFVDPAMGSPVLVAGGEAVVPAVAEAVAVARERGIFVVWVVRE  104

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            HDPSGRD ELFRRHLYS GK  PT KG  GAEL DGL IKEGDY+LVKTRFSAFF T+L 
Sbjct  105  HDPSGRDVELFRRHLYSGGK-GPTVKGLKGAELADGLFIKEGDYKLVKTRFSAFFATHLD  163

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMK  276
            S L++ GI +LVI GVQTPNCIRQTV+DAV  +Y+ V V++DATAAA P+IH +NI DMK
Sbjct  164  SVLKTQGIKNLVIVGVQTPNCIRQTVYDAVELDYEKVMVLIDATAAARPDIHLANIRDMK  223

Query  275  NIGVMTPTLEEW  240
             IGV TPTLEEW
Sbjct  224  TIGVETPTLEEW  235



>gb|AFW70918.1| hypothetical protein ZEAMMB73_638698 [Zea mays]
Length=242

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 155/194 (80%), Gaps = 4/194 (2%)
 Frame = -2

Query  815  SMASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
            +MA+ KW  TA+L+IDMQ DF+ P    PM V G +A+VP V  AV VAR RGI ++WVV
Sbjct  49   NMAAAKWSETAMLVIDMQ-DFVDPAMRSPMLVAGGEAVVPAVAGAVAVARERGIFVVWVV  107

Query  641  REHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTN  462
            REHDPSGRD ELFRRH YS GK  PT KG  GAEL DGLVIKEG+Y+LVKTRFSAFF T+
Sbjct  108  REHDPSGRDVELFRRHHYSGGK-GPTVKGLKGAELADGLVIKEGEYKLVKTRFSAFFATH  166

Query  461  LHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFD  282
            L S L++ GI +LVI GVQTPNCIRQTVFDA+A +Y+ VTV++DATAAA PEIH SNI D
Sbjct  167  LDSVLKTAGIKNLVIVGVQTPNCIRQTVFDAIALDYEKVTVLIDATAAARPEIHLSNIRD  226

Query  281  MKNIGVMTPTLEEW  240
            MKNIGV TPTLEEW
Sbjct  227  MKNIGVDTPTLEEW  240



>ref|XP_009628049.1| PREDICTED: uncharacterized protein LOC104118502 isoform X3 [Nicotiana 
tomentosiformis]
Length=165

 Score =   225 bits (574),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 136/190 (72%), Gaps = 38/190 (20%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            KW  TALL+IDMQ                                      VVREHD  G
Sbjct  8    KWNKTALLVIDMQ--------------------------------------VVREHDQLG  29

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            RD ELFRRHLY  GKPKPTSKGSVGAELVDGLVI+E DY+LVKTRFSAFFNTNLHSYLQ 
Sbjct  30   RDVELFRRHLYGDGKPKPTSKGSVGAELVDGLVIEEDDYKLVKTRFSAFFNTNLHSYLQG  89

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
             GIT+LVI GVQTPNCIRQTVFDAVA +Y+ VTVI+DATAAATP+IH +NIFDMKN+GV 
Sbjct  90   IGITNLVIIGVQTPNCIRQTVFDAVALDYERVTVIIDATAAATPDIHIANIFDMKNVGVA  149

Query  260  TPTLEEWCES  231
            TPTLEEWC S
Sbjct  150  TPTLEEWCRS  159



>dbj|BAJ88415.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   228 bits (580),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 153/192 (80%), Gaps = 3/192 (2%)
 Frame = -2

Query  809  ASGKWRNTALLIIDMQNDFILP--GGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
            A+GKW  TA+L+IDMQ DF+ P  G P+ V G +A+VP V +AV VAR RGI ++WVVRE
Sbjct  48   AAGKWSETAMLVIDMQKDFVDPAMGSPVLVAGGEAVVPAVAEAVAVARERGIFVVWVVRE  107

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            HDPSGRD ELFRRHLYS GK  PT KG  GAEL DGL IKEGDY+LVKTRFSAFF T+L 
Sbjct  108  HDPSGRDVELFRRHLYSGGK-GPTVKGLKGAELADGLFIKEGDYKLVKTRFSAFFATHLD  166

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMK  276
            S L++ GI +LVI GVQTPNCIRQTV+DAV  +Y+ V V++DATAAA P+IH +NI DMK
Sbjct  167  SVLKTQGIKNLVIVGVQTPNCIRQTVYDAVELDYEKVMVLIDATAAARPDIHLANIRDMK  226

Query  275  NIGVMTPTLEEW  240
             IGV TPTLEEW
Sbjct  227  TIGVETPTLEEW  238



>ref|XP_002988054.1| hypothetical protein SELMODRAFT_183601 [Selaginella moellendorffii]
 gb|EFJ10846.1| hypothetical protein SELMODRAFT_183601 [Selaginella moellendorffii]
Length=193

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 142/191 (74%), Gaps = 2/191 (1%)
 Frame = -2

Query  806  SGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            +G  R TALL+IDMQNDF+LPGGPMHV GA AIVP V K+VE AR  G  I+WVVREHD 
Sbjct  2    AGPQRRTALLVIDMQNDFVLPGGPMHVLGAPAIVPAVQKSVETARRHGHFIVWVVREHDA  61

Query  626  SGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYL  447
            S RD ELFRRHLY  G+  PT KG  GA LVDGL+ + G++   K RFSAFF TNL   L
Sbjct  62   SARDVELFRRHLYD-GETGPTCKGESGAALVDGLIPQPGEHIQRKFRFSAFFATNLDLVL  120

Query  446  QSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            +  GI+ LVI GVQTPNCIR TVFDA+A +Y  VTVI DATAAA+PEIH  N+ DM+N+ 
Sbjct  121  RRAGISHLVIVGVQTPNCIRATVFDAIALDYA-VTVIADATAAASPEIHAGNLLDMRNVS  179

Query  266  VMTPTLEEWCE  234
              TPTLEEW +
Sbjct  180  AATPTLEEWAK  190



>gb|KFK38972.1| hypothetical protein AALP_AA3G183500 [Arabis alpina]
Length=177

 Score =   221 bits (562),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 138/191 (72%), Gaps = 20/191 (10%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +WRNTALL+IDMQ DFI       V G ++IVPNV+  VE+AR RGI +IWVVREHDP G
Sbjct  4    RWRNTALLVIDMQKDFIEEASVRRVKGGKSIVPNVVGVVELARQRGIIVIWVVREHDPQG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIK-EGDYRLVKTRFSAFFNTNLHSYLQ  444
            RD ELFRRHLY+  K  P  KG+VGAELVDGL+IK E DY++VKTRFSAFF         
Sbjct  64   RDVELFRRHLYNSEKVGPVVKGTVGAELVDGLMIKEEEDYKIVKTRFSAFF---------  114

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
                      GVQTPNCIRQTVFDAV  +Y  VTVI DATAAATPEIHT+NI DMKNIG+
Sbjct  115  ----------GVQTPNCIRQTVFDAVELDYPSVTVITDATAAATPEIHTANILDMKNIGI  164

Query  263  MTPTLEEWCES  231
             TP+L EW E 
Sbjct  165  KTPSLHEWSEE  175



>ref|XP_006426937.1| hypothetical protein CICLE_v10026617mg [Citrus clementina]
 gb|ESR40177.1| hypothetical protein CICLE_v10026617mg [Citrus clementina]
Length=173

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  722  GAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGA  543
            G +AI+P+VIK+VE+AR RGI I+WVVREHDPSG + ELFRRH YS G+  P  KGS GA
Sbjct  3    GGKAILPSVIKSVEIARQRGIRIVWVVREHDPSGTNVELFRRHRYSNGRVGPVIKGSRGA  62

Query  542  ELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVA  363
             LVDGL IK+GDY++ KTRFSAFF T LHS+LQ  G+ SLVITG+QTPNCIRQT FDA+A
Sbjct  63   ALVDGLEIKQGDYKVAKTRFSAFFATPLHSFLQDAGVDSLVITGIQTPNCIRQTAFDAIA  122

Query  362  WNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLEEWC  237
            ++Y+ VTVIVDATAA TPE+H++NI DMK + + TPTL+EW 
Sbjct  123  YDYRSVTVIVDATAAVTPEVHSANIHDMKKVKIATPTLQEWS  164



>gb|EEC72908.1| hypothetical protein OsI_06736 [Oryza sativa Indica Group]
Length=195

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 128/168 (76%), Gaps = 2/168 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPG-GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            +W  TA+L+IDMQ DF+ P      +   +AI+P V  AV VAR RGI I+WVVREHDPS
Sbjct  10   EWSETAMLVIDMQKDFVDPATSSAALLAGEAILPTVTAAVAVARQRGIFIVWVVREHDPS  69

Query  623  GRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
            GRD ELFRRH YS GK     +GS GAEL DGL IK+GDY+LVKTRFSAFF T+L S L+
Sbjct  70   GRDVELFRRHFYSSGKGLGV-EGSKGAELADGLTIKDGDYKLVKTRFSAFFATHLDSVLK  128

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
            ++GI +LVI GVQTPNCIRQTVFDAVA +Y  V VI+DATAAA PEIH
Sbjct  129  TSGIKNLVIVGVQTPNCIRQTVFDAVALDYDKVAVIIDATAAAKPEIH  176



>ref|XP_001771068.1| predicted protein [Physcomitrella patens]
 gb|EDQ64069.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 137/191 (72%), Gaps = 1/191 (1%)
 Frame = -2

Query  803  GKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
             KW++TALL++DMQNDF+ P   + V G   ++P V KAV++AR +G  ++WVVREH  +
Sbjct  9    AKWKSTALLVVDMQNDFLSPECCLFVAGGPRVIPAVQKAVDIAREKGAFVVWVVREHHET  68

Query  623  GRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
            GRD E FR+HLY  G   PT +G+VGA LVDGLV   G++++VK+RFSAFF TNL   L+
Sbjct  69   GRDVEYFRKHLYD-GTSGPTMRGAVGAALVDGLVPIPGEHKIVKSRFSAFFATNLDLVLR  127

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
              GI  +V+ GVQTPNCIR T FDAVA++Y  VTV+ DAT A +  IH++N+ DM+ + +
Sbjct  128  REGIQHVVVAGVQTPNCIRATAFDAVAYDYPFVTVLSDATGAQSDAIHSANLLDMRKVSI  187

Query  263  MTPTLEEWCES  231
             TPT+ EW  S
Sbjct  188  ATPTVAEWAAS  198



>gb|ADE77768.1| unknown [Picea sitchensis]
Length=162

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 118/183 (64%), Gaps = 39/183 (21%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W+ TALL+IDMQNDFILPGGPMHV G  ++VP V ++V +AR +G  I+WVVREHD  GR
Sbjct  10   WKKTALLVIDMQNDFILPGGPMHVAGGASVVPAVKESVALAREKGALIVWVVREHDAYGR  69

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D E FRRHLY   K KPT+KG+ GAELV+GLVI+EGDY+LVKTRFSAFF TNLH  LQS 
Sbjct  70   DVEFFRRHLYGEEKEKPTTKGTRGAELVEGLVIQEGDYKLVKTRFSAFFATNLHYLLQSA  129

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMT  258
            GITSLV+                                        +N+FDM+N+ + T
Sbjct  130  GITSLVV---------------------------------------VANLFDMRNVTIET  150

Query  257  PTL  249
            PTL
Sbjct  151  PTL  153



>ref|XP_004952219.1| PREDICTED: uncharacterized protein LOC101764217 isoform X1 [Setaria 
italica]
Length=250

 Score =   197 bits (502),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 138/181 (76%), Gaps = 3/181 (2%)
 Frame = -2

Query  809  ASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
            A+ KW  TA+L+IDMQ DF+ P    PM V G +A+VP V +AV VAR RGI ++WVVRE
Sbjct  50   AAAKWSETAMLVIDMQKDFVDPAMRSPMLVAGGEAVVPAVAEAVAVARERGIFLVWVVRE  109

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            HDPSGRD ELFRRH YS GK  PT KG  GAEL DGLVIKEG+Y+LVKTRFSAFF T+L 
Sbjct  110  HDPSGRDVELFRRHHYSGGK-GPTVKGLKGAELADGLVIKEGEYKLVKTRFSAFFATHLD  168

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMK  276
            S L++ GI +LVI GVQTPNCIRQTVFDAVA +Y+ +TV++DATAAA PEIH        
Sbjct  169  SVLKTAGIKNLVIVGVQTPNCIRQTVFDAVALDYEKITVLIDATAAARPEIHLCEYLCFI  228

Query  275  N  273
            N
Sbjct  229  N  229



>gb|EMT18998.1| Putative isochorismatase family protein rutB [Aegilops tauschii]
Length=229

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 137/172 (80%), Gaps = 3/172 (2%)
 Frame = -2

Query  809  ASGKWRNTALLIIDMQNDFILP--GGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
            A+G+W  TA+L+IDMQ DF+ P  G P+ V G +A+VP V +AV VAR RGI ++WVVRE
Sbjct  55   AAGRWSETAMLVIDMQKDFVDPAMGSPVLVAGGEAVVPAVAEAVAVARERGIFVVWVVRE  114

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            HDPSGRD ELFRRHLYS GK  PT KG  GAEL DGL IKEGDY+LVKTRFSAFF T+L 
Sbjct  115  HDPSGRDVELFRRHLYSGGK-GPTVKGLKGAELADGLFIKEGDYKLVKTRFSAFFATHLD  173

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
            S L++ GI +LVI GVQTPNCIRQTV+DAV  +Y+ V V++DATAAA P+IH
Sbjct  174  SVLKTQGIKNLVIVGVQTPNCIRQTVYDAVELDYEKVIVLIDATAAARPDIH  225



>gb|EMS50491.1| Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB [Triticum 
urartu]
Length=249

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 137/172 (80%), Gaps = 3/172 (2%)
 Frame = -2

Query  809  ASGKWRNTALLIIDMQNDFILP--GGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
            A+G+W  TA+L+IDMQ DF+ P  G P+ V G +A+VP V +AV VAR RGI ++WVVRE
Sbjct  56   AAGRWSETAMLVIDMQKDFVDPAMGSPVLVAGGEAVVPAVAEAVAVARERGIFVVWVVRE  115

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            HDPSGRD ELFRRHLYS GK  PT KG  GAEL DGL IKEGDY+LVKTRFSAFF T+L 
Sbjct  116  HDPSGRDVELFRRHLYSGGK-GPTVKGLKGAELADGLFIKEGDYKLVKTRFSAFFATHLD  174

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
            S L++ GI +LVI GVQTPNCIRQTV+DAV  +Y+ V V++DATAAA P+IH
Sbjct  175  SVLKTQGIKNLVIVGVQTPNCIRQTVYDAVELDYEKVMVLIDATAAARPDIH  226



>ref|XP_010234136.1| PREDICTED: uncharacterized protein LOC100846613 isoform X2 [Brachypodium 
distachyon]
Length=214

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 132/202 (65%), Gaps = 40/202 (20%)
 Frame = -2

Query  827  APFTSM----ASGKWRNTALLIIDMQNDFILP--GGPMHVGGAQAIVPNVIKAVEVARNR  666
            +PF S     A+ KW  TA+L+IDMQ DF+ P  G P+ V G + +VP V +AV VAR R
Sbjct  45   SPFKSQRSMAAAAKWTETAMLVIDMQKDFVDPAMGSPVLVAGGEGVVPTVAEAVSVARER  104

Query  665  GIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTR  486
            GI ++WVVREHDPSGRD ELFRRHLYS GK  PT+KGS GAEL DGLVIKE         
Sbjct  105  GIFVVWVVREHDPSGRDVELFRRHLYSGGK-GPTAKGSKGAELADGLVIKE---------  154

Query  485  FSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPE  306
                                    GVQTPNCIRQT +DAVA +Y+ VTVI+DATAAA P+
Sbjct  155  ------------------------GVQTPNCIRQTAYDAVALDYEKVTVIIDATAAARPD  190

Query  305  IHTSNIFDMKNIGVMTPTLEEW  240
            IH SNI DMKNIGV  PTLEEW
Sbjct  191  IHLSNIRDMKNIGVEAPTLEEW  212



>ref|XP_006298601.1| hypothetical protein CARUB_v10014686mg [Capsella rubella]
 gb|EOA31499.1| hypothetical protein CARUB_v10014686mg [Capsella rubella]
Length=145

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = -2

Query  647  VVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEG--DYRLVKTRFSAF  474
            VVREHDP GRD E+FRRH Y+     PT KG+VGAELV+GL+I+E   DY++VKTRFSAF
Sbjct  2    VVREHDPRGRDVEVFRRHHYNSETVGPTVKGTVGAELVEGLIIREEEEDYKIVKTRFSAF  61

Query  473  FNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTS  294
            F TNLHS+LQ++G+  LVI GVQTPNCIRQTVFDAV  +Y  VTVI DATAAATPEIHT+
Sbjct  62   FGTNLHSFLQTSGVNKLVIAGVQTPNCIRQTVFDAVELDYPNVTVITDATAAATPEIHTA  121

Query  293  NIFDMKNIGVMTPTLEEWCE  234
            NI DMKNIGV TPTL EW E
Sbjct  122  NILDMKNIGVKTPTLHEWSE  141



>ref|XP_011013251.1| PREDICTED: uncharacterized protein LOC105117329 isoform X3 [Populus 
euphratica]
Length=160

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 125/190 (66%), Gaps = 39/190 (21%)
 Frame = -2

Query  815  SMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
            SMA  KW  TALL+IDMQ                                      VVRE
Sbjct  2    SMAD-KWNQTALLVIDMQ--------------------------------------VVRE  22

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            HDP GRDAELFRRHLYSPG   PTSKGSVGAELVDGLVIKEGDY+LVKTRFSAFF T+LH
Sbjct  23   HDPQGRDAELFRRHLYSPGNVGPTSKGSVGAELVDGLVIKEGDYKLVKTRFSAFFATHLH  82

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMK  276
            S+L + GI SLVI+GVQTPNCIRQTVFDAVA +YQPVTVIVDATAAATP IH  +  +  
Sbjct  83   SFLGTEGIKSLVISGVQTPNCIRQTVFDAVALDYQPVTVIVDATAAATPGIHDGSRKEEN  142

Query  275  NIGVMTPTLE  246
              G     LE
Sbjct  143  RKGKEEENLE  152



>dbj|BAD21813.1| isochorismatase hydrolase-like [Oryza sativa Japonica Group]
 dbj|BAD28670.1| isochorismatase hydrolase-like [Oryza sativa Japonica Group]
Length=428

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 128/172 (74%), Gaps = 6/172 (3%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPG-GPMHVGGAQAIVPNVIKAVEVARNRGIPIIW----VVRE  636
            +W  TA+L+IDMQ DF+ P      +   +AI+P V  AV VAR RGI I+W    VVRE
Sbjct  10   EWSETAMLVIDMQKDFVDPATSSAALLAGEAILPTVTAAVAVARQRGIFIVWQKYKVVRE  69

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            HDPSGRD ELFRRH YS GK     +GS GAEL DGL IK+GDY+LVKTRFSAFF T+L 
Sbjct  70   HDPSGRDVELFRRHFYSSGKGLGV-EGSKGAELADGLTIKDGDYKLVKTRFSAFFATHLD  128

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
            S L+++GI +LVI GVQTPNCIRQTVFDAVA +Y  V VI+DATAAA PEIH
Sbjct  129  SVLKTSGIKNLVIVGVQTPNCIRQTVFDAVALDYDKVAVIIDATAAAKPEIH  180



>gb|KHN47837.1| hypothetical protein glysoja_029255 [Glycine soja]
Length=221

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 131/211 (62%), Gaps = 47/211 (22%)
 Frame = -2

Query  866  SIQFKNSL*LS*AAPFTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKA  687
            S++ K++L ++ A P   MA   W  TALL+IDMQ DFI  G PM V G + IVPNVIKA
Sbjct  55   SLRSKSALAVAGADPL-EMAE-DWNRTALLVIDMQKDFIEDGRPMLVKGGKYIVPNVIKA  112

Query  686  VEVARNRGIPIIWVVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGD  507
            V+VAR RGI I+WVVREHDP G D ELFRRH Y+ GK  PTSKGS               
Sbjct  113  VDVARQRGILIVWVVREHDPLGTDVELFRRHHYAAGKVGPTSKGS---------------  157

Query  506  YRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivda  327
                                           GVQTPNCIRQTV DAVA +YQPVTVIVDA
Sbjct  158  ------------------------------EGVQTPNCIRQTVCDAVALDYQPVTVIVDA  187

Query  326  taaaTPEIHTSNIFDMKNIGVMTPTLEEWCE  234
            TAAATP+IH +N+FDMKNIGV TPTL+EW E
Sbjct  188  TAAATPDIHLANVFDMKNIGVATPTLQEWSE  218



>ref|XP_001695827.1| hypothetical protein CHLREDRAFT_103992 [Chlamydomonas reinhardtii]
 gb|EDP01164.1| predicted protein [Chlamydomonas reinhardtii]
Length=195

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = -2

Query  803  GKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
             K  +TAL+ IDMQNDF+L   P+ V    A +P+V +A+  AR + +PI+W++REHDPS
Sbjct  2    AKQADTALICIDMQNDFLLTSSPLCVKCGLACLPHVQEAIAAARAKSLPIVWIIREHDPS  61

Query  623  GRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
            G D E  R HL   G    T  GS GAELV+GL ++ G+  ++K RFSAF  T+L   L+
Sbjct  62   GVDIEYTRVHLLQSGGAGATVAGSKGAELVEGLEVQPGEAVVIKRRFSAFLATHLDLVLR  121

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
              G+  +V+ GVQTPNCIR T  DA+  +Y  V V+ DATA+ +  +  +N+ DM+ +G+
Sbjct  122  RLGVKRVVLCGVQTPNCIRATAVDALGLDY-GVQVLSDATASKSEAVQENNLEDMRCMGI  180

Query  263  MTPTLEEW  240
             TPT  EW
Sbjct  181  ATPTTAEW  188



>ref|XP_009353593.1| PREDICTED: uncharacterized protein LOC103944848 isoform X6 [Pyrus 
x bretschneideri]
Length=171

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 111/166 (67%), Gaps = 38/166 (23%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W++TALL+IDMQ                                      VVREHDP GR
Sbjct  4    WKHTALLVIDMQ--------------------------------------VVREHDPLGR  25

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            D ELFRRHLY  GK  PT KG  GAELVDGLVI++GDY+LVKTRFSAFF T L S+L+ +
Sbjct  26   DVELFRRHLYPAGKVGPTVKGERGAELVDGLVIEQGDYKLVKTRFSAFFATPLDSFLKGS  85

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
            GI SLV+TGVQTPNCIRQTVFD VA +Y+ VTVI+DATAAATP+IH
Sbjct  86   GIDSLVVTGVQTPNCIRQTVFDGVALDYKSVTVILDATAAATPDIH  131



>ref|XP_005849810.1| hypothetical protein CHLNCDRAFT_50982 [Chlorella variabilis]
 gb|EFN57708.1| hypothetical protein CHLNCDRAFT_50982 [Chlorella variabilis]
Length=202

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 123/181 (68%), Gaps = 7/181 (4%)
 Frame = -2

Query  782  LLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAELF  603
            LL+IDMQNDF LP   + V GA A +P VI AVE+AR + + IIWV+REHDPSG D ELF
Sbjct  20   LLVIDMQNDFCLPDAVLCVKGAMACLPAVIAAVELARRKAVEIIWVIREHDPSGIDVELF  79

Query  602  RRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITSL  423
            R  ++  G+   T +G+ GAELV GL ++ G+  ++K RFSAFF+T L    +  G+   
Sbjct  80   REPMFRLGR-SSTVRGTPGAELVAGLAVRPGERIVIKRRFSAFFDTELDRVCRRMGV---  135

Query  422  VITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLEE  243
               G  TPNCIR T +DA+A +Y  VTV+ DATA++T E+  +N++D++ + V TPT+ E
Sbjct  136  ---GRVTPNCIRGTAWDAIALDYPQVTVLSDATASSTDEVQQANLYDLRAVSVDTPTVAE  192

Query  242  W  240
            W
Sbjct  193  W  193



>ref|XP_002949507.1| hypothetical protein VOLCADRAFT_59236 [Volvox carteri f. nagariensis]
 gb|EFJ49526.1| hypothetical protein VOLCADRAFT_59236 [Volvox carteri f. nagariensis]
Length=190

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 120/184 (65%), Gaps = 2/184 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             T L+ IDMQNDF LP  P+ V GA   +P V +A++VAR + + ++WV+REHDPSG D 
Sbjct  5    ETCLICIDMQNDFCLPTSPLCVAGAMGCLPKVKQAIDVARAKQMHVVWVIREHDPSGVDV  64

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E  R HL+  G    T  G+ GAELV+GL ++ G+  +VK RFSAF +T+L   L+   +
Sbjct  65   EFTRAHLFKDG-AGSTVPGTKGAELVEGLEVRAGELVIVKKRFSAFLHTHLDLVLRRLKV  123

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
              +V+ GVQTPNCIR T  D++  +Y+   V+ DATA+ +  +  +N+ DM+ +G+ TPT
Sbjct  124  QRVVLCGVQTPNCIRATAVDSLGHDYE-TLVLSDATASKSEAVQDANLEDMRCMGIATPT  182

Query  251  LEEW  240
            +  W
Sbjct  183  VAAW  186



>ref|XP_006369197.1| hypothetical protein POPTR_0001s18650g, partial [Populus trichocarpa]
 gb|ERP65766.1| hypothetical protein POPTR_0001s18650g, partial [Populus trichocarpa]
Length=122

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -2

Query  647  VVREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFN  468
            V+REHDP GRD E+F RHLYS G   PTSKGSVGAEL DGLVIKEGDY+LVKT  SAF  
Sbjct  1    VLREHDPQGRDVEVFHRHLYSSGNVGPTSKGSVGAELADGLVIKEGDYKLVKTCLSAFVA  60

Query  467  TNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQP  348
            T+LHS L++ GI SLVI+GV+TPNCIRQTVFDA+A +YQP
Sbjct  61   THLHSLLRTEGIKSLVISGVRTPNCIRQTVFDAIAVDYQP  100



>gb|AFW70917.1| hypothetical protein ZEAMMB73_638698 [Zea mays]
Length=186

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 104/137 (76%), Gaps = 3/137 (2%)
 Frame = -2

Query  815  SMASGKWRNTALLIIDMQNDFILPG--GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
            +MA+ KW  TA+L+IDMQ DF+ P    PM V G +A+VP V  AV VAR RGI ++WVV
Sbjct  49   NMAAAKWSETAMLVIDMQKDFVDPAMRSPMLVAGGEAVVPAVAGAVAVARERGIFVVWVV  108

Query  641  REHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTN  462
            REHDPSGRD ELFRRH YS GK  PT KG  GAEL DGLVIKEG+Y+LVKTRFSAFF T+
Sbjct  109  REHDPSGRDVELFRRHHYSGGK-GPTVKGLKGAELADGLVIKEGEYKLVKTRFSAFFATH  167

Query  461  LHSYLQSNGITSLVITG  411
            L S L++ GI +LVI G
Sbjct  168  LDSVLKTAGIKNLVIVG  184



>ref|XP_011008325.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105113728 
[Populus euphratica]
Length=207

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 98/124 (79%), Gaps = 2/124 (2%)
 Frame = -2

Query  662  IPIIWV--VREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKT  489
            IPI WV  + +HDP GRD E+F  HLYS G   PTSKGSVGAEL DGL IKEGDY+LVKT
Sbjct  77   IPIGWVFVLSQHDPKGRDVEVFHGHLYSXGNVGPTSKGSVGAELADGLEIKEGDYKLVKT  136

Query  488  RFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTP  309
             FSAFF T L S L++ GI SLVI+GV+TPNCIRQTVFDA+A +YQPV VI  ATAAATP
Sbjct  137  PFSAFFATLLLSLLRTEGIKSLVISGVRTPNCIRQTVFDAIAVDYQPVIVIFYATAAATP  196

Query  308  EIHT  297
            +IH 
Sbjct  197  DIHV  200



>ref|WP_015284272.1| nicotinamidase-like amidase [Methanoregula formicica]
 ref|YP_007247815.1| nicotinamidase-like amidase [Methanoregula formicica SMSP]
 gb|AGB01308.1| nicotinamidase-like amidase [Methanoregula formicica SMSP]
Length=188

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 114/174 (66%), Gaps = 3/174 (2%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            ALLIIDMQNDF+    P  V GA A+VP +   +   R R +P+  ++R H P G D E+
Sbjct  5    ALLIIDMQNDFVCEDSPYRVAGATAVVPKIQAVLAEFRKRNLPVFHILRIHRPDGSDVEI  64

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
             R+  +   K      G+ GA ++D LV +EG+Y L KTR SAF  T L   L++ GITS
Sbjct  65   IRQEKFK--KVPFAVAGTHGAAIIDELVPREGEYILTKTRMSAFIGTELDLILRTLGITS  122

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            +V+TG+QTPNCIR TVFDA+A+NY P  ++ DA  AAT EIH +N+ DM+NIGV
Sbjct  123  VVVTGIQTPNCIRTTVFDAIAYNY-PAIIVDDAVGAATEEIHRANLRDMENIGV  175



>ref|WP_011736809.1| isochorismatase [Pelobacter propionicus]
 ref|YP_902631.1| isochorismatase hydrolase [Pelobacter propionicus DSM 2379]
 gb|ABL00574.1| isochorismatase hydrolase [Pelobacter propionicus DSM 2379]
Length=190

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 114/185 (62%), Gaps = 2/185 (1%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            AL+IIDMQNDF+LPG P  V GA A +P V + ++  R    P+  VVRE+   G D E 
Sbjct  7    ALIIIDMQNDFVLPGAPACVAGAYATLPCVRRLLDFFRANSWPVFHVVREYRADGSDIEC  66

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
             R H +   K +    G+ G E+V  L   EG+YR+VK RFS F NT L   L+  G T 
Sbjct  67   TRLHGFLNDK-RYAVPGTEGCEIVAELAPVEGEYRVVKNRFSGFMNTELDFMLRRIGATQ  125

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLE  246
            LVI G Q PNCIR T+FDA+A  Y PV  + DAT+A TP+I  +NI D+KNIGV   TL 
Sbjct  126  LVICGTQYPNCIRTTIFDAIAHGY-PVINVTDATSAQTPQIAEANITDLKNIGVECVTLR  184

Query  245  EWCES  231
            E+ +S
Sbjct  185  EFLQS  189



>ref|WP_027984630.1| isochorismatase [delta proteobacterium PSCGC 5296]
Length=193

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 117/179 (65%), Gaps = 2/179 (1%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +  N ALLIIDMQNDF++PG P+ V GA+A VP + KA++  R + +P+   VRE+ P G
Sbjct  4    QTENYALLIIDMQNDFVMPGSPIRVAGAKATVPLIAKALKSFRTKKLPVFHAVREYRPDG  63

Query  620  RDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
             D E+ R   +   + K    G+ G E+VD L    G+YR+VK RFSAF NT L   L+ 
Sbjct  64   SDIEITRLDNFLE-RAKTVVPGTEGCEIVDELRPLPGEYRIVKNRFSAFMNTELDFMLRR  122

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
              IT+L+I G Q P+CIR +VFDAV++ Y  VT++ DAT+A T EI  SNI D+ +IGV
Sbjct  123  LEITNLIICGTQYPSCIRCSVFDAVSYGYT-VTLLTDATSAQTEEIAESNIRDISDIGV  180



>ref|NP_001046543.2| Os02g0276200 [Oryza sativa Japonica Group]
 dbj|BAF08457.2| Os02g0276200 [Oryza sativa Japonica Group]
Length=125

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 87/120 (73%), Gaps = 2/120 (2%)
 Frame = -2

Query  767  MQNDFILPG-GPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAELFRRHL  591
            MQ DF+ P      +   +AI+P V  AV VAR RGI I+WVVREHDPSGRD ELFRRH 
Sbjct  1    MQKDFVDPATSSAALLAGEAILPTVTAAVAVARQRGIFIVWVVREHDPSGRDVELFRRHF  60

Query  590  YSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITSLVITG  411
            YS GK     +GS GAEL DGL IK+GDY+LVKTRFSAFF T+L S L+++GI +LVI G
Sbjct  61   YSSGKGLGV-EGSKGAELADGLTIKDGDYKLVKTRFSAFFATHLDSVLKTSGIKNLVIVG  119



>ref|WP_012107800.1| isochorismatase hydrolase [Methanoregula boonei]
 ref|YP_001405383.1| isochorismatase hydrolase [Methanoregula boonei 6A8]
 gb|ABS56740.1| isochorismatase hydrolase [Methanoregula boonei 6A8]
Length=188

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 114/174 (66%), Gaps = 3/174 (2%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            ALLIIDMQNDF+  G P+ V  A++++P +++ +E  R + +P+  ++R H   G D E+
Sbjct  5    ALLIIDMQNDFVREGAPLRVAQAKSVIPKILEVLEAFRAKNLPVFHILRIHRSDGSDVEI  64

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
             R  ++S  +      GS GA  +  L  + G++ + K R SAF  T L   LQ+ G+T 
Sbjct  65   TRIEIFS--RHPFAVAGSEGAREITELTPRPGEHVIGKVRMSAFIGTELGLMLQTLGVTE  122

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            LV+TG+QTPNCIR TVFDA+A+NY PV ++ DAT A + +IH +N+ DMKNIGV
Sbjct  123  LVVTGIQTPNCIRTTVFDAIAYNY-PVILVDDATGAQSEDIHRANVLDMKNIGV  175



>ref|WP_011699486.1| isochorismatase [Syntrophobacter fumaroxidans]
 ref|YP_846754.1| isochorismatase hydrolase [Syntrophobacter fumaroxidans MPOB]
 gb|ABK18319.1| isochorismatase hydrolase [Syntrophobacter fumaroxidans MPOB]
Length=195

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 115/188 (61%), Gaps = 10/188 (5%)
 Frame = -2

Query  782  LLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAELF  603
            L+I+DMQNDF+LPG P  + GA A +P +++A+E  R R  P+  VVRE+   G D E F
Sbjct  10   LIIVDMQNDFVLPGSPTALDGAYATIPEIVRALEFFRERKWPVFHVVREYREDGSDIESF  69

Query  602  R----RHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
            R       Y  G P     G+ G E+V  L    G+YR+VK RFSAF  T L   L+  G
Sbjct  70   RYGRFMEQYKCGVP-----GTRGCEIVAELTPLPGEYRIVKNRFSAFMLTELDFMLRRLG  124

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTP  255
            +  + + G Q PNCIR TVFD VA+ Y  VTV+ DAT+A TPEI  +NI DM+NI V   
Sbjct  125  LDRIAVCGTQYPNCIRTTVFDGVAYGY-AVTVLTDATSARTPEIAAANITDMRNIDVECI  183

Query  254  TLEEWCES  231
            T+EE+ ++
Sbjct  184  TVEEFVKA  191



>ref|WP_006847929.1| isochorismatase [Prevotella copri]
 gb|EFB35093.1| isochorismatase family protein [Prevotella copri DSM 18205]
Length=219

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 114/183 (62%), Gaps = 1/183 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
            + A+L+IDMQNDF+ P G + V GA+A +P + K +   R++   ++WV R+H  SG D 
Sbjct  32   DVAILVIDMQNDFVDPKGKLCVAGAKATIPAINKLIAYGRSKNWKVVWVTRDHRSSGVDV  91

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            +  R  L+  GK      G+ G  LVDGL  ++ D    K R SAFFNTNL   L+  G+
Sbjct  92   DAPRIPLFVEGKTGYCVPGTWGGALVDGLKPEKEDIMSPKFRNSAFFNTNLDLMLRRMGV  151

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
             ++V+ G Q PNC+R T  DA++++Y+   V  DA +A TPE+  +N+FDMKN+G+   +
Sbjct  152  RTVVLAGTQYPNCVRGTANDAMSYDYE-TVVCTDACSAKTPEVAAANVFDMKNMGIKCIS  210

Query  251  LEE  243
            L+E
Sbjct  211  LDE  213



>ref|WP_014807235.1| nicotinamidase-like amidase [Anaerobaculum mobile]
 ref|YP_006444333.1| nicotinamidase-like amidase [Anaerobaculum mobile DSM 13181]
 gb|AFM22008.1| nicotinamidase-like amidase [Anaerobaculum mobile DSM 13181]
Length=212

 Score =   141 bits (356),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 116/187 (62%), Gaps = 2/187 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             TA LI+DMQNDF LPG P  V GA  +  N+ +A+E  R   +P++ V R + P G D 
Sbjct  3    KTAFLIVDMQNDFCLPGAPFEVKGAMGVARNIRRALEACRQHKLPVVHVFRYYRPDGSDV  62

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E+ R   +         +G+ G E+V+ L    G+Y + K R+SAFF T L S L+  G+
Sbjct  63   EITRYDKFMQ-VGGALIEGTKGGEIVEELKPLAGEYLVCKRRWSAFFQTELDSLLKRLGV  121

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
              +V+TGVQTPNCIR TV+DA + +Y+ V V+VD T A T E+H +N+ DMKNIG    T
Sbjct  122  DQVVVTGVQTPNCIRGTVWDANSLDYE-VIVLVDGTGANTQEVHEANLTDMKNIGAKLMT  180

Query  251  LEEWCES  231
            ++E+ +S
Sbjct  181  VDEFVKS  187



>ref|WP_035105234.1| hypothetical protein, partial [Desulfovibrio sp. L21-Syr-AB]
Length=185

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 113/182 (62%), Gaps = 1/182 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            R+TALLIIDMQ DF++PG P  VG A   V  + +A+ V R RG P+++V R +   G +
Sbjct  5    RHTALLIIDMQRDFVVPGAPCAVGEAGVAVDGISRALAVFRGRGWPVVYVTRSYRADGSN  64

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
             E  RR  +  G+ +   +GS GA +VD L+   G+  + K  FSAFF+T L   L++  
Sbjct  65   VEYTRRGGFLSGERQCCLEGSEGARIVDELLPLPGETVITKPSFSAFFHTELDLILRNRS  124

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTP  255
            IT L +TGV T NC+R TVFDAV   Y+  TVI DATAA T +I   N+ DM+ IGV TP
Sbjct  125  ITGLAVTGVNTANCVRATVFDAVGLGYR-TTVISDATAADTAQITQDNLRDMRAIGVDTP  183

Query  254  TL  249
             L
Sbjct  184  PL  185



>ref|WP_011447213.1| isochorismatase hydrolase [Methanospirillum hungatei]
 ref|YP_501636.1| isochorismatase hydrolase [Methanospirillum hungatei JF-1]
 gb|ABD39917.1| isochorismatase hydrolase [Methanospirillum hungatei JF-1]
Length=191

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 112/175 (64%), Gaps = 5/175 (3%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            ALLIIDMQNDF      + V GAQA++  + + + + R + +P+  +VR H+P G D E 
Sbjct  6    ALLIIDMQNDFASAHAVLPVAGAQAVITPLTQLLSLFRGKHLPVFHIVRVHEPDGSDVEW  65

Query  605  FRRHLYSPGKPKPTS-KGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGIT  429
            FR  L+   K KP + +GS  A ++D L    G++ + K R SAF  T L   L++ G+ 
Sbjct  66   FRADLF---KDKPFAVRGSHSAAVIDELTPVPGEHLIEKVRMSAFIGTTLDLMLRTLGVN  122

Query  428  SLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
             +V+ G+QTPNCIR TVFDA+A+NY+   ++ DAT A T EIH +N+ DMKNIGV
Sbjct  123  IVVVGGIQTPNCIRTTVFDAMAFNYE-TILVDDATGAQTKEIHEANVLDMKNIGV  176



>ref|WP_015540064.1| Amidases related to nicotinamidase [Gordonibacter pamelaeae]
 ref|YP_007803113.1| Amidases related to nicotinamidase [Gordonibacter pamelaeae 7-10-1-b]
 emb|CBL04720.1| Amidases related to nicotinamidase [Gordonibacter pamelaeae 7-10-1-b]
Length=214

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 113/192 (59%), Gaps = 5/192 (3%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            R  AL++IDMQN FI P   + V GA A VP   +A++ AR  G+P+  VVRE+   G D
Sbjct  5    RKAALIVIDMQNGFIDPASALCVEGAAATVPACSRALDHARELGMPVFHVVREYAEDGSD  64

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVI---KEGDYRLVKTRFSAFFNTNLHSYLQ  444
             E  R   +  G  KP S+  V    +D L     + GD  +VK RFSAFFNTNL + L+
Sbjct  65   VEAVRHAAWHDGG-KPVSRACVNPRSLDELAPLAPQPGDRVVVKPRFSAFFNTNLDNVLR  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
              G+ ++V+ G  TPNCIR T +DA++ +Y  V VI D T++ TP +  +NI DM +IG 
Sbjct  124  RLGVGTVVLIGTTTPNCIRTTCYDALSLDYN-VAVIEDCTSSRTPAVQAANIEDMAHIGA  182

Query  263  MTPTLEEWCESG  228
               T +E+C  G
Sbjct  183  QMLTCDEFCMQG  194



>ref|WP_006508291.1| nicotinamidase-like amidase [Xenococcus sp. PCC 7305]
 gb|ELS04626.1| nicotinamidase-like amidase [Xenococcus sp. PCC 7305]
Length=190

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 112/185 (61%), Gaps = 2/185 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            R TAL+IIDMQNDF+L G PM V GA+AIVPN+ K +   R    P+  V+RE+   G D
Sbjct  3    RQTALIIIDMQNDFVLAGAPMEVAGARAIVPNLKKVLNYFRRASWPVFHVIREYRADGSD  62

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
             E  RR  +   +      G+ G E+++ L    G+YRLVK  FS F NT L   L+   
Sbjct  63   IEKPRRDRFLTDQSYCVP-GTKGWEIIEELNPVAGEYRLVKNHFSGFMNTELDFMLRRLE  121

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTP  255
            ++++V+ GVQ PNCIR T++D V+  Y  VT++ DA  A T  +  +NI+D+ NIGV   
Sbjct  122  VSNIVVCGVQYPNCIRATIYDGVSLGYD-VTLVTDAAGAETEAVAKANIYDISNIGVECI  180

Query  254  TLEEW  240
            T E++
Sbjct  181  TTEQF  185



>ref|WP_028571956.1| isochorismatase [Desulfonatronum lacustre]
Length=196

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 106/181 (59%), Gaps = 2/181 (1%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            ALLI+DMQNDF+LP  P  V GA+  +P +    E AR R  P+I VVREH P G D E 
Sbjct  8    ALLIVDMQNDFVLPDAPAAVAGARETIPVIAALAEHARKRSWPVIHVVREHRPDGSDVEY  67

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
             R+ L+  G     + G+ GA +V  L  + GDY L K RFSAF  T L   L+   + +
Sbjct  68   TRQELFQNGAGICVA-GTPGARIVVELTPRSGDYVLTKQRFSAFLGTELDFLLRRLRVET  126

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLE  246
            LV+ G Q PNCIR T  DA+  +Y+ V V+ DA +A T  +  +NI DM+N+G+     +
Sbjct  127  LVVAGTQYPNCIRATAVDALGRDYR-VIVVSDACSAQTERVAANNIEDMRNMGITCMAFQ  185

Query  245  E  243
            E
Sbjct  186  E  186



>ref|WP_005030489.1| isochorismatase [Bilophila wadsworthia]
 gb|EFV42655.1| hypothetical protein HMPREF0179_03533 [Bilophila wadsworthia 
3_1_6]
Length=188

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 110/183 (60%), Gaps = 2/183 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
            N AL+IIDMQNDF+LP  P+ V GAQA VP + K ++ AR  G  +I V+R+H   G D 
Sbjct  2    NIALVIIDMQNDFVLPEAPLCVKGAQATVPTIQKLLDRARAEGWRVIHVIRQHRRDGSDV  61

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E+ R  L++ G       G+ GAE+VD L     +  L K RFSAFF T L   L+   I
Sbjct  62   EIGRAPLFTQGA-GICVPGTKGAEIVDELAPLPNETILRKLRFSAFFQTELDMLLRRLKI  120

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
             +L+I G Q PNC+R T  DA++ +Y    V+ DA +A T EI  +NI DMKN+G+   T
Sbjct  121  DTLLIAGTQYPNCVRGTATDAMSHDYN-TIVVTDACSAQTDEIAATNIRDMKNMGITCVT  179

Query  251  LEE  243
            L E
Sbjct  180  LAE  182



>ref|WP_029437032.1| isochorismatase [Bilophila wadsworthia]
Length=188

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 110/183 (60%), Gaps = 2/183 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
            N AL+IIDMQNDF+LP  P+ V GAQA VP + K ++ AR  G  +I V+R+H   G D 
Sbjct  2    NIALVIIDMQNDFVLPEAPLCVKGAQATVPTIQKLLDRARAEGWRVIHVIRQHRRDGSDV  61

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E+ R  L++ G       G+ GAE+VD L     +  L K RFSAFF T L   L+   I
Sbjct  62   EIGRAPLFTQGA-GICVPGTKGAEIVDELAPLPDETILRKLRFSAFFQTELDMILRRLKI  120

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
             +L+I G Q PNC+R T  DA++ +Y    V+ DA +A T EI  +NI DMKN+G+   T
Sbjct  121  DTLLIAGTQYPNCVRGTATDAMSHDYN-TIVVTDACSAQTDEIAATNIRDMKNMGITCVT  179

Query  251  LEE  243
            L E
Sbjct  180  LAE  182



>ref|WP_015775476.1| isochorismatase [Desulfomicrobium baculatum]
 ref|YP_003159805.1| isochorismatase hydrolase [Desulfomicrobium baculatum DSM 4028]
 gb|ACU91389.1| isochorismatase hydrolase [Desulfomicrobium baculatum DSM 4028]
Length=193

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 113/185 (61%), Gaps = 5/185 (3%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
            N ALLIIDMQ DF +PGG   V GA A +P + K +   R+ G P+  +VRE+   G D 
Sbjct  5    NRALLIIDMQYDFAVPGGACEVAGAHATIPVIRKVLTSFRDLGRPVFHIVREYRSDGSDV  64

Query  611  ELFRRHLYSPGKPKP-TSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
            E+ R+      K +P    G+ GA +  GL   EG+YR+VK RFSAF  T L   L+  G
Sbjct  65   EISRQEAL---KTRPMVVPGTPGARIAPGLEPIEGEYRIVKQRFSAFMFTELDLILRRKG  121

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTP  255
            I+ L +TG Q P C+R T+FD ++  Y  +T++ DA+++ T EIH +NI D+++ G+   
Sbjct  122  ISHLAVTGTQLPFCLRATLFDGLSLGYH-MTLLTDASSSRTQEIHLANIRDIRDAGMACV  180

Query  254  TLEEW  240
            T+EE+
Sbjct  181  TVEEY  185



>ref|WP_011980618.1| isochorismatase [Sulfurovum sp. NBC37-1]
 ref|YP_001358242.1| isochorismatase hydrolase [Sulfurovum sp. NBC37-1]
 dbj|BAF71885.1| isochorismatase hydrolase [Sulfurovum sp. NBC37-1]
Length=188

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 111/188 (59%), Gaps = 2/188 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             TAL+I+DMQNDF+LP  P  + GA  I+PN+ K +   R + +P+  V RE+   G D 
Sbjct  3    KTALIIVDMQNDFVLPNAPHCIEGAVPIIPNIQKVLYTFREKLLPVFHVYREYRADGSDI  62

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E  R   +  G  K     + G E++DGL   +G+YR+VK RFS F NT L   L+   I
Sbjct  63   EKTRLDDFL-GGTKYCVPRTKGCEIIDGLSPMDGEYRIVKNRFSGFMNTELDFILRRLKI  121

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
              +V+ G+Q PNCIR T++D +A  Y  VT++ DATAA T EI  +NI D++NIGV   +
Sbjct  122  ERIVVCGIQYPNCIRATIYDGIALGYD-VTLVTDATAAQTEEIAQANIMDIRNIGVECIS  180

Query  251  LEEWCESG  228
             E   E  
Sbjct  181  TELLIEQA  188



>ref|WP_009369225.1| isochorismatase [Bilophila sp. 4_1_30]
 gb|EGW43146.1| hypothetical protein HMPREF0178_03917 [Bilophila sp. 4_1_30]
Length=188

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 111/183 (61%), Gaps = 2/183 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
            N AL+IIDMQNDF+LP  P+ V GAQA VP + + ++ AR  G  +I V+R+H   G D 
Sbjct  2    NIALVIIDMQNDFVLPEAPLCVKGAQATVPTIRELLDRARAEGWRVIHVIRQHRRDGSDV  61

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E+ R  L++ G       G+ GAE+VD L     +  L K RFSAFF T L   L+   I
Sbjct  62   EIGRAPLFTQGA-GICVPGTKGAEIVDELAPLPNETILRKLRFSAFFQTELDMLLRRLKI  120

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
             +L+I G Q PNC+R T  DA++ +Y    V+ DA +A T EI ++N+ DMKN+G+   T
Sbjct  121  DTLLIAGTQYPNCVRGTATDAMSHDYN-TIVVTDACSAQTDEIASTNVRDMKNMGITCVT  179

Query  251  LEE  243
            L E
Sbjct  180  LAE  182



>ref|WP_027184219.1| hypothetical protein [Desulfovibrio inopinatus]
Length=195

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 110/185 (59%), Gaps = 1/185 (1%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            AL+ IDMQNDF+LPG P  VG A + + N+ K +   R++ +P++ V R +   G D EL
Sbjct  6    ALVSIDMQNDFVLPGAPFAVGEAMSRIENMSKVLHFFRSKNLPVVHVCRRYRTDGSDVEL  65

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
             RR  +  G  +   + + GA++V  L     +Y +VK RFSAFF T L   L+  GI +
Sbjct  66   VRRSAFLDGTSRGVVENTEGAKIVQELSPSNNEYVIVKPRFSAFFATELDLLLRRLGIHT  125

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLE  246
            +V+ GV T NCIR T +D ++ +Y  V V+ DATAA T  I   N+ DM  IG+ TP+ E
Sbjct  126  IVLIGVNTANCIRSTAYDGISLDYD-VVVLADATAAQTKAITEYNLQDMARIGIATPSFE  184

Query  245  EWCES  231
            E+  S
Sbjct  185  EFRHS  189



>ref|WP_010937344.1| isochorismatase [Desulfovibrio vulgaris]
 ref|YP_009258.1| isochorismatase [Desulfovibrio vulgaris str. Hildenborough]
 ref|YP_968366.1| isochorismatase hydrolase [Desulfovibrio vulgaris DP4]
 ref|YP_005700870.1| isochorismatase hydrolase [Desulfovibrio vulgaris RCH1]
 gb|AAS94517.1| isochorismatase family protein [Desulfovibrio vulgaris str. Hildenborough]
 gb|ABM29939.1| isochorismatase hydrolase [Desulfovibrio vulgaris DP4]
 gb|ADP85232.1| isochorismatase hydrolase [Desulfovibrio vulgaris RCH1]
Length=204

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 104/177 (59%), Gaps = 2/177 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            R  AL IIDMQNDF+LPG P  V GA   VP +   +  AR  G  ++ VVR H   G D
Sbjct  5    RTVALAIIDMQNDFVLPGAPACVEGAMGTVPVIAGLLAKARAEGWMVLHVVRAHRADGSD  64

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
            AE  R HL+  G     + G+ GAE+V GL    G+  LVKTRFSAF  T     L+  G
Sbjct  65   AEKSREHLFLEGGGLCVA-GTPGAEIVAGLEPASGETVLVKTRFSAFMGTECDMLLRRRG  123

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            + +L+++G Q PNCIR T  DA A +Y  V V+ DA +A TP +  SNI DM+ +G+
Sbjct  124  VDTLLVSGTQYPNCIRGTAVDAFALDYD-VVVVTDACSARTPGVAESNINDMRAMGI  179



>ref|WP_028586584.1| isochorismatase [Desulfocurvus vexinensis]
Length=187

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 113/181 (62%), Gaps = 2/181 (1%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            ALLIIDMQ DF LP GP+ V GA A VP + + + + R RG  +  V+REH P G DAE+
Sbjct  2    ALLIIDMQEDFALPTGPLFVPGAPATVPALARLLALGRARGWAVFHVLREHAPDGSDAEI  61

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
             RR L++ G       G+ GA +V+ L    G+  +VK RFSAFF T+LH+ L + G+ +
Sbjct  62   TRRGLFT-GGGGFCLPGTPGARIVEPLRPLPGETCVVKKRFSAFFGTDLHARLTALGVGT  120

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLE  246
            +V+ G Q PNCIR T  DA+A +Y+ V V+ D  +AAT  +  +N+ D++ +G+    L 
Sbjct  121  VVLGGTQYPNCIRATATDALARDYR-VIVVTDCCSAATQAVAEANVADLRAMGLTCVPLA  179

Query  245  E  243
            E
Sbjct  180  E  180



>ref|WP_020879378.1| isochorismatase hydrolase [Desulfovibrio sp. X2]
 gb|EPR44338.1| isochorismatase hydrolase [Desulfovibrio sp. X2]
Length=199

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 110/174 (63%), Gaps = 2/174 (1%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            AL I+DMQNDF+LPG P  V GA+A VP +++ + +AR R  P++ V R H P G DAE+
Sbjct  13   ALAIVDMQNDFVLPGAPACVAGAEATVPTLVRLLALARARAWPVVHVHRLHRPDGSDAEI  72

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
             RRHL+S G       GS GAE++  L    G+Y L KTR+SAF +T L + L+   + +
Sbjct  73   PRRHLFSQGT-GICVTGSKGAEIIPALAPLPGEYLLPKTRYSAFLDTPLDALLRRLNVRT  131

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            L++ G Q PNCIR T  DA+A +Y    V+ DA +A  P++  +N+ DM  +G+
Sbjct  132  LLVGGTQYPNCIRATATDAMARDYH-TIVVTDACSAQAPDVAQANVRDMLAMGI  184



>ref|WP_028578072.1| isochorismatase [Desulfomicrobium escambiense]
Length=194

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 113/184 (61%), Gaps = 3/184 (2%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
            N ALLIIDMQNDF +PGG   V GA A +P + + +   R  G+P+  VVRE+   G D 
Sbjct  2    NEALLIIDMQNDFAVPGGTCEVPGAHATIPAIRRVLLRFRELGLPVFHVVREYRADGSDV  61

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E+ R  L +  +      G+ G  +V GL  + G+YR+VK RFSAF  T L   L+  GI
Sbjct  62   EITR--LAALKEKDMVVPGTPGVRIVPGLEPEAGEYRIVKPRFSAFMFTELDLILRRKGI  119

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
            T L +TG Q P C+R T+FD +   Y+ +T+I DA+++ T EIH +NI D+++ G+   +
Sbjct  120  THLAVTGTQLPFCLRATLFDGLCLGYR-MTLITDASSSRTEEIHHANIRDIRDAGMDCVS  178

Query  251  LEEW  240
            ++E+
Sbjct  179  VDEY  182



>ref|WP_031388075.1| isochorismatase [Desulfonatronum thiodismutans]
Length=192

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 107/181 (59%), Gaps = 2/181 (1%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            ALLI+DMQNDF+LP  P  V GA+  +P +    E AR R  P+I VVREH P G D E 
Sbjct  4    ALLIVDMQNDFVLPDAPAAVAGARETIPVIATLAEHARKRSWPVIHVVREHRPDGSDVEY  63

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
             R+ L+  G     + G+ GA +V  L+ + GDY L K RFSAF  T L   L+     +
Sbjct  64   TRQELFQNGAGICVA-GTPGARIVAELMPRSGDYVLTKQRFSAFLGTELDLLLRRLRAET  122

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPTLE  246
            L++ G Q PNCIR T  DA+  +Y+ V V+ DA +A T  I  +NI DM+N+G++    +
Sbjct  123  LIVAGTQYPNCIRATAVDALGRDYR-VIVVTDACSAQTERIAANNIEDMRNMGMLCIPFQ  181

Query  245  E  243
            E
Sbjct  182  E  182



>ref|WP_008871388.1| isochorismatase [Desulfonatronospira thiodismutans]
 gb|EFI34039.1| isochorismatase hydrolase [Desulfonatronospira thiodismutans 
ASO3-1]
Length=189

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 105/181 (58%), Gaps = 2/181 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
            N AL +IDMQND +LPG P HV GA   +P +    E  RN   P+I+VVR H     D 
Sbjct  6    NPALAVIDMQNDVVLPGSPCHVPGAMETIPAIRNLAEHFRNNKWPVIYVVRGHRQDASDL  65

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E  R  L+   K      G+ GAE+VDGL +K  DY LVK RFSAF  T     L+   I
Sbjct  66   EYTRLQLFM-DKGGICVTGTKGAEIVDGLEVKPQDYILVKKRFSAFLFTEFDLLLRRLNI  124

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
             +L I G Q PNCIR T  DA+A +Y+ V V+ DA +A++  I  +NI DM+N+G+   +
Sbjct  125  KTLAIAGTQYPNCIRSTAVDALARDYR-VVVVTDACSASSRRIADNNIEDMQNMGIECLS  183

Query  251  L  249
            L
Sbjct  184  L  184



>pdb|3HU5|A Chain A, Crystal Structure Of Isochorismatase Family Protein 
From Desulfovibrio Vulgaris Subsp. Vulgaris Str. Hildenborough
 pdb|3HU5|B Chain B, Crystal Structure Of Isochorismatase Family Protein 
From Desulfovibrio Vulgaris Subsp. Vulgaris Str. Hildenborough
Length=204

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 101/177 (57%), Gaps = 2/177 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            R  AL IID QNDF+LPG P  V GA   VP +   +  AR  G  ++ VVR H   G D
Sbjct  7    RTVALAIIDXQNDFVLPGAPACVEGAXGTVPVIAGLLAKARAEGWXVLHVVRAHRADGSD  66

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
            AE  R HL+  G     + G+ GAE+V GL    G+  LVKTRFSAF  T     L+  G
Sbjct  67   AEKSREHLFLEGGGLCVA-GTPGAEIVAGLEPASGETVLVKTRFSAFXGTECDXLLRRRG  125

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            + +L+++G Q PNCIR T  DA A +Y  V V+ DA +A TP +  SNI D +  G+
Sbjct  126  VDTLLVSGTQYPNCIRGTAVDAFALDYD-VVVVTDACSARTPGVAESNINDXRAXGI  181



>emb|CBX30283.1| hypothetical protein N47_D30920 [uncultured Desulfobacterium 
sp.]
Length=197

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 116/188 (62%), Gaps = 14/188 (7%)
 Frame = -2

Query  794  RNTALLIIDMQNDFI--LPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            + TALLIIDMQND +  +P G       + ++P + + ++  RN+GI +I  VR   P G
Sbjct  17   KTTALLIIDMQNDVMNMVPPG-------RQVIPVIKQVLDACRNKGISVIHKVRIQRPDG  69

Query  620  RDAELFRRHLYSPGKPKP-TSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
             D E FR  ++   K KP   +G+ GAE+V  L   +G++++   RFS FF T++   L 
Sbjct  70   IDVERFRVEMF---KNKPYLVEGTPGAEIVPELKPAKGEFQVKGARFSGFFQTDMQLVLT  126

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
              G+ +LVI GVQTPNCIR TV DA+ ++Y  V ++ DA AA T ++H +N+FDMKN+GV
Sbjct  127  RLGVKNLVICGVQTPNCIRSTVTDAIGYDYD-VILLKDAIAAQTEQVHEANLFDMKNMGV  185

Query  263  MTPTLEEW  240
                 +E+
Sbjct  186  TIILSDEF  193



>ref|WP_009608165.1| isochorismatase hydrolase [Eggerthella sp. HGA1]
 gb|EGC90297.1| isochorismatase family protein [Eggerthella sp. HGA1]
Length=215

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 107/192 (56%), Gaps = 5/192 (3%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            R  AL+IIDMQ+ F+     + V GA A VP   +A+  AR  G+P+   +RE+   G D
Sbjct  5    RKAALIIIDMQHGFLDSSSALCVAGAAATVPACTRALNRARELGMPVFHAIREYAADGSD  64

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDG---LVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
             E  R   +  G  KP S+       +D    L  + GD  +VK RFSAFF T L   L+
Sbjct  65   VEAARHRGWVEGG-KPVSRACASPRTLDEYEPLAPQPGDRVIVKPRFSAFFATQLDLVLR  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
              G+ ++V+ G  TPNCIR T +DA++ +Y  V ++ D T++ TPE+  +NI DM  IG 
Sbjct  124  RLGVGTVVLIGTTTPNCIRTTCYDALSLDYN-VVLLEDCTSSRTPEVQAANIEDMAFIGA  182

Query  263  MTPTLEEWCESG  228
               T +E+CE G
Sbjct  183  HIMTCDEFCERG  194



>ref|WP_036630059.1| isochorismatase, partial [Oscillibacter sp. KLE 1728]
Length=207

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 106/178 (60%), Gaps = 3/178 (2%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAE  609
            +ALL+IDM+N F+ P G   +  AQ++VPN ++AVE+AR +GIP+ +V R +   G D E
Sbjct  8    SALLVIDMENGFVHPEGGHWIRFAQSMVPNCVRAVELARAKGIPVFFVKRLYRADGSDVE  67

Query  608  LFRRHLYSPG--KPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
            L R   +  G    +P S G   A+  +GL  + GDY ++K R+SAFF T L   L+   
Sbjct  68   LTRYPGWVAGGRACRPASTGPNSAQAPEGLRPQPGDYTIIKPRWSAFFQTELDLILRRLD  127

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
            + ++++TG  TPNCIR T +DA+A  Y    V+ D  ++ T EI   N+ DM   G +
Sbjct  128  VRTVILTGTTTPNCIRTTCYDAIALEYN-TVVLTDCCSSHTEEIQRVNLEDMARAGAI  184



>ref|WP_009305788.1| MULTISPECIES: isochorismatase hydrolase [Eggerthella]
 ref|YP_003180595.1| isochorismatase hydrolase [Eggerthella lenta DSM 2243]
 gb|ACV54206.1| isochorismatase hydrolase [Eggerthella lenta DSM 2243]
 gb|EFV32962.1| isochorismatase [Eggerthella sp. 1_3_56FAA]
 gb|EQI07456.1| isochorismatase family protein [Clostridium difficile F501]
 gb|KGI75205.1| hypothetical protein HMPREF9458_00435 [Eggerthella lenta 1_1_60AFAA]
Length=215

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 106/192 (55%), Gaps = 5/192 (3%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            R  AL+IIDMQ+ F+     + V GA A VP   +A+  AR  G+P+   +RE+   G D
Sbjct  5    RKAALIIIDMQHGFLDSSSALCVAGAAATVPACTRALNRARELGMPVFHAIREYAADGSD  64

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDG---LVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
             E  R   +  G  KP S+       +D    L  + GD  + K RFSAFF T L   L+
Sbjct  65   VEAARHRGWVEGG-KPVSRACASPRTLDEYEPLAPQPGDRVIAKPRFSAFFATQLDLVLR  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
              G+ ++V+ G  TPNCIR T +DA++ +Y  V ++ D T++ TPE+  +NI DM  IG 
Sbjct  124  RLGVGTVVLIGTTTPNCIRTTCYDALSLDYN-VVLLEDCTSSRTPEVQAANIEDMAFIGA  182

Query  263  MTPTLEEWCESG  228
               T +E+CE G
Sbjct  183  HIMTCDEFCERG  194



>ref|WP_022289918.1| isochorismatase hydrolase [Oscillibacter sp. CAG:155]
 emb|CDC68198.1| isochorismatase hydrolase [Oscillibacter sp. CAG:155]
Length=233

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 105/177 (59%), Gaps = 3/177 (2%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            ALL+IDM+N F+ P G   + GA A VP  ++AVE+AR++GIP+ +V R +   G D EL
Sbjct  9    ALLVIDMENGFVTPQGGHCIRGAAATVPACVRAVELARDKGIPVFFVKRIYRRDGSDVEL  68

Query  605  FRRHLYSPG--KPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
             R   +  G     P S G   A   +GL  + GDY + K R+SAFF+T L   L+   I
Sbjct  69   TRYEGWKAGGRACGPASVGPNSARAPEGLQPQPGDYTIWKPRWSAFFHTELDLILRRLDI  128

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
             ++++TG  TPNCIR T +DA+A  Y    ++ D  ++ T EI  +N+ DM+ +G +
Sbjct  129  RTVILTGTTTPNCIRTTCYDAMALEYN-TVILTDCCSSQTEEIQQANLADMQRVGAI  184



>gb|ERK60745.1| isochorismatase family protein [Oscillibacter sp. KLE 1728]
Length=233

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 106/178 (60%), Gaps = 3/178 (2%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAE  609
            +ALL+IDM+N F+ P G   +  AQ++VPN ++AVE+AR +GIP+ +V R +   G D E
Sbjct  8    SALLVIDMENGFVHPEGGHWIRFAQSMVPNCVRAVELARAKGIPVFFVKRLYRADGSDVE  67

Query  608  LFRRHLYSPG--KPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
            L R   +  G    +P S G   A+  +GL  + GDY ++K R+SAFF T L   L+   
Sbjct  68   LTRYPGWVAGGRACRPASTGPNSAQAPEGLRPQPGDYTIIKPRWSAFFQTELDLILRRLD  127

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
            + ++++TG  TPNCIR T +DA+A  Y    V+ D  ++ T EI   N+ DM   G +
Sbjct  128  VRTVILTGTTTPNCIRTTCYDAIALEYN-TVVLTDCCSSHTEEIQRVNLEDMARAGAI  184



>ref|WP_015758258.1| isochorismatase hydrolase [Desulfotomaculum acetoxidans]
 ref|YP_003192188.1| isochorismatase hydrolase [Desulfotomaculum acetoxidans DSM 771]
 gb|ACV63565.1| isochorismatase hydrolase [Desulfotomaculum acetoxidans DSM 771]
Length=235

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 112/185 (61%), Gaps = 3/185 (2%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            ALL+ID++N F+       +  A A +P   + ++++R +G+P+ ++ R +  +G D EL
Sbjct  9    ALLVIDLENGFVRSESSHVINTAAASLPACEQVIQLSRKKGLPVFFIKRIYRQNGSDVEL  68

Query  605  FRRHLYSPGKPK--PTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
             R   +  G     P SKG++ AE+ + +  K GDY ++K R+SAFF T L   L+  GI
Sbjct  69   TRWQAWINGGKAMTPASKGAISAEVPETVKPKPGDYTIIKPRWSAFFQTELDLILRRLGI  128

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
            +++V+ G  TPNCIR T +DA+A +Y+ V ++ D  ++ TPEI  +NI D++ IG M   
Sbjct  129  STVVLIGTTTPNCIRTTAYDAIALDYE-VVIVEDCCSSQTPEIQKANIDDLQRIGCMIID  187

Query  251  LEEWC  237
             E +C
Sbjct  188  SENYC  192



>ref|WP_035386908.1| hypothetical protein [Ferrimonas senticii]
Length=180

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 103/175 (59%), Gaps = 7/175 (4%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            AL+IIDMQNDF+ P G   V  AQA V  + K +   R +  P+I V+R H   G D+E+
Sbjct  3    ALMIIDMQNDFVDPAGRAVVAQAQATVATIAKLLSHWRQQRWPVIHVLRRHHSDGSDSEV  62

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
            FRRH      P   +  S GA     L  + GD+ L KTRFSAF+ T L   L ++GI S
Sbjct  63   FRRH-----APVCVAD-SWGAIPYPSLEPQSGDWVLYKTRFSAFYRTELEQLLATHGIDS  116

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVM  261
            L I G Q PNCIR TV D +  + Q +T++ DA +A   +I ++NI DM+N+G +
Sbjct  117  LAICGTQLPNCIRGTVMDGLYRDLQ-ITIVEDACSAQNQQIASNNIIDMRNMGAV  170



>ref|WP_035022374.1| isochorismatase, partial [Enterorhabdus mucosicola]
Length=201

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 105/188 (56%), Gaps = 1/188 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             TAL++IDMQ  FI P  P+ + GA A V    +A+  ARN G+ +  V RE+   G D 
Sbjct  6    RTALILIDMQLGFIDPASPLCIAGAAATVSACERALAAARNHGLAVYHVRREYAADGSDV  65

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E  R  + + G    ++           L  +EG+  +VK  +SAFF T+LH  LQ+ GI
Sbjct  66   EAVRHRVRAEGGRPLSAAWPESLACPPELAPREGEPVIVKPSWSAFFGTDLHERLQARGI  125

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
             ++V+ G  TPNC+R T +D +A  Y  V V+ DAT++ TPE+  +N+ DM  +GV   T
Sbjct  126  GTIVLAGTTTPNCVRSTAYDGMALGYN-VAVLADATSSRTPEVQQANLEDMAYVGVQILT  184

Query  251  LEEWCESG  228
             +E   +G
Sbjct  185  ADELAATG  192



>ref|WP_016408509.1| isochorismatase hydrolase [Firmicutes bacterium CAG:102]
 emb|CCX41071.1| isochorismatase hydrolase [Firmicutes bacterium CAG:102]
Length=215

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 105/189 (56%), Gaps = 3/189 (2%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W+ TAL++IDM+N FI    P+ +  A   VP   + +  AR RGIP+ +V R +  +G 
Sbjct  3    WKTTALVVIDMENAFISKESPLCIQEAAKSVPACGRVIRKARERGIPVFFVNRIYRRNGS  62

Query  617  DAELFRRHLYSPGKP--KPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
            D E  R   +  G     P S G++  E+      ++GDY ++K RFSAFF T L   L+
Sbjct  63   DVEFTRYDSWLGGNRYLAPNSTGALSIEVPAEFTPQKGDYTIIKPRFSAFFQTELDLILR  122

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
              G+ ++++TG  TPNCIR + +D ++ +Y  + +I D  ++ T EI   NI DM  +G 
Sbjct  123  RLGVKTVILTGTTTPNCIRTSCYDGLSLDYN-ILIIEDCCSSNTAEIQRVNIEDMARVGA  181

Query  263  MTPTLEEWC  237
            +    + +C
Sbjct  182  VITDSDTFC  190



>ref|WP_013344816.1| isochorismatase hydrolase [Ferrimonas balearica]
 ref|YP_003912584.1| isochorismatase hydrolase [Ferrimonas balearica DSM 9799]
 gb|ADN75510.1| isochorismatase hydrolase [Ferrimonas balearica DSM 9799]
Length=184

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 104/174 (60%), Gaps = 7/174 (4%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            AL+I+DMQ DF+ P G   V  A   VP +  A+  AR +G P+I VVREHDP+G + E 
Sbjct  3    ALMIVDMQQDFVSPDGAACVAQALPSVPAIAAALAHARQQGWPVIHVVREHDPAGLNTEP  62

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
            FR+     G+P   S G+ GAE+V  L   EG+  +VKTRFSAF+ T +   L S     
Sbjct  63   FRK-----GRPVCVS-GTWGAEIVPELTPIEGELVVVKTRFSAFYQTAMDEVLNSLNWPE  116

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
            +++ G Q PNC+R TV DAV  +  P++V+V+  +A    +  +N+ DM N GV
Sbjct  117  IILCGTQLPNCLRATVHDAVNRDL-PLSVLVEGCSAQNQAVADANLEDMANFGV  169



>ref|WP_018659025.1| hypothetical protein [Allofustis seminis]
Length=220

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 108/187 (58%), Gaps = 6/187 (3%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            A LIIDMQ DF+    P+ V      +P++ +A+E  R   +P+  V R +  +G D E+
Sbjct  5    AFLIIDMQRDFLDEDSPLVVKAGLEALPHIERALEATRKSNVPVFHVFRLYRGNGSDVEV  64

Query  605  FRRHLYSPGKPKPTS--KGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
             R   Y   K    S   G+ GAE+   +   +G+Y +VK R+SAFF T L   L+  G+
Sbjct  65   TR---YEGWKSNGGSLVPGTEGAEIPASIAPIDGEYLIVKQRWSAFFMTELDLVLRRLGV  121

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
              +++TGVQTPNCIR T +DA + +Y+ V  + D T AA  E+H  N+ DMKNIGV   T
Sbjct  122  RQVILTGVQTPNCIRGTAWDANSLDYE-VICLTDGTNAANAEVHEQNLRDMKNIGVKLMT  180

Query  251  LEEWCES  231
             +E+ E+
Sbjct  181  TDEYVEN  187



>ref|WP_013978833.1| isochorismatase hydrolase [Eggerthella sp. YY7918]
 ref|YP_004709984.1| hypothetical protein EGYY_03500 [Eggerthella sp. YY7918]
 dbj|BAK43583.1| hypothetical protein EGYY_03500 [Eggerthella sp. YY7918]
Length=214

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 108/192 (56%), Gaps = 5/192 (3%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            +  A ++IDMQ+ F+     + V GA A VP   +A++ AR   +P+   +R +   G D
Sbjct  5    KTAAFVLIDMQHGFVDLSSSLCVAGAAATVPACARALDRARELDMPVFHAIRAYAADGSD  64

Query  614  AELFRRHLYSPGKPKPTSKGSV---GAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
             E  RR ++S G  +P S         E ++ L  +  D  +VK RFSAFF T+L   L+
Sbjct  65   VEACRRAVWSDGG-RPLSSAYADERSLEEMEPLAPQGNDRVIVKPRFSAFFGTSLDLVLR  123

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
              G+ ++V+ G  TPNCIR T +DA++ +Y  V ++ D T++ TPE+  +NI DM++IG 
Sbjct  124  RMGVGTVVLAGTTTPNCIRTTCYDALSLDYN-VVILEDCTSSRTPEVQQANIEDMRHIGA  182

Query  263  MTPTLEEWCESG  228
               +  E+C  G
Sbjct  183  HIMSCAEFCADG  194



>ref|WP_013008113.1| nicotinamidase [Deferribacter desulfuricans]
 ref|YP_003496623.1| isochorismatase hydrolase [Deferribacter desulfuricans SSM1]
 dbj|BAI80867.1| isochorismatase hydrolase [Deferribacter desulfuricans SSM1]
Length=171

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 87/145 (60%), Gaps = 9/145 (6%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            ALLIIDM NDF+L G P+ V  A++I+PN+ + ++ AR  G P+I+V   HD    + ++
Sbjct  4    ALLIIDMLNDFVLEGAPLQVPNAKSIIPNIKREIDKARKEGYPVIYVCDAHDEDDEEFKI  63

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
            +  H           KG+ GAE+V+ L    GD  + KTR+S F+NTNL   L+  G+  
Sbjct  64   WPHH---------CVKGTKGAEVVEELKPVGGDIVVEKTRYSGFYNTNLDEILRDLGVEQ  114

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQ  351
            L++TG+ T  C+  TV DAV+  Y+
Sbjct  115  LIVTGLVTNICVMYTVADAVSRGYK  139



>ref|WP_014117646.1| putative hydrolase [Oscillibacter valericigenes]
 ref|YP_004881483.1| putative hydrolase [Oscillibacter valericigenes Sjm18-20]
 dbj|BAK98977.1| putative hydrolase [Oscillibacter valericigenes Sjm18-20]
Length=265

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 107/185 (58%), Gaps = 3/185 (2%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAE  609
            +ALL+IDM++ FI    P+    A+AI+P  ++AV  AR + IP+ +V R +  +G D E
Sbjct  40   SALLVIDMEDAFINKNSPLCNPMAEAIIPACVRAVNSARAKSIPVFFVKRVYRNNGSDVE  99

Query  608  LFRRHLYSPG-KP-KPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
            L R   +  G +P  P+S G   A+  +GL    GDY ++K RFSAFF T L   L+   
Sbjct  100  LTRYKRWDDGGRPLGPSSIGEGSAQAPEGLRPIRGDYTIIKPRFSAFFQTELDLILRRLQ  159

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTP  255
            + ++++ G  TPNCIR T +DA + +Y  V ++ D  ++ T EI  +N+ DM  +G    
Sbjct  160  VRTVILCGTATPNCIRTTAYDAFSLDYN-VLILQDCCSSITQEIQVANLADMARVGAQLM  218

Query  254  TLEEW  240
            T  ++
Sbjct  219  TSAQF  223



>ref|WP_015750724.1| isochorismatase [Desulfohalobium retbaense]
 ref|YP_003197143.1| isochorismatase hydrolase [Desulfohalobium retbaense DSM 5692]
 gb|ACV67565.1| isochorismatase hydrolase [Desulfohalobium retbaense DSM 5692]
Length=189

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 99/173 (57%), Gaps = 2/173 (1%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            AL+IIDMQ DF+LP G + + GA+  VP + + ++  R R +PI  VVR +   G D E 
Sbjct  3    ALIIIDMQEDFVLPHGSLCIQGAKDTVPRIREVLDGFRQRALPIFHVVRSYRADGVDVEW  62

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
             R   +  G       G+ GA +V  L  +  +Y + K RFSAF +T L   L+   I  
Sbjct  63   PREQAFRKGH-HAVVPGTPGARIVSELAPRPNEYVVTKKRFSAFMHTELDLLLRRLHIRE  121

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            L + G Q P C+R +VFDA+A +Y+ VT+I D T+A T  I  +N FDM NIG
Sbjct  122  LAVCGTQLPVCVRCSVFDAIALDYR-VTLIADGTSAQTEAIAEANRFDMANIG  173



>ref|WP_035009280.1| isochorismatase, partial [Enterorhabdus caecimuris]
Length=201

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 104/188 (55%), Gaps = 1/188 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             TAL++IDMQ  FI    P+ + GA A +P   +A+  AR+  + +  V RE+   G D 
Sbjct  6    RTALILIDMQRGFIDTTSPLCIAGAAATIPACERALAAARDHRLAVYHVRREYAADGSDV  65

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E  R   ++ G    ++           L  +EG+  + K  +SAFF T+LH  LQ+ GI
Sbjct  66   EAVRHGTWAEGGRPLSAAWPESLACPPELEPREGEPVIAKPSWSAFFGTDLHERLQARGI  125

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
             ++V+ G  TPNC+R T +D +A  Y  V V+ DAT++ TPE+  +N+ DM ++GV   T
Sbjct  126  GTIVLAGTTTPNCVRSTAYDGMALGYN-VAVLADATSSRTPEVQRANLADMAHVGVQILT  184

Query  251  LEEWCESG  228
             +E   +G
Sbjct  185  ADELAATG  192



>gb|EOS52365.1| hypothetical protein C811_00395 [Enterorhabdus caecimuris B7]
Length=435

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 104/188 (55%), Gaps = 1/188 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             TAL++IDMQ  FI    P+ + GA A +P   +A+  AR+  + +  V RE+   G D 
Sbjct  6    RTALILIDMQRGFIDTTSPLCIAGAAATIPACERALAAARDHRLAVYHVRREYAADGSDV  65

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E  R   ++ G    ++           L  +EG+  + K  +SAFF T+LH  LQ+ GI
Sbjct  66   EAVRHGTWAEGGRPLSAAWPESLACPPELEPREGEPVIAKPSWSAFFGTDLHERLQARGI  125

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
             ++V+ G  TPNC+R T +D +A  Y  V V+ DAT++ TPE+  +N+ DM ++GV   T
Sbjct  126  GTIVLAGTTTPNCVRSTAYDGMALGYN-VAVLADATSSRTPEVQRANLADMAHVGVQILT  184

Query  251  LEEWCESG  228
             +E   +G
Sbjct  185  ADELAATG  192



>ref|WP_022177182.1| amidase related to nicotinamidase [Oscillibacter sp. CAG:241]
 emb|CDB27042.1| amidase related to nicotinamidase [Oscillibacter sp. CAG:241]
Length=196

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 102/183 (56%), Gaps = 3/183 (2%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            AL++IDMQ  F+    P+ + GA   VP   +A++     G+P+++ VR +   G D E 
Sbjct  5    ALVVIDMQRGFLDASSPLFIPGAADTVPACARAIDCCHRAGVPVVFAVRHYRADGSDVER  64

Query  605  FRRHLYSPG-KP-KPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
             R  +++ G +P   T   S+     +     + DY +VK RFSAFF+T L   L+  G+
Sbjct  65   ARYDVWARGGRPLSETCPPSMSDAWPEEFHRADTDYVIVKPRFSAFFHTELDLILRRLGV  124

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
             ++++ G  TPNCIR T +DA++ +Y    V+ D T++ TP +  +N+ DM+ +G    T
Sbjct  125  DTVLLAGTTTPNCIRSTFYDALSLDYD-AAVLSDCTSSVTPAVQAANLADMRRVGGQVLT  183

Query  251  LEE  243
             EE
Sbjct  184  AEE  186



>ref|WP_020495338.1| hypothetical protein [Sciscionella marina]
Length=219

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 84/148 (57%), Gaps = 2/148 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            R  ALL+IDMQNDF+L G P+ V   +A++P V  A+  AR  G+P+++    H+P G D
Sbjct  11   RCAALLVIDMQNDFLLEGAPLEVAQGRAMMPVVNGAIAAARGSGMPVLFTRHAHNPDGTD  70

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
              +F R   +  +      G+ G EL  GL     +  L KTR+SAF  T+L   L   G
Sbjct  71   MGMFARIYPAVAERTALIDGTAGTELYAGLDRDAAEPVLAKTRYSAFHGTDLRDRLA--G  128

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            + +LV+ GV T +C++ T  DA+  +Y+
Sbjct  129  VRTLVLCGVTTEDCVQATARDAMFLDYE  156



>ref|WP_013886620.1| nicotinamidase [Flexistipes sinusarabici]
 ref|YP_004603707.1| isochorismatase hydrolase [Flexistipes sinusarabici DSM 4947]
 gb|AEI15139.1| isochorismatase hydrolase [Flexistipes sinusarabici DSM 4947]
Length=171

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 85/147 (58%), Gaps = 9/147 (6%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
            N AL+IIDM NDF+  G P+    A++IV  + +  ++A     P+I+V   HDP  ++ 
Sbjct  2    NKALIIIDMLNDFVQEGAPLQTPNAKSIVACINEQRKIAAENSNPVIYVCDAHDPEDKEF  61

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            E++         PK   KG+ GAE++D L  +  D  L KTR+S FF++ L+  L+   I
Sbjct  62   EIW---------PKHCVKGTKGAEIIDELKPESNDIVLEKTRYSCFFDSRLNEILKEKNI  112

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             +LV+TG+ T  C+  T  DAV+ NY+
Sbjct  113  DTLVLTGLLTNVCVMYTAADAVSRNYR  139



>ref|WP_022254807.1| putative hydrolase [Firmicutes bacterium CAG:466]
 emb|CDC24697.1| putative hydrolase [Firmicutes bacterium CAG:466]
Length=216

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 101/188 (54%), Gaps = 3/188 (2%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            AL++IDM+  F+    P+++  A   VP + K +  ARNR IP+ +V R +   G D E 
Sbjct  8    ALVVIDMEEGFLNENSPLYIKQAADTVPALAKVIAEARNRKIPVFFVNRIYRKDGSDVEA  67

Query  605  FRRHLYSPGKP--KPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
             R   +  G     P S G    ++ +    + GDY ++K+RFSAFF T L   L+   +
Sbjct  68   CRYDNWLAGGRCLAPNSTGDCSIQVPEAFTPQAGDYTIIKSRFSAFFQTELDLILRRLRV  127

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
             ++++TG  TPNCIR T +D ++ +Y  V +I D  ++ +  +  +N+ DM  IG +   
Sbjct  128  DTVILTGTTTPNCIRATCYDGLSLDYN-VAIIEDCCSSRSEAVQKANMEDMAFIGAIVLD  186

Query  251  LEEWCESG  228
             E + + G
Sbjct  187  AETFLKEG  194



>ref|WP_014452790.1| putative hydrolase [Caldisericum exile]
 ref|YP_005472486.1| putative hydrolase [Caldisericum exile AZM16c01]
 dbj|BAL80383.1| putative hydrolase [Caldisericum exile AZM16c01]
Length=189

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 105/190 (55%), Gaps = 18/190 (9%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            ALLIIDMQ DF+    P+ V G + I+PN+   +   R + +  I++ REH         
Sbjct  4    ALLIIDMQEDFLDESSPLFVKGGREIIPNIEMLLSFFRKQNLNRIFIKREH---------  54

Query  605  FRRHLYSPGKPKPTSKGSV------GAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQ  444
              R      KP+    G V      GA++V  L   E +  ++K RFSAFF+T L   L+
Sbjct  55   --RGSIDIDKPRIPYGGKVLLPNSEGAKIVKELFPMESEIVVIKKRFSAFFHTELDLILR  112

Query  443  SNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGV  264
               I +L++TGVQTPNCIR T  D V+++Y  V V+ D TA+++ E+  +N+FD++ +G+
Sbjct  113  RLQIDTLILTGVQTPNCIRATAVDGVSYDYD-VIVVSDGTASSSDEVQKANLFDLEKMGI  171

Query  263  MTPTLEEWCE  234
                + +  E
Sbjct  172  KILNVNDVIE  181



>ref|WP_013484860.1| isochorismatase hydrolase [Ethanoligenens harbinense]
 ref|YP_004091227.1| isochorismatase hydrolase [Ethanoligenens harbinense YUAN-3]
 gb|ADU26496.1| isochorismatase hydrolase [Ethanoligenens harbinense YUAN-3]
Length=214

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 104/198 (53%), Gaps = 22/198 (11%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            AL+ IDMQNDF+LPG    V G   I+PN+ K + +AR++ + I+ V+R +   G DA+L
Sbjct  13   ALITIDMQNDFVLPGAVSQVPGTDKILPNMTKLLRLARDKSLTIVHVIRLYSADGSDADL  72

Query  605  FRRHLYSPGKP---------------KPTSKGSVGAELVDGLV--IKEGDYRLVKTRFSA  477
             RR++   G+                KP S     A L  G +  I + ++ + K+R+ A
Sbjct  73   CRRNIIESGRKIACPETHGAEIVSVLKPNSTFLDYANLQKGYIQEISKNEWVIYKSRWGA  132

Query  476  FFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHT  297
            F+ TNL  +L +  IT+L+ +G   PNC R ++++A   +++     +     A  +I+ 
Sbjct  133  FYKTNLEKFLSNRRITTLIFSGCNFPNCPRTSIYEASERDFK-----IVLVMDAISQIYP  187

Query  296  SNIFDMKNIGVMTPTLEE  243
              + +M  IGV   T ++
Sbjct  188  KGLEEMNGIGVSLLTTDQ  205



>ref|WP_009138962.1| isochorismatase hydrolase [Slackia piriformis]
 gb|EJZ84030.1| hypothetical protein HMPREF9451_00739 [Slackia piriformis YIT 
12062]
Length=189

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 105/183 (57%), Gaps = 16/183 (9%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
            +TAL++IDMQN FI    P+ + GA+  +P   + +E AR   +P+  VVR +   G D 
Sbjct  6    STALIMIDMQNGFINEASPLCIAGAKKSIPACRRVLEYARENVVPVYHVVRRYAADGSDV  65

Query  611  ELFRRHLYSPGKP----KPTSKGSVG----AELVDGLVIKEGDYRLVKTRFSAFFNTNLH  456
            E  R  ++   +P     P   GS+     A L D + +       VK RFSAFF T+LH
Sbjct  66   EPCRYDIWKDERPLSDACPEEIGSLEPAELAPLADEVTV-------VKPRFSAFFQTDLH  118

Query  455  SYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMK  276
            + LQ  GI +L++TG  TPNCIR T +DA+++NY  V V+ DAT++   ++  +N+ DM 
Sbjct  119  ARLQKQGIDTLLLTGTTTPNCIRSTCYDALSYNYD-VIVVEDATSSRNEDVQRANMEDMA  177

Query  275  NIG  267
             IG
Sbjct  178  FIG  180



>ref|WP_013977866.1| isochorismatase hydrolase [Clostridium sp. SY8519]
 ref|YP_004709007.1| nicotinamidase-like amidase [Clostridium sp. SY8519]
 dbj|BAK47905.1| amidase related to nicotinamidase [Clostridium sp. SY8519]
Length=194

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 100/178 (56%), Gaps = 5/178 (3%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
            ++A+++IDMQN F+     + + GA+  VP   + +  A    +P+ +V R +   G D 
Sbjct  7    DSAVVVIDMQNGFLERESSLCIQGAKETVPACSRVIRQAHREQVPVFFVNRRYRADGSDV  66

Query  611  ELFRRHLYSPGKPKPTSK---GSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQS  441
            EL R+  +  G  +P S+   G + AE    L     DY LVK RFSAFF+T L   L+ 
Sbjct  67   ELVRKERWEQGG-RPLSELACGPLSAENPPELGGGPQDYMLVKPRFSAFFHTELDLLLRR  125

Query  440  NGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
              I ++ + G  TPNCIR T +D ++ +Y+ V ++ D  ++ T EI  +N+ DM+NIG
Sbjct  126  KQIRTVYLLGTTTPNCIRTTCYDGLSLDYE-VVIVADCCSSNTEEIQQANLRDMENIG  182



>ref|WP_035133791.1| hypothetical protein [Flavobacterium beibuense]
 gb|KGO80797.1| hypothetical protein Q763_09685 [Flavobacterium beibuense F44-8]
Length=211

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 104/208 (50%), Gaps = 33/208 (16%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W  +AL+IIDMQ DF    G  ++ G + +  N+ K   V RN  +P+I V+R +   G 
Sbjct  3    WNRSALIIIDMQKDFAKKDGASYIQGTEDVTENIAKLASVFRNCQLPVIHVIRLYKEDGS  62

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLV-------------------IKEGDYRLV  495
            +AEL R+ L+  GK K  S GS GA++V  L+                   I   D+ + 
Sbjct  63   NAELCRKSLFQDGK-KIVSPGSNGAKIVTELLPENAENYSDISLLNGQIIPIAPYDFIVY  121

Query  494  KTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaa  315
            K R+ AF++T L  +L S+ I SL+I G   PNC R T+++A   +Y           + 
Sbjct  122  KPRWGAFYSTQLDDWLTSHQINSLLIAGCNFPNCPRATIYEASERDYH---------ISI  172

Query  314  TPE----IHTSNIFDMKNIGVMTPTLEE  243
             PE    I+   I ++K IGV   +++E
Sbjct  173  VPETISGIYPKGIDELKGIGVGICSVKE  200



>ref|WP_022364427.1| putative hydrolase [Clostridium sp. CAG:505]
 emb|CDD60742.1| putative hydrolase [Clostridium sp. CAG:505]
Length=216

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 99/188 (53%), Gaps = 3/188 (2%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            AL++IDM+  F+     +++  A   VP + K +  ARNR IP+ +V R +   G D E 
Sbjct  8    ALVVIDMEEGFLNENSQLYIKQAADTVPALAKVIAEARNRKIPVFFVNRIYRKDGSDVEA  67

Query  605  FRRHLYSPGKP--KPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
             R   +  G     P S G    ++ +    + GDY ++K RFSAFF T L   L+   +
Sbjct  68   CRYDNWLAGGRCLAPNSTGDCSIQVPEAFTPQAGDYTIIKPRFSAFFQTELDLILRRLRV  127

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIGVMTPT  252
             ++++TG  TPNCIR T +D ++ +Y  V +I D  ++ +  +  +N+ DM  IG +   
Sbjct  128  DTVILTGTTTPNCIRATCYDGLSLDYN-VAIIEDCCSSRSEAVQKANMEDMAFIGAIVLD  186

Query  251  LEEWCESG  228
             E + + G
Sbjct  187  AETFLKEG  194



>ref|WP_016413614.1| amidase related to nicotinamidase [Firmicutes bacterium CAG:103]
 emb|CCX46179.1| amidase related to nicotinamidase [Firmicutes bacterium CAG:103]
Length=190

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 94/176 (53%), Gaps = 5/176 (3%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            AL++IDMQ  F+    P+ +  A+  VP     +      G+P+I+ VR +   G D E 
Sbjct  5    ALIMIDMQRGFLDSASPLCIPAAEGTVPACAALIGRCHEAGVPVIYAVRHYRADGTDVEK  64

Query  605  FRRHLYSPGKPKPTSK---GSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
             R   ++ G  KP S+     +     D   +   DY LVK RFSAFF+T L   L+  G
Sbjct  65   PRAAAWASGG-KPLSEVCAAHLSDAFPDAFTVLPQDYVLVKPRFSAFFHTGLDLILRRLG  123

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDMKNIG  267
            + ++++ G  TPNCIR T +DA++ +Y    V+ D T++ T  +  +N+ DM+ +G
Sbjct  124  VQTVLLAGTTTPNCIRTTCYDAISLDYD-AVVLSDCTSSVTDAVQAANLADMQRVG  178



>ref|WP_025999931.1| isochorismatase [Pseudomonas fluorescens]
 gb|KGE68606.1| isochorismatase [Pseudomonas fluorescens LMG 5329]
Length=217

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 81/147 (55%), Gaps = 0/147 (0%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             TA+L+IDMQNDFI  G P+     +A++P + K V+  R+RG  II+    H   G D 
Sbjct  12   RTAVLVIDMQNDFIAVGAPLETSTGRALIPILNKLVDALRDRGATIIYTAHVHKEDGTDI  71

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
              +       G+ +   +GS+GAE+      K+GD  + K R+SAFF T L   L+   I
Sbjct  72   GRYGEIHPPSGRGEALVEGSLGAEIYPECAPKKGDRLIKKHRYSAFFETELQQILKERWI  131

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             ++V+ GV T NC+  T  DA+  +Y+
Sbjct  132  QNVVVVGVTTENCVHATARDALFRDYR  158



>ref|WP_009673344.1| MULTISPECIES: isochorismatase hydrolase [Paenibacillus]
 gb|EGL18296.1| isochorismatase family protein [Paenibacillus sp. HGF7]
 gb|EPD90356.1| hypothetical protein HMPREF1207_01142 [Paenibacillus sp. HGH0039]
Length=230

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 88/166 (53%), Gaps = 20/166 (12%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
              ALL ID QNDF LPG P  + G   ++P + + +E  R  GIP+I V+R ++  G +A
Sbjct  9    TCALLTIDTQNDFSLPGAPAEIPGTSEVLPVMGRLLEQCRAHGIPVIHVIRIYERDGSNA  68

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGL-------------------VIKEGDYRLVKT  489
            +L R+ +   G     + G+ GA+L D +                    I E ++ L K 
Sbjct  69   DLCRKEMIEAGAAI-AAPGTWGADLADAIKPPHAEELRFEALLGGEIQAIGEREWVLYKP  127

Query  488  RFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            R+ AF+NT L ++L+  GI +L+ TG   PNC R ++++A   +++
Sbjct  128  RWGAFYNTKLENFLKERGIDTLIFTGCNFPNCPRTSMYEASERDFK  173



>ref|WP_031305530.1| hypothetical protein, partial [Brevibacillus panacihumi]
Length=193

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 83/156 (53%), Gaps = 9/156 (6%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGG-----AQAIVPNVIKAVEVARNRGIPIIWVVREHD  630
            + TALL+IDMQN +  P G +   G       A +P V + VE  R  GI  IW ++ H 
Sbjct  10   KETALLVIDMQNSYCHPQGSIGRNGYDYTMMNATIPKVKELVEACRQAGIVDIWTIQNHY  69

Query  629  PSG--RDAELFRRHLYSPGKPKPTSKGSVGAELVDGL--VIKEGDYRLVKTRFSAFFNTN  462
            P    R     + H +      P  KG+  AE+VD L  + KE    L+K RFSAFF+T 
Sbjct  70   PDDITRKTHRIKPHTHRWQAGPPALKGTWDAEIVDELKDLAKEPAELLIKHRFSAFFDTT  129

Query  461  LHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNY  354
            L + L+  GIT+LV+ GV T +C+  +V DA   +Y
Sbjct  130  LDTLLRMKGITTLVVCGVATTHCVETSVRDAYQRDY  165



>ref|WP_036922034.1| cysteine hydrolase [Propionicicella superfundia]
Length=214

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 90/175 (51%), Gaps = 24/175 (14%)
 Frame = -2

Query  815  SMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
             + S +W  +ALL+ID+Q DFI   G  HV G   IVP + + V   R  G PI+ V+R 
Sbjct  2    DLTSPEWDRSALLVIDVQRDFIDDDGSAHVPGTADIVPRLGRLVTAFRVAGRPIVHVIRL  61

Query  635  HDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGD-----------------  507
            +   G D +L RR L + G     + GS GA  V G++  EGD                 
Sbjct  62   Y--RGEDVDLPRRQLVASGV-SLVAPGSPGAS-VPGVLFPEGDVDLDTTALLRGEFQQIG  117

Query  506  ---YRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
               Y   K R+SAF+ T LH +L+   +T++V+ G   PNC R T+FDA A +Y+
Sbjct  118  PTEYIAFKPRWSAFYRTGLHDWLRQQDVTTVVVAGCNLPNCPRATLFDASARDYR  172



>gb|EST54863.1| isochorismatase hydrolase [Brevibacillus panacihumi W25]
Length=222

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 83/156 (53%), Gaps = 9/156 (6%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGG-----AQAIVPNVIKAVEVARNRGIPIIWVVREHD  630
            + TALL+IDMQN +  P G +   G       A +P V + VE  R  GI  IW ++ H 
Sbjct  10   KETALLVIDMQNSYCHPQGSIGRNGYDYTMMNATIPKVKELVEACRQAGIVDIWTIQNHY  69

Query  629  PSG--RDAELFRRHLYSPGKPKPTSKGSVGAELVDGL--VIKEGDYRLVKTRFSAFFNTN  462
            P    R     + H +      P  KG+  AE+VD L  + KE    L+K RFSAFF+T 
Sbjct  70   PDDITRKTHRIKPHTHRWQAGPPALKGTWDAEIVDELKDLAKEPAELLIKHRFSAFFDTT  129

Query  461  LHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNY  354
            L + L+  GIT+LV+ GV T +C+  +V DA   +Y
Sbjct  130  LDTLLRMKGITTLVVCGVATTHCVETSVRDAYQRDY  165



>ref|WP_024578955.1| isochorismatase [Bradyrhizobium sp. OHSU_III]
Length=221

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 83/148 (56%), Gaps = 2/148 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             T ++++DMQNDF+  G  +    A A+VP + + ++  R++GI +I+    H   G D 
Sbjct  12   KTVMIVVDMQNDFVAEGAKLRSAQAAAMVPRLAQTLKACRDKGIRVIYTAHVHRRDGSDM  71

Query  611  ELFRRHLYSPGKPKPT-SKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
             L+   LY P   + +   GS G E+ + L    G++ + K R+SAFF T+L   L+  G
Sbjct  72   GLYD-DLYGPIADRSSLVDGSAGVEIFNDLAPAPGEHVIKKHRYSAFFATDLDLILREWG  130

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            IT+++I+G  T NC   T  DA+  NY+
Sbjct  131  ITTVIISGTTTENCCHATARDAMFHNYK  158



>ref|WP_016841118.1| hypothetical protein [Bradyrhizobium elkanii]
Length=217

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 84/147 (57%), Gaps = 2/147 (1%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAE  609
            T ++++DMQNDF+  G  +    A A+VP + + ++  R++GI +I+    H   G D  
Sbjct  13   TVMIVVDMQNDFVAEGAKLRSAQAAAMVPRLAQTLKACRDKGIRVIYTAHVHRRDGSDMG  72

Query  608  LFRRHLYSPGKPKPT-SKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            L+   LYSP   + +   G+ G E+ + L    G++ + K R+SAFF T+L   L+  GI
Sbjct  73   LYD-DLYSPIADRSSLVDGTEGVEIFNDLAPAPGEHVIKKHRYSAFFATDLDLILREWGI  131

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            T+++I+G  T NC   T  DA+  NY+
Sbjct  132  TTVIISGTTTENCCHATARDAMFHNYK  158



>ref|WP_018750863.1| hypothetical protein [Paenibacillus sanguinis]
Length=223

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 103/204 (50%), Gaps = 25/204 (12%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            ++  A++ ID QNDF LPG    + G   ++P++ + ++V R+R IPI+ V+R +   G 
Sbjct  10   FKKCAIITIDTQNDFCLPGAVAEIAGTVNVLPHMKRVLDVCRSRNIPIMHVIRLYKKDGS  69

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELV-------------DGL------VIKEGDYRLV  495
            + ++ RR L   G P  T  GS+GA+LV             +GL      +I   ++ + 
Sbjct  70   NVDICRRELIEKGVPIVTP-GSMGADLVEMISPQNSVQIDDEGLLQGRIQLIANNEWVMY  128

Query  494  KTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaa  315
            K R+ AF+ T+L  +L+   I +L+  G   PNC R +++ A   +++     V     A
Sbjct  129  KPRWGAFYQTDLEVFLKEKNIDTLIFLGCNFPNCPRTSIYQASERDFK-----VVMVEDA  183

Query  314  TPEIHTSNIFDMKNIGVMTPTLEE  243
               ++   I +M NIGV     EE
Sbjct  184  ISGVYDKGIHEMINIGVKVTKTEE  207



>ref|WP_028340494.1| isochorismatase [Bradyrhizobium elkanii]
Length=217

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 84/147 (57%), Gaps = 2/147 (1%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAE  609
            T ++++DMQNDF+  G  +    A A+VP + + ++  R++GI +++    H   G D  
Sbjct  13   TVMIVVDMQNDFVAEGAKLRSAQAAAMVPRLAQTLKACRDKGIRVVYTAHVHRRDGSDMG  72

Query  608  LFRRHLYSPGKPKPT-SKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            L+   LYSP   + +   G+ G E+ + L    G++ + K R+SAFF T+L   L+  GI
Sbjct  73   LYD-DLYSPIADRSSLVDGTEGVEIFNDLAPAPGEHVIKKHRYSAFFATDLDLILREWGI  131

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            T+++I+G  T NC   T  DA+  NY+
Sbjct  132  TTVIISGTTTENCCHATARDAMFHNYK  158



>ref|WP_015050898.1| nicotinamidase [Thermacetogenium phaeum]
 ref|YP_006920520.1| isochorismatase hydrolase [Thermacetogenium phaeum DSM 12270]
 gb|AFV12021.1| isochorismatase hydrolase [Thermacetogenium phaeum DSM 12270]
Length=187

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 106/189 (56%), Gaps = 13/189 (7%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGA-QAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAE  609
            AL+++DM NDF++ GG ++VG A + ++P + +A+E AR+  IP+I++   H P  R+ E
Sbjct  5    ALIVVDMLNDFVVEGGALYVGEAGRRVIPVIARALEKARSHKIPVIYICDRHLPGDREFE  64

Query  608  LFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGIT  429
            +F         P     G+ G E+   L  +EGD  + K R+S F+ T+L   L+  G  
Sbjct  65   MF---------PTHCVAGTWGGEVCAELAPREGDVIIPKRRYSGFYGTDLDLALRELGAE  115

Query  428  SLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIHTSNIFDM-KNIGVMTPT  252
             LV+ GV T  C+  T  DA   NY+ V+V+ D  A+   + H   + +M K +GV    
Sbjct  116  DLVLVGVCTNICVLYTAADARMRNYK-VSVLKDGVASFDEKAHEFALREMEKTLGVQLLL  174

Query  251  LEEWCESGH  225
            ++EW E+G+
Sbjct  175  VDEW-EAGN  182



>ref|WP_019121745.1| hypothetical protein [Brevibacillus massiliensis]
Length=208

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 79/148 (53%), Gaps = 0/148 (0%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            +  ALL+IDM+NDF+ PG PM V  A  ++PN+ + ++  R + + II+    H     D
Sbjct  9    KRAALLVIDMENDFVRPGAPMFVPMAYDMLPNIKRLLDACREKEMTIIYTAHVHGKDRGD  68

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
              L        G       G+ G E+   +  KEG+  + K R+SAF+NT+L + L++ G
Sbjct  69   MGLMADFWAPIGSQTALVDGTEGVEIYQEIAPKEGELLIKKHRYSAFYNTDLETQLRNRG  128

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            I +L+ITG  T  C   T  DA   +Y+
Sbjct  129  IDTLIITGTVTNMCCESTARDAQFRDYK  156



>ref|WP_022671011.1| nicotinamidase [Hippea alviniae]
Length=171

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 9/145 (6%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            A+L++DM NDF L   P+ V   + I+PN+ + +E  R    PII+V   H P  R+ ++
Sbjct  4    AILVVDMLNDFTLDNAPLKVEENRKIIPNIKELLEKERKNNTPIIYVCDSHLPDDREFKI  63

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
            +         PK   KG+ GA++VD L  KE D+ + KT +  F+ TNL   L+  G+  
Sbjct  64   W---------PKHCVKGTEGAQIVDELKPKESDFIVEKTTYDGFYRTNLDDLLKQLGVDH  114

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQ  351
            L+ITG     CI  T   AV   YQ
Sbjct  115  LIITGCVINICILYTASSAVLRGYQ  139



>ref|WP_028333784.1| isochorismatase [Bradyrhizobium elkanii]
Length=217

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 83/147 (56%), Gaps = 2/147 (1%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAE  609
            T ++++DMQNDF+  G  +    A A VP + + ++  R++GI +I+    H   G D  
Sbjct  13   TVMIVVDMQNDFVAEGAKLRSAQAAATVPRLAQTLKACRDKGIRVIYTAHVHRRDGSDMG  72

Query  608  LFRRHLYSPGKPKPT-SKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            L+   LYSP   + +   G+ G E+ + L    G++ + K R+SAFF T+L   L+  GI
Sbjct  73   LYD-DLYSPIADRSSLVDGTEGVEIFNDLAPALGEHVIKKHRYSAFFATDLDLILREWGI  131

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            T+++I+G  T NC   T  DA+  NY+
Sbjct  132  TTVIISGTTTENCCHATARDAMFHNYK  158



>ref|WP_018608119.1| MULTISPECIES: putative isochorismatase hydrolase [Pseudomonas]
 gb|EPJ86112.1| putative isochorismatase hydrolase [Pseudomonas sp. CFII68]
Length=203

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 90/158 (57%), Gaps = 6/158 (4%)
 Frame = -2

Query  824  PFTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWV  645
            PFT+ ++    + ALL+IDMQ+DF+    P+   GA AIVP + +   +AR  GIP+I+ 
Sbjct  4    PFTTASA--THSIALLVIDMQHDFVDEDAPIACKGAGAIVPLIHELAGLARTLGIPVIYT  61

Query  644  VREHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNT  465
               H     D  L   +    G+ +   +G+ G E++D L   E DY LVK R+S FF T
Sbjct  62   RESHRKQKVDFGLELEY----GETEHCVEGTRGIEIIDELRPHESDYVLVKRRYSGFFAT  117

Query  464  NLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            +L   L+  G+ +LV+TGV T  C+R T  DA+  +Y+
Sbjct  118  DLDLLLKGLGVNTLVLTGVATDVCVRATAQDALQLDYR  155



>ref|WP_029082938.1| isochorismatase [Bradyrhizobium sp. th.b2]
Length=221

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 83/147 (56%), Gaps = 2/147 (1%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAE  609
            T ++++DMQNDF+  G  +    A A+VP + + ++  R++GI +I+    H   G D  
Sbjct  13   TVMIVVDMQNDFVAEGAKLRSAQAAAMVPRLAQTLKACRDKGIRVIYTAHVHRRDGSDMG  72

Query  608  LFRRHLYSPGKPKPT-SKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
            L+   LYSP   + +   G+ G E+ + L     ++ + K R+SAFF T+L   L+  GI
Sbjct  73   LYD-DLYSPIADRSSLVDGTAGVEIFNDLAPAPSEHVIKKHRYSAFFATDLDLILREWGI  131

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            T+++I+G  T NC   T  DA+  NY+
Sbjct  132  TTVIISGTTTENCCHATARDAMFHNYK  158



>emb|CEI51942.1| Nicotinamidase [Acinetobacter bereziniae]
Length=211

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 79/149 (53%), Gaps = 2/149 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            + TALLIIDM+NDF+ P   M V  A  IVPN+I    ++R +G+ II+    H     D
Sbjct  9    KKTALLIIDMENDFVKPDASMWVPMATEIVPNIISLATISREKGLTIIYTTHVHQKDRSD  68

Query  614  AELFRRHLYSP-GKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
              L     +SP  +       + G E+   L  ++ +  + K R+SAF+NT+L  YL+  
Sbjct  69   MGLM-SDFWSPIDQQSALVDDTEGVEIYPDLAPQKDEIVIKKNRYSAFYNTDLDQYLKKL  127

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            GI +L+ITG  T  C   T  DA   NY+
Sbjct  128  GIETLIITGTVTNMCCESTARDAHFRNYK  156



>ref|WP_031361441.1| isochorismatase, partial [Burkholderia sordidicola]
Length=207

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 81/147 (55%), Gaps = 0/147 (0%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             TA++++DMQNDF+  G P+ V  A+A+VP + KA+++ R+ GI +I+    H   G D 
Sbjct  10   KTAMIVVDMQNDFVASGAPIEVSAARAMVPKLAKALKICRDAGIRVIYTAHVHRRDGCDM  69

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
             LF               G+ GA++   L    G++ + K R+SAFF T+L   L+   +
Sbjct  70   GLFDDLHPVVANRDAMVDGTPGADIYSELAPAAGEHVIKKHRYSAFFCTDLDIILREWRV  129

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             +++I+G  T NC   T  DA+  NY+
Sbjct  130  DTVIISGTTTENCCHATAPDAMFRNYR  156



>ref|WP_035581656.1| isochorismatase [Halomonas sp. TG39a]
Length=207

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 78/147 (53%), Gaps = 0/147 (0%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             TALL+IDM+NDF+ PG PM V  A   VPN+ K ++V R +G  +I+    H     D 
Sbjct  10   KTALLVIDMENDFVKPGAPMCVPMATKAVPNIKKLIDVCRKKGATVIYTTHVHGKDRGDM  69

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
             L           +     + G E+   +  +EG+  + K R+SAF+NT+L + L++ GI
Sbjct  70   GLMSGFWPPIDSQEALVDNTPGTEIYSDIAPQEGELVIKKHRYSAFYNTDLETQLRNRGI  129

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             +L+ITG  T  C   T  DA   +Y+
Sbjct  130  DTLIITGTVTNMCCESTARDAQFRDYK  156



>ref|WP_002717979.1| tat (twin-arginine translocation) pathway signal sequence [Afipia 
felis]
 gb|EKS30387.1| tat (twin-arginine translocation) pathway signal sequence [Afipia 
felis ATCC 53690]
Length=259

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 99/201 (49%), Gaps = 25/201 (12%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAE  609
            + L+ ID QNDF L G P  + G  A+VPN+ + +E  R +G+PII V+R + P G + +
Sbjct  56   SVLITIDTQNDFSLHGAPAEIPGTMAVVPNIKRGLEAFRRKGLPIIHVIRLYQPDGSNVD  115

Query  608  LFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGD-------------------YRLVKTR  486
            + RR L   G  +  + G+ GAELV  L     D                   + + K R
Sbjct  116  VARRKLLQDG-ARIVNPGTDGAELVSDLKRSASDRLDSAALLAGHSQQVGPKEWVIYKPR  174

Query  485  FSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPE  306
            + AF+ TNL   L+  G+ ++ + G   PNC R T+++A   +++     +     A   
Sbjct  175  WGAFYGTNLADQLRELGVDTIALAGCNYPNCPRTTLYEASERDFR-----LIMLTDAVSG  229

Query  305  IHTSNIFDMKNIGVMTPTLEE  243
            ++   + +MK IGV   T +E
Sbjct  230  VYDKGLQEMKAIGVNLMTTDE  250



>ref|WP_013909211.1| nicotinamidase [Thermodesulfobacterium geofontis]
 ref|YP_004627439.1| isochorismatase hydrolase [Thermodesulfobacterium geofontis OPF15]
 gb|AEH22511.1| isochorismatase hydrolase [Thermodesulfobacterium geofontis OPF15]
Length=172

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 79/146 (54%), Gaps = 10/146 (7%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGG-AQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAE  609
            ALLIIDM NDFI P G ++ G  A+ I+P + +  +  + +G PII++   HD +  +  
Sbjct  3    ALLIIDMLNDFIKPDGALYCGKKAEEIIPEIERLKKEFKEKGYPIIYLCDAHDQNDEEFS  62

Query  608  LFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGIT  429
             F  H           KG+ GA++VD L     D  + KTRFS F+ TNL + L+S G+ 
Sbjct  63   AFTPH---------CIKGTKGAQVVDELSPAGDDLVIYKTRFSGFYRTNLEAVLRSLGVK  113

Query  428  SLVITGVQTPNCIRQTVFDAVAWNYQ  351
             L +TGV T  C+  T  DA    ++
Sbjct  114  ELYLTGVCTSICVMDTAADAFYRGFK  139



>ref|WP_037603655.1| cysteine hydrolase [Streptacidiphilus rugosus]
Length=218

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 100/212 (47%), Gaps = 33/212 (16%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W  +ALL+ID+Q DF+  GG M V G   I+P + + V+  R  G P++ VVR ++P G 
Sbjct  12   WARSALLVIDVQRDFVA-GGAMPVPGTDEILPALAELVDAYRAAGRPVVHVVRLYEPGGD  70

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYR---------------------  501
            D +L RR     G  +  + GS G+ELV  ++   GD+R                     
Sbjct  71   DVDLPRRAAVQQGG-RLAAPGSTGSELVPAVL---GDHRPAPLDPASLLTGAPQPLGARE  126

Query  500  --LVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivda  327
              L K R+SAF  T L   L+ +G+ ++V+ G   PNC R T+FDA A + +        
Sbjct  127  FVLYKPRWSAFHRTRLEELLREHGVDTVVVAGCNLPNCPRATLFDASARDLR-----TVL  181

Query  326  taaaTPEIHTSNIFDMKNIGVMTPTLEEWCES  231
               A  +       D+  IGV   T  E C +
Sbjct  182  VTDAVSQWSRERGEDLGRIGVRQATTAEVCRA  213



>gb|KFF90113.1| isochorismatase [Serratia nematodiphila]
Length=204

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 88/156 (56%), Gaps = 4/156 (3%)
 Frame = -2

Query  818  TSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVR  639
            T++   + R  A+L+IDMQ DF+  GGP+   G +AI+  +   +  AR  GIP+I+   
Sbjct  6    TTLPPNRTRRFAVLVIDMQYDFLDEGGPVPCEGGRAIIAPLQVLLNFARGAGIPVIYTQE  65

Query  638  EHDPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNL  459
             H  +  D   F R L   G+     +GS G E++  L  + GD  L+K R+SAFF T+L
Sbjct  66   SHRVNRVD---FGREL-DYGETLHCLEGSRGVEIIADLSPQVGDQVLIKRRYSAFFATDL  121

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
               L+  G+ ++V+TGV T  C+R T  DA+  +Y+
Sbjct  122  DLLLRGIGVDTVVLTGVATDVCVRATAQDAMQLDYR  157



>ref|WP_037386669.1| isochorismatase [Serratia sp. DD3]
Length=198

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 81/147 (55%), Gaps = 4/147 (3%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
              A+L+IDMQ+DFI    P+     + IVP+V   +  AR   IPII+    H     D 
Sbjct  9    RAAILVIDMQHDFIDEDAPIPCSKGRDIVPHVATLLNFARQSHIPIIYTQEAHRRQRVD-  67

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
              F R L   G+     +GS G E++  L   EGDY +VK R+SAFF T+L   L+  G+
Sbjct  68   --FGREL-DYGETLHCLEGSSGVEIIPELRPLEGDYVIVKRRYSAFFATDLELLLRGLGV  124

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             +L++TGV T  C+R T  DA+  +Y+
Sbjct  125  NTLILTGVATDVCVRATAQDAMQLDYR  151



>ref|WP_039237375.1| isochorismatase [Bacillus thermotolerans]
 gb|KIA67809.1| Nicotinamidase [Bacillus thermotolerans]
 gb|KIF99646.1| Nicotinamidase [Bacillaceae bacterium MTCC 8252]
Length=214

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 76/147 (52%), Gaps = 0/147 (0%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            +  ALL+IDM+NDF+ PG PM V  A  +VP +   +   R +G  II+    H     D
Sbjct  9    KKAALLVIDMENDFVKPGAPMQVPMAYEMVPTLKTLLNACREKGATIIYTAHVHGKDRGD  68

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
              L  +     G       G+ G E+ + L   EG+  + K R+SAF+NT+L + L++ G
Sbjct  69   MGLMGQFWEPIGNQTALVDGTEGVEIYEELAPMEGELVIKKHRYSAFYNTDLETQLRNRG  128

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNY  354
            I +L+ITG  T  C   T  DA   +Y
Sbjct  129  IDTLIITGTVTNMCCESTARDAQFRDY  155



>ref|WP_037344892.1| isochorismatase [Sciscionella sp. SE31]
Length=219

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 82/148 (55%), Gaps = 2/148 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            R  ALL+IDMQNDF+L G P+ V   +A++P V  A+  AR  G+P+++    H+  G D
Sbjct  11   RCAALLVIDMQNDFLLEGAPLEVAQGRAMMPVVNGAIAAARASGMPVLFTRHAHNRDGTD  70

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
              +F R   +  +      G+ G EL   L     +  L KTR+SAF  T+L   L   G
Sbjct  71   MGMFARIYPAVAERTALIDGTPGTELYADLDRSPEEPVLAKTRYSAFHGTDLRDRLA--G  128

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            + +LV+ GV T +C++ T  DA+  +++
Sbjct  129  VRTLVLCGVTTEDCVQATARDAMFLDFE  156



>gb|KEY57324.1| N-carbamoylsarcosine amidase [Serratia sp. DD3]
Length=200

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 81/147 (55%), Gaps = 4/147 (3%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
              A+L+IDMQ+DFI    P+     + IVP+V   +  AR   IPII+    H     D 
Sbjct  11   RAAILVIDMQHDFIDEDAPIPCSKGRDIVPHVATLLNFARQSHIPIIYTQEAHRRQRVD-  69

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
              F R L   G+     +GS G E++  L   EGDY +VK R+SAFF T+L   L+  G+
Sbjct  70   --FGREL-DYGETLHCLEGSSGVEIIPELRPLEGDYVIVKRRYSAFFATDLELLLRGLGV  126

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             +L++TGV T  C+R T  DA+  +Y+
Sbjct  127  NTLILTGVATDVCVRATAQDAMQLDYR  153



>ref|WP_004830927.1| hypothetical protein [Acinetobacter bereziniae]
 gb|ENV21591.1| hypothetical protein F963_02407 [Acinetobacter bereziniae NIPH 
3]
Length=211

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 79/149 (53%), Gaps = 2/149 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            + TALLIIDM+NDF+ P   M V  A  IVPN+   V ++R +G+ II+    H     D
Sbjct  9    KKTALLIIDMENDFVKPDASMWVPMATEIVPNIKSLVTISREKGLTIIYTTHVHQKDRSD  68

Query  614  AELFRRHLYSP-GKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
              L     +SP  +       + G E+   L  ++ +  + K R+SAF+NT+L  YL+  
Sbjct  69   MGLM-SDFWSPIDQQSALVDDTEGVEIYPDLAPQKDEIVIKKNRYSAFYNTDLDQYLKKL  127

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            GI +L+ITG  T  C   T  DA   NY+
Sbjct  128  GIETLIITGTVTNMCCESTARDAHFRNYK  156



>ref|WP_005099166.1| cysteine hydrolase [Mycobacterium abscessus]
 gb|EIU15338.1| isochorismatase hydrolase [Mycobacterium abscessus 5S-0304]
 gb|EIU16693.1| isochorismatase hydrolase [Mycobacterium abscessus 5S-0421]
 gb|EIU17913.1| isochorismatase hydrolase [Mycobacterium abscessus 5S-0422]
 gb|EIU28397.1| isochorismatase hydrolase [Mycobacterium abscessus 5S-0708]
 gb|EIU33588.1| isochorismatase hydrolase [Mycobacterium abscessus 5S-0817]
 gb|EIU34063.1| isochorismatase hydrolase [Mycobacterium abscessus 5S-1212]
 gb|EIU42782.1| isochorismatase hydrolase [Mycobacterium abscessus 5S-1215]
 gb|EIU97197.1| isochorismatase hydrolase [Mycobacterium abscessus 5S-0921]
 gb|EUA71710.1| isochorismatase family protein [Mycobacterium abscessus subsp. 
bolletii 1513]
 gb|AIR43766.1| cysteine hydrolase [Mycobacterium abscessus subsp. abcessus]
Length=216

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 102/203 (50%), Gaps = 24/203 (12%)
 Frame = -2

Query  821  FTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
             T   + +W ++AL+IID+Q +F+   G M V G    +P + +     RN G PI+ VV
Sbjct  1    MTDFVAPEWGSSALVIIDVQTEFV--SGAMTVPGTADRIPALARLASAFRNAGRPIVHVV  58

Query  641  REHDPSGRDAELFRRHLYSPGK--PKPTSKGS--------VGAELVDGLVIKEG------  510
            R + P G D +L RR     G+    P + GS         GA+L   L++  G      
Sbjct  59   RLYVPGGSDTDLPRRAEILAGREIAAPGTDGSQIPHELLPTGAQLDSALLLAGGFQEVGP  118

Query  509  -DYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtviv  333
             ++ L K R+SAF+ T L  +L+  GI+++V+ G   PNC R T+FDA   +Y+ V V  
Sbjct  119  AEHILFKPRWSAFYRTELEQHLRERGISTVVVAGCNLPNCPRATLFDASERDYRAVVVED  178

Query  332  dataaaTPEIHTSNIFDMKNIGV  264
              +      +H     D++ IGV
Sbjct  179  ATSQVTPERLH-----DLRLIGV  196



>ref|WP_017524172.1| hypothetical protein [Pusillimonas noertemannii]
Length=217

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 82/149 (55%), Gaps = 2/149 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            R T ++++DMQNDF+ PG P+    AQ +VP + + ++  R +G+ +I+    H   G D
Sbjct  11   RKTVVIVVDMQNDFVAPGAPLLSQQAQDMVPRLAETLQACRAQGMRVIYTAHVHRRDGSD  70

Query  614  AELFRRHLYSP-GKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
              L+   LY P          +VG ++   L  + G++ + K R+SAFF T+L   L+  
Sbjct  71   MGLYDD-LYPPIADRSALVDETVGGDIYKPLAPQAGEHVIKKHRYSAFFATDLDLILREW  129

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            GI +++ITG  T NC   T  DA+  NY+
Sbjct  130  GIETVIITGTTTENCCHATARDAMFHNYK  158



>ref|WP_026919521.1| isochorismatase [Gordonia shandongensis]
Length=398

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 103/207 (50%), Gaps = 24/207 (12%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
             W N AL++ID+QNDF+   GP  V G    +P + +A    R    PI+ VVR + P  
Sbjct  8    DWANAALVLIDVQNDFV--SGPAAVPGTAERLPAMARAARTFRESARPIVHVVRSYRPGE  65

Query  620  RDAELFRRH-------LYSPGKPKPTSKGSVGAELVD--------GLV--IKEGDYRLVK  492
             D +L RR        +  PG P       +GA  VD        G V  I   +Y L K
Sbjct  66   SDVDLLRRAGIERGDAVVEPGTPGALIAVELGAPAVDLDWASLRFGAVQQIGPAEYVLYK  125

Query  491  TRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaT  312
             R+SAF  T L  +L  + +T++V+ G   PNC R T+FDA   +Y+   ++ DAT+  T
Sbjct  126  PRWSAFHRTALDEFLSDHDVTTVVVAGCNLPNCPRATLFDASERDYR-TVLVTDATSQTT  184

Query  311  PEIHTSNIFDMKNIGVMTPTLEEWCES  231
            PE     + D+  IGV T T +E  ++
Sbjct  185  PE----RVADLAAIGVQTRTAQEVADA  207



>ref|WP_037411134.1| hypothetical protein, partial [Solirubrobacter sp. URHD0082]
Length=188

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 89/162 (55%), Gaps = 16/162 (10%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQ-----AIVPNVIKAVEVARNRGIPIIWVVREHD  630
            R+TAL+++DMQ DF +PGG     G        ++P + + +E AR  G P+I++     
Sbjct  4    RHTALVVVDMQRDFCIPGGAFDKLGVDISMYPLMIPRLARLIEGARAAGAPVIYIQMTVL  63

Query  629  PSGRDAEL-------FRRHLYSPGKPKP---TSKGSVGAELVDGLVIKEGDYRLVKTRFS  480
            P GR +E         R HL + G  +P   T  GSVG E++  L  ++GD+ + K R S
Sbjct  64   P-GRRSESPAQIRFNLRLHLGADGVVEPLSYTPDGSVGQEVIPELAPQDGDWIVKKYRSS  122

Query  479  AFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNY  354
            AF+ TNL   L+SNGI S+V++G  T  C+  T  D +  +Y
Sbjct  123  AFWGTNLDMLLRSNGIKSIVVSGCTTEGCVESTARDGLFADY  164



>ref|WP_037534165.1| hypothetical protein [Sphingobacterium thalpophilum]
Length=213

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 97/197 (49%), Gaps = 25/197 (13%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W  +ALLIIDMQNDF  P G  ++   + ++ NV    +  R   +P++ +VR +   G 
Sbjct  7    WNRSALLIIDMQNDFAKPDGNAYIDRTKDVIENVAYLADTFRRNQLPVLHIVRLYLKDGS  66

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKE-------------------GDYRLV  495
            +AEL R+ +    K      GS GA++V  L+ K                     D+   
Sbjct  67   NAELCRKEVIRQSKAMVIP-GSSGAKIVQELLPKNVEMYEDKKLLTGSILQLAPFDFVAY  125

Query  494  KTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaa  315
            K R+ AF+ TNL ++L++  I SLVI G   PNC R T+F+A   +Y+     +     A
Sbjct  126  KPRWGAFYKTNLEAWLKNRKINSLVIAGCNFPNCPRTTIFEASERDYR-----LAIVPEA  180

Query  314  TPEIHTSNIFDMKNIGV  264
              +I+   I ++K IGV
Sbjct  181  ISQIYPKGIDELKGIGV  197



>ref|WP_009584969.1| isochorismatase family protein [Acinetobacter sp. WC-743]
 gb|ELW85817.1| isochorismatase family protein [Acinetobacter sp. WC-743]
Length=211

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 79/149 (53%), Gaps = 2/149 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            + TALLIIDM+NDF+ P   M V  A  IVPN+   V ++R +G+ II+    H     D
Sbjct  9    KKTALLIIDMENDFVKPDASMWVPMATEIVPNIKSLVTISREKGLTIIYTTHVHQKDRSD  68

Query  614  AELFRRHLYSP-GKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
              L     +SP  +       + G E+   L  ++ +  + K R+SAF+NT+L  YL+  
Sbjct  69   MGLM-SDFWSPIDQQSALVDHTEGVEIYPDLAPQKDEIVIKKNRYSAFYNTDLDQYLKKL  127

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            GI +L+ITG  T  C   T  DA   NY+
Sbjct  128  GIETLIITGTVTNMCCESTARDAHFRNYK  156



>ref|WP_035587446.1| nicotinamidase [Hippea jasoniae]
Length=171

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 78/145 (54%), Gaps = 9/145 (6%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            A+L++DM NDF+  G P+ V   + I+PN+ + +E  R  G  II+V   H P  ++ ++
Sbjct  4    AVLVVDMLNDFVEDGAPLRVEENKKIIPNIKRLIEKQRKEGAHIIYVCDSHTPDDKEFKI  63

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
            +         PK   +G+ GAE+VD L  KE D+ + KT +  F+NT+L+  L   G+  
Sbjct  64   W---------PKHCVEGTRGAEIVDELKPKEDDFIVKKTTYDGFYNTSLNDLLVQLGVKE  114

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQ  351
            L+ITG     CI  T   AV   Y 
Sbjct  115  LIITGCVINICILYTASSAVLRGYD  139



>ref|WP_033633676.1| isochorismatase [Serratia nematodiphila]
Length=197

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 86/154 (56%), Gaps = 4/154 (3%)
 Frame = -2

Query  812  MASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREH  633
            M   + R  A+L+IDMQ DF+  GGP+   G +AI+  +   +  AR  GIP+I+    H
Sbjct  1    MPPNRTRRFAVLVIDMQYDFLDEGGPVPCEGGRAIIAPLQVLLNFARGAGIPVIYTQESH  60

Query  632  DPSGRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHS  453
              +  D   F R L   G+     +GS G E++  L  + GD  L+K R+SAFF T+L  
Sbjct  61   RVNRVD---FGREL-DYGETLHCLEGSRGVEIIADLSPQVGDQVLIKRRYSAFFATDLDL  116

Query  452  YLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             L+  G+ ++V+TGV T  C+R T  DA+  +Y+
Sbjct  117  LLRGIGVDTVVLTGVATDVCVRATAQDAMQLDYR  150



>ref|WP_005029167.1| hypothetical protein [Acinetobacter bereziniae]
 gb|ENW01004.1| hypothetical protein F938_00520 [Acinetobacter bereziniae CIP 
70.12]
Length=211

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            + TALLIIDM+NDF+ P   M V  A  IVPN+     ++R +G+ II+    H     D
Sbjct  9    KKTALLIIDMENDFVKPDASMWVPMATEIVPNIKSLATISREKGLTIIYTTHVHQKDRSD  68

Query  614  AELFRRHLYSP-GKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
              L     +SP  +       + G E+   L  ++ +  + K R+SAF+NT+L  YL+  
Sbjct  69   MGLM-SDFWSPIDQQSALVDDTEGVEIYPDLAPQKDELVIKKNRYSAFYNTDLDQYLKKL  127

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            GI +L+ITG  T  C   T  DA   NY+
Sbjct  128  GIETLIITGTVTNMCCESTARDAHFRNYK  156



>ref|WP_024016992.1| pyrimidine utilization protein B [Alteromonas macleodii]
 ref|YP_008920069.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Aegean Sea MED64']
 gb|AGP83179.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Aegean Sea MED64']
Length=244

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 106/202 (52%), Gaps = 17/202 (8%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGG-----AQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            TA++++D+QN +    G +   G      + ++ N +K ++ AR  G+P++++    D  
Sbjct  37   TAVIVVDLQNAYASKNGYLDKAGFDVSTTEPVIANTVKVLDTARAAGMPVVFLQNGWDAD  96

Query  623  GRDA------ELFRRHLYSPGKPKPTSKGSVGAE------LVDGLVIKEGDYRLVKTRFS  480
             ++A        ++ +     + +P  KGS+ A+      LVD L  ++GD  + KTR+S
Sbjct  97   YKEAGGPGSPNWYKSNALKTMRKQPELKGSLLAKGTWDYALVDALKPQDGDIVIPKTRYS  156

Query  479  AFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
             F+NTNL S L++ GI +LV TG+ T  C+  T+ D     Y  V +   A  A  PEIH
Sbjct  157  GFYNTNLDSMLRARGIRNLVFTGIATNVCVESTLRDGFHLEYFGVVLADAAYQAGPPEIH  216

Query  299  TSNIFDMKNIGVMTPTLEEWCE  234
             +++F+++       T  ++CE
Sbjct  217  EASLFNIQTFFGWVSTTAQFCE  238



>ref|WP_012123347.1| nicotinamidase [Ignicoccus hospitalis]
 ref|YP_001435790.1| isochorismatase hydrolase [Ignicoccus hospitalis KIN4/I]
 gb|ABU82383.1| isochorismatase hydrolase [Ignicoccus hospitalis KIN4/I]
Length=183

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 83/145 (57%), Gaps = 8/145 (6%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            ALLIIDM NDF+ P G ++V  ++ I+P V +     +  G+P+I+    H P G D EL
Sbjct  3    ALLIIDMLNDFVNPKGKLYVPKSETIIPKVKELKRAFKEAGLPVIYTNDAHLP-GVDKEL  61

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
                L+ P         + GA++V+ L  +EGDY + K R+SAFF+T+L   L+  G++ 
Sbjct  62   ---ELWGPH----AVANTWGAQVVEELAPEEGDYVVTKRRYSAFFSTDLDLLLRELGVSE  114

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQ  351
            +V+TGV T  C+  T  DA    Y+
Sbjct  115  VVLTGVATNVCVLHTAADAFFRGYK  139



>ref|WP_023559915.1| amidohydrolase [Alteromonas macleodii]
 ref|YP_008549992.1| amidohydrolase [Alteromonas macleodii str. 'Deep ecotype']
 sp|B4RRW0.1|RUTB_ALTMD RecName: Full=Peroxyureidoacrylate/ureidoacrylate amidohydrolase 
RutB; AltName: Full=Ureidoacrylate amidohydrolase
 gb|AGV54108.1| amidohydrolase [Alteromonas macleodii str. 'Deep ecotype']
Length=244

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 106/202 (52%), Gaps = 17/202 (8%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGG-----AQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            TA++++D+QN +    G +   G      + ++ N +K ++ AR  G+P++++    D  
Sbjct  37   TAVIVVDLQNAYASKNGYLDKAGFDVSTTKPVIANTVKVLDTARAAGMPVVFLQNGWDAD  96

Query  623  GRDA------ELFRRHLYSPGKPKPTSKGSVGAE------LVDGLVIKEGDYRLVKTRFS  480
             ++A        ++ +     + +P  KGS+ A+      LVD L  +EGD  + KTR+S
Sbjct  97   YKEAGGPGSPNWYKSNALKTMRKQPELKGSLLAKGTWDYALVDALKPQEGDIVIPKTRYS  156

Query  479  AFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
             F+NTNL S L++ GI +LV TG+ T  C+  T+ D     Y  V +   A  A  P+IH
Sbjct  157  GFYNTNLDSMLRARGIRNLVFTGIATNVCVESTLRDGFHLEYFGVVLADAAYQAGPPDIH  216

Query  299  TSNIFDMKNIGVMTPTLEEWCE  234
             +++F+++       T  ++CE
Sbjct  217  EASLFNIQTFFGWVSTTAQFCE  238



>ref|WP_005087581.1| cysteine hydrolase [Mycobacterium abscessus]
 gb|EIC70097.1| isochorismatase hydrolase [Mycobacterium abscessus M94]
Length=211

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 101/203 (50%), Gaps = 24/203 (12%)
 Frame = -2

Query  821  FTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
             T   + +W ++AL+IID+Q +F+   G M V G    +P + +     R  G PI+ VV
Sbjct  1    MTDFVAPEWGSSALVIIDVQTEFV--SGAMTVPGTADRIPALARLASAFRKAGRPIVHVV  58

Query  641  REHDPSGRDAELFRRHLYSPGK--PKPTSKGS--------VGAELVDGLVIKEG------  510
            R + P G D +L RR     G+    P + GS         GA+L   L++  G      
Sbjct  59   RLYVPGGSDTDLPRRAEILAGREIAAPGTDGSQIPHELLPTGAQLDSALLLAGGFQEVGP  118

Query  509  -DYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtviv  333
             ++ L K R+SAF+ T L  +L+  GI+++V+ G   PNC R T+FDA   +Y+ V V  
Sbjct  119  AEHILFKPRWSAFYRTELEQHLRERGISTVVVAGCNLPNCPRATLFDASERDYRAVVVED  178

Query  332  dataaaTPEIHTSNIFDMKNIGV  264
              +      +H     D++ IGV
Sbjct  179  ATSQVTPERLH-----DLRLIGV  196



>ref|WP_005093220.1| MULTISPECIES: cysteine hydrolase [Mycobacterium]
 ref|YP_001702589.1| Hypothetical isochorismatase hydrolase [Mycobacterium abscessus]
 emb|CAM61935.1| Hypothetical isochorismatase hydrolase [Mycobacterium abscessus 
ATCC 19977]
 gb|EIT97645.1| isochorismatase hydrolase [Mycobacterium abscessus 4S-0726-RA]
 gb|EIU00069.1| isochorismatase hydrolase [Mycobacterium abscessus 4S-0303]
 gb|EIU02564.1| isochorismatase hydrolase [Mycobacterium abscessus 4S-0726-RB]
 gb|EIU47571.1| isochorismatase hydrolase [Mycobacterium abscessus 6G-0125-R]
 gb|EIU49264.1| isochorismatase hydrolase [Mycobacterium abscessus 6G-0125-S]
 gb|EIU59949.1| isochorismatase hydrolase [Mycobacterium abscessus 6G-0728-S]
 gb|EIU64845.1| isochorismatase hydrolase [Mycobacterium abscessus 6G-1108]
 gb|EIU96983.1| isochorismatase hydrolase [Mycobacterium abscessus 6G-0212]
 gb|EIV00113.1| isochorismatase hydrolase [Mycobacterium abscessus 6G-0728-R]
 gb|EIV13581.1| isochorismatase hydrolase [Mycobacterium abscessus 4S-0206]
 gb|EIV26820.1| isochorismatase hydrolase [Mycobacterium abscessus 3A-0119-R]
 gb|EIV32779.1| isochorismatase hydrolase [Mycobacterium abscessus 3A-0122-R]
 gb|EIV39576.1| isochorismatase hydrolase [Mycobacterium abscessus 3A-0122-S]
 gb|EIV40987.1| isochorismatase hydrolase [Mycobacterium abscessus 3A-0731]
 gb|EIV52906.1| isochorismatase hydrolase [Mycobacterium abscessus 4S-0116-R]
 gb|EIV55917.1| isochorismatase hydrolase [Mycobacterium abscessus 3A-0930-S]
 gb|EIV56727.1| isochorismatase hydrolase [Mycobacterium abscessus 3A-0930-R]
 gb|EIV66971.1| isochorismatase hydrolase [Mycobacterium abscessus 4S-0116-S]
 gb|EIV80677.1| isochorismatase hydrolase [Mycobacterium abscessus 3A-0810-R]
 gb|EPZ21363.1| cysteine hydrolase [Mycobacterium abscessus V06705]
 gb|ETZ60231.1| isochorismatase family protein [Mycobacterium abscessus MAB_110811_2726]
 gb|ETZ88876.1| isochorismatase family protein [Mycobacterium abscessus MAB_030201_1075]
 gb|ETZ95950.1| isochorismatase family protein [Mycobacterium abscessus MAB_030201_1061]
 gb|EUA45106.1| isochorismatase family protein [Mycobacterium abscessus 21]
 gb|EUA60364.1| isochorismatase family protein [Mycobacterium abscessus 1948]
 gb|EUA76552.1| isochorismatase family protein [Mycobacterium abscessus subsp. 
bolletii 103]
 gb|EUA83587.1| isochorismatase family protein [Mycobacterium chelonae 1518]
 gb|AIR33023.1| cysteine hydrolase [Mycobacterium abscessus subsp. bolletii 103]
 gb|AIR37907.1| cysteine hydrolase [Mycobacterium abscessus subsp. bolletii]
 gb|AIV10828.1| cysteine hydrolase [Mycobacterium abscessus subsp. bolletii]
Length=211

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 101/203 (50%), Gaps = 24/203 (12%)
 Frame = -2

Query  821  FTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
             T   + +W ++AL+IID+Q +F+   G M V G    +P + +     R  G PI+ VV
Sbjct  1    MTDFVAPEWGSSALVIIDVQTEFV--SGAMTVPGTADRIPALARLASAFRKAGRPIVHVV  58

Query  641  REHDPSGRDAELFRRHLYSPGK--PKPTSKGS--------VGAELVDGLVIKEG------  510
            R + P G D +L RR     G+    P + GS         GA+L   L++  G      
Sbjct  59   RLYVPGGSDTDLPRRAEILAGREIAAPGTDGSQIPHELLPTGAQLDSALLLAGGFQEVGP  118

Query  509  -DYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtviv  333
             ++ L K R+SAF+ T L  +L+  GI+++V+ G   PNC R T+FDA   +Y+ V V  
Sbjct  119  AEHILFKPRWSAFYRTELEQHLRERGISTVVVAGCNLPNCPRATLFDASERDYRAVVVED  178

Query  332  dataaaTPEIHTSNIFDMKNIGV  264
              +      +H     D++ IGV
Sbjct  179  ATSQVTPERLH-----DLRLIGV  196



>ref|WP_016889150.1| cysteine hydrolase [Mycobacterium abscessus]
Length=211

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 101/203 (50%), Gaps = 24/203 (12%)
 Frame = -2

Query  821  FTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
             T   + +W ++AL+IID+Q +F+   G M V G    +P + +     R  G PI+ VV
Sbjct  1    MTDFVAPEWGSSALVIIDVQTEFV--SGAMTVPGTADRIPALARLASAFRKAGRPIVHVV  58

Query  641  REHDPSGRDAELFRRHLYSPGK--PKPTSKGS--------VGAELVDGLVIKEG------  510
            R + P G D +L RR     G+    P + GS         GA+L   L++  G      
Sbjct  59   RLYVPGGSDTDLPRRAEILAGREIAAPGTDGSQIPHELLPTGAQLDSALLLAGGFQEVGP  118

Query  509  -DYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtviv  333
             ++ L K R+SAF+ T L  +L+  GI+++V+ G   PNC R T+FDA   +Y+ V V  
Sbjct  119  AEHILFKPRWSAFYRTELEQHLRERGISTVVVAGCNLPNCPRATLFDASERDYRAVVVED  178

Query  332  dataaaTPEIHTSNIFDMKNIGV  264
              +      +H     D++ IGV
Sbjct  179  ATSQVTPERLH-----DLRLIGV  196



>ref|WP_027033918.1| isochorismatase [Mesorhizobium loti]
Length=214

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 80/148 (54%), Gaps = 6/148 (4%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            +  A+++IDM N+F  PGG M + G + +V   +  +E AR RG+P+IWV   H P    
Sbjct  20   QRAAIIVIDMVNEFCKPGGAMVLPGYETLVGPQLAVIEAARARGVPVIWVHDAHRPG---  76

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
                RR      +     +GS G E+++ L  ++ +  ++K R+SAFF T+L   L+   
Sbjct  77   ---MRREREWVKRTPHCLEGSWGPEIIEDLGARDDEIHVIKRRYSAFFQTDLDLTLRDMQ  133

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            +  LVI GV T  C+R TV DA    Y+
Sbjct  134  VDQLVIFGVVTNICVRSTVHDAFFQGYE  161



>ref|WP_027059651.1| isochorismatase [Mesorhizobium loti]
Length=214

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 80/148 (54%), Gaps = 6/148 (4%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            +  A+++IDM N+F  PGG M + G + +V   +  +E AR RG+P+IWV   H P    
Sbjct  20   QRAAIIVIDMVNEFCKPGGAMVLPGYETLVGPQLAVIEAARARGVPVIWVHDAHRPG---  76

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
                RR      +     +GS G E+++ L  ++ +  ++K R+SAFF T+L   L+   
Sbjct  77   ---MRREREWVKRTPHCLEGSWGPEIIEDLGARDDEIHVIKRRYSAFFQTDLDLTLRDMQ  133

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            +  LVI GV T  C+R TV DA    Y+
Sbjct  134  VDQLVIFGVVTNICVRSTVHDAFFQGYE  161



>ref|WP_017205388.1| cysteine hydrolase [Mycobacterium abscessus]
Length=216

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 101/203 (50%), Gaps = 24/203 (12%)
 Frame = -2

Query  821  FTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
             T   + +W ++AL+IID+Q +F+   G M V G    +P + +     R  G PI+ VV
Sbjct  1    MTDFVAPEWGSSALVIIDVQTEFV--SGAMTVPGTADRIPALARLASAFRKAGRPIVHVV  58

Query  641  REHDPSGRDAELFRRHLYSPGK--PKPTSKGS--------VGAELVDGLVIKEG------  510
            R + P G D +L RR     G+    P + GS         GA+L   L++  G      
Sbjct  59   RLYVPGGSDTDLPRRAEILAGREIAAPGTDGSQIPHELLPTGAQLDSALLLAGGFQEVGP  118

Query  509  -DYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtviv  333
             ++ L K R+SAF+ T L  +L+  GI+++V+ G   PNC R T+FDA   +Y+ V V  
Sbjct  119  AEHILFKPRWSAFYRTELEQHLRERGISTVVVAGCNLPNCPRATLFDASERDYRAVVVED  178

Query  332  dataaaTPEIHTSNIFDMKNIGV  264
              +      +H     D++ IGV
Sbjct  179  ATSQVTPERLH-----DLRLIGV  196



>ref|WP_005085198.1| cysteine hydrolase [Mycobacterium abscessus]
 gb|EIC63677.1| isochorismatase hydrolase [Mycobacterium abscessus M93]
Length=211

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 101/203 (50%), Gaps = 24/203 (12%)
 Frame = -2

Query  821  FTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
             T   + +W ++AL+IID+Q +F+   G M V G    +P + +     R  G PI+ VV
Sbjct  1    MTDFVAPEWGSSALVIIDVQTEFV--SGAMTVPGTADRIPALARLASAFRKAGRPIVHVV  58

Query  641  REHDPSGRDAELFRRHLYSPGK--PKPTSKGS--------VGAELVDGLVIKEG------  510
            R + P G D +L RR     G+    P + GS         GA+L   L++  G      
Sbjct  59   RLYVPGGSDTDLPRRAEILTGREIAAPGTDGSQIPHELLPTGAQLDSALLLAGGFQEVGP  118

Query  509  -DYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtviv  333
             ++ L K R+SAF+ T L  +L+  GI+++V+ G   PNC R T+FDA   +Y+ V V  
Sbjct  119  AEHILFKPRWSAFYRTELEQHLRERGISTVVVAGCNLPNCPRATLFDASERDYRAVVVED  178

Query  332  dataaaTPEIHTSNIFDMKNIGV  264
              +      +H     D++ IGV
Sbjct  179  ATSQVTPERLH-----DLRLIGV  196



>ref|WP_034089665.1| cysteine hydrolase [Streptacidiphilus albus]
Length=212

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 108/210 (51%), Gaps = 24/210 (11%)
 Frame = -2

Query  800  KWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSG  621
            +W ++ALL+ID+Q DF L  GP+ + G  A++P + + V   R  G PI+ +VR + P G
Sbjct  7    RWASSALLVIDVQQDF-LDEGPVPIPGTTAVLPRLAELVAAYRAAGRPIVHIVRLYVPGG  65

Query  620  RDAELFRR-------HLYSPGKP----KPTSKGSVGAEL-VDGLV------IKEGDYRLV  495
             DA+  RR        + +PG P     P   G   AEL  + L+      + E +  L 
Sbjct  66   SDADPPRRASVEAGARIVAPGTPGSRLAPAVLGDRDAELDAEALLAGDPQRLGEAEVVLY  125

Query  494  KTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaa  315
            K R+ AF  T L   L+  G+ ++V+ G   PNC R T+F+A + +++   ++ DA +  
Sbjct  126  KPRWGAFHRTGLEQLLREQGVDTVVVAGCNLPNCPRATLFEASSRDFR-TVLVTDAVSMT  184

Query  314  TPEIHTSNIFDMKNIGVMTPTLEEWCESGH  225
            TPE     + D+  IGV   T  E  ++G 
Sbjct  185  TPE----RLADLAGIGVHLATTAEVVDAGR  210



>ref|WP_018159779.1| hypothetical protein [Smaragdicoccus niigatensis]
Length=207

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 95/194 (49%), Gaps = 23/194 (12%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W++ AL+IID+Q DF L  G M V G   ++P + + V   R   +PI  VVR + P G 
Sbjct  9    WQSAALVIIDVQRDF-LDDGVMPVAGTSGVLPELARLVTAFRAASLPICHVVRLYVPGGS  67

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAEL--------VDGLVIKEGDYRLV--------KTR  486
            D +L RR     G     + GS GAEL        +D   +  G+ + V        K R
Sbjct  68   DVDLLRRAQIE-GGAHIAAPGSAGAELPVELLDVPLDTEALLRGELQQVGPREIIMFKPR  126

Query  485  FSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPE  306
            +SAF  T+L  +L+ NG  ++V+ G   PNC R T+FDA   +++ V      +     +
Sbjct  127  WSAFHRTHLQEWLEQNGCDTVVVAGCNLPNCPRATLFDASERDFRAVLATDAVS-----Q  181

Query  305  IHTSNIFDMKNIGV  264
            +    + D+  IGV
Sbjct  182  VTAERLGDLARIGV  195



>ref|WP_027479482.1| cysteine hydrolase [Gryllotalpicola ginsengisoli]
Length=227

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 85/165 (52%), Gaps = 18/165 (11%)
 Frame = -2

Query  797  WRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGR  618
            W + AL++ID+Q DF L GG   V G   +VP++   V   R  G PI  VVR + P G 
Sbjct  18   WDSCALVVIDVQRDF-LDGGASPVAGTSGVVPHIATLVSAFRAAGRPIAHVVRLYQPGGT  76

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLV----------------KTR  486
            D +L RR +   G  +  + GS GAE+ + ++    D R +                K R
Sbjct  77   DVDLPRRAMVHAGA-RIVAPGSAGAEIPESVLPARLDARALLSGEAQPVGPGEVVFFKPR  135

Query  485  FSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            +SAF+ T L  +L +NG  ++++ G   PNC R T+FDA   +++
Sbjct  136  WSAFYRTGLEGWLHANGCDTVLVVGCNLPNCPRATLFDASERDFR  180



>ref|WP_009077965.1| pyrimidine utilization protein B [Streptomyces sp. AA4]
 gb|EFL07794.1| pyrimidine utilization protein B [Streptomyces sp. AA4]
Length=212

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 81/148 (55%), Gaps = 2/148 (1%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             TAL++IDMQ+DF+ PG P+     +A++P +   V   R+ GIP+ +    H P G D 
Sbjct  12   RTALVVIDMQHDFLAPGAPLESPAGRAMIPTLNDTVRFCRDAGIPVFFTAHVHRPDGSDM  71

Query  611  ELFRRHLYSP-GKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
              F   LY P        +G+ GA L   +  +  +  ++K R+SAF+ T+    L+  G
Sbjct  72   GRF-ADLYPPIAAGAALIEGTPGAALYSEVDRRPDEPLILKHRYSAFYGTDFEMQLRGRG  130

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            + +LV TGV T +C+  T+ DA+  +++
Sbjct  131  VDTLVATGVTTEDCVHATIRDAMFRDFR  158



>ref|WP_014977454.1| amidohydrolase [Alteromonas macleodii]
 ref|YP_006800345.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'English Channel 673']
 gb|AFT75968.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'English Channel 673']
Length=244

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 105/202 (52%), Gaps = 17/202 (8%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGG-----AQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            TA++++D+QN +    G +   G        ++ N IK +E AR  G+P++++    D  
Sbjct  37   TAVIVVDLQNAYASKNGYLDKAGFDVSTTAPVIQNTIKVLETARAAGMPVVFLQNGWDAD  96

Query  623  GRDA------ELFRRHLYSPGKPKPTSKGSVGAE------LVDGLVIKEGDYRLVKTRFS  480
             ++A        ++ +     + +P  KGS+ A+      LVD L  ++GD  + KTR+S
Sbjct  97   YKEAGGPGSPNWYKSNALKTMRKQPELKGSLLAKGTWDYALVDALKPQDGDIIIPKTRYS  156

Query  479  AFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
             F+NTNL S L++ GI +LV TG+ T  C+  T+ D     Y  V +   A  A  P+IH
Sbjct  157  GFYNTNLDSMLRARGIRNLVFTGIATNVCVESTLRDGFHLEYFGVVLADAAYQAGPPDIH  216

Query  299  TSNIFDMKNIGVMTPTLEEWCE  234
             +++F+++       T  ++CE
Sbjct  217  EASLFNIQTFFGWVSTTAQFCE  238



>emb|CAJ72591.1| strongly similar to isochorismatase (2,3 dihydro-2,3-dihydroxybenzoate 
synthase) [Candidatus Kuenenia stuttgartiensis]
Length=186

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 77/146 (53%), Gaps = 9/146 (6%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
            NTALLI DM NDF+  G  + V  A+ I+P + K +  AR  GIP+I+    H  +  + 
Sbjct  17   NTALLICDMLNDFVKKGASLEVPAARDIIPGIKKEILSARKSGIPVIYCCDAHIKNDPEF  76

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
             L+         P+   +G+ GA +V  L   + D+ + K R+S F+ T+L   L+  G 
Sbjct  77   SLW---------PEHAVEGTEGACIVKELAPGKDDFLVTKKRYSCFYKTSLQKVLKQFGA  127

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNY  354
            T L+ITGV T  C+  TV DA    Y
Sbjct  128  THLIITGVVTNICVLYTVCDAYMRGY  153



>ref|WP_024502292.1| isochorismatase [Mesorhizobium ciceri]
Length=214

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 81/149 (54%), Gaps = 8/149 (5%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPS-GR  618
            R  A+++IDM N+F  PGG M + G + +V   +  +E AR  G+P+IWV   H P   R
Sbjct  20   RRAAIIVIDMVNEFCKPGGAMVLPGYETLVAPQLAVIEAARAAGVPVIWVHDSHRPGMRR  79

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            + E  +R  +          GS G E+++ L  ++ +  ++K R+SAFF T+L   L+  
Sbjct  80   EREWLKRTPH-------CLDGSWGPEIIEDLGARDDEIHVIKRRYSAFFQTDLDLTLKDM  132

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             +  LVI GV T  C+R TV DA    Y+
Sbjct  133  QVDQLVIFGVVTNICVRSTVHDAFFQGYE  161



>ref|WP_022521193.1| MULTISPECIES: Benzamide amidohydrolase [Halomonas]
 emb|CDG52739.1| Benzamide amidohydrolase [Halomonas sp. A3H3]
Length=207

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 77/147 (52%), Gaps = 0/147 (0%)
 Frame = -2

Query  791  NTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDA  612
             TALL+IDM+NDF+ PG PM V  A   VPN+ K ++V R +G  +I+    H     D 
Sbjct  10   KTALLVIDMENDFVKPGAPMCVPMATKAVPNIKKLIDVCRKKGATVIYTTHVHGKDRGDM  69

Query  611  ELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGI  432
             L           +     + G E+   +  +EG+  + K R+SAF+NT+L + L++ GI
Sbjct  70   GLMSGFWPPIDSQEALVDNTPGTEIYPDIAPQEGELVIKKHRYSAFYNTDLETQLRNRGI  129

Query  431  TSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             +LVITG  T  C   T   A   +Y+
Sbjct  130  DTLVITGTVTNMCCESTARGAQFRDYK  156



>ref|WP_033294644.1| hypothetical protein, partial [Amycolatopsis jejuensis]
Length=165

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 86/156 (55%), Gaps = 10/156 (6%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGG----AQAIVPNVIKAVEVARNRGIPIIWVVREHDP  627
            R+TA++++DMQN F  P G +   G     +A++PNV   V+ A    +P+ W ++EH P
Sbjct  9    RSTAVIVVDMQNGFCHPDGTVAKAGPIDPLRAVIPNVTALVQAAHGARMPVFWSIQEHLP  68

Query  626  SGRDAELFRRHLYSPGKP---KPTSKGSVGAELVDGLV-IKEGDYRLVKTRFSAFFNTNL  459
              +D  + R  L +P       P  +G+  AEL+D  + +   D R+VK R SAF+ T L
Sbjct  69   --QDVSIDRSRLTNPQAELADPPCLQGTWDAELIDEFLDLARNDTRIVKHRASAFYGTGL  126

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
               L+  GI ++++ GV +  C+  TV DA A + Q
Sbjct  127  ELQLRMRGIGTVIVCGVSSSYCVDATVRDAYARDLQ  162



>ref|WP_005067321.1| cysteine hydrolase [Mycobacterium abscessus]
 gb|EHM19115.1| isochorismatase hydrolase [Mycobacterium abscessus subsp. bolletii 
CCUG 48898 = JCM 15300]
 gb|EIV68240.1| isochorismatase hydrolase [Mycobacterium abscessus subsp. bolletii 
CCUG 48898 = JCM 15300]
 dbj|BAP96546.1| nicotinamidase [Mycobacterium abscessus subsp. bolletii CCUG 
48898 = JCM 15300]
Length=216

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 101/203 (50%), Gaps = 24/203 (12%)
 Frame = -2

Query  821  FTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
             T   + +W ++AL+IID+Q +F+   G M V G    +P + +     R  G PI+ VV
Sbjct  1    MTDFVAPEWGSSALVIIDVQTEFV--SGAMTVPGTADRIPALARLASAFRKAGRPIVHVV  58

Query  641  REHDPSGRDAELFRRHLYSPGK--PKPTSKGS--------VGAELVDGLVIKEG------  510
            R + P G D +L RR     G+    P + GS         GA+L   L++  G      
Sbjct  59   RLYVPGGSDTDLPRRAEILAGREIAAPGTDGSQIPHELLPTGAQLDSALLLAGGFQEVGP  118

Query  509  -DYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtviv  333
             ++ L K R+SAF+ T L  +L+  G++++V+ G   PNC R T+FDA   +Y+ V V  
Sbjct  119  AEHILFKPRWSAFYRTELEQHLRERGVSTVVVAGCNLPNCPRATLFDASERDYRAVVVED  178

Query  332  dataaaTPEIHTSNIFDMKNIGV  264
              +      +H     D++ IGV
Sbjct  179  ATSQVTPERLH-----DLRLIGV  196



>ref|WP_013681190.1| nicotinamidase [Hippea maritima]
 ref|YP_004339204.1| isochorismatase hydrolase [Hippea maritima DSM 10411]
 gb|AEA33145.1| isochorismatase hydrolase [Hippea maritima DSM 10411]
Length=171

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 76/145 (52%), Gaps = 9/145 (6%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            A+L++DM NDF L   P+ V     I+PN+   ++  R  G  +I+V   H    ++ ++
Sbjct  4    AVLVVDMLNDFTLDSAPLKVKENAKIIPNIKALLDEKRKSGTAVIYVCDAHAEDDKEFKI  63

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
            +         PK   +GS GAE+VD L  +EGD+ + KT +  F+NT L S L+  G+  
Sbjct  64   W---------PKHCVRGSKGAEIVDELKPQEGDFIVEKTTYDGFYNTELDSLLKQLGVKK  114

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQ  351
            L+ITG     CI  T   AV   Y+
Sbjct  115  LIITGCVINICIMYTASSAVLRGYE  139



>ref|WP_018182879.1| isochorismatase hydrolase [Kaistia granuli]
Length=210

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 88/155 (57%), Gaps = 9/155 (6%)
 Frame = -2

Query  815  SMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVRE  636
            +M+  K R TA++++DM NDF  PGG M + G + +VP  +  ++ AR  G P++WV   
Sbjct  14   TMSLDKTR-TAVIVVDMINDFCKPGGAMVLPGYETLVPQQLAVIDAARAVGAPVLWVHDV  72

Query  635  HDPS-GRDAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNL  459
            H  +  RD E  +R   +P       +G+ G E+++ L  ++ +  ++K R+SAFF T+L
Sbjct  73   HRANMRRDREWVKR---TP----HCVEGTWGTEIIEDLGARDDEIHIIKRRYSAFFQTDL  125

Query  458  HSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNY  354
               L+   IT LV+ GV T  C+R TV DA    Y
Sbjct  126  DLTLKDMQITQLVVFGVVTNICVRSTVHDAFFIGY  160



>ref|WP_005074742.1| cysteine hydrolase [Mycobacterium abscessus]
 gb|EHM21030.1| isochorismatase hydrolase [Mycobacterium abscessus subsp. bolletii 
BD]
Length=211

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 100/203 (49%), Gaps = 24/203 (12%)
 Frame = -2

Query  821  FTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
             T   + +W ++AL+IID+Q +F+   G M V G    +P +       R  G PI+ VV
Sbjct  1    MTDFVAPEWGSSALVIIDVQTEFV--SGAMTVPGTADRIPALASLASAFRKAGRPIVHVV  58

Query  641  REHDPSGRDAELFRRHLYSPGK--PKPTSKGS--------VGAELVDGLVIKEG------  510
            R + P G D +L RR     G+    P + GS         GA+L   L++  G      
Sbjct  59   RLYVPGGSDTDLPRRAEILAGREIAAPGTDGSQIPHELLPTGAQLDSALLLAGGFQEVGP  118

Query  509  -DYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtviv  333
             ++ L K R+SAF+ T L  +L+  GI+++V+ G   PNC R T+FDA   +Y+ V V  
Sbjct  119  AEHILFKPRWSAFYRTELEQHLRERGISTVVVAGCNLPNCPRATLFDASERDYRAVVVED  178

Query  332  dataaaTPEIHTSNIFDMKNIGV  264
              +      +H     D++ IGV
Sbjct  179  ATSQVTPERLH-----DLRLIGV  196



>ref|WP_015068127.1| pyrimidine utilization protein B [Alteromonas macleodii]
 ref|YP_006978293.1| pyrimidine utilization protein B [Alteromonas macleodii AltDE1]
 ref|YP_008173300.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Ionian Sea U4']
 ref|YP_008177401.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Ionian Sea U8']
 ref|YP_008181354.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Ionian Sea UM7']
 ref|YP_008197698.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Ionian Sea U7']
 ref|YP_008185252.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Ionian Sea UM4b']
 gb|AFV86938.1| pyrimidine utilization protein B [Alteromonas macleodii AltDE1]
 gb|AGP87042.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Ionian Sea U4']
 gb|AGP91163.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Ionian Sea U7']
 gb|AGP94999.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Ionian Sea U8']
 gb|AGP98952.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Ionian Sea UM7']
 gb|AGQ03132.1| pyrimidine utilization protein B [Alteromonas macleodii str. 
'Ionian Sea UM4b']
Length=244

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 106/202 (52%), Gaps = 17/202 (8%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGG-----AQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            TA++++D+QN +    G +   G      + ++ N +K ++ AR  G+P++++    D  
Sbjct  37   TAVIVVDLQNAYASKNGYLDKAGFDVSTTEPVIANTVKVLDTARAAGMPVVFLQNGWDAD  96

Query  623  GRDA------ELFRRHLYSPGKPKPTSKGSVGAE------LVDGLVIKEGDYRLVKTRFS  480
             ++A        ++ +     + +P  KGS+ A+      LVD L  ++GD  + KTR+S
Sbjct  97   YKEAGGPGSPNWYKSNALKTMRKQPELKGSLLAKGTWDYALVDALKPQDGDIVIPKTRYS  156

Query  479  AFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
             F+NTNL S L++ GI +LV TG+ T  C+  T+ D     Y  V +   A  A  P+IH
Sbjct  157  GFYNTNLDSMLRARGIRNLVFTGIATNVCVESTLRDGFHLEYFGVVLADAAYQAGPPDIH  216

Query  299  TSNIFDMKNIGVMTPTLEEWCE  234
             +++F+++       T  ++CE
Sbjct  217  EASLFNIQTFFGWVSTTAQFCE  238



>ref|WP_005060529.1| cysteine hydrolase [Mycobacterium abscessus]
 ref|YP_008022305.1| isochorismatase hydrolase [Mycobacterium abscessus subsp. bolletii 
50594]
 ref|YP_009039147.1| cysteine hydrolase [Mycobacterium abscessus subsp. bolletii str. 
GO 06]
 gb|EHB99472.1| isochorismatase hydrolase [Mycobacterium abscessus 47J26]
 gb|EIU65649.1| isochorismatase hydrolase [Mycobacterium abscessus subsp. bolletii 
1S-151-0930]
 gb|EIU70013.1| isochorismatase hydrolase [Mycobacterium abscessus subsp. bolletii 
1S-152-0914]
 gb|EIU86879.1| isochorismatase hydrolase [Mycobacterium abscessus subsp. bolletii 
2B-0626]
 gb|AGM28441.1| isochorismatase hydrolase [Mycobacterium abscessus subsp. bolletii 
50594]
 gb|EPQ24291.1| cysteine hydrolase [Mycobacterium abscessus subsp. bolletii CRM-0020]
 gb|ETZ81360.1| isochorismatase family protein [Mycobacterium abscessus MAB_091912_2455]
 gb|AIC72415.1| cysteine hydrolase [Mycobacterium abscessus subsp. bolletii str. 
GO 06]
 gb|AIV16719.1| cysteine hydrolase [Mycobacterium abscessus]
 gb|AIV21247.1| cysteine hydrolase [Mycobacterium abscessus]
Length=216

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 90/174 (52%), Gaps = 19/174 (11%)
 Frame = -2

Query  821  FTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
             T   + +W ++AL+IID+Q +F+   G M V G    +P + +     R  G PI+ VV
Sbjct  1    MTDFVAPEWGSSALVIIDVQTEFV--SGAMTVPGTADRIPALARLASAFRKAGRPIVHVV  58

Query  641  REHDPSGRDAELFRRHLYSPGK--PKPTSKGS--------VGAELVDGLVIKEG------  510
            R + P G D +L RR     G+    P + GS         GA+L   L++  G      
Sbjct  59   RLYMPGGSDTDLPRRAEILAGREIAAPGTDGSQIPHELLPTGAQLDSALLLAGGFQEVGP  118

Query  509  -DYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             ++ L K R+SAF+ T L  +L+  GI+++V+ G   PNC R T+FDA   +Y+
Sbjct  119  AEHILFKPRWSAFYRTELEQHLRERGISTVVVAGCNLPNCPRATLFDASERDYR  172



>ref|WP_025253976.1| amidohydrolase [Alteromonas sp. ALT199]
 gb|EXF47575.1| pyrimidine utilization protein B [Alteromonas sp. ALT199]
Length=243

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 104/202 (51%), Gaps = 17/202 (8%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGG-----AQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            TA++++D+QN +    G +   G        ++ N +K +E AR  G+P++++    D  
Sbjct  37   TAVIVVDLQNAYASKNGYLDKAGFDVSTTAPVIENTVKVLETARAAGMPVVFLQNGWDAD  96

Query  623  GRDA------ELFRRHLYSPGKPKPTSKGSVGAE------LVDGLVIKEGDYRLVKTRFS  480
             ++A        ++ +     + +P  KGS+ A+      LVD L  + GD  + KTR+S
Sbjct  97   YKEAGGPGSPNWYKSNALKTMRKQPELKGSLLAKGTWDYALVDALKPQAGDIVIPKTRYS  156

Query  479  AFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
             F+NTNL S L++ GI ++V TG+ T  C+  T+ D     Y  V +   A  A  PEIH
Sbjct  157  GFYNTNLDSMLRARGIRNIVFTGIATNVCVESTLRDGFHLEYFGVVLADAAYQAGPPEIH  216

Query  299  TSNIFDMKNIGVMTPTLEEWCE  234
             +++F+++       T  ++CE
Sbjct  217  EASLFNIQTFFGWVSTTAQFCE  238



>ref|WP_016895104.1| cysteine hydrolase [Mycobacterium abscessus]
Length=216

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 90/174 (52%), Gaps = 19/174 (11%)
 Frame = -2

Query  821  FTSMASGKWRNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVV  642
             T   + +W ++AL+IID+Q +F+   G M V G    +P + +     R  G PI+ VV
Sbjct  1    MTDFVAPEWGSSALVIIDVQTEFV--SGAMTVPGTADRIPALARLASAFRKAGRPIVHVV  58

Query  641  REHDPSGRDAELFRRHLYSPGK--PKPTSKGS--------VGAELVDGLVIKEG------  510
            R + P G D +L RR     G+    P + GS         GA+L   L++  G      
Sbjct  59   RLYVPGGSDTDLPRRAEILAGREIAAPGTDGSQIPHELLPTGAQLDSALLLAGGFQEVGP  118

Query  509  -DYRLVKTRFSAFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             ++ L K R+SAF+ T L  +L+  GI+++V+ G   PNC R T+FDA   +Y+
Sbjct  119  AEHILFKPRWSAFYRTELEQHLRERGISTVVVAGCNLPNCPRATLFDASERDYR  172



>ref|WP_027045720.1| isochorismatase [Mesorhizobium sp. URHC0008]
Length=214

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 79/148 (53%), Gaps = 6/148 (4%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            +  A+++IDM N+F  PGG M + G + +V   +  +E AR  G+P+IWV   H P    
Sbjct  20   QRAAIIVIDMVNEFCKPGGAMVLPGYETLVAPQLAVIEAARASGVPVIWVHDAHRPG---  76

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
                RR      +     +GS G E+++ L  ++ +  ++K R+SAFF T+L   L+   
Sbjct  77   ---MRREREWVKRTPHCVEGSWGPEIIEDLGARDDEIHVIKRRYSAFFQTDLDLTLKDMQ  133

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            +  LVI GV T  C+R TV DA    Y+
Sbjct  134  VDQLVIFGVVTNICVRSTVHDAFFQGYE  161



>ref|WP_013530303.1| isochorismatase hydrolase [Mesorhizobium ciceri]
 ref|YP_004141670.1| isochorismatase hydrolase [Mesorhizobium ciceri biovar biserrulae 
WSM1271]
 gb|ADV11620.1| isochorismatase hydrolase [Mesorhizobium ciceri biovar biserrulae 
WSM1271]
Length=214

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 80/149 (54%), Gaps = 8/149 (5%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPS-GR  618
            R  A+++IDM N+F  PGG M + G + +V   +  +E AR  G+P+IWV   H P   R
Sbjct  20   RRAAIIVIDMVNEFCKPGGAMVLPGYETLVAPQLAVIEAARAAGVPVIWVHDSHRPGMRR  79

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            + E  +R  +          GS G E+++ L  +  +  ++K R+SAFF T+L   L+  
Sbjct  80   EREWLKRTPH-------CLDGSWGPEIIEDLGARADEIHVIKRRYSAFFQTDLDLTLKDM  132

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             +  LVI GV T  C+R TV DA    Y+
Sbjct  133  QVDQLVIFGVVTNICVRSTVHDAFFQGYE  161



>ref|WP_025270667.1| nicotinamidase [Hippea sp. KM1]
Length=171

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 76/145 (52%), Gaps = 9/145 (6%)
 Frame = -2

Query  785  ALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRDAEL  606
            A+L++DM NDF L G P+ V     I+PN+ + ++  R  G  +I+V   H    ++  +
Sbjct  4    AVLVVDMLNDFTLDGAPLKVEENARIIPNIKELLDKKRKDGAAVIYVCDAHTEDDKEFNI  63

Query  605  FRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNGITS  426
            +         PK   KG+ GA++VD L  +EGD+ + KT +  F+NT L S L+  GI  
Sbjct  64   W---------PKHCVKGTEGAKVVDELKPQEGDFVVEKTTYDGFYNTELDSLLKQLGIKK  114

Query  425  LVITGVQTPNCIRQTVFDAVAWNYQ  351
            L ITG     CI  T   AV   Y+
Sbjct  115  LTITGCVINICIMYTASSAVLRGYE  139



>ref|WP_027056010.1| isochorismatase [Mesorhizobium loti]
Length=214

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 79/148 (53%), Gaps = 6/148 (4%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            +  A+++IDM N+F  PGG M + G + +V   +  +E AR  G+P+IWV   H P    
Sbjct  20   QRAAIIVIDMVNEFCKPGGAMVLPGYETLVGPQLAVIEAARASGVPVIWVHDAHRPG---  76

Query  614  AELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSNG  435
                RR      +     +GS G E+++ L  ++ +  ++K R+SAFF T+L   L+   
Sbjct  77   ---MRREREWVKRTPHCVEGSWGPEIIEDLGARDDEIHVIKRRYSAFFQTDLDLTLKDMQ  133

Query  434  ITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            I  LVI GV T  C+R TV DA    Y+
Sbjct  134  IDQLVIFGVVTNICVRSTVHDAFFQGYE  161



>ref|WP_027162238.1| isochorismatase [Mesorhizobium sp. WSM1293]
Length=214

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 80/149 (54%), Gaps = 8/149 (5%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPS-GR  618
            R  A+++IDM N+F  PGG M + G + +V   +  +E AR  G+P+IWV   H P   R
Sbjct  20   RRAAVIVIDMVNEFCKPGGAMVLPGYETLVAPQLAVIEAARAAGVPVIWVHDSHRPGMRR  79

Query  617  DAELFRRHLYSPGKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
            + E  +R  +          GS G E+++ L  +  +  ++K R+SAFF T+L   L+  
Sbjct  80   EREWLKRTPH-------CLDGSWGPEIIEDLGARADEIHVIKRRYSAFFQTDLDLTLKDM  132

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
             +  LVI GV T  C+R TV DA    Y+
Sbjct  133  QVDQLVIFGVVTNICVRSTVHDAFFQGYE  161



>dbj|BAJ23975.1| benzamide amidohydrolase [uncultured bacterium]
Length=217

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 81/149 (54%), Gaps = 2/149 (1%)
 Frame = -2

Query  794  RNTALLIIDMQNDFILPGGPMHVGGAQAIVPNVIKAVEVARNRGIPIIWVVREHDPSGRD  615
            + TA++++DMQNDF+ PG P+    AQ +VP + + +   R +G+ +++    H   G D
Sbjct  11   KKTAVIVVDMQNDFVAPGAPLLSQQAQDMVPRLAETLRTCREQGMRVVYTAHVHRRDGCD  70

Query  614  AELFRRHLYSP-GKPKPTSKGSVGAELVDGLVIKEGDYRLVKTRFSAFFNTNLHSYLQSN  438
              L+   LY P          + G ++   L  + G++ + K R+SAFF T+L   L+  
Sbjct  71   MGLY-DDLYPPIADRSALVDETEGGDIYKPLAPQPGEHVIKKHRYSAFFATDLDLILREW  129

Query  437  GITSLVITGVQTPNCIRQTVFDAVAWNYQ  351
            GI +++ITG  T NC   T  DA+  NY+
Sbjct  130  GIETVIITGTTTENCCHATARDAMFRNYK  158



>ref|WP_039228642.1| amidohydrolase [Alteromonas macleodii]
 gb|KHT49391.1| amidohydrolase [Alteromonas macleodii]
Length=244

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 104/202 (51%), Gaps = 17/202 (8%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGG-----AQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            TA++++D+QN +    G +   G        ++ N  K +E AR  G+P++++    D  
Sbjct  37   TAVIVVDLQNAYASKNGYLDKAGFDVSTTAPVIENTTKVLETARAAGMPVVFLQNGWDAD  96

Query  623  GRDA------ELFRRHLYSPGKPKPTSKGSVGAE------LVDGLVIKEGDYRLVKTRFS  480
             ++A        ++ +     + +P  KGS+ A+      LVD L  ++GD  + KTR+S
Sbjct  97   YKEAGGPGSPNWYKSNALKTMRKQPELKGSLLAKGTWDYALVDALKPQDGDIVIPKTRYS  156

Query  479  AFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
             F+NTNL S L++ GI +LV TG+ T  C+  T+ D     Y  V +   A  A  P+IH
Sbjct  157  GFYNTNLDSMLRARGIRNLVFTGIATNVCVESTLRDGFHLEYFGVVLADAAYQAGPPDIH  216

Query  299  TSNIFDMKNIGVMTPTLEEWCE  234
             +++F+++       T  ++CE
Sbjct  217  EASLFNIQTFFGWVSTTAQFCE  238



>ref|WP_014950779.1| amidohydrolase [Alteromonas macleodii]
 ref|YP_006749277.1| pyrimidine utilization protein B [Alteromonas macleodii ATCC 
27126]
 gb|AFS38723.1| pyrimidine utilization protein B [Alteromonas macleodii ATCC 
27126]
Length=244

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 104/202 (51%), Gaps = 17/202 (8%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGG-----AQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            TA++++D+QN +    G +   G        ++ N  K +E AR  G+P++++    D  
Sbjct  37   TAVIVVDLQNAYASKNGYLDKAGFDVSTTAPVIENTTKVLETARAAGMPVVFLQNGWDAD  96

Query  623  GRDA------ELFRRHLYSPGKPKPTSKGSVGAE------LVDGLVIKEGDYRLVKTRFS  480
             ++A        ++ +     + +P  KGS+ A+      LVD L  ++GD  + KTR+S
Sbjct  97   YKEAGGPGSPNWYKSNALKTMRKQPELKGSLLAKGTWDYALVDALKPQDGDIIIPKTRYS  156

Query  479  AFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
             F+NTNL S L++ GI +LV TG+ T  C+  T+ D     Y  V +   A  A  P+IH
Sbjct  157  GFYNTNLDSMLRARGIRNLVFTGIATNVCVESTLRDGFHLEYFGVVLADAAYQAGPPDIH  216

Query  299  TSNIFDMKNIGVMTPTLEEWCE  234
             +++F+++       T  ++CE
Sbjct  217  EASLFNIQTFFGWVSTTAQFCE  238



>ref|WP_039231260.1| amidohydrolase [Alteromonas macleodii]
 gb|KHT60601.1| amidohydrolase [Alteromonas macleodii]
Length=244

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 104/202 (51%), Gaps = 17/202 (8%)
 Frame = -2

Query  788  TALLIIDMQNDFILPGGPMHVGG-----AQAIVPNVIKAVEVARNRGIPIIWVVREHDPS  624
            TA++++D+QN +    G +   G        ++ N  K +E AR  G+P++++    D  
Sbjct  37   TAVIVVDLQNAYASKNGYLDKAGFDVSTTAPVIENTTKVLETARAAGMPVVFLQNGWDAD  96

Query  623  GRDA------ELFRRHLYSPGKPKPTSKGSVGAE------LVDGLVIKEGDYRLVKTRFS  480
             ++A        ++ +     + +P  KGS+ A+      LVD L  ++GD  + KTR+S
Sbjct  97   YKEAGGPGSPNWYKSNALKTMRKQPELKGSLLAKGTWDYALVDALKPQDGDIIIPKTRYS  156

Query  479  AFFNTNLHSYLQSNGITSLVITGVQTPNCIRQTVFDAVAWNYQPvtvivdataaaTPEIH  300
             F+NTNL S L++ GI +LV TG+ T  C+  T+ D     Y  V +   A  A  P+IH
Sbjct  157  GFYNTNLDSMLRARGIRNLVFTGIATNVCVESTLRDGFHLEYFGVVLADAAYQAGPPDIH  216

Query  299  TSNIFDMKNIGVMTPTLEEWCE  234
             +++F+++       T  ++CE
Sbjct  217  EASLFNIQTFFGWVSTTAQFCE  238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1802351708432